F481854

General Info

Members Datasets Scaffolds Average Seq Length
811 302 1622 203

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0224430|Ga0373933_0224430_447_1181
Length 244
Sequence LAIGFAADGPPEIISEILRCVQNDKEPTPALTLQHFNEPVITFLDGKLVNALPTQAIVDVGGVGYEVFIPLSSYDKLPAVGQAIRILTHLVVREDAHVLYGFMTPAERDLFRLLVNSVSGIGPKLALAVLSGMSVTSFKAAVVNSDVASISKISGLGKKTAERIVLELKDKVGVAAAWESASAAHAPTPEQQQANEAVLALIALGYKQADAHKAVHDLQQKGEGQGKSAEELVKLALKRIAAGR

Samples

Sample ID Description Type Environment
1 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
106 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 6.04
Rhizosphere 93.09
Stem 0
Stem Tuber 0
Unclassified 25.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373933_0224430 3300035724 Bacteria 1206
2 SwRhRL2b_contig_1925602 2162886007 Unclassified 1653
3 CNXas_1000032 3300000545 Bacteria 29092
4 JGI24746J21847_1004796 3300001977 Bacteria 2123
5 JGI24737J22298_10031574 3300001990 Unclassified 1653
6 JGI24737J22298_10112436 3300001990 Unclassified 805
7 JGI24743J22301_10050390 3300001991 Bacteria 848
8 JGI24035J26624_1001767 3300002126 Unclassified 2019
9 JGI24035J26624_1005034 3300002126 Unclassified 1259
10 JGI25406J46586_10000067 3300003203 Bacteria 47883
11 JGI25405J52794_10000545 3300003911 Bacteria 5484
12 Ga0065704_10002125 3300005289 Bacteria 5811
13 Ga0065704_10010972 3300005289 Unclassified 1741
14 Ga0065704_10100547 3300005289 Unclassified 2269
15 Ga0065704_10117366 3300005289 Bacteria 1832
16 Ga0065704_10127098 3300005289 Bacteria 1680
17 Ga0065712_10116444 3300005290 Unclassified 1735
18 Ga0065712_10145340 3300005290 Bacteria 1414
19 Ga0065712_10412688 3300005290 Unclassified 719
20 Ga0065715_10005105 3300005293 Bacteria 6415
21 Ga0065715_10021659 3300005293 Bacteria 1388
22 Ga0065715_10100199 3300005293 Unclassified 3328
23 Ga0065715_10263650 3300005293 Unclassified 1130
24 Ga0065715_10323647 3300005293 Bacteria 997
25 Ga0065715_10329070 3300005293 Unclassified 987
26 Ga0065707_10004715 3300005295 Bacteria 4133
27 Ga0065707_10037229 3300005295 Bacteria 1268
28 Ga0065707_10170990 3300005295 Unclassified 1450
29 Ga0065707_10246755 3300005295 Bacteria 1136
30 Ga0070676_10003991 3300005328 Bacteria 7745
31 Ga0070676_10060105 3300005328 Bacteria 2256
32 Ga0070676_10125997 3300005328 Bacteria 1614
33 Ga0070676_10240657 3300005328 Bacteria 1203
34 Ga0070676_10246248 3300005328 Unclassified 1191
35 Ga0070676_10516783 3300005328 Bacteria 850
36 Ga0070683_100042548 3300005329 Bacteria 4183
37 Ga0070683_100094596 3300005329 Unclassified 2808
38 Ga0070683_100895519 3300005329 Unclassified 851
39 Ga0070690_100062396 3300005330 Bacteria 2403
40 Ga0070690_100090341 3300005330 Unclassified 2016
41 Ga0070690_100103601 3300005330 Bacteria 1889
42 Ga0070690_100223846 3300005330 Unclassified 1319
43 Ga0070690_100260899 3300005330 Bacteria 1229
44 Ga0070670_100002690 3300005331 Bacteria 14671
45 Ga0070677_10014707 3300005333 Bacteria 2760
46 Ga0068869_100543509 3300005334 Bacteria 975
47 Ga0070666_10002044 3300005335 Bacteria 12250
48 Ga0070666_10148094 3300005335 Bacteria 1637
49 Ga0070666_10185876 3300005335 Unclassified 1459
