F481854
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 811 | 302 | 1622 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300035724|Ga0373933_0224430|Ga0373933_0224430_447_1181 |
| Length | 244 |
| Sequence | LAIGFAADGPPEIISEILRCVQNDKEPTPALTLQHFNEPVITFLDGKLVNALPTQAIVDVGGVGYEVFIPLSSYDKLPAVGQAIRILTHLVVREDAHVLYGFMTPAERDLFRLLVNSVSGIGPKLALAVLSGMSVTSFKAAVVNSDVASISKISGLGKKTAERIVLELKDKVGVAAAWESASAAHAPTPEQQQANEAVLALIALGYKQADAHKAVHDLQQKGEGQGKSAEELVKLALKRIAAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 106 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 123 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 215 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 216 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 222 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 301 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 302 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0 |
| Rhizoplane | 6.04 |
| Rhizosphere | 93.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373933_0224430 | 3300035724 | Bacteria | 1206 |
| 2 | SwRhRL2b_contig_1925602 | 2162886007 | Unclassified | 1653 |
| 3 | CNXas_1000032 | 3300000545 | Bacteria | 29092 |
| 4 | JGI24746J21847_1004796 | 3300001977 | Bacteria | 2123 |
| 5 | JGI24737J22298_10031574 | 3300001990 | Unclassified | 1653 |
| 6 | JGI24737J22298_10112436 | 3300001990 | Unclassified | 805 |
| 7 | JGI24743J22301_10050390 | 3300001991 | Bacteria | 848 |
| 8 | JGI24035J26624_1001767 | 3300002126 | Unclassified | 2019 |
| 9 | JGI24035J26624_1005034 | 3300002126 | Unclassified | 1259 |
| 10 | JGI25406J46586_10000067 | 3300003203 | Bacteria | 47883 |
| 11 | JGI25405J52794_10000545 | 3300003911 | Bacteria | 5484 |
| 12 | Ga0065704_10002125 | 3300005289 | Bacteria | 5811 |
| 13 | Ga0065704_10010972 | 3300005289 | Unclassified | 1741 |
| 14 | Ga0065704_10100547 | 3300005289 | Unclassified | 2269 |
| 15 | Ga0065704_10117366 | 3300005289 | Bacteria | 1832 |
| 16 | Ga0065704_10127098 | 3300005289 | Bacteria | 1680 |
| 17 | Ga0065712_10116444 | 3300005290 | Unclassified | 1735 |
| 18 | Ga0065712_10145340 | 3300005290 | Bacteria | 1414 |
| 19 | Ga0065712_10412688 | 3300005290 | Unclassified | 719 |
| 20 | Ga0065715_10005105 | 3300005293 | Bacteria | 6415 |
| 21 | Ga0065715_10021659 | 3300005293 | Bacteria | 1388 |
| 22 | Ga0065715_10100199 | 3300005293 | Unclassified | 3328 |
| 23 | Ga0065715_10263650 | 3300005293 | Unclassified | 1130 |
| 24 | Ga0065715_10323647 | 3300005293 | Bacteria | 997 |
| 25 | Ga0065715_10329070 | 3300005293 | Unclassified | 987 |
| 26 | Ga0065707_10004715 | 3300005295 | Bacteria | 4133 |
| 27 | Ga0065707_10037229 | 3300005295 | Bacteria | 1268 |
| 28 | Ga0065707_10170990 | 3300005295 | Unclassified | 1450 |
| 29 | Ga0065707_10246755 | 3300005295 | Bacteria | 1136 |
| 30 | Ga0070676_10003991 | 3300005328 | Bacteria | 7745 |
| 31 | Ga0070676_10060105 | 3300005328 | Bacteria | 2256 |
| 32 | Ga0070676_10125997 | 3300005328 | Bacteria | 1614 |
| 33 | Ga0070676_10240657 | 3300005328 | Bacteria | 1203 |
| 34 | Ga0070676_10246248 | 3300005328 | Unclassified | 1191 |
| 35 | Ga0070676_10516783 | 3300005328 | Bacteria | 850 |
| 36 | Ga0070683_100042548 | 3300005329 | Bacteria | 4183 |
| 37 | Ga0070683_100094596 | 3300005329 | Unclassified | 2808 |
| 38 | Ga0070683_100895519 | 3300005329 | Unclassified | 851 |
| 39 | Ga0070690_100062396 | 3300005330 | Bacteria | 2403 |
| 40 | Ga0070690_100090341 | 3300005330 | Unclassified | 2016 |
| 41 | Ga0070690_100103601 | 3300005330 | Bacteria | 1889 |
| 42 | Ga0070690_100223846 | 3300005330 | Unclassified | 1319 |
| 43 | Ga0070690_100260899 | 3300005330 | Bacteria | 1229 |
| 44 | Ga0070670_100002690 | 3300005331 | Bacteria | 14671 |
| 45 | Ga0070677_10014707 | 3300005333 | Bacteria | 2760 |
| 46 | Ga0068869_100543509 | 3300005334 | Bacteria | 975 |
| 47 | Ga0070666_10002044 | 3300005335 | Bacteria | 12250 |
| 48 | Ga0070666_10148094 | 3300005335 | Bacteria | 1637 |
| 49 | Ga0070666_10185876 | 3300005335 | Unclassified | 1459 |
| 50 | Ga0068868_100047031 | 3300005338 | Unclassified | 3379 |
| 51 | Ga0068868_100128866 | 3300005338 | Bacteria | 2069 |
| 52 | Ga0070660_100244259 | 3300005339 | Bacteria | 1463 |
| 53 | Ga0070660_100741479 | 3300005339 | Unclassified | 824 |
| 54 | Ga0070689_100005579 | 3300005340 | Bacteria | 8608 |
| 55 | Ga0070689_100011679 | 3300005340 | Bacteria | 6300 |
| 56 | Ga0070689_100101999 | 3300005340 | Bacteria | 2272 |
| 57 | Ga0070689_100985453 | 3300005340 | Bacteria | 749 |
| 58 | Ga0070689_101044459 | 3300005340 | Unclassified | 728 |
| 59 | Ga0070687_100000532 | 3300005343 | Bacteria | 12757 |
| 60 | Ga0070687_100297117 | 3300005343 | Unclassified | 1023 |
| 61 | Ga0070661_100036936 | 3300005344 | Bacteria | 3552 |
| 62 | Ga0070661_100213856 | 3300005344 | Bacteria | 1477 |
| 63 | Ga0070661_100256672 | 3300005344 | Unclassified | 1350 |
| 64 | Ga0070692_10189823 | 3300005345 | Unclassified | 1196 |
| 65 | Ga0070668_100003567 | 3300005347 | Bacteria | 11476 |
| 66 | Ga0070668_100005061 | 3300005347 | Bacteria | 9757 |
| 67 | Ga0070668_100014650 | 3300005347 | Bacteria | 5860 |
| 68 | Ga0070668_100040112 | 3300005347 | Bacteria | 3582 |
| 69 | Ga0070668_100286034 | 3300005347 | Unclassified | 1378 |
| 70 | Ga0070668_100670126 | 3300005347 | Unclassified | 913 |
| 71 | Ga0070669_100012470 | 3300005353 | Bacteria | 6031 |
| 72 | Ga0070669_100020039 | 3300005353 | Bacteria | 4775 |
| 73 | Ga0070669_100027129 | 3300005353 | Bacteria | 4122 |
| 74 | Ga0070669_100739206 | 3300005353 | Bacteria | 833 |
| 75 | Ga0070675_100000800 | 3300005354 | Bacteria | 22104 |
| 76 | Ga0070675_100003333 | 3300005354 | Bacteria | 12166 |
| 77 | Ga0070675_100018699 | 3300005354 | Bacteria | 5517 |
| 78 | Ga0070675_100059661 | 3300005354 | Bacteria | 3148 |
| 79 | Ga0070675_100059971 | 3300005354 | Bacteria | 3140 |
| 80 | Ga0070675_100128420 | 3300005354 | Unclassified | 2158 |
| 81 | Ga0070675_100158243 | 3300005354 | Bacteria | 1946 |
| 82 | Ga0070675_100297309 | 3300005354 | Unclassified | 1422 |
| 83 | Ga0070671_100003803 | 3300005355 | Bacteria | 11845 |
| 84 | Ga0070671_100010844 | 3300005355 | Bacteria | 7312 |
| 85 | Ga0070671_100033560 | 3300005355 | Bacteria | 4246 |
| 86 | Ga0070671_100204669 | 3300005355 | Unclassified | 1674 |
| 87 | Ga0070671_100350480 | 3300005355 | Bacteria | 1260 |
| 88 | Ga0070671_100431036 | 3300005355 | Bacteria | 1130 |
| 89 | Ga0070674_100007782 | 3300005356 | Bacteria | 6334 |
| 90 | Ga0070674_100043245 | 3300005356 | Bacteria | 3063 |
| 91 | Ga0070673_100004127 | 3300005364 | Bacteria | 9150 |
| 92 | Ga0070673_100007695 | 3300005364 | Bacteria | 7129 |
| 93 | Ga0070673_100021847 | 3300005364 | Bacteria | 4649 |
| 94 | Ga0070673_100025303 | 3300005364 | Bacteria | 4367 |
| 95 | Ga0070673_100097377 | 3300005364 | Bacteria | 2416 |
| 96 | Ga0070673_100208643 | 3300005364 | Bacteria | 1686 |
| 97 | Ga0070688_100000621 | 3300005365 | Bacteria | 17688 |
| 98 | Ga0070688_100020654 | 3300005365 | Bacteria | 3832 |
| 99 | Ga0070688_100046314 | 3300005365 | Bacteria | 2692 |
| 100 | Ga0070688_100525831 | 3300005365 | Bacteria | 896 |
| 101 | Ga0070688_100534370 | 3300005365 | Bacteria | 889 |
| 102 | Ga0070659_100016047 | 3300005366 | Bacteria | 5620 |
| 103 | Ga0070667_100009056 | 3300005367 | Bacteria | 8241 |
| 104 | Ga0070667_100022604 | 3300005367 | Bacteria | 5214 |
| 105 | Ga0070667_100034224 | 3300005367 | Bacteria | 4249 |
| 106 | Ga0070667_100228150 | 3300005367 | Bacteria | 1660 |
| 107 | Ga0070667_100240290 | 3300005367 | Bacteria | 1617 |
| 108 | Ga0070667_100272573 | 3300005367 | Bacteria | 1518 |
| 109 | Ga0070703_10006701 | 3300005406 | Bacteria | 3227 |
| 110 | Ga0070703_10061495 | 3300005406 | Bacteria | 1230 |
| 111 | Ga0070709_10040051 | 3300005434 | Bacteria | 2878 |
| 112 | Ga0070714_100058473 | 3300005435 | Bacteria | 3303 |
| 113 | Ga0070714_100141051 | 3300005435 | Unclassified | 2163 |
| 114 | Ga0070714_100587793 | 3300005435 | Bacteria | 1068 |
| 115 | Ga0070714_100798682 | 3300005435 | Unclassified | 914 |
| 116 | Ga0070713_100192867 | 3300005436 | Unclassified | 1837 |
| 117 | Ga0070710_10630516 | 3300005437 | Unclassified | 749 |
| 118 | Ga0070701_10026804 | 3300005438 | Bacteria | 2815 |
| 119 | Ga0070701_10062971 | 3300005438 | Unclassified | 1961 |
| 120 | Ga0070711_100081920 | 3300005439 | Bacteria | 2301 |
| 121 | Ga0070705_100244569 | 3300005440 | Bacteria | 1256 |
| 122 | Ga0070705_100443943 | 3300005440 | Bacteria | 972 |
| 123 | Ga0070700_100029511 | 3300005441 | Bacteria | 3271 |
| 124 | Ga0070694_100006500 | 3300005444 | Bacteria | 7100 |
| 125 | Ga0070694_100034600 | 3300005444 | Bacteria | 3333 |
| 126 | Ga0070708_100009081 | 3300005445 | Bacteria | 8015 |
| 127 | Ga0070708_100013237 | 3300005445 | Bacteria | 6750 |
| 128 | Ga0070708_100050292 | 3300005445 | Bacteria | 3690 |
| 129 | Ga0070708_100059790 | 3300005445 | Bacteria | 3399 |
| 130 | Ga0070708_100092401 | 3300005445 | Bacteria | 2757 |
| 131 | Ga0070708_100181420 | 3300005445 | Bacteria | 1968 |
| 132 | Ga0070708_100223150 | 3300005445 | Bacteria | 1767 |
| 133 | Ga0070708_100312414 | 3300005445 | Bacteria | 1480 |
| 134 | Ga0070708_100736785 | 3300005445 | Bacteria | 927 |
| 135 | Ga0070708_100855034 | 3300005445 | Unclassified | 854 |
| 136 | Ga0070708_100893936 | 3300005445 | Unclassified | 834 |
| 137 | Ga0070708_101270254 | 3300005445 | Unclassified | 688 |
| 138 | Ga0070663_100132282 | 3300005455 | Unclassified | 1896 |
| 139 | Ga0070678_100002933 | 3300005456 | Bacteria | 9455 |
| 140 | Ga0070678_100047630 | 3300005456 | Unclassified | 3082 |
| 141 | Ga0070678_100343406 | 3300005456 | Bacteria | 1281 |
| 142 | Ga0070662_100001248 | 3300005457 | Bacteria | 15598 |
| 143 | Ga0070662_100190260 | 3300005457 | Bacteria | 1623 |
| 144 | Ga0070662_100667563 | 3300005457 | Unclassified | 878 |
| 145 | Ga0070681_10025041 | 3300005458 | Bacteria | 6005 |
| 146 | Ga0068867_100038574 | 3300005459 | Bacteria | 3478 |
| 147 | Ga0068867_100045690 | 3300005459 | Unclassified | 3213 |