50 Ga0068868_100047031 3300005338 Unclassified 3379
51 Ga0068868_100128866 3300005338 Bacteria 2069
52 Ga0070660_100244259 3300005339 Bacteria 1463
53 Ga0070660_100741479 3300005339 Unclassified 824
54 Ga0070689_100005579 3300005340 Bacteria 8608
55 Ga0070689_100011679 3300005340 Bacteria 6300
56 Ga0070689_100101999 3300005340 Bacteria 2272
57 Ga0070689_100985453 3300005340 Bacteria 749
58 Ga0070689_101044459 3300005340 Unclassified 728
59 Ga0070687_100000532 3300005343 Bacteria 12757
60 Ga0070687_100297117 3300005343 Unclassified 1023
61 Ga0070661_100036936 3300005344 Bacteria 3552
62 Ga0070661_100213856 3300005344 Bacteria 1477
63 Ga0070661_100256672 3300005344 Unclassified 1350
64 Ga0070692_10189823 3300005345 Unclassified 1196
65 Ga0070668_100003567 3300005347 Bacteria 11476
66 Ga0070668_100005061 3300005347 Bacteria 9757
67 Ga0070668_100014650 3300005347 Bacteria 5860
68 Ga0070668_100040112 3300005347 Bacteria 3582
69 Ga0070668_100286034 3300005347 Unclassified 1378
70 Ga0070668_100670126 3300005347 Unclassified 913
71 Ga0070669_100012470 3300005353 Bacteria 6031
72 Ga0070669_100020039 3300005353 Bacteria 4775
73 Ga0070669_100027129 3300005353 Bacteria 4122
74 Ga0070669_100739206 3300005353 Bacteria 833
75 Ga0070675_100000800 3300005354 Bacteria 22104
76 Ga0070675_100003333 3300005354 Bacteria 12166
77 Ga0070675_100018699 3300005354 Bacteria 5517
78 Ga0070675_100059661 3300005354 Bacteria 3148
79 Ga0070675_100059971 3300005354 Bacteria 3140
80 Ga0070675_100128420 3300005354 Unclassified 2158
81 Ga0070675_100158243 3300005354 Bacteria 1946
82 Ga0070675_100297309 3300005354 Unclassified 1422
83 Ga0070671_100003803 3300005355 Bacteria 11845
84 Ga0070671_100010844 3300005355 Bacteria 7312
85 Ga0070671_100033560 3300005355 Bacteria 4246
86 Ga0070671_100204669 3300005355 Unclassified 1674
87 Ga0070671_100350480 3300005355 Bacteria 1260
88 Ga0070671_100431036 3300005355 Bacteria 1130
89 Ga0070674_100007782 3300005356 Bacteria 6334
90 Ga0070674_100043245 3300005356 Bacteria 3063
91 Ga0070673_100004127 3300005364 Bacteria 9150
92 Ga0070673_100007695 3300005364 Bacteria 7129
93 Ga0070673_100021847 3300005364 Bacteria 4649
94 Ga0070673_100025303 3300005364 Bacteria 4367
95 Ga0070673_100097377 3300005364 Bacteria 2416
96 Ga0070673_100208643 3300005364 Bacteria 1686
97 Ga0070688_100000621 3300005365 Bacteria 17688
98 Ga0070688_100020654 3300005365 Bacteria 3832
99 Ga0070688_100046314 3300005365 Bacteria 2692
100 Ga0070688_100525831 3300005365 Bacteria 896
101 Ga0070688_100534370 3300005365 Bacteria 889
102 Ga0070659_100016047 3300005366 Bacteria 5620
103 Ga0070667_100009056 3300005367 Bacteria 8241
104 Ga0070667_100022604 3300005367 Bacteria 5214
105 Ga0070667_100034224 3300005367 Bacteria 4249
106 Ga0070667_100228150 3300005367 Bacteria 1660
107 Ga0070667_100240290 3300005367 Bacteria 1617
108 Ga0070667_100272573 3300005367 Bacteria 1518
109 Ga0070703_10006701 3300005406 Bacteria 3227
110 Ga0070703_10061495 3300005406 Bacteria 1230
111 Ga0070709_10040051 3300005434 Bacteria 2878
112 Ga0070714_100058473 3300005435 Bacteria 3303
113 Ga0070714_100141051 3300005435 Unclassified 2163