| 148 | Ga0068867_100154449 | 3300005459 | Unclassified | 1805 |
| 149 | Ga0070685_10022977 | 3300005466 | Bacteria | 3408 |
| 150 | Ga0070685_10076742 | 3300005466 | Unclassified | 1993 |
| 151 | Ga0070706_100000227 | 3300005467 | Bacteria | 68755 |
| 152 | Ga0070706_100001536 | 3300005467 | Bacteria | 24129 |
| 153 | Ga0070706_100006339 | 3300005467 | Bacteria | 11177 |
| 154 | Ga0070706_100012642 | 3300005467 | Bacteria | 7813 |
| 155 | Ga0070706_100033974 | 3300005467 | Unclassified | 4708 |
| 156 | Ga0070706_100080958 | 3300005467 | Unclassified | 3007 |
| 157 | Ga0070706_100094407 | 3300005467 | Bacteria | 2776 |
| 158 | Ga0070706_100242806 | 3300005467 | Unclassified | 1682 |
| 159 | Ga0070706_100265682 | 3300005467 | Unclassified | 1601 |
| 160 | Ga0070706_100316879 | 3300005467 | Bacteria | 1455 |
| 161 | Ga0070706_100355014 | 3300005467 | Bacteria | 1366 |
| 162 | Ga0070706_100359938 | 3300005467 | Bacteria | 1356 |
| 163 | Ga0070706_100619038 | 3300005467 | Bacteria | 1006 |
| 164 | Ga0070707_100049683 | 3300005468 | Bacteria | 4020 |
| 165 | Ga0070707_100052130 | 3300005468 | Bacteria | 3922 |
| 166 | Ga0070707_100125418 | 3300005468 | Bacteria | 2494 |
| 167 | Ga0070707_100132686 | 3300005468 | Unclassified | 2422 |
| 168 | Ga0070707_100154274 | 3300005468 | Bacteria | 2237 |
| 169 | Ga0070707_100234337 | 3300005468 | Unclassified | 1786 |
| 170 | Ga0070707_100342903 | 3300005468 | Bacteria | 1451 |
| 171 | Ga0070707_100424734 | 3300005468 | Bacteria | 1290 |
| 172 | Ga0070707_100501440 | 3300005468 | Unclassified | 1175 |
| 173 | Ga0070707_100647816 | 3300005468 | Bacteria | 1019 |
| 174 | Ga0070707_100773660 | 3300005468 | Bacteria | 924 |
| 175 | Ga0070707_100817351 | 3300005468 | Bacteria | 896 |
| 176 | Ga0070698_100011183 | 3300005471 | Bacteria | 9536 |
| 177 | Ga0070698_100012644 | 3300005471 | Bacteria | 8937 |
| 178 | Ga0070698_100014761 | 3300005471 | Bacteria | 8252 |
| 179 | Ga0070699_100057478 | 3300005518 | Bacteria | 3370 |
| 180 | Ga0070699_100068033 | 3300005518 | Bacteria | 3092 |
| 181 | Ga0070699_100083652 | 3300005518 | Bacteria | 2784 |
| 182 | Ga0070699_100100250 | 3300005518 | Unclassified | 2538 |
| 183 | Ga0070699_100151243 | 3300005518 | Bacteria | 2053 |
| 184 | Ga0070699_100187658 | 3300005518 | Unclassified | 1836 |
| 185 | Ga0070699_100621590 | 3300005518 | Bacteria | 985 |
| 186 | Ga0070679_100037540 | 3300005530 | Unclassified | 4813 |
| 187 | Ga0070684_100000230 | 3300005535 | Bacteria | 38807 |
| 188 | Ga0070684_100011931 | 3300005535 | Bacteria | 6940 |
| 189 | Ga0070684_100073522 | 3300005535 | Bacteria | 3012 |
| 190 | Ga0070684_100773643 | 3300005535 | Unclassified | 897 |
| 191 | Ga0070697_100000640 | 3300005536 | Bacteria | 26481 |
| 192 | Ga0070697_100001810 | 3300005536 | Bacteria | 16323 |
| 193 | Ga0070697_100012250 | 3300005536 | Bacteria | 6717 |
| 194 | Ga0070697_100014557 | 3300005536 | Bacteria | 6178 |
| 195 | Ga0070697_100019134 | 3300005536 | Bacteria | 5406 |
| 196 | Ga0070697_100019752 | 3300005536 | Bacteria | 5323 |
| 197 | Ga0070697_100039216 | 3300005536 | Bacteria | 3829 |
| 198 | Ga0070697_100088907 | 3300005536 | Unclassified | 2551 |
| 199 | Ga0070697_100091775 | 3300005536 | Bacteria | 2512 |
| 200 | Ga0070697_100102487 | 3300005536 | Bacteria | 2378 |
| 201 | Ga0070697_100350587 | 3300005536 | Bacteria | 1275 |
| 202 | Ga0070697_100405974 | 3300005536 | Unclassified | 1183 |
| 203 | Ga0070672_100006079 | 3300005543 | Bacteria | 8072 |
| 204 | Ga0070672_100023736 | 3300005543 | Bacteria | 4524 |
| 205 | Ga0070672_100025838 | 3300005543 | Bacteria | 4362 |
| 206 | Ga0070672_100228567 | 3300005543 | Bacteria | 1562 |
| 207 | Ga0070672_100273200 | 3300005543 | Bacteria | 1428 |
| 208 | Ga0070672_100299164 | 3300005543 | Bacteria | 1364 |
| 209 | Ga0070686_100433967 | 3300005544 | Bacteria | 1006 |
| 210 | Ga0070695_100359243 | 3300005545 | Unclassified | 1093 |
| 211 | Ga0070696_100056918 | 3300005546 | Bacteria | 2728 |
| 212 | Ga0070693_100054334 | 3300005547 | Bacteria | 2303 |
| 213 | Ga0070665_100042759 | 3300005548 | Bacteria | 4555 |
| 214 | Ga0070665_100051907 | 3300005548 | Unclassified | 4112 |
| 215 | Ga0070665_100054112 | 3300005548 | Bacteria | 4025 |
| 216 | Ga0070665_100076204 | 3300005548 | Bacteria | 3361 |
| 217 | Ga0070665_100177204 | 3300005548 | Bacteria | 2133 |
| 218 | Ga0070665_100183921 | 3300005548 | Unclassified | 2090 |
| 219 | Ga0070665_100315931 | 3300005548 | Bacteria | 1566 |
| 220 | Ga0070665_100824782 | 3300005548 | Bacteria | 940 |
| 221 | Ga0070704_100001031 | 3300005549 | Bacteria | 14352 |
| 222 | Ga0070704_100440432 | 3300005549 | Bacteria | 1120 |
| 223 | Ga0068855_100515826 | 3300005563 | Unclassified | 1297 |
| 224 | Ga0070664_100098766 | 3300005564 | Bacteria | 2537 |
| 225 | Ga0070664_100202370 | 3300005564 | Bacteria | 1772 |
| 226 | Ga0070664_100348878 | 3300005564 | Bacteria | 1346 |
| 227 | Ga0070664_100726141 | 3300005564 | Bacteria | 926 |
| 228 | Ga0068856_100016596 | 3300005614 | Bacteria | 7128 |
| 229 | Ga0070702_100048251 | 3300005615 | Bacteria | 2423 |
| 230 | Ga0070702_100675412 | 3300005615 | Unclassified | 784 |
| 231 | Ga0068852_100565794 | 3300005616 | Bacteria | 1138 |
| 232 | Ga0068864_100081207 | 3300005618 | Bacteria | 2842 |
| 233 | Ga0068866_10027744 | 3300005718 | Bacteria | 2691 |
| 234 | Ga0068866_10451087 | 3300005718 | Unclassified | 841 |
| 235 | Ga0068863_100015159 | 3300005841 | Bacteria | 7404 |
| 236 | Ga0068858_100001678 | 3300005842 | Bacteria | 22642 |
| 237 | Ga0068858_100002353 | 3300005842 | Bacteria | 19101 |
| 238 | Ga0068858_100549661 | 3300005842 | Bacteria | 1118 |
| 239 | Ga0068860_100114018 | 3300005843 | Unclassified | 2585 |
| 240 | Ga0068860_100116100 | 3300005843 | Bacteria | 2560 |
| 241 | Ga0068860_100214393 | 3300005843 | Bacteria | 1868 |
| 242 | Ga0068860_100395673 | 3300005843 | Bacteria | 1366 |
| 243 | Ga0068862_100008618 | 3300005844 | Bacteria | 8436 |
| 244 | Ga0068862_100243203 | 3300005844 | Unclassified | 1637 |
| 245 | Ga0081455_10001703 | 3300005937 | Bacteria | 26634 |
| 246 | Ga0081455_10001745 | 3300005937 | Bacteria | 26278 |
| 247 | Ga0081455_10010995 | 3300005937 | Bacteria | 9122 |
| 248 | Ga0081455_10074912 | 3300005937 | Bacteria | 2794 |
| 249 | Ga0081455_10118118 | 3300005937 | Unclassified | 2094 |
| 250 | Ga0081455_10177519 | 3300005937 | Bacteria | 1616 |
| 251 | Ga0081455_10459080 | 3300005937 | Bacteria | 868 |
| 252 | Ga0081540_1000437 | 3300005983 | Bacteria | 41175 |
| 253 | Ga0081540_1007907 | 3300005983 | Bacteria | 7510 |
| 254 | Ga0081540_1062621 | 3300005983 | Bacteria | 1765 |
| 255 | Ga0081539_10000287 | 3300005985 | Bacteria | 113988 |
| 256 | Ga0081539_10000621 | 3300005985 | Bacteria | 71799 |
| 257 | Ga0081539_10025018 | 3300005985 | Unclassified | 3857 |
| 258 | Ga0081539_10051779 | 3300005985 | Bacteria | 2311 |
| 259 | Ga0070717_10005952 | 3300006028 | Bacteria | 8931 |
| 260 | Ga0070717_10024471 | 3300006028 | Unclassified | 4795 |
| 261 | Ga0070717_10048500 | 3300006028 | Bacteria | 3483 |
| 262 | Ga0070717_10055646 | 3300006028 | Bacteria | 3265 |
| 263 | Ga0070717_10057975 | 3300006028 | Bacteria | 3201 |
| 264 | Ga0070717_10104447 | 3300006028 | Unclassified | 2410 |
| 265 | Ga0070717_10112906 | 3300006028 | Bacteria | 2320 |
| 266 | Ga0070717_10234777 | 3300006028 | Bacteria | 1615 |
| 267 | Ga0070717_10270190 | 3300006028 | Bacteria | 1506 |
| 268 | Ga0070717_10414115 | 3300006028 | Unclassified | 1212 |
| 269 | Ga0070717_10682713 | 3300006028 | Unclassified | 933 |
| 270 | Ga0070715_10336635 | 3300006163 | Bacteria | 819 |
| 271 | Ga0070716_100112460 | 3300006173 | Bacteria | 1690 |
| 272 | Ga0070716_100120800 | 3300006173 | Bacteria | 1640 |
| 273 | Ga0070716_100251424 | 3300006173 | Bacteria | 1204 |
| 274 | Ga0070712_100032172 | 3300006175 | Bacteria | 3539 |
| 275 | Ga0070712_100056078 | 3300006175 | Bacteria | 2762 |
| 276 | Ga0070712_100075678 | 3300006175 | Bacteria | 2422 |
| 277 | Ga0070712_100078432 | 3300006175 | Unclassified | 2384 |
| 278 | Ga0070712_100080217 | 3300006175 | Unclassified | 2361 |
| 279 | Ga0070712_100117694 | 3300006175 | Unclassified | 1994 |
| 280 | Ga0070712_100198204 | 3300006175 | Unclassified | 1575 |
| 281 | Ga0070712_100375735 | 3300006175 | Bacteria | 1169 |
| 282 | Ga0070712_100636899 | 3300006175 | Unclassified | 905 |
| 283 | Ga0070712_100845427 | 3300006175 | Bacteria | 787 |
| 284 | Ga0097621_100017406 | 3300006237 | Bacteria | 5457 |
| 285 | Ga0097621_100088344 | 3300006237 | Bacteria | 2589 |
| 286 | Ga0097621_100130785 | 3300006237 | Bacteria | 2137 |
| 287 | Ga0068871_100010934 | 3300006358 | Bacteria | 6648 |
| 288 | Ga0068871_100050694 | 3300006358 | Bacteria | 3358 |
| 289 | Ga0068871_100162593 | 3300006358 | Bacteria | 1910 |
| 290 | Ga0068871_100435588 | 3300006358 | Unclassified | 1173 |
| 291 | Ga0068871_100494899 | 3300006358 | Unclassified | 1101 |
| 292 | Ga0068871_100675311 | 3300006358 | Bacteria | 945 |
| 293 | Ga0075433_10184947 | 3300006852 | Bacteria | 1854 |
| 294 | Ga0075433_10237240 | 3300006852 | Unclassified | 1619 |
| 295 | Ga0075433_10313871 | 3300006852 | Unclassified | 1387 |
| 296 | Ga0075434_100476365 | 3300006871 | Bacteria | 1269 |
| 297 | Ga0075434_101071184 | 3300006871 | Bacteria | 820 |
| 298 | Ga0068865_100168209 | 3300006881 | Bacteria | 1678 |
| 299 | Ga0075436_100010844 | 3300006914 | Bacteria | 6252 |
| 300 | Ga0075436_100129430 | 3300006914 | Unclassified | 1770 |
| 301 | Ga0075435_100272786 | 3300007076 | Bacteria | 1443 |
| 302 | Ga0075435_100327447 | 3300007076 | Unclassified | 1312 |
| 303 | Ga0099795_10089245 | 3300007788 | Bacteria | 1193 |
| 304 | Ga0099795_10340755 | 3300007788 | Unclassified | 668 |
| 305 | Ga0105240_10029117 | 3300009093 | Bacteria | 7201 |
| 306 | Ga0105240_10409715 | 3300009093 | Unclassified | 1525 |
| 307 | Ga0111539_10201444 | 3300009094 | Bacteria | 2321 |
| 308 | Ga0105245_10010327 | 3300009098 | Bacteria | 8134 |