114 Ga0070714_100587793 3300005435 Bacteria 1068
115 Ga0070714_100798682 3300005435 Unclassified 914
116 Ga0070713_100192867 3300005436 Unclassified 1837
117 Ga0070710_10630516 3300005437 Unclassified 749
118 Ga0070701_10026804 3300005438 Bacteria 2815
119 Ga0070701_10062971 3300005438 Unclassified 1961
120 Ga0070711_100081920 3300005439 Bacteria 2301
121 Ga0070705_100244569 3300005440 Bacteria 1256
122 Ga0070705_100443943 3300005440 Bacteria 972
123 Ga0070700_100029511 3300005441 Bacteria 3271
124 Ga0070694_100006500 3300005444 Bacteria 7100
125 Ga0070694_100034600 3300005444 Bacteria 3333
126 Ga0070708_100009081 3300005445 Bacteria 8015
127 Ga0070708_100013237 3300005445 Bacteria 6750
128 Ga0070708_100050292 3300005445 Bacteria 3690
129 Ga0070708_100059790 3300005445 Bacteria 3399
130 Ga0070708_100092401 3300005445 Bacteria 2757
131 Ga0070708_100181420 3300005445 Bacteria 1968
132 Ga0070708_100223150 3300005445 Bacteria 1767
133 Ga0070708_100312414 3300005445 Bacteria 1480
134 Ga0070708_100736785 3300005445 Bacteria 927
135 Ga0070708_100855034 3300005445 Unclassified 854
136 Ga0070708_100893936 3300005445 Unclassified 834
137 Ga0070708_101270254 3300005445 Unclassified 688
138 Ga0070663_100132282 3300005455 Unclassified 1896
139 Ga0070678_100002933 3300005456 Bacteria 9455
140 Ga0070678_100047630 3300005456 Unclassified 3082
141 Ga0070678_100343406 3300005456 Bacteria 1281
142 Ga0070662_100001248 3300005457 Bacteria 15598
143 Ga0070662_100190260 3300005457 Bacteria 1623
144 Ga0070662_100667563 3300005457 Unclassified 878
145 Ga0070681_10025041 3300005458 Bacteria 6005
146 Ga0068867_100038574 3300005459 Bacteria 3478
147 Ga0068867_100045690 3300005459 Unclassified 3213
148 Ga0068867_100154449 3300005459 Unclassified 1805
149 Ga0070685_10022977 3300005466 Bacteria 3408
150 Ga0070685_10076742 3300005466 Unclassified 1993
151 Ga0070706_100000227 3300005467 Bacteria 68755
152 Ga0070706_100001536 3300005467 Bacteria 24129
153 Ga0070706_100006339 3300005467 Bacteria 11177
154 Ga0070706_100012642 3300005467 Bacteria 7813
155 Ga0070706_100033974 3300005467 Unclassified 4708
156 Ga0070706_100080958 3300005467 Unclassified 3007
157 Ga0070706_100094407 3300005467 Bacteria 2776
158 Ga0070706_100242806 3300005467 Unclassified 1682
159 Ga0070706_100265682 3300005467 Unclassified 1601
160 Ga0070706_100316879 3300005467 Bacteria 1455
161 Ga0070706_100355014 3300005467 Bacteria 1366
162 Ga0070706_100359938 3300005467 Bacteria 1356
163 Ga0070706_100619038 3300005467 Bacteria 1006
164 Ga0070707_100049683 3300005468 Bacteria 4020
165 Ga0070707_100052130 3300005468 Bacteria 3922
166 Ga0070707_100125418 3300005468 Bacteria 2494
167 Ga0070707_100132686 3300005468 Unclassified 2422
168 Ga0070707_100154274 3300005468 Bacteria 2237
169 Ga0070707_100234337 3300005468 Unclassified 1786
170 Ga0070707_100342903 3300005468 Bacteria 1451
171 Ga0070707_100424734 3300005468 Bacteria 1290
172 Ga0070707_100501440 3300005468 Unclassified 1175
173 Ga0070707_100647816 3300005468 Bacteria 1019
174 Ga0070707_100773660 3300005468 Bacteria 924
175 Ga0070707_100817351 3300005468 Bacteria 896