| 309 | Ga0105247_10112987 | 3300009101 | Bacteria | 1750 |
| 310 | Ga0114129_10004895 | 3300009147 | Bacteria | 18901 |
| 311 | Ga0114129_10280608 | 3300009147 | Bacteria | 2226 |
| 312 | Ga0114129_10537557 | 3300009147 | Unclassified | 1522 |
| 313 | Ga0105243_10342715 | 3300009148 | Bacteria | 1369 |
| 314 | Ga0105242_10008800 | 3300009176 | Bacteria | 7744 |
| 315 | Ga0105242_10171629 | 3300009176 | Bacteria | 1906 |
| 316 | Ga0105242_10383673 | 3300009176 | Bacteria | 1307 |
| 317 | Ga0105248_10085246 | 3300009177 | Bacteria | 3555 |
| 318 | Ga0105248_11057800 | 3300009177 | Bacteria | 917 |
| 319 | Ga0105237_10020734 | 3300009545 | Bacteria | 6770 |
| 320 | Ga0105237_10241007 | 3300009545 | Unclassified | 1809 |
| 321 | Ga0105237_10968854 | 3300009545 | Viruses | 857 |
| 322 | Ga0105249_10003062 | 3300009553 | Bacteria | 14440 |
| 323 | Ga0105249_10034778 | 3300009553 | Bacteria | 4567 |
| 324 | Ga0105249_10060224 | 3300009553 | Bacteria | 3482 |
| 325 | Ga0099796_10146036 | 3300010159 | Bacteria | 928 |
| 326 | Ga0105239_10012805 | 3300010375 | Bacteria | 9332 |
| 327 | Ga0105239_10035273 | 3300010375 | Bacteria | 5493 |
| 328 | Ga0105239_10375110 | 3300010375 | Bacteria | 1608 |
| 329 | Ga0105239_10516453 | 3300010375 | Bacteria | 1359 |
| 330 | Ga0105239_10705775 | 3300010375 | Unclassified | 1153 |
| 331 | Ga0105239_10734157 | 3300010375 | Bacteria | 1130 |
| 332 | Ga0157346_1010875 | 3300012480 | Unclassified | 667 |
| 333 | Ga0157347_1025576 | 3300012502 | Unclassified | 715 |
| 334 | Ga0157371_10213717 | 3300013102 | Bacteria | 1384 |
| 335 | Ga0157371_10453814 | 3300013102 | Bacteria | 943 |
| 336 | Ga0157370_10185263 | 3300013104 | Bacteria | 1933 |
| 337 | Ga0157374_10000068 | 3300013296 | Bacteria | 106195 |
| 338 | Ga0157374_10004587 | 3300013296 | Bacteria | 11587 |
| 339 | Ga0157374_10005441 | 3300013296 | Bacteria | 10696 |
| 340 | Ga0157374_10015983 | 3300013296 | Bacteria | 6593 |
| 341 | Ga0157374_10040135 | 3300013296 | Bacteria | 4309 |
| 342 | Ga0157374_10058052 | 3300013296 | Unclassified | 3616 |
| 343 | Ga0157374_10086120 | 3300013296 | Unclassified | 2989 |
| 344 | Ga0157374_10195063 | 3300013296 | Bacteria | 1982 |
| 345 | Ga0157374_10255521 | 3300013296 | Bacteria | 1725 |
| 346 | Ga0157374_10274258 | 3300013296 | Bacteria | 1664 |
| 347 | Ga0157374_10429921 | 3300013296 | Unclassified | 1320 |
| 348 | Ga0157378_10005429 | 3300013297 | Bacteria | 11178 |
| 349 | Ga0157378_10016462 | 3300013297 | Bacteria | 6476 |
| 350 | Ga0157378_10033584 | 3300013297 | Bacteria | 4537 |
| 351 | Ga0157378_10036119 | 3300013297 | Bacteria | 4373 |
| 352 | Ga0157378_10041698 | 3300013297 | Bacteria | 4072 |
| 353 | Ga0157378_10044064 | 3300013297 | Bacteria | 3961 |
| 354 | Ga0157378_10157817 | 3300013297 | Unclassified | 2119 |
| 355 | Ga0157378_10165237 | 3300013297 | Bacteria | 2073 |
| 356 | Ga0157378_10175101 | 3300013297 | Bacteria | 2015 |
| 357 | Ga0157378_10202204 | 3300013297 | Bacteria | 1879 |
| 358 | Ga0157378_10314914 | 3300013297 | Bacteria | 1519 |
| 359 | Ga0157378_10357537 | 3300013297 | Bacteria | 1428 |
| 360 | Ga0157378_10799979 | 3300013297 | Bacteria | 968 |
| 361 | Ga0163162_10002701 | 3300013306 | Bacteria | 16826 |
| 362 | Ga0163162_10007809 | 3300013306 | Bacteria | 10428 |
| 363 | Ga0163162_10011424 | 3300013306 | Bacteria | 8659 |
| 364 | Ga0163162_10023089 | 3300013306 | Bacteria | 6136 |
| 365 | Ga0163162_10076339 | 3300013306 | Bacteria | 3412 |
| 366 | Ga0163162_10096704 | 3300013306 | Bacteria | 3041 |
| 367 | Ga0163162_10096814 | 3300013306 | Bacteria | 3039 |
| 368 | Ga0163162_10274383 | 3300013306 | Bacteria | 1818 |
| 369 | Ga0157372_10036367 | 3300013307 | Bacteria | 5427 |
| 370 | Ga0157372_10233647 | 3300013307 | Bacteria | 2132 |
| 371 | Ga0157372_10476927 | 3300013307 | Bacteria | 1454 |
| 372 | Ga0157375_10002103 | 3300013308 | Bacteria | 17179 |
| 373 | Ga0157375_10002145 | 3300013308 | Bacteria | 17041 |
| 374 | Ga0157375_10007613 | 3300013308 | Bacteria | 9473 |
| 375 | Ga0157375_10007724 | 3300013308 | Bacteria | 9414 |
| 376 | Ga0157375_10009633 | 3300013308 | Bacteria | 8489 |
| 377 | Ga0157375_10065220 | 3300013308 | Bacteria | 3630 |
| 378 | Ga0157375_10074631 | 3300013308 | Bacteria | 3413 |
| 379 | Ga0157375_10091057 | 3300013308 | Bacteria | 3110 |
| 380 | Ga0157375_10326004 | 3300013308 | Unclassified | 1700 |
| 381 | Ga0157375_10429539 | 3300013308 | Bacteria | 1487 |
| 382 | Ga0163163_10178409 | 3300014325 | Bacteria | 2171 |
| 383 | Ga0163163_10262610 | 3300014325 | Unclassified | 1778 |
| 384 | Ga0163163_10639788 | 3300014325 | Bacteria | 1127 |
| 385 | Ga0157380_11681875 | 3300014326 | Unclassified | 692 |
| 386 | Ga0182008_10022323 | 3300014497 | Bacteria | 3242 |
| 387 | Ga0157377_10118189 | 3300014745 | Unclassified | 1603 |
| 388 | Ga0157377_10168089 | 3300014745 | Bacteria | 1369 |
| 389 | Ga0157379_10368660 | 3300014968 | Unclassified | 1317 |
| 390 | Ga0157379_10498264 | 3300014968 | Unclassified | 1129 |
| 391 | Ga0157376_10001598 | 3300014969 | Bacteria | 14997 |
| 392 | Ga0157376_10003774 | 3300014969 | Bacteria | 10473 |
| 393 | Ga0157376_10077971 | 3300014969 | Bacteria | 2835 |
| 394 | Ga0157376_10130270 | 3300014969 | Bacteria | 2243 |
| 395 | Ga0157376_10218726 | 3300014969 | Bacteria | 1763 |
| 396 | Ga0157376_10420639 | 3300014969 | Bacteria | 1297 |
| 397 | Ga0157376_10508480 | 3300014969 | Unclassified | 1185 |
| 398 | Ga0182006_1131722 | 3300015261 | Unclassified | 860 |
| 399 | Ga0163161_10003776 | 3300017792 | Bacteria | 10610 |
| 400 | Ga0163161_10013881 | 3300017792 | Bacteria | 5612 |
| 401 | Ga0213874_10062731 | 3300021377 | Bacteria | 1168 |
| 402 | Ga0207666_1000587 | 3300025271 | Bacteria | 4375 |
| 403 | Ga0207673_1001785 | 3300025290 | Unclassified | 2389 |
| 404 | Ga0207673_1006360 | 3300025290 | Unclassified | 1460 |
| 405 | Ga0207673_1006829 | 3300025290 | Bacteria | 1421 |
| 406 | Ga0207697_10000281 | 3300025315 | Bacteria | 28268 |
| 407 | Ga0207697_10000496 | 3300025315 | Bacteria | 22132 |
| 408 | Ga0207697_10000868 | 3300025315 | Bacteria | 17109 |
| 409 | Ga0207697_10000876 | 3300025315 | Bacteria | 17049 |
| 410 | Ga0207697_10001461 | 3300025315 | Bacteria | 12903 |
| 411 | Ga0207697_10007026 | 3300025315 | Bacteria | 5041 |
| 412 | Ga0207697_10016269 | 3300025315 | Bacteria | 3064 |
| 413 | Ga0207697_10026017 | 3300025315 | Unclassified | 2393 |
| 414 | Ga0207697_10048027 | 3300025315 | Bacteria | 1760 |
| 415 | Ga0207653_10009899 | 3300025885 | Bacteria | 2973 |
| 416 | Ga0207682_10009209 | 3300025893 | Bacteria | 3900 |
| 417 | Ga0207682_10140594 | 3300025893 | Unclassified | 1083 |
| 418 | Ga0207692_10064018 | 3300025898 | Bacteria | 1913 |
| 419 | Ga0207692_10089602 | 3300025898 | Bacteria | 1665 |
| 420 | Ga0207642_10285994 | 3300025899 | Bacteria | 950 |
| 421 | Ga0207688_10003305 | 3300025901 | Bacteria | 8812 |
| 422 | Ga0207688_10185043 | 3300025901 | Unclassified | 1243 |
| 423 | Ga0207680_10001473 | 3300025903 | Bacteria | 11150 |
| 424 | Ga0207680_10096509 | 3300025903 | Bacteria | 1891 |
| 425 | Ga0207680_10415348 | 3300025903 | Unclassified | 952 |
| 426 | Ga0207647_10034060 | 3300025904 | Bacteria | 3255 |
| 427 | Ga0207685_10109286 | 3300025905 | Bacteria | 1196 |
| 428 | Ga0207699_10513232 | 3300025906 | Bacteria | 866 |
| 429 | Ga0207645_10004008 | 3300025907 | Bacteria | 10980 |
| 430 | Ga0207645_10005947 | 3300025907 | Bacteria | 8793 |
| 431 | Ga0207645_10026736 | 3300025907 | Bacteria | 3728 |
| 432 | Ga0207645_10063650 | 3300025907 | Bacteria | 2357 |
| 433 | Ga0207645_10131366 | 3300025907 | Unclassified | 1630 |
| 434 | Ga0207645_10215034 | 3300025907 | Bacteria | 1266 |
| 435 | Ga0207684_10000205 | 3300025910 | Bacteria | 91547 |
| 436 | Ga0207684_10002005 | 3300025910 | Bacteria | 20962 |
| 437 | Ga0207684_10003655 | 3300025910 | Bacteria | 14946 |
| 438 | Ga0207684_10028263 | 3300025910 | Unclassified | 4778 |
| 439 | Ga0207684_10032430 | 3300025910 | Unclassified | 4442 |
| 440 | Ga0207684_10032588 | 3300025910 | Unclassified | 4430 |
| 441 | Ga0207684_10084831 | 3300025910 | Bacteria | 2698 |
| 442 | Ga0207684_10103635 | 3300025910 | Bacteria | 2433 |
| 443 | Ga0207684_10214066 | 3300025910 | Unclassified | 1662 |
| 444 | Ga0207684_10308167 | 3300025910 | Bacteria | 1365 |
| 445 | Ga0207684_10347487 | 3300025910 | Bacteria | 1277 |
| 446 | Ga0207684_10481335 | 3300025910 | Unclassified | 1065 |
| 447 | Ga0207684_10494042 | 3300025910 | Unclassified | 1049 |
| 448 | Ga0207684_10617966 | 3300025910 | Bacteria | 925 |
| 449 | Ga0207684_10626171 | 3300025910 | Bacteria | 918 |
| 450 | Ga0207707_10079230 | 3300025912 | Unclassified | 2868 |
| 451 | Ga0207695_10009328 | 3300025913 | Bacteria | 12144 |
| 452 | Ga0207695_10062816 | 3300025913 | Bacteria | 3831 |
| 453 | Ga0207671_10011128 | 3300025914 | Bacteria | 7352 |
| 454 | Ga0207693_10006434 | 3300025915 | Bacteria | 9731 |
| 455 | Ga0207693_10008083 | 3300025915 | Bacteria | 8629 |
| 456 | Ga0207693_10011275 | 3300025915 | Bacteria | 7236 |
| 457 | Ga0207693_10021447 | 3300025915 | Bacteria | 5132 |
| 458 | Ga0207693_10140540 | 3300025915 | Bacteria | 1899 |
| 459 | Ga0207693_10205768 | 3300025915 | Unclassified | 1547 |
| 460 | Ga0207693_10669106 | 3300025915 | Bacteria | 806 |
| 461 | Ga0207663_10394868 | 3300025916 | Bacteria | 1056 |
| 462 | Ga0207660_10506889 | 3300025917 | Bacteria | 979 |
| 463 | Ga0207662_10000089 | 3300025918 | Bacteria | 43194 |
| 464 | Ga0207662_10133324 | 3300025918 | Bacteria | 1568 |
| 465 | Ga0207657_10075271 | 3300025919 | Bacteria | 2849 |
| 466 | Ga0207649_10112684 | 3300025920 | Bacteria | 1820 |
| 467 | Ga0207649_10189288 | 3300025920 | Bacteria | 1446 |
| 468 | Ga0207646_10000925 | 3300025922 | Bacteria | 37781 |
| 469 | Ga0207646_10018784 | 3300025922 | Bacteria | 6441 |
| 470 | Ga0207646_10018999 | 3300025922 | Bacteria | 6399 |
| 471 | Ga0207646_10049477 | 3300025922 | Unclassified | 3765 |
| 472 | Ga0207646_10088317 | 3300025922 | Bacteria | 2774 |
| 473 | Ga0207646_10105923 | 3300025922 | Unclassified | 2522 |
| 474 | Ga0207646_10264346 | 3300025922 | Bacteria | 1555 |
| 475 | Ga0207646_10477104 | 3300025922 | Unclassified | 1125 |
| 476 | Ga0207646_10549703 | 3300025922 | Bacteria | 1038 |
| 477 | Ga0207681_10006654 | 3300025923 | Bacteria | 7097 |
| 478 | Ga0207681_10046696 | 3300025923 | Unclassified | 2914 |
| 479 | Ga0207681_10159312 | 3300025923 | Unclassified | 1699 |
| 480 | Ga0207681_10163087 | 3300025923 | Unclassified | 1682 |
| 481 | Ga0207681_10255155 | 3300025923 | Unclassified | 1371 |
| 482 | Ga0207681_10476512 | 3300025923 | Bacteria | 1019 |
| 483 | Ga0207650_10071088 | 3300025925 | Bacteria | 2617 |
| 484 | Ga0207650_10075546 | 3300025925 | Unclassified | 2543 |
| 485 | Ga0207659_10002784 | 3300025926 | Bacteria | 10428 |
| 486 | Ga0207659_10005479 | 3300025926 | Bacteria | 7699 |
| 487 | Ga0207659_10007171 | 3300025926 | Bacteria | 6842 |
| 488 | Ga0207659_10048418 | 3300025926 | Bacteria | 3011 |
| 489 | Ga0207659_10072306 | 3300025926 | Bacteria | 2521 |
| 490 | Ga0207659_10074765 | 3300025926 | Bacteria | 2484 |
| 491 | Ga0207659_10098027 | 3300025926 | Bacteria | 2203 |
| 492 | Ga0207659_10107845 | 3300025926 | Bacteria | 2112 |
| 493 | Ga0207659_10173548 | 3300025926 | Bacteria | 1702 |
| 494 | Ga0207659_10175712 | 3300025926 | Unclassified | 1692 |
| 495 | Ga0207659_10393346 | 3300025926 | Unclassified | 1158 |
| 496 | Ga0207687_10205483 | 3300025927 | Bacteria | 1542 |
| 497 | Ga0207687_10861319 | 3300025927 | Unclassified | 774 |
| 498 | Ga0207700_10072142 | 3300025928 | Bacteria | 2661 |
| 499 | Ga0207700_10158445 | 3300025928 | Unclassified | 1878 |
| 500 | Ga0207700_10363522 | 3300025928 | Bacteria | 1262 |
| 501 | Ga0207664_10037918 | 3300025929 | Bacteria | 3734 |
| 502 | Ga0207664_10193629 | 3300025929 | Bacteria | 1751 |
| 503 | Ga0207664_10533484 | 3300025929 | Bacteria | 1052 |
| 504 | Ga0207644_10008161 | 3300025931 | Bacteria | 6859 |
| 505 | Ga0207644_10109485 | 3300025931 | Unclassified | 2087 |
| 506 | Ga0207644_10259397 | 3300025931 | Bacteria | 1389 |
| 507 | Ga0207644_10262980 | 3300025931 | Unclassified | 1380 |
| 508 | Ga0207690_10002749 | 3300025932 | Bacteria | 10627 |
| 509 | Ga0207690_10023034 | 3300025932 | Bacteria | 3882 |
| 510 | Ga0207690_10169693 | 3300025932 | Bacteria | 1633 |
| 511 | Ga0207690_10403814 | 3300025932 | Unclassified | 1090 |
| 512 | Ga0207706_10000188 | 3300025933 | Bacteria | 68890 |
| 513 | Ga0207706_10016526 | 3300025933 | Bacteria | 6660 |
| 514 | Ga0207706_10045646 | 3300025933 | Bacteria | 3881 |
| 515 | Ga0207706_10076858 | 3300025933 | Bacteria | 2936 |
| 516 | Ga0207706_10138950 | 3300025933 | Bacteria | 2137 |
| 517 | Ga0207706_10172663 | 3300025933 | Bacteria | 1899 |
| 518 | Ga0207706_10459746 | 3300025933 | Bacteria | 1100 |
| 519 | Ga0207686_10005884 | 3300025934 | Bacteria | 6582 |
| 520 | Ga0207686_10218869 | 3300025934 | Bacteria | 1373 |
| 521 | Ga0207686_10294801 | 3300025934 | Bacteria | 1202 |
| 522 | Ga0207709_10303355 | 3300025935 | Unclassified | 1188 |
| 523 | Ga0207670_10019155 | 3300025936 | Bacteria | 4173 |
| 524 | Ga0207670_10022746 | 3300025936 | Bacteria | 3890 |
| 525 | Ga0207670_10397484 | 3300025936 | Bacteria | 1101 |
| 526 | Ga0207669_10006416 | 3300025937 | Bacteria | 5374 |
| 527 | Ga0207669_10013117 | 3300025937 | Bacteria | 4103 |
| 528 | Ga0207669_10260257 | 3300025937 | Unclassified | 1297 |
| 529 | Ga0207704_10119008 | 3300025938 | Bacteria | 1803 |
| 530 | Ga0207704_10627582 | 3300025938 | Bacteria | 883 |
| 531 | Ga0207665_10058162 | 3300025939 | Bacteria | 2613 |
| 532 | Ga0207665_10060956 | 3300025939 | Bacteria | 2556 |
| 533 | Ga0207665_10093409 | 3300025939 | Bacteria | 2089 |
| 534 | Ga0207665_10108711 | 3300025939 | Bacteria | 1946 |
| 535 | Ga0207665_10305575 | 3300025939 | Unclassified | 1190 |
| 536 | Ga0207665_10378695 | 3300025939 | Unclassified | 1074 |
| 537 | Ga0207691_10000701 | 3300025940 | Bacteria | 33170 |
| 538 | Ga0207691_10015640 | 3300025940 | Bacteria | 7211 |
| 539 | Ga0207691_10051282 | 3300025940 | Bacteria | 3773 |
| 540 | Ga0207691_10069262 | 3300025940 | Bacteria | 3187 |
| 541 | Ga0207691_10072407 | 3300025940 | Bacteria | 3108 |
| 542 | Ga0207691_10087884 | 3300025940 | Bacteria | 2788 |
| 543 | Ga0207691_10132486 | 3300025940 | Unclassified | 2201 |
| 544 | Ga0207711_10178744 | 3300025941 | Bacteria | 1928 |
| 545 | Ga0207689_10845754 | 3300025942 | Bacteria | 772 |
| 546 | Ga0207661_10019238 | 3300025944 | Bacteria | 5086 |
| 547 | Ga0207661_10122603 | 3300025944 | Bacteria | 2215 |
| 548 | Ga0207661_10287921 | 3300025944 | Bacteria | 1470 |
| 549 | Ga0207679_10058395 | 3300025945 | Bacteria | 2859 |
| 550 | Ga0207679_10066701 | 3300025945 | Bacteria | 2697 |
| 551 | Ga0207679_10413966 | 3300025945 | Unclassified | 1188 |
| 552 | Ga0207651_10005845 | 3300025960 | Bacteria | 6361 |
| 553 | Ga0207651_10020349 | 3300025960 | Unclassified | 4003 |
| 554 | Ga0207651_10050688 | 3300025960 | Bacteria | 2820 |
| 555 | Ga0207651_10259750 | 3300025960 | Bacteria | 1425 |
| 556 | Ga0207651_10281618 | 3300025960 | Unclassified | 1374 |
| 557 | Ga0207651_10288692 | 3300025960 | Bacteria | 1359 |
| 558 | Ga0207651_10351669 | 3300025960 | Bacteria | 1241 |
| 559 | Ga0207651_10371128 | 3300025960 | Bacteria | 1210 |
| 560 | Ga0207712_10002700 | 3300025961 | Bacteria | 11328 |
| 561 | Ga0207712_10022117 | 3300025961 | Bacteria | 4184 |
| 562 | Ga0207712_10095695 | 3300025961 | Bacteria | 2196 |
| 563 | Ga0207712_10439587 | 3300025961 | Bacteria | 1104 |
| 564 | Ga0207668_10005123 | 3300025972 | Bacteria | 7710 |
| 565 | Ga0207668_10031009 | 3300025972 | Bacteria | 3517 |
| 566 | Ga0207668_10039445 | 3300025972 | Bacteria | 3179 |
| 567 | Ga0207668_10116779 | 3300025972 | Bacteria | 2013 |
| 568 | Ga0207658_10004530 | 3300025986 | Bacteria | 9650 |
| 569 | Ga0207658_10015104 | 3300025986 | Bacteria | 5296 |
| 570 | Ga0207658_10065267 | 3300025986 | Bacteria | 2733 |
| 571 | Ga0207658_10300830 | 3300025986 | Bacteria | 1382 |
| 572 | Ga0207658_10659906 | 3300025986 | Unclassified | 943 |
| 573 | Ga0207677_10026383 | 3300026023 | Unclassified | 3642 |
| 574 | Ga0207677_10175449 | 3300026023 | Bacteria | 1680 |
| 575 | Ga0207677_10202382 | 3300026023 | Bacteria | 1579 |
| 576 | Ga0207703_10003597 | 3300026035 | Bacteria | 12943 |
| 577 | Ga0207703_10003667 | 3300026035 | Bacteria | 12802 |
| 578 | Ga0207703_10740507 | 3300026035 | Bacteria | 936 |
| 579 | Ga0207703_10996945 | 3300026035 | Bacteria | 804 |
| 580 | Ga0207639_10103904 | 3300026041 | Bacteria | 2302 |
| 581 | Ga0207678_10003433 | 3300026067 | Bacteria | 14278 |
| 582 | Ga0207708_10064110 | 3300026075 | Bacteria | 2807 |
| 583 | Ga0207702_10256284 | 3300026078 | Bacteria | 1645 |
| 584 | Ga0207702_10515426 | 3300026078 | Bacteria | 1167 |
| 585 | Ga0207641_10097556 | 3300026088 | Bacteria | 2583 |
| 586 | Ga0207641_11220985 | 3300026088 | Unclassified | 752 |
| 587 | Ga0207648_10005881 | 3300026089 | Bacteria | 12274 |
| 588 | Ga0207648_10095028 | 3300026089 | Bacteria | 2607 |
| 589 | Ga0207648_10210856 | 3300026089 | Bacteria | 1724 |
| 590 | Ga0207648_10343891 | 3300026089 | Unclassified | 1344 |
| 591 | Ga0207676_10301446 | 3300026095 | Unclassified | 1463 |
| 592 | Ga0207676_10361470 | 3300026095 | Unclassified | 1345 |
| 593 | Ga0207675_100271294 | 3300026118 | Bacteria | 1646 |
| 594 | Ga0207675_100402868 | 3300026118 | Bacteria | 1348 |
| 595 | Ga0207683_10000956 | 3300026121 | Bacteria | 26510 |
| 596 | Ga0207683_10021156 | 3300026121 | Bacteria | 5567 |
| 597 | Ga0207683_10058985 | 3300026121 | Bacteria | 3370 |
| 598 | Ga0207683_10064527 | 3300026121 | Unclassified | 3227 |
| 599 | Ga0207683_10154283 | 3300026121 | Unclassified | 2074 |
| 600 | Ga0207683_10627132 | 3300026121 | Bacteria | 996 |
| 601 | Ga0207698_10497392 | 3300026142 | Bacteria | 1186 |
| 602 | Ga0209179_1059167 | 3300027512 | Unclassified | 830 |
| 603 | Ga0209998_10053772 | 3300027717 | Bacteria | 937 |
| 604 | Ga0209974_10006217 | 3300027876 | Bacteria | 4179 |
| 605 | Ga0268266_10000031 | 3300028379 | Bacteria | 406292 |
| 606 | Ga0268266_10004338 | 3300028379 | Bacteria | 13628 |
| 607 | Ga0268266_10007108 | 3300028379 | Bacteria | 10155 |
| 608 | Ga0268266_10194531 | 3300028379 | Unclassified | 1853 |
| 609 | Ga0268266_10304443 | 3300028379 | Bacteria | 1488 |
| 610 | Ga0268266_10324673 | 3300028379 | Bacteria | 1441 |
| 611 | Ga0268266_10353031 | 3300028379 | Bacteria | 1382 |
| 612 | Ga0268265_10026139 | 3300028380 | Bacteria | 4150 |
| 613 | Ga0268265_10222869 | 3300028380 | Unclassified | 1651 |
| 614 | Ga0268265_10361226 | 3300028380 | Bacteria | 1329 |
| 615 | Ga0268264_10025901 | 3300028381 | Unclassified | 4788 |
| 616 | Ga0268264_10101091 | 3300028381 | Bacteria | 2505 |
| 617 | Ga0268264_10475400 | 3300028381 | Bacteria | 1215 |
| 618 | Ga0316177_1042747 | 3300030731 | Bacteria | 843 |
| 619 | Ga0307405_10326327 | 3300031731 | Bacteria | 1174 |
| 620 | Ga0307413_10131017 | 3300031824 | Bacteria | 1716 |
| 621 | Ga0307409_100531863 | 3300031995 | Bacteria | 1150 |
| 622 | Ga0307416_100034273 | 3300032002 | Bacteria | 3861 |
| 623 | Ga0307414_10114151 | 3300032004 | Bacteria | 2063 |
| 624 | Ga0307415_101045744 | 3300032126 | Bacteria | 761 |
| 625 | Ga0373934_0263216 | 3300035086 | Unclassified | 714 |
| 626 | Ga0373944_0097695 | 3300035089 | Bacteria | 989 |
| 627 | Ga0373923_0153933 | 3300035111 | Bacteria | 1046 |
| 628 | Ga0373939_0069843 | 3300035114 | Unclassified | 1141 |
| 629 | Ga0373941_0094849 | 3300035115 | Bacteria | 1030 |
| 630 | Ga0373943_0076845 | 3300035170 | Unclassified | 1704 |
| 631 | Ga0373943_0123301 | 3300035170 | Bacteria | 1379 |
| 632 | Ga0373943_0235650 | 3300035170 | Bacteria | 1024 |
| 633 | Ga0373943_0278161 | 3300035170 | Unclassified | 946 |
| 634 | Ga0373946_0191322 | 3300035171 | Bacteria | 976 |
| 635 | Ga0373955_0190003 | 3300035172 | Unclassified | 1221 |
| 636 | Ga0373931_0052126 | 3300035691 | Bacteria | 2181 |