176 Ga0070698_100011183 3300005471 Bacteria 9536
177 Ga0070698_100012644 3300005471 Bacteria 8937
178 Ga0070698_100014761 3300005471 Bacteria 8252
179 Ga0070699_100057478 3300005518 Bacteria 3370
180 Ga0070699_100068033 3300005518 Bacteria 3092
181 Ga0070699_100083652 3300005518 Bacteria 2784
182 Ga0070699_100100250 3300005518 Unclassified 2538
183 Ga0070699_100151243 3300005518 Bacteria 2053
184 Ga0070699_100187658 3300005518 Unclassified 1836
185 Ga0070699_100621590 3300005518 Bacteria 985
186 Ga0070679_100037540 3300005530 Unclassified 4813
187 Ga0070684_100000230 3300005535 Bacteria 38807
188 Ga0070684_100011931 3300005535 Bacteria 6940
189 Ga0070684_100073522 3300005535 Bacteria 3012
190 Ga0070684_100773643 3300005535 Unclassified 897
191 Ga0070697_100000640 3300005536 Bacteria 26481
192 Ga0070697_100001810 3300005536 Bacteria 16323
193 Ga0070697_100012250 3300005536 Bacteria 6717
194 Ga0070697_100014557 3300005536 Bacteria 6178
195 Ga0070697_100019134 3300005536 Bacteria 5406
196 Ga0070697_100019752 3300005536 Bacteria 5323
197 Ga0070697_100039216 3300005536 Bacteria 3829
198 Ga0070697_100088907 3300005536 Unclassified 2551
199 Ga0070697_100091775 3300005536 Bacteria 2512
200 Ga0070697_100102487 3300005536 Bacteria 2378
201 Ga0070697_100350587 3300005536 Bacteria 1275
202 Ga0070697_100405974 3300005536 Unclassified 1183
203 Ga0070672_100006079 3300005543 Bacteria 8072
204 Ga0070672_100023736 3300005543 Bacteria 4524
205 Ga0070672_100025838 3300005543 Bacteria 4362
206 Ga0070672_100228567 3300005543 Bacteria 1562
207 Ga0070672_100273200 3300005543 Bacteria 1428
208 Ga0070672_100299164 3300005543 Bacteria 1364
209 Ga0070686_100433967 3300005544 Bacteria 1006
210 Ga0070695_100359243 3300005545 Unclassified 1093
211 Ga0070696_100056918 3300005546 Bacteria 2728
212 Ga0070693_100054334 3300005547 Bacteria 2303
213 Ga0070665_100042759 3300005548 Bacteria 4555
214 Ga0070665_100051907 3300005548 Unclassified 4112
215 Ga0070665_100054112 3300005548 Bacteria 4025
216 Ga0070665_100076204 3300005548 Bacteria 3361
217 Ga0070665_100177204 3300005548 Bacteria 2133
218 Ga0070665_100183921 3300005548 Unclassified 2090
219 Ga0070665_100315931 3300005548 Bacteria 1566
220 Ga0070665_100824782 3300005548 Bacteria 940
221 Ga0070704_100001031 3300005549 Bacteria 14352
222 Ga0070704_100440432 3300005549 Bacteria 1120
223 Ga0068855_100515826 3300005563 Unclassified 1297
224 Ga0070664_100098766 3300005564 Bacteria 2537
225 Ga0070664_100202370 3300005564 Bacteria 1772
226 Ga0070664_100348878 3300005564 Bacteria 1346
227 Ga0070664_100726141 3300005564 Bacteria 926
228 Ga0068856_100016596 3300005614 Bacteria 7128
229 Ga0070702_100048251 3300005615 Bacteria 2423
230 Ga0070702_100675412 3300005615 Unclassified 784
231 Ga0068852_100565794 3300005616 Bacteria 1138
232 Ga0068864_100081207 3300005618 Bacteria 2842
233 Ga0068866_10027744 3300005718 Bacteria 2691
234 Ga0068866_10451087 3300005718 Unclassified 841
235 Ga0068863_100015159 3300005841 Bacteria 7404
236 Ga0068858_100001678 3300005842 Bacteria 22642
237 Ga0068858_100002353 3300005842 Bacteria 19101