| 637 | Ga0373931_0366462 | 3300035691 | Unclassified | 905 |
| 638 | Ga0373935_0080670 | 3300035692 | Bacteria | 2114 |
| 639 | Ga0373935_0187848 | 3300035692 | Bacteria | 1422 |
| 640 | Ga0373935_0557542 | 3300035692 | Bacteria | 835 |
| 641 | Ga0373927_0061848 | 3300035695 | Bacteria | 2422 |
| 642 | Ga0373933_0189731 | 3300035724 | Bacteria | 1313 |
| 643 | Ga0373947_0083067 | 3300035725 | Unclassified | 1986 |
| 644 | Ga0373947_0086384 | 3300035725 | Bacteria | 1950 |
| 645 | Ga0373947_0127835 | 3300035725 | Bacteria | 1620 |
| 646 | Ga0373947_0130464 | 3300035725 | Bacteria | 1604 |
| 647 | Ga0373947_0304246 | 3300035725 | Bacteria | 1064 |
| 648 | Ga0373947_0414122 | 3300035725 | Bacteria | 910 |
| 649 | Ga0373937_0111985 | 3300036401 | Unclassified | 2539 |
| 650 | Ga0373925_0141207 | 3300037068 | Bacteria | 1885 |
| 651 | Ga0373925_0500198 | 3300037068 | Bacteria | 998 |
| 652 | Ga0373925_0780592 | 3300037068 | Bacteria | 788 |
| 653 | Ga0395900_0004035 | 3300037418 | Bacteria | 15667 |
| 654 | Ga0395900_0224499 | 3300037418 | Bacteria | 1892 |
| 655 | Ga0395900_0361843 | 3300037418 | Bacteria | 1422 |
| 656 | Ga0395898_0019143 | 3300037466 | Bacteria | 6970 |
| 657 | Ga0395905_0196138 | 3300037471 | Bacteria | 1893 |
| 658 | Ga0395905_0464077 | 3300037471 | Bacteria | 1165 |
| 659 | Ga0395901_0000998 | 3300038443 | Bacteria | 30593 |
| 660 | Ga0395901_0018822 | 3300038443 | Bacteria | 7059 |
| 661 | Ga0395901_0066015 | 3300038443 | Bacteria | 3769 |
| 662 | Ga0395901_0371114 | 3300038443 | Bacteria | 1474 |
| 663 | Ga0400483_012820 | 3300039062 | Bacteria | 1186 |
| 664 | Ga0400483_260540 | 3300039062 | Unclassified | 1372 |
| 665 | Ga0436363_0483572 | 3300039450 | Bacteria | 1787 |
| 666 | Ga0439465_0042900 | 3300041413 | Bacteria | 1467 |
| 667 | Ga0451577_0046326 | 3300042876 | Bacteria | 3891 |
| 668 | Ga0451577_0046605 | 3300042876 | Bacteria | 3878 |
| 669 | Ga0439440_0015709 | 3300042993 | Bacteria | 1649 |
| 670 | Ga0466965_0133134 | 3300044683 | Bacteria | 1290 |
| 671 | Ga0466963_0075392 | 3300044694 | Bacteria | 2276 |
| 672 | Ga0466963_0120377 | 3300044694 | Bacteria | 1806 |
| 673 | Ga0466964_0041029 | 3300044706 | Unclassified | 1870 |
| 674 | Ga0453684_0000737 | 3300044712 | Bacteria | 114674 |
| 675 | Ga0453684_0036025 | 3300044712 | Bacteria | 6826 |
| 676 | Ga0453684_0515898 | 3300044712 | Bacteria | 1321 |
| 677 | Ga0466971_0001103 | 3300044719 | Bacteria | 11208 |
| 678 | Ga0466968_0055095 | 3300044735 | Bacteria | 1706 |
| 679 | Ga0451576_0161799 | 3300045051 | Bacteria | 2336 |
| 680 | Ga0451576_0221092 | 3300045051 | Bacteria | 1977 |
| 681 | Ga0451576_0469499 | 3300045051 | Bacteria | 1321 |
| 682 | Ga0466967_0096957 | 3300045976 | Unclassified | 2691 |
| 683 | Ga0466967_0223318 | 3300045976 | Bacteria | 1791 |
| 684 | Ga0495592_0080290 | 3300046454 | Unclassified | 2360 |
| 685 | Ga0495603_0461067 | 3300046455 | Unclassified | 728 |
| 686 | Ga0495651_0270684 | 3300046462 | Bacteria | 1152 |
| 687 | Ga0495580_0001088 | 3300046472 | Bacteria | 23858 |
| 688 | Ga0495580_0300702 | 3300046472 | Bacteria | 1093 |
| 689 | Ga0495582_0000609 | 3300046473 | Bacteria | 19727 |
| 690 | Ga0495664_0347479 | 3300046477 | Unclassified | 893 |
| 691 | Ga0495584_0414512 | 3300046491 | Bacteria | 685 |
| 692 | Ga0495594_0000905 | 3300046499 | Bacteria | 15363 |
| 693 | Ga0495608_0217808 | 3300046511 | Bacteria | 1199 |
| 694 | Ga0495618_0108217 | 3300046514 | Unclassified | 1780 |
| 695 | Ga0495618_0183398 | 3300046514 | Bacteria | 1329 |
| 696 | Ga0495630_0142002 | 3300046517 | Unclassified | 1826 |
| 697 | Ga0495643_0000114 | 3300046522 | Bacteria | 131108 |
| 698 | Ga0495652_0100157 | 3300046529 | Unclassified | 2351 |
| 699 | Ga0495652_0137704 | 3300046529 | Unclassified | 1924 |
| 700 | Ga0495665_0293181 | 3300046531 | Bacteria | 834 |
| 701 | Ga0495640_0114751 | 3300046533 | Unclassified | 1756 |
| 702 | Ga0495586_0147613 | 3300046535 | Bacteria | 1322 |
| 703 | Ga0495587_0075006 | 3300046536 | Unclassified | 1964 |
| 704 | Ga0495587_0265497 | 3300046536 | Bacteria | 964 |
| 705 | Ga0495587_0329282 | 3300046536 | Unclassified | 853 |
| 706 | Ga0495598_0253384 | 3300046537 | Bacteria | 653 |
| 707 | Ga0495645_0034806 | 3300046543 | Bacteria | 3672 |
| 708 | Ga0495645_0252616 | 3300046543 | Bacteria | 1171 |
| 709 | Ga0495667_0050374 | 3300046559 | Unclassified | 2750 |
| 710 | Ga0495668_0533150 | 3300046616 | Bacteria | 648 |
| 711 | Ga0495634_0218037 | 3300046642 | Bacteria | 1179 |
| 712 | Ga0495635_0076852 | 3300046663 | Unclassified | 2288 |
| 713 | Ga0495599_0009817 | 3300046678 | Bacteria | 5858 |
| 714 | Ga0495623_0243615 | 3300046679 | Unclassified | 1014 |
| 715 | Ga0495646_0200965 | 3300046680 | Bacteria | 1085 |
| 716 | Ga0495647_0065125 | 3300046681 | Unclassified | 1447 |
| 717 | Ga0495658_0021507 | 3300046683 | Bacteria | 3401 |
| 718 | Ga0495669_0071474 | 3300046684 | Bacteria | 1582 |
| 719 | Ga0495669_0079928 | 3300046684 | Bacteria | 1500 |
| 720 | Ga0495624_0121367 | 3300046690 | Unclassified | 1605 |
| 721 | Ga0495581_0102181 | 3300047315 | Bacteria | 1666 |
| 722 | Ga0495604_0086851 | 3300047317 | Unclassified | 2331 |
| 723 | Ga0495604_0450486 | 3300047317 | Bacteria | 841 |
| 724 | Ga0495674_0170177 | 3300047319 | Unclassified | 1818 |
| 725 | Ga0495674_0577336 | 3300047319 | Bacteria | 893 |
| 726 | Ga0495675_0116630 | 3300047444 | Unclassified | 1665 |
| 727 | Ga0495675_0135444 | 3300047444 | Bacteria | 1529 |
| 728 | Ga0495675_0209418 | 3300047444 | Bacteria | 1184 |
| 729 | Ga0495684_0026773 | 3300047471 | Bacteria | 4431 |
| 730 | Ga0495684_0178662 | 3300047471 | Unclassified | 1574 |
| 731 | Ga0495602_0136110 | 3300048088 | Unclassified | 1951 |
| 732 | Ga0496100_0002862 | 3300048903 | Bacteria | 8839 |
| 733 | Ga0496100_0761353 | 3300048903 | Unclassified | 758 |
| 734 | Ga0496101_0053961 | 3300048904 | Bacteria | 2901 |
| 735 | Ga0496101_0607484 | 3300048904 | Bacteria | 865 |
| 736 | Ga0496102_0016965 | 3300048905 | Bacteria | 6372 |
| 737 | Ga0496102_0099463 | 3300048905 | Unclassified | 2700 |
| 738 | Ga0496102_0228962 | 3300048905 | Bacteria | 1752 |
| 739 | Ga0496102_1206721 | 3300048905 | Bacteria | 676 |
| 740 | Ga0496103_0021096 | 3300048906 | Bacteria | 3919 |
| 741 | Ga0496104_0017668 | 3300048907 | Bacteria | 6501 |
| 742 | Ga0496104_0069145 | 3300048907 | Bacteria | 3356 |
| 743 | Ga0496104_0099240 | 3300048907 | Unclassified | 2788 |
| 744 | Ga0496105_0067713 | 3300048908 | Bacteria | 2948 |
| 745 | Ga0496105_0117254 | 3300048908 | Unclassified | 2196 |
| 746 | Ga0496105_0357670 | 3300048908 | Bacteria | 1165 |
| 747 | Ga0496105_0629537 | 3300048908 | Unclassified | 830 |
| 748 | Ga0496106_0057256 | 3300048909 | Bacteria | 2947 |
| 749 | Ga0496107_0010608 | 3300048910 | Bacteria | 6405 |
| 750 | Ga0496107_0100637 | 3300048910 | Unclassified | 2119 |
| 751 | Ga0496107_0375550 | 3300048910 | Bacteria | 1057 |
| 752 | Ga0496107_0510062 | 3300048910 | Unclassified | 892 |
| 753 | Ga0496108_0140860 | 3300048911 | Unclassified | 2078 |
| 754 | Ga0496109_0061407 | 3300048912 | Bacteria | 3436 |
| 755 | Ga0496109_0929166 | 3300048912 | Unclassified | 808 |
| 756 | Ga0496110_0047306 | 3300048913 | Bacteria | 3766 |
| 757 | Ga0496110_0262184 | 3300048913 | Bacteria | 1573 |
| 758 | Ga0496110_0522475 | 3300048913 | Unclassified | 1080 |
| 759 | Ga0496111_0152131 | 3300048914 | Bacteria | 1716 |
| 760 | Ga0496112_0042820 | 3300048915 | Unclassified | 4431 |
| 761 | Ga0496112_0090753 | 3300048915 | Bacteria | 3024 |
| 762 | Ga0496112_0172086 | 3300048915 | Bacteria | 2131 |
| 763 | Ga0496112_0255242 | 3300048915 | Bacteria | 1704 |
| 764 | Ga0496112_0351301 | 3300048915 | Unclassified | 1417 |
| 765 | Ga0496112_0355012 | 3300048915 | Unclassified | 1408 |
| 766 | Ga0496112_0381012 | 3300048915 | Bacteria | 1351 |
| 767 | Ga0496112_0437944 | 3300048915 | Unclassified | 1245 |
| 768 | Ga0496113_0229935 | 3300048916 | Bacteria | 1479 |
| 769 | Ga0496113_0552820 | 3300048916 | Unclassified | 923 |
| 770 | Ga0496114_0018483 | 3300048917 | Bacteria | 5637 |
| 771 | Ga0496114_0019073 | 3300048917 | Bacteria | 5558 |
| 772 | Ga0496114_0109958 | 3300048917 | Unclassified | 2360 |
| 773 | Ga0496114_0295367 | 3300048917 | Bacteria | 1430 |
| 774 | Ga0496115_0004087 | 3300048918 | Bacteria | 10544 |
| 775 | Ga0496115_0005586 | 3300048918 | Bacteria | 9152 |
| 776 | Ga0496115_0083164 | 3300048918 | Unclassified | 2609 |
| 777 | Ga0496115_0200715 | 3300048918 | Bacteria | 1648 |
| 778 | Ga0496115_0255583 | 3300048918 | Bacteria | 1442 |
| 779 | Ga0496115_0327778 | 3300048918 | Bacteria | 1251 |
| 780 | Ga0496115_0782753 | 3300048918 | Bacteria | 744 |
| 781 | Ga0501031_0024640 | 3300049568 | Bacteria | 3922 |
| 782 | Ga0501032_0308430 | 3300049569 | Unclassified | 1022 |
| 783 | Ga0501033_0000227 | 3300049570 | Bacteria | 54233 |
| 784 | Ga0501036_0059603 | 3300049572 | Bacteria | 3234 |
| 785 | Ga0501037_0000082 | 3300049573 | Bacteria | 86538 |
| 786 | Ga0501038_0003342 | 3300049574 | Bacteria | 14958 |
| 787 | Ga0501039_0001111 | 3300049575 | Bacteria | 19793 |
| 788 | Ga0501043_0000170 | 3300049579 | Bacteria | 58695 |
| 789 | Ga0501043_0008673 | 3300049579 | Bacteria | 8003 |
| 790 | Ga0501047_0032352 | 3300049581 | Bacteria | 5048 |
| 791 | Ga0501070_0137289 | 3300049586 | Bacteria | 2019 |
| 792 | Ga0501071_0029657 | 3300049587 | Bacteria | 3863 |
| 793 | Ga0501035_0000002 | 3300049822 | Bacteria | 585447 |
| 794 | Ga0501044_0002437 | 3300049823 | Bacteria | 21218 |
| 795 | nmdc:mga05p37_1728_c1 | 3300050507 | Bacteria | 25493 |
| 796 | nmdc:mga05p37_222672_c1 | 3300050507 | Bacteria | 2276 |
| 797 | nmdc:mga08y16_177878_c1 | 3300050511 | Bacteria | 2209 |
| 798 | nmdc:mga08y16_363195_c1 | 3300050511 | Bacteria | 1486 |
| 799 | nmdc:mga0n895_865536_c1 | 3300050512 | Bacteria | 891 |
| 800 | nmdc:mga0rr50_1046161_c1 | 3300050513 | Bacteria | 695 |
| 801 | nmdc:mga0rr50_191170_c1 | 3300050513 | Unclassified | 1677 |
| 802 | nmdc:mga08x19_6381_c1 | 3300050514 | Bacteria | 6980 |
| 803 | nmdc:mga0a205_309339_c1 | 3300050515 | Unclassified | 1452 |
| 804 | nmdc:mga0a205_671309_c1 | 3300050515 | Unclassified | 887 |
| 805 | Ga0495601_0007125 | 3300053077 | Bacteria | 6552 |
| 806 | Ga0495601_0091758 | 3300053077 | Unclassified | 1956 |
| 807 | Ga0495612_0039666 | 3300053078 | Bacteria | 1916 |
| 808 | Ga0500555_000016 | 3300053103 | Bacteria | 203144 |
| 809 | Ga0500616_0000988 | 3300053153 | Bacteria | 30726 |
| 810 | Ga0500616_0025273 | 3300053153 | Bacteria | 3295 |
| 811 | Ga0466962_0000080 | 3300061719 | Bacteria | 38429 |
| 812 | Ga0373933_0224430 | |||
| 813 | SwRhRL2b_contig_1925602 | |||
| 814 | CNXas_1000032 | |||
| 815 | JGI24746J21847_1004796 | |||
| 816 | JGI24737J22298_10031574 | |||
| 817 | JGI24737J22298_10112436 | |||
| 818 | JGI24743J22301_10050390 | |||
| 819 | JGI24035J26624_1001767 | |||
| 820 | JGI24035J26624_1005034 | |||
| 821 | JGI25406J46586_10000067 | |||
| 822 | JGI25405J52794_10000545 | |||
| 823 | Ga0065704_10002125 | |||
| 824 | Ga0065704_10010972 | |||
| 825 | Ga0065704_10100547 | |||
| 826 | Ga0065704_10117366 | |||
| 827 | Ga0065704_10127098 | |||
| 828 | Ga0065712_10116444 | |||
| 829 | Ga0065712_10145340 | |||
| 830 | Ga0065712_10412688 | |||
| 831 | Ga0065715_10005105 | |||
| 832 | Ga0065715_10021659 | |||
| 833 | Ga0065715_10100199 | |||
| 834 | Ga0065715_10263650 | |||
| 835 | Ga0065715_10323647 | |||
| 836 | Ga0065715_10329070 | |||
| 837 | Ga0065707_10004715 | |||
| 838 | Ga0065707_10037229 | |||
| 839 | Ga0065707_10170990 | |||
| 840 | Ga0065707_10246755 | |||
| 841 | Ga0070676_10003991 | |||
| 842 | Ga0070676_10060105 | |||
| 843 | Ga0070676_10125997 | |||
| 844 | Ga0070676_10240657 | |||
| 845 | Ga0070676_10246248 | |||
| 846 | Ga0070676_10516783 | |||
| 847 | Ga0070683_100042548 | |||
| 848 | Ga0070683_100094596 | |||
| 849 | Ga0070683_100895519 | |||
| 850 | Ga0070690_100062396 | |||
| 851 | Ga0070690_100090341 | |||
| 852 | Ga0070690_100103601 | |||
| 853 | Ga0070690_100223846 | |||
| 854 | Ga0070690_100260899 | |||
| 855 | Ga0070670_100002690 | |||
| 856 | Ga0070677_10014707 | |||
| 857 | Ga0068869_100543509 | |||
| 858 | Ga0070666_10002044 | |||
| 859 | Ga0070666_10148094 | |||
| 860 | Ga0070666_10185876 | |||
| 861 | Ga0068868_100047031 | |||
| 862 | Ga0068868_100128866 | |||
| 863 | Ga0070660_100244259 | |||
| 864 | Ga0070660_100741479 | |||
| 865 | Ga0070689_100005579 | |||
| 866 | Ga0070689_100011679 | |||
| 867 | Ga0070689_100101999 | |||
| 868 | Ga0070689_100985453 | |||
| 869 | Ga0070689_101044459 | |||
| 870 | Ga0070687_100000532 | |||
| 871 | Ga0070687_100297117 | |||
| 872 | Ga0070661_100036936 | |||
| 873 | Ga0070661_100213856 | |||
| 874 | Ga0070661_100256672 | |||
| 875 | Ga0070692_10189823 | |||
| 876 | Ga0070668_100003567 | |||
| 877 | Ga0070668_100005061 | |||
| 878 | Ga0070668_100014650 | |||
| 879 | Ga0070668_100040112 | |||
| 880 | Ga0070668_100286034 | |||
| 881 | Ga0070668_100670126 | |||
| 882 | Ga0070669_100012470 | |||
| 883 | Ga0070669_100020039 | |||
| 884 | Ga0070669_100027129 | |||
| 885 | Ga0070669_100739206 | |||
| 886 | Ga0070675_100000800 | |||
| 887 | Ga0070675_100003333 | |||
| 888 | Ga0070675_100018699 | |||
| 889 | Ga0070675_100059661 | |||
| 890 | Ga0070675_100059971 | |||
| 891 | Ga0070675_100128420 | |||
| 892 | Ga0070675_100158243 | |||
| 893 | Ga0070675_100297309 | |||
| 894 | Ga0070671_100003803 | |||
| 895 | Ga0070671_100010844 | |||
| 896 | Ga0070671_100033560 | |||
| 897 | Ga0070671_100204669 | |||
| 898 | Ga0070671_100350480 | |||
| 899 | Ga0070671_100431036 | |||
| 900 | Ga0070674_100007782 | |||
| 901 | Ga0070674_100043245 | |||
| 902 | Ga0070673_100004127 | |||
| 903 | Ga0070673_100007695 | |||
| 904 | Ga0070673_100021847 | |||
| 905 | Ga0070673_100025303 | |||
| 906 | Ga0070673_100097377 | |||
| 907 | Ga0070673_100208643 | |||
| 908 | Ga0070688_100000621 | |||
| 909 | Ga0070688_100020654 | |||
| 910 | Ga0070688_100046314 | |||
| 911 | Ga0070688_100525831 | |||
| 912 | Ga0070688_100534370 | |||
| 913 | Ga0070659_100016047 | |||
| 914 | Ga0070667_100009056 | |||
| 915 | Ga0070667_100022604 | |||
| 916 | Ga0070667_100034224 | |||
| 917 | Ga0070667_100228150 | |||
| 918 | Ga0070667_100240290 | |||
| 919 | Ga0070667_100272573 | |||
| 920 | Ga0070703_10006701 | |||
| 921 | Ga0070703_10061495 | |||
| 922 | Ga0070709_10040051 | |||
| 923 | Ga0070714_100058473 | |||
| 924 | Ga0070714_100141051 | |||
| 925 | Ga0070714_100587793 | |||
| 926 | Ga0070714_100798682 | |||
| 927 | Ga0070713_100192867 | |||
| 928 | Ga0070710_10630516 | |||
| 929 | Ga0070701_10026804 | |||
| 930 | Ga0070701_10062971 | |||
| 931 | Ga0070711_100081920 | |||
| 932 | Ga0070705_100244569 | |||
| 933 | Ga0070705_100443943 | |||
| 934 | Ga0070700_100029511 | |||
| 935 | Ga0070694_100006500 | |||
| 936 | Ga0070694_100034600 | |||
| 937 | Ga0070708_100009081 | |||
| 938 | Ga0070708_100013237 | |||
| 939 | Ga0070708_100050292 | |||
| 940 | Ga0070708_100059790 | |||
| 941 | Ga0070708_100092401 | |||
| 942 | Ga0070708_100181420 | |||
| 943 | Ga0070708_100223150 | |||
| 944 | Ga0070708_100312414 | |||
| 945 | Ga0070708_100736785 | |||
| 946 | Ga0070708_100855034 | |||
| 947 | Ga0070708_100893936 | |||
| 948 | Ga0070708_101270254 | |||
| 949 | Ga0070663_100132282 | |||
| 950 | Ga0070678_100002933 | |||
| 951 | Ga0070678_100047630 | |||
| 952 | Ga0070678_100343406 | |||
| 953 | Ga0070662_100001248 | |||
| 954 | Ga0070662_100190260 | |||
| 955 | Ga0070662_100667563 | |||
| 956 | Ga0070681_10025041 | |||
| 957 | Ga0068867_100038574 | |||
| 958 | Ga0068867_100045690 | |||
| 959 | Ga0068867_100154449 | |||
| 960 | Ga0070685_10022977 | |||
| 961 | Ga0070685_10076742 | |||
| 962 | Ga0070706_100000227 | |||
| 963 | Ga0070706_100001536 | |||
| 964 | Ga0070706_100006339 | |||
| 965 | Ga0070706_100012642 | |||
| 966 | Ga0070706_100033974 | |||
| 967 | Ga0070706_100080958 | |||
| 968 | Ga0070706_100094407 | |||
| 969 | Ga0070706_100242806 | |||
| 970 | Ga0070706_100265682 | |||
| 971 | Ga0070706_100316879 | |||
| 972 | Ga0070706_100355014 | |||
| 973 | Ga0070706_100359938 | |||
| 974 | Ga0070706_100619038 | |||
| 975 | Ga0070707_100049683 | |||
| 976 | Ga0070707_100052130 | |||
| 977 | Ga0070707_100125418 | |||
| 978 | Ga0070707_100132686 | |||
| 979 | Ga0070707_100154274 | |||
| 980 | Ga0070707_100234337 | |||
| 981 | Ga0070707_100342903 | |||
| 982 | Ga0070707_100424734 | |||
| 983 | Ga0070707_100501440 | |||
| 984 | Ga0070707_100647816 | |||
| 985 | Ga0070707_100773660 | |||
| 986 | Ga0070707_100817351 | |||
| 987 | Ga0070698_100011183 | |||
| 988 | Ga0070698_100012644 | |||
| 989 | Ga0070698_100014761 | |||
| 990 | Ga0070699_100057478 | |||
| 991 | Ga0070699_100068033 | |||
| 992 | Ga0070699_100083652 | |||
| 993 | Ga0070699_100100250 | |||
| 994 | Ga0070699_100151243 | |||
| 995 | Ga0070699_100187658 | |||
| 996 | Ga0070699_100621590 | |||
| 997 | Ga0070679_100037540 | |||
| 998 | Ga0070684_100000230 | |||
| 999 | Ga0070684_100011931 | |||
| 1000 | Ga0070684_100073522 | |||
| 1001 | Ga0070684_100773643 | |||
| 1002 | Ga0070697_100000640 | |||
| 1003 | Ga0070697_100001810 | |||
| 1004 | Ga0070697_100012250 | |||
| 1005 | Ga0070697_100014557 | |||
| 1006 | Ga0070697_100019134 | |||
| 1007 | Ga0070697_100019752 | |||
| 1008 | Ga0070697_100039216 | |||
| 1009 | Ga0070697_100088907 | |||
| 1010 | Ga0070697_100091775 | |||
| 1011 | Ga0070697_100102487 | |||
| 1012 | Ga0070697_100350587 | |||
| 1013 | Ga0070697_100405974 | |||
| 1014 | Ga0070672_100006079 | |||
| 1015 | Ga0070672_100023736 | |||
| 1016 | Ga0070672_100025838 | |||
| 1017 | Ga0070672_100228567 | |||
| 1018 | Ga0070672_100273200 | |||
| 1019 | Ga0070672_100299164 | |||
| 1020 | Ga0070686_100433967 | |||
| 1021 | Ga0070695_100359243 | |||
| 1022 | Ga0070696_100056918 | |||
| 1023 | Ga0070693_100054334 | |||
| 1024 | Ga0070665_100042759 | |||
| 1025 | Ga0070665_100051907 | |||
| 1026 | Ga0070665_100054112 | |||
| 1027 | Ga0070665_100076204 | |||
| 1028 | Ga0070665_100177204 | |||
| 1029 | Ga0070665_100183921 | |||
| 1030 | Ga0070665_100315931 | |||
| 1031 | Ga0070665_100824782 | |||
| 1032 | Ga0070704_100001031 | |||
| 1033 | Ga0070704_100440432 | |||
| 1034 | Ga0068855_100515826 | |||
| 1035 | Ga0070664_100098766 | |||
| 1036 | Ga0070664_100202370 | |||
| 1037 | Ga0070664_100348878 | |||
| 1038 | Ga0070664_100726141 | |||
| 1039 | Ga0068856_100016596 | |||
| 1040 | Ga0070702_100048251 | |||
| 1041 | Ga0070702_100675412 | |||
| 1042 | Ga0068852_100565794 | |||
| 1043 | Ga0068864_100081207 | |||
| 1044 | Ga0068866_10027744 | |||
| 1045 | Ga0068866_10451087 | |||
| 1046 | Ga0068863_100015159 | |||
| 1047 | Ga0068858_100001678 | |||
| 1048 | Ga0068858_100002353 | |||
| 1049 | Ga0068858_100549661 | |||
| 1050 | Ga0068860_100114018 | |||
| 1051 | Ga0068860_100116100 | |||
| 1052 | Ga0068860_100214393 | |||
| 1053 | Ga0068860_100395673 | |||
| 1054 | Ga0068862_100008618 | |||
| 1055 | Ga0068862_100243203 | |||
| 1056 | Ga0081455_10001703 | |||
| 1057 | Ga0081455_10001745 | |||
| 1058 | Ga0081455_10010995 | |||
| 1059 | Ga0081455_10074912 | |||
| 1060 | Ga0081455_10118118 | |||
| 1061 | Ga0081455_10177519 | |||
| 1062 | Ga0081455_10459080 | |||
| 1063 | Ga0081540_1000437 | |||
| 1064 | Ga0081540_1007907 | |||
| 1065 | Ga0081540_1062621 | |||
| 1066 | Ga0081539_10000287 | |||
| 1067 | Ga0081539_10000621 | |||
| 1068 | Ga0081539_10025018 | |||
| 1069 | Ga0081539_10051779 | |||
| 1070 | Ga0070717_10005952 | |||
| 1071 | Ga0070717_10024471 | |||
| 1072 | Ga0070717_10048500 | |||
| 1073 | Ga0070717_10055646 | |||
| 1074 | Ga0070717_10057975 | |||
| 1075 | Ga0070717_10104447 | |||
| 1076 | Ga0070717_10112906 | |||
| 1077 | Ga0070717_10234777 | |||
| 1078 | Ga0070717_10270190 | |||
| 1079 | Ga0070717_10414115 | |||
| 1080 | Ga0070717_10682713 | |||
| 1081 | Ga0070715_10336635 | |||
| 1082 | Ga0070716_100112460 | |||
| 1083 | Ga0070716_100120800 | |||
| 1084 | Ga0070716_100251424 | |||
| 1085 | Ga0070712_100032172 | |||
| 1086 | Ga0070712_100056078 | |||
| 1087 | Ga0070712_100075678 | |||