238 Ga0068858_100549661 3300005842 Bacteria 1118
239 Ga0068860_100114018 3300005843 Unclassified 2585
240 Ga0068860_100116100 3300005843 Bacteria 2560
241 Ga0068860_100214393 3300005843 Bacteria 1868
242 Ga0068860_100395673 3300005843 Bacteria 1366
243 Ga0068862_100008618 3300005844 Bacteria 8436
244 Ga0068862_100243203 3300005844 Unclassified 1637
245 Ga0081455_10001703 3300005937 Bacteria 26634
246 Ga0081455_10001745 3300005937 Bacteria 26278
247 Ga0081455_10010995 3300005937 Bacteria 9122
248 Ga0081455_10074912 3300005937 Bacteria 2794
249 Ga0081455_10118118 3300005937 Unclassified 2094
250 Ga0081455_10177519 3300005937 Bacteria 1616
251 Ga0081455_10459080 3300005937 Bacteria 868
252 Ga0081540_1000437 3300005983 Bacteria 41175
253 Ga0081540_1007907 3300005983 Bacteria 7510
254 Ga0081540_1062621 3300005983 Bacteria 1765
255 Ga0081539_10000287 3300005985 Bacteria 113988
256 Ga0081539_10000621 3300005985 Bacteria 71799
257 Ga0081539_10025018 3300005985 Unclassified 3857
258 Ga0081539_10051779 3300005985 Bacteria 2311
259 Ga0070717_10005952 3300006028 Bacteria 8931
260 Ga0070717_10024471 3300006028 Unclassified 4795
261 Ga0070717_10048500 3300006028 Bacteria 3483
262 Ga0070717_10055646 3300006028 Bacteria 3265
263 Ga0070717_10057975 3300006028 Bacteria 3201
264 Ga0070717_10104447 3300006028 Unclassified 2410
265 Ga0070717_10112906 3300006028 Bacteria 2320
266 Ga0070717_10234777 3300006028 Bacteria 1615
267 Ga0070717_10270190 3300006028 Bacteria 1506
268 Ga0070717_10414115 3300006028 Unclassified 1212
269 Ga0070717_10682713 3300006028 Unclassified 933
270 Ga0070715_10336635 3300006163 Bacteria 819
271 Ga0070716_100112460 3300006173 Bacteria 1690
272 Ga0070716_100120800 3300006173 Bacteria 1640
273 Ga0070716_100251424 3300006173 Bacteria 1204
274 Ga0070712_100032172 3300006175 Bacteria 3539
275 Ga0070712_100056078 3300006175 Bacteria 2762
276 Ga0070712_100075678 3300006175 Bacteria 2422
277 Ga0070712_100078432 3300006175 Unclassified 2384
278 Ga0070712_100080217 3300006175 Unclassified 2361
279 Ga0070712_100117694 3300006175 Unclassified 1994
280 Ga0070712_100198204 3300006175 Unclassified 1575
281 Ga0070712_100375735 3300006175 Bacteria 1169
282 Ga0070712_100636899 3300006175 Unclassified 905
283 Ga0070712_100845427 3300006175 Bacteria 787
284 Ga0097621_100017406 3300006237 Bacteria 5457
285 Ga0097621_100088344 3300006237 Bacteria 2589
286 Ga0097621_100130785 3300006237 Bacteria 2137
287 Ga0068871_100010934 3300006358 Bacteria 6648
288 Ga0068871_100050694 3300006358 Bacteria 3358
289 Ga0068871_100162593 3300006358 Bacteria 1910
290 Ga0068871_100435588 3300006358 Unclassified 1173
291 Ga0068871_100494899 3300006358 Unclassified 1101
292 Ga0068871_100675311 3300006358 Bacteria 945
293 Ga0075433_10184947 3300006852 Bacteria 1854
294 Ga0075433_10237240 3300006852 Unclassified 1619
295 Ga0075433_10313871 3300006852 Unclassified 1387
296 Ga0075434_100476365 3300006871 Bacteria 1269
297 Ga0075434_101071184 3300006871 Bacteria 820
298 Ga0068865_100168209 3300006881 Bacteria 1678
299 Ga0075436_100010844 3300006914 Bacteria 6252
300 Ga0075436_100129430 3300006914 Unclassified 1770
301 Ga0075435_100272786 3300007076 Bacteria 1443
302 Ga0075435_100327447 3300007076 Unclassified 1312
303 Ga0099795_10089245 3300007788 Bacteria 1193
304 Ga0099795_10340755 3300007788 Unclassified 668
305 Ga0105240_10029117 3300009093 Bacteria 7201
306 Ga0105240_10409715 3300009093 Unclassified 1525
307 Ga0111539_10201444 3300009094 Bacteria 2321
308 Ga0105245_10010327 3300009098 Bacteria 8134
309 Ga0105247_10112987 3300009101 Bacteria 1750
310 Ga0114129_10004895 3300009147 Bacteria 18901
311 Ga0114129_10280608 3300009147 Bacteria 2226
312 Ga0114129_10537557 3300009147 Unclassified 1522
313 Ga0105243_10342715 3300009148 Bacteria 1369
314 Ga0105242_10008800 3300009176 Bacteria 7744
315 Ga0105242_10171629 3300009176 Bacteria 1906
316 Ga0105242_10383673 3300009176 Bacteria 1307
317 Ga0105248_10085246 3300009177 Bacteria 3555
318 Ga0105248_11057800 3300009177 Bacteria 917
319 Ga0105237_10020734 3300009545 Bacteria 6770
320 Ga0105237_10241007 3300009545 Unclassified 1809
321 Ga0105237_10968854 3300009545 Viruses 857
322 Ga0105249_10003062 3300009553 Bacteria 14440
323 Ga0105249_10034778 3300009553 Bacteria 4567
324 Ga0105249_10060224 3300009553 Bacteria 3482
325 Ga0099796_10146036 3300010159 Bacteria 928
326 Ga0105239_10012805 3300010375 Bacteria 9332
327 Ga0105239_10035273 3300010375 Bacteria 5493
328 Ga0105239_10375110 3300010375 Bacteria 1608
329 Ga0105239_10516453 3300010375 Bacteria 1359
330 Ga0105239_10705775 3300010375 Unclassified 1153
331 Ga0105239_10734157 3300010375 Bacteria 1130
332 Ga0157346_1010875 3300012480 Unclassified 667
333 Ga0157347_1025576 3300012502 Unclassified 715
334 Ga0157371_10213717 3300013102 Bacteria 1384
335 Ga0157371_10453814 3300013102 Bacteria 943
336 Ga0157370_10185263 3300013104 Bacteria 1933
337 Ga0157374_10000068 3300013296 Bacteria 106195
338 Ga0157374_10004587 3300013296 Bacteria 11587
339 Ga0157374_10005441 3300013296 Bacteria 10696
340 Ga0157374_10015983 3300013296 Bacteria 6593
341 Ga0157374_10040135 3300013296 Bacteria 4309
342 Ga0157374_10058052 3300013296 Unclassified 3616
343 Ga0157374_10086120 3300013296 Unclassified 2989
344 Ga0157374_10195063 3300013296 Bacteria 1982
345 Ga0157374_10255521 3300013296 Bacteria 1725
346 Ga0157374_10274258 3300013296 Bacteria 1664
347 Ga0157374_10429921 3300013296 Unclassified 1320
348 Ga0157378_10005429 3300013297 Bacteria 11178
349 Ga0157378_10016462 3300013297 Bacteria 6476
350 Ga0157378_10033584 3300013297 Bacteria 4537
351 Ga0157378_10036119 3300013297 Bacteria 4373
352 Ga0157378_10041698 3300013297 Bacteria 4072
353 Ga0157378_10044064 3300013297 Bacteria 3961
354 Ga0157378_10157817 3300013297 Unclassified 2119
355 Ga0157378_10165237 3300013297 Bacteria 2073
356 Ga0157378_10175101 3300013297 Bacteria 2015
357 Ga0157378_10202204 3300013297 Bacteria 1879
358 Ga0157378_10314914 3300013297 Bacteria 1519
359 Ga0157378_10357537 3300013297 Bacteria 1428
360 Ga0157378_10799979 3300013297 Bacteria 968
361 Ga0163162_10002701 3300013306 Bacteria 16826
362 Ga0163162_10007809 3300013306 Bacteria 10428
363 Ga0163162_10011424 3300013306 Bacteria 8659
364 Ga0163162_10023089 3300013306 Bacteria