| 1088 | Ga0070712_100078432 | |||
| 1089 | Ga0070712_100080217 | |||
| 1090 | Ga0070712_100117694 | |||
| 1091 | Ga0070712_100198204 | |||
| 1092 | Ga0070712_100375735 | |||
| 1093 | Ga0070712_100636899 | |||
| 1094 | Ga0070712_100845427 | |||
| 1095 | Ga0097621_100017406 | |||
| 1096 | Ga0097621_100088344 | |||
| 1097 | Ga0097621_100130785 | |||
| 1098 | Ga0068871_100010934 | |||
| 1099 | Ga0068871_100050694 | |||
| 1100 | Ga0068871_100162593 | |||
| 1101 | Ga0068871_100435588 | |||
| 1102 | Ga0068871_100494899 | |||
| 1103 | Ga0068871_100675311 | |||
| 1104 | Ga0075433_10184947 | |||
| 1105 | Ga0075433_10237240 | |||
| 1106 | Ga0075433_10313871 | |||
| 1107 | Ga0075434_100476365 | |||
| 1108 | Ga0075434_101071184 | |||
| 1109 | Ga0068865_100168209 | |||
| 1110 | Ga0075436_100010844 | |||
| 1111 | Ga0075436_100129430 | |||
| 1112 | Ga0075435_100272786 | |||
| 1113 | Ga0075435_100327447 | |||
| 1114 | Ga0099795_10089245 | |||
| 1115 | Ga0099795_10340755 | |||
| 1116 | Ga0105240_10029117 | |||
| 1117 | Ga0105240_10409715 | |||
| 1118 | Ga0111539_10201444 | |||
| 1119 | Ga0105245_10010327 | |||
| 1120 | Ga0105247_10112987 | |||
| 1121 | Ga0114129_10004895 | |||
| 1122 | Ga0114129_10280608 | |||
| 1123 | Ga0114129_10537557 | |||
| 1124 | Ga0105243_10342715 | |||
| 1125 | Ga0105242_10008800 | |||
| 1126 | Ga0105242_10171629 | |||
| 1127 | Ga0105242_10383673 | |||
| 1128 | Ga0105248_10085246 | |||
| 1129 | Ga0105248_11057800 | |||
| 1130 | Ga0105237_10020734 | |||
| 1131 | Ga0105237_10241007 | |||
| 1132 | Ga0105237_10968854 | |||
| 1133 | Ga0105249_10003062 | |||
| 1134 | Ga0105249_10034778 | |||
| 1135 | Ga0105249_10060224 | |||
| 1136 | Ga0099796_10146036 | |||
| 1137 | Ga0105239_10012805 | |||
| 1138 | Ga0105239_10035273 | |||
| 1139 | Ga0105239_10375110 | |||
| 1140 | Ga0105239_10516453 | |||
| 1141 | Ga0105239_10705775 | |||
| 1142 | Ga0105239_10734157 | |||
| 1143 | Ga0157346_1010875 | |||
| 1144 | Ga0157347_1025576 | |||
| 1145 | Ga0157371_10213717 | |||
| 1146 | Ga0157371_10453814 | |||
| 1147 | Ga0157370_10185263 | |||
| 1148 | Ga0157374_10000068 | |||
| 1149 | Ga0157374_10004587 | |||
| 1150 | Ga0157374_10005441 | |||
| 1151 | Ga0157374_10015983 | |||
| 1152 | Ga0157374_10040135 | |||
| 1153 | Ga0157374_10058052 | |||
| 1154 | Ga0157374_10086120 | |||
| 1155 | Ga0157374_10195063 | |||
| 1156 | Ga0157374_10255521 | |||
| 1157 | Ga0157374_10274258 | |||
| 1158 | Ga0157374_10429921 | |||
| 1159 | Ga0157378_10005429 | |||
| 1160 | Ga0157378_10016462 | |||
| 1161 | Ga0157378_10033584 | |||
| 1162 | Ga0157378_10036119 | |||
| 1163 | Ga0157378_10041698 | |||
| 1164 | Ga0157378_10044064 | |||
| 1165 | Ga0157378_10157817 | |||
| 1166 | Ga0157378_10165237 | |||
| 1167 | Ga0157378_10175101 | |||
| 1168 | Ga0157378_10202204 | |||
| 1169 | Ga0157378_10314914 | |||
| 1170 | Ga0157378_10357537 | |||
| 1171 | Ga0157378_10799979 | |||
| 1172 | Ga0163162_10002701 | |||
| 1173 | Ga0163162_10007809 | |||
| 1174 | Ga0163162_10011424 | |||
| 1175 | Ga0163162_10023089 | |||
| 1176 | Ga0163162_10076339 | |||
| 1177 | Ga0163162_10096704 | |||
| 1178 | Ga0163162_10096814 | |||
| 1179 | Ga0163162_10274383 | |||
| 1180 | Ga0157372_10036367 | |||
| 1181 | Ga0157372_10233647 | |||
| 1182 | Ga0157372_10476927 | |||
| 1183 | Ga0157375_10002103 | |||
| 1184 | Ga0157375_10002145 | |||
| 1185 | Ga0157375_10007613 | |||
| 1186 | Ga0157375_10007724 | |||
| 1187 | Ga0157375_10009633 | |||
| 1188 | Ga0157375_10065220 | |||
| 1189 | Ga0157375_10074631 | |||
| 1190 | Ga0157375_10091057 | |||
| 1191 | Ga0157375_10326004 | |||
| 1192 | Ga0157375_10429539 | |||
| 1193 | Ga0163163_10178409 | |||
| 1194 | Ga0163163_10262610 | |||
| 1195 | Ga0163163_10639788 | |||
| 1196 | Ga0157380_11681875 | |||
| 1197 | Ga0182008_10022323 | |||
| 1198 | Ga0157377_10118189 | |||
| 1199 | Ga0157377_10168089 | |||
| 1200 | Ga0157379_10368660 | |||
| 1201 | Ga0157379_10498264 | |||
| 1202 | Ga0157376_10001598 | |||
| 1203 | Ga0157376_10003774 | |||
| 1204 | Ga0157376_10077971 | |||
| 1205 | Ga0157376_10130270 | |||
| 1206 | Ga0157376_10218726 | |||
| 1207 | Ga0157376_10420639 | |||
| 1208 | Ga0157376_10508480 | |||
| 1209 | Ga0182006_1131722 | |||
| 1210 | Ga0163161_10003776 | |||
| 1211 | Ga0163161_10013881 | |||
| 1212 | Ga0213874_10062731 | |||
| 1213 | Ga0207666_1000587 | |||
| 1214 | Ga0207673_1001785 | |||
| 1215 | Ga0207673_1006360 | |||
| 1216 | Ga0207673_1006829 | |||
| 1217 | Ga0207697_10000281 | |||
| 1218 | Ga0207697_10000496 | |||
| 1219 | Ga0207697_10000868 | |||
| 1220 | Ga0207697_10000876 | |||
| 1221 | Ga0207697_10001461 | |||
| 1222 | Ga0207697_10007026 | |||
| 1223 | Ga0207697_10016269 | |||
| 1224 | Ga0207697_10026017 | |||
| 1225 | Ga0207697_10048027 | |||
| 1226 | Ga0207653_10009899 | |||
| 1227 | Ga0207682_10009209 | |||
| 1228 | Ga0207682_10140594 | |||
| 1229 | Ga0207692_10064018 | |||
| 1230 | Ga0207692_10089602 | |||
| 1231 | Ga0207642_10285994 | |||
| 1232 | Ga0207688_10003305 | |||
| 1233 | Ga0207688_10185043 | |||
| 1234 | Ga0207680_10001473 | |||
| 1235 | Ga0207680_10096509 | |||
| 1236 | Ga0207680_10415348 | |||
| 1237 | Ga0207647_10034060 | |||
| 1238 | Ga0207685_10109286 | |||
| 1239 | Ga0207699_10513232 | |||
| 1240 | Ga0207645_10004008 | |||
| 1241 | Ga0207645_10005947 | |||
| 1242 | Ga0207645_10026736 | |||
| 1243 | Ga0207645_10063650 | |||
| 1244 | Ga0207645_10131366 | |||
| 1245 | Ga0207645_10215034 | |||
| 1246 | Ga0207684_10000205 | |||
| 1247 | Ga0207684_10002005 | |||
| 1248 | Ga0207684_10003655 | |||
| 1249 | Ga0207684_10028263 | |||
| 1250 | Ga0207684_10032430 | |||
| 1251 | Ga0207684_10032588 | |||
| 1252 | Ga0207684_10084831 | |||
| 1253 | Ga0207684_10103635 | |||
| 1254 | Ga0207684_10214066 | |||
| 1255 | Ga0207684_10308167 | |||
| 1256 | Ga0207684_10347487 | |||
| 1257 | Ga0207684_10481335 | |||
| 1258 | Ga0207684_10494042 | |||
| 1259 | Ga0207684_10617966 | |||
| 1260 | Ga0207684_10626171 | |||
| 1261 | Ga0207707_10079230 | |||
| 1262 | Ga0207695_10009328 | |||
| 1263 | Ga0207695_10062816 | |||
| 1264 | Ga0207671_10011128 | |||
| 1265 | Ga0207693_10006434 | |||
| 1266 | Ga0207693_10008083 | |||
| 1267 | Ga0207693_10011275 | |||
| 1268 | Ga0207693_10021447 | |||
| 1269 | Ga0207693_10140540 | |||
| 1270 | Ga0207693_10205768 | |||
| 1271 | Ga0207693_10669106 | |||
| 1272 | Ga0207663_10394868 | |||
| 1273 | Ga0207660_10506889 | |||
| 1274 | Ga0207662_10000089 | |||
| 1275 | Ga0207662_10133324 | |||
| 1276 | Ga0207657_10075271 | |||
| 1277 | Ga0207649_10112684 | |||
| 1278 | Ga0207649_10189288 | |||
| 1279 | Ga0207646_10000925 | |||
| 1280 | Ga0207646_10018784 | |||
| 1281 | Ga0207646_10018999 | |||
| 1282 | Ga0207646_10049477 | |||
| 1283 | Ga0207646_10088317 | |||
| 1284 | Ga0207646_10105923 | |||
| 1285 | Ga0207646_10264346 | |||
| 1286 | Ga0207646_10477104 | |||
| 1287 | Ga0207646_10549703 | |||
| 1288 | Ga0207681_10006654 | |||
| 1289 | Ga0207681_10046696 | |||
| 1290 | Ga0207681_10159312 | |||
| 1291 | Ga0207681_10163087 | |||
| 1292 | Ga0207681_10255155 | |||
| 1293 | Ga0207681_10476512 | |||
| 1294 | Ga0207650_10071088 | |||
| 1295 | Ga0207650_10075546 | |||
| 1296 | Ga0207659_10002784 | |||
| 1297 | Ga0207659_10005479 | |||
| 1298 | Ga0207659_10007171 | |||
| 1299 | Ga0207659_10048418 | |||
| 1300 | Ga0207659_10072306 | |||
| 1301 | Ga0207659_10074765 | |||
| 1302 | Ga0207659_10098027 | |||
| 1303 | Ga0207659_10107845 | |||
| 1304 | Ga0207659_10173548 | |||
| 1305 | Ga0207659_10175712 | |||
| 1306 | Ga0207659_10393346 | |||
| 1307 | Ga0207687_10205483 | |||
| 1308 | Ga0207687_10861319 | |||
| 1309 | Ga0207700_10072142 | |||
| 1310 | Ga0207700_10158445 | |||
| 1311 | Ga0207700_10363522 | |||
| 1312 | Ga0207664_10037918 | |||
| 1313 | Ga0207664_10193629 | |||
| 1314 | Ga0207664_10533484 | |||
| 1315 | Ga0207644_10008161 | |||
| 1316 | Ga0207644_10109485 | |||
| 1317 | Ga0207644_10259397 | |||
| 1318 | Ga0207644_10262980 | |||
| 1319 | Ga0207690_10002749 | |||
| 1320 | Ga0207690_10023034 | |||
| 1321 | Ga0207690_10169693 | |||
| 1322 | Ga0207690_10403814 | |||
| 1323 | Ga0207706_10000188 | |||
| 1324 | Ga0207706_10016526 | |||
| 1325 | Ga0207706_10045646 | |||
| 1326 | Ga0207706_10076858 | |||
| 1327 | Ga0207706_10138950 | |||
| 1328 | Ga0207706_10172663 | |||
| 1329 | Ga0207706_10459746 | |||
| 1330 | Ga0207686_10005884 | |||
| 1331 | Ga0207686_10218869 | |||
| 1332 | Ga0207686_10294801 | |||
| 1333 | Ga0207709_10303355 | |||
| 1334 | Ga0207670_10019155 | |||
| 1335 | Ga0207670_10022746 | |||
| 1336 | Ga0207670_10397484 | |||
| 1337 | Ga0207669_10006416 | |||
| 1338 | Ga0207669_10013117 | |||
| 1339 | Ga0207669_10260257 | |||
| 1340 | Ga0207704_10119008 | |||
| 1341 | Ga0207704_10627582 | |||
| 1342 | Ga0207665_10058162 | |||
| 1343 | Ga0207665_10060956 | |||
| 1344 | Ga0207665_10093409 | |||
| 1345 | Ga0207665_10108711 | |||
| 1346 | Ga0207665_10305575 | |||
| 1347 | Ga0207665_10378695 | |||
| 1348 | Ga0207691_10000701 | |||
| 1349 | Ga0207691_10015640 | |||
| 1350 | Ga0207691_10051282 | |||
| 1351 | Ga0207691_10069262 | |||
| 1352 | Ga0207691_10072407 | |||
| 1353 | Ga0207691_10087884 | |||
| 1354 | Ga0207691_10132486 | |||
| 1355 | Ga0207711_10178744 | |||
| 1356 | Ga0207689_10845754 | |||
| 1357 | Ga0207661_10019238 | |||
| 1358 | Ga0207661_10122603 | |||
| 1359 | Ga0207661_10287921 | |||
| 1360 | Ga0207679_10058395 | |||
| 1361 | Ga0207679_10066701 | |||
| 1362 | Ga0207679_10413966 | |||
| 1363 | Ga0207651_10005845 | |||
| 1364 | Ga0207651_10020349 | |||
| 1365 | Ga0207651_10050688 | |||
| 1366 | Ga0207651_10259750 | |||
| 1367 | Ga0207651_10281618 | |||
| 1368 | Ga0207651_10288692 | |||
| 1369 | Ga0207651_10351669 | |||
| 1370 | Ga0207651_10371128 | |||
| 1371 | Ga0207712_10002700 | |||
| 1372 | Ga0207712_10022117 | |||
| 1373 | Ga0207712_10095695 | |||
| 1374 | Ga0207712_10439587 | |||
| 1375 | Ga0207668_10005123 | |||
| 1376 | Ga0207668_10031009 | |||
| 1377 | Ga0207668_10039445 | |||
| 1378 | Ga0207668_10116779 | |||
| 1379 | Ga0207658_10004530 | |||
| 1380 | Ga0207658_10015104 | |||
| 1381 | Ga0207658_10065267 | |||
| 1382 | Ga0207658_10300830 | |||
| 1383 | Ga0207658_10659906 | |||
| 1384 | Ga0207677_10026383 | |||
| 1385 | Ga0207677_10175449 | |||
| 1386 | Ga0207677_10202382 | |||
| 1387 | Ga0207703_10003597 | |||
| 1388 | Ga0207703_10003667 | |||
| 1389 | Ga0207703_10740507 | |||
| 1390 | Ga0207703_10996945 | |||
| 1391 | Ga0207639_10103904 | |||
| 1392 | Ga0207678_10003433 | |||
| 1393 | Ga0207708_10064110 | |||
| 1394 | Ga0207702_10256284 | |||
| 1395 | Ga0207702_10515426 | |||
| 1396 | Ga0207641_10097556 | |||
| 1397 | Ga0207641_11220985 | |||
| 1398 | Ga0207648_10005881 | |||
| 1399 | Ga0207648_10095028 | |||
| 1400 | Ga0207648_10210856 | |||
| 1401 | Ga0207648_10343891 | |||
| 1402 | Ga0207676_10301446 | |||
| 1403 | Ga0207676_10361470 | |||
| 1404 | Ga0207675_100271294 | |||
| 1405 | Ga0207675_100402868 | |||
| 1406 | Ga0207683_10000956 | |||
| 1407 | Ga0207683_10021156 | |||
| 1408 | Ga0207683_10058985 | |||
| 1409 | Ga0207683_10064527 | |||
| 1410 | Ga0207683_10154283 | |||
| 1411 | Ga0207683_10627132 | |||
| 1412 | Ga0207698_10497392 | |||
| 1413 | Ga0209179_1059167 | |||
| 1414 | Ga0209998_10053772 | |||
| 1415 | Ga0209974_10006217 | |||
| 1416 | Ga0268266_10000031 | |||
| 1417 | Ga0268266_10004338 | |||
| 1418 | Ga0268266_10007108 | |||
| 1419 | Ga0268266_10194531 | |||
| 1420 | Ga0268266_10304443 | |||
| 1421 | Ga0268266_10324673 | |||
| 1422 | Ga0268266_10353031 | |||
| 1423 | Ga0268265_10026139 | |||
| 1424 | Ga0268265_10222869 | |||
| 1425 | Ga0268265_10361226 | |||
| 1426 | Ga0268264_10025901 | |||
| 1427 | Ga0268264_10101091 | |||
| 1428 | Ga0268264_10475400 | |||
| 1429 | Ga0316177_1042747 | |||
| 1430 | Ga0307405_10326327 | |||
| 1431 | Ga0307413_10131017 | |||
| 1432 | Ga0307409_100531863 | |||
| 1433 | Ga0307416_100034273 | |||
| 1434 | Ga0307414_10114151 | |||
| 1435 | Ga0307415_101045744 | |||
| 1436 | Ga0373934_0263216 | |||
| 1437 | Ga0373944_0097695 | |||
| 1438 | Ga0373923_0153933 | |||
| 1439 | Ga0373939_0069843 | |||
| 1440 | Ga0373941_0094849 | |||
| 1441 | Ga0373943_0076845 | |||
| 1442 | Ga0373943_0123301 | |||
| 1443 | Ga0373943_0235650 | |||
| 1444 | Ga0373943_0278161 | |||
| 1445 | Ga0373946_0191322 | |||
| 1446 | Ga0373955_0190003 | |||
| 1447 | Ga0373931_0052126 | |||
| 1448 | Ga0373931_0366462 | |||
| 1449 | Ga0373935_0080670 | |||
| 1450 | Ga0373935_0187848 | |||
| 1451 | Ga0373935_0557542 | |||
| 1452 | Ga0373927_0061848 | |||
| 1453 | Ga0373933_0189731 | |||
| 1454 | Ga0373947_0083067 | |||
| 1455 | Ga0373947_0086384 | |||
| 1456 | Ga0373947_0127835 | |||
| 1457 | Ga0373947_0130464 | |||
| 1458 | Ga0373947_0304246 | |||
| 1459 | Ga0373947_0414122 | |||
| 1460 | Ga0373937_0111985 | |||
| 1461 | Ga0373925_0141207 | |||
| 1462 | Ga0373925_0500198 | |||
| 1463 | Ga0373925_0780592 | |||
| 1464 | Ga0395900_0004035 | |||
| 1465 | Ga0395900_0224499 | |||
| 1466 | Ga0395900_0361843 | |||
| 1467 | Ga0395898_0019143 | |||
| 1468 | Ga0395905_0196138 | |||
| 1469 | Ga0395905_0464077 | |||
| 1470 | Ga0395901_0000998 | |||
| 1471 | Ga0395901_0018822 | |||
| 1472 | Ga0395901_0066015 | |||
| 1473 | Ga0395901_0371114 | |||
| 1474 | Ga0400483_012820 | |||
| 1475 | Ga0400483_260540 | |||
| 1476 | Ga0436363_0483572 | |||
| 1477 | Ga0439465_0042900 | |||
| 1478 | Ga0451577_0046326 | |||
| 1479 | Ga0451577_0046605 | |||
| 1480 | Ga0439440_0015709 | |||
| 1481 | Ga0466965_0133134 | |||
| 1482 | Ga0466963_0075392 | |||
| 1483 | Ga0466963_0120377 | |||
| 1484 | Ga0466964_0041029 | |||
| 1485 | Ga0453684_0000737 | |||
| 1486 | Ga0453684_0036025 | |||
| 1487 | Ga0453684_0515898 | |||
| 1488 | Ga0466971_0001103 | |||
| 1489 | Ga0466968_0055095 | |||
| 1490 | Ga0451576_0161799 | |||
| 1491 | Ga0451576_0221092 | |||
| 1492 | Ga0451576_0469499 | |||
| 1493 | Ga0466967_0096957 | |||
| 1494 | Ga0466967_0223318 | |||
| 1495 | Ga0495592_0080290 | |||
| 1496 | Ga0495603_0461067 | |||
| 1497 | Ga0495651_0270684 | |||
| 1498 | Ga0495580_0001088 | |||
| 1499 | Ga0495580_0300702 | |||
| 1500 | Ga0495582_0000609 | |||
| 1501 | Ga0495664_0347479 | |||
| 1502 | Ga0495584_0414512 | |||
| 1503 | Ga0495594_0000905 | |||
| 1504 | Ga0495608_0217808 | |||
| 1505 | Ga0495618_0108217 | |||
| 1506 | Ga0495618_0183398 | |||
| 1507 | Ga0495630_0142002 | |||
| 1508 | Ga0495643_0000114 | |||
| 1509 | Ga0495652_0100157 | |||
| 1510 | Ga0495652_0137704 | |||
| 1511 | Ga0495665_0293181 | |||
| 1512 | Ga0495640_0114751 | |||
| 1513 | Ga0495586_0147613 | |||
| 1514 | Ga0495587_0075006 | |||
| 1515 | Ga0495587_0265497 | |||
| 1516 | Ga0495587_0329282 | |||
| 1517 | Ga0495598_0253384 | |||
| 1518 | Ga0495645_0034806 | |||
| 1519 | Ga0495645_0252616 | |||
| 1520 | Ga0495667_0050374 | |||
| 1521 | Ga0495668_0533150 | |||
| 1522 | Ga0495634_0218037 | |||
| 1523 | Ga0495635_0076852 | |||
| 1524 | Ga0495599_0009817 | |||
| 1525 | Ga0495623_0243615 | |||
| 1526 | Ga0495646_0200965 | |||
| 1527 | Ga0495647_0065125 | |||
| 1528 | Ga0495658_0021507 | |||
| 1529 | Ga0495669_0071474 | |||
| 1530 | Ga0495669_0079928 | |||
| 1531 | Ga0495624_0121367 | |||
| 1532 | Ga0495581_0102181 | |||
| 1533 | Ga0495604_0086851 | |||
| 1534 | Ga0495604_0450486 | |||
| 1535 | Ga0495674_0170177 | |||
| 1536 | Ga0495674_0577336 | |||
| 1537 | Ga0495675_0116630 | |||
| 1538 | Ga0495675_0135444 | |||
| 1539 | Ga0495675_0209418 | |||
| 1540 | Ga0495684_0026773 | |||
| 1541 | Ga0495684_0178662 | |||
| 1542 | Ga0495602_0136110 | |||
| 1543 | Ga0496100_0002862 | |||
| 1544 | Ga0496100_0761353 | |||
| 1545 | Ga0496101_0053961 | |||
| 1546 | Ga0496101_0607484 | |||
| 1547 | Ga0496102_0016965 | |||
| 1548 | Ga0496102_0099463 | |||
| 1549 | Ga0496102_0228962 | |||
| 1550 | Ga0496102_1206721 | |||
| 1551 | Ga0496103_0021096 | |||
| 1552 | Ga0496104_0017668 | |||
| 1553 | Ga0496104_0069145 | |||
| 1554 | Ga0496104_0099240 | |||
| 1555 | Ga0496105_0067713 | |||
| 1556 | Ga0496105_0117254 | |||
| 1557 | Ga0496105_0357670 | |||
| 1558 | Ga0496105_0629537 | |||
| 1559 | Ga0496106_0057256 | |||
| 1560 | Ga0496107_0010608 | |||
| 1561 | Ga0496107_0100637 | |||
| 1562 | Ga0496107_0375550 | |||
| 1563 | Ga0496107_0510062 | |||
| 1564 | Ga0496108_0140860 | |||
| 1565 | Ga0496109_0061407 | |||
| 1566 | Ga0496109_0929166 | |||
| 1567 | Ga0496110_0047306 | |||
| 1568 | Ga0496110_0262184 | |||
| 1569 | Ga0496110_0522475 | |||
| 1570 | Ga0496111_0152131 | |||
| 1571 | Ga0496112_0042820 | |||
| 1572 | Ga0496112_0090753 | |||
| 1573 | Ga0496112_0172086 | |||
| 1574 | Ga0496112_0255242 | |||
| 1575 | Ga0496112_0351301 | |||
| 1576 | Ga0496112_0355012 | |||
| 1577 | Ga0496112_0381012 | |||
| 1578 | Ga0496112_0437944 | |||
| 1579 | Ga0496113_0229935 | |||
| 1580 | Ga0496113_0552820 | |||
| 1581 | Ga0496114_0018483 | |||
| 1582 | Ga0496114_0019073 | |||
| 1583 | Ga0496114_0109958 | |||
| 1584 | Ga0496114_0295367 | |||
| 1585 | Ga0496115_0004087 | |||
| 1586 | Ga0496115_0005586 | |||
| 1587 | Ga0496115_0083164 | |||
| 1588 | Ga0496115_0200715 | |||
| 1589 | Ga0496115_0255583 | |||
| 1590 | Ga0496115_0327778 | |||
| 1591 | Ga0496115_0782753 | |||
| 1592 | Ga0501031_0024640 | |||
| 1593 | Ga0501032_0308430 | |||
| 1594 | Ga0501033_0000227 | |||
| 1595 | Ga0501036_0059603 | |||
| 1596 | Ga0501037_0000082 | |||
| 1597 | Ga0501038_0003342 | |||
| 1598 | Ga0501039_0001111 | |||
| 1599 | Ga0501043_0000170 | |||
| 1600 | Ga0501043_0008673 | |||
| 1601 | Ga0501047_0032352 | |||
| 1602 | Ga0501070_0137289 | |||
| 1603 | Ga0501071_0029657 | |||
| 1604 | Ga0501035_0000002 | |||
| 1605 | Ga0501044_0002437 | |||
| 1606 | nmdc:mga05p37_1728_c1 | |||
| 1607 | nmdc:mga05p37_222672_c1 | |||
| 1608 | nmdc:mga08y16_177878_c1 | |||
| 1609 | nmdc:mga08y16_363195_c1 | |||
| 1610 | nmdc:mga0n895_865536_c1 | |||
| 1611 | nmdc:mga0rr50_1046161_c1 | |||
| 1612 | nmdc:mga0rr50_191170_c1 | |||
| 1613 | nmdc:mga08x19_6381_c1 | |||
| 1614 | nmdc:mga0a205_309339_c1 | |||
| 1615 | nmdc:mga0a205_671309_c1 | |||
| 1616 | Ga0495601_0007125 | |||
| 1617 | Ga0495601_0091758 | |||
| 1618 | Ga0495612_0039666 | |||
| 1619 | Ga0500555_000016 | |||
| 1620 | Ga0500616_0000988 | |||
| 1621 | Ga0500616_0025273 | |||
| 1622 | Ga0466962_0000080 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1d8l-assembly1.cif.gz_A | e. coli holliday junction binding protein ruva nh2 region lacking domain iii | 0.9807 | 1 | 132 |
| 7pbu-assembly1.cif.gz_F | ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] | 0.9744 | 1 | 132 |
| 7x7q-assembly1.cif.gz_G | cryoem structure of ruva-ruvb-holliday junction complex | 0.9683 | 1 | 132 |
| 2zte-assembly1.cif.gz_A | mtruva form iv | 0.9595 | 1 | 132 |
| 7pbu-assembly1.cif.gz_F | ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] | 0.9531 | 1 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1d8lB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9882 | 1 | 63 | 2.40.50.140 |
| 2ztdA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9732 | 1 | 63 | 2.40.50.140 |
| 1bvsA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9606 | 68 | 134 | 1.10.150.20 |
| 1d8lB01 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9572 | 68 | 132 | 1.10.150.20 |
| 1bvsA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.954 | 1 | 64 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1KT27-F1-model_v4 | Holliday junction branch migration protein RuvA | 1.005 | 1 | 87 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A2V5L187-F1-model_v4 | Holliday junction branch migration protein RuvA | 1.002 | 1 | 125 |
GO:0003677
GO:0005524 GO:0005737 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A382QH54-F1-model_v4 | DNA helicase Holliday junction RuvA type domain-containing protein | 1 | 1 | 61 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A660YIC9-F1-model_v4 | Holliday junction branch migration protein RuvA | 0.9931 | 1 | 102 |
GO:0003677
GO:0005524 GO:0005737 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A358XVD5-F1-model_v4 | Holliday junction branch migration protein RuvA | 0.9929 | 1 | 62 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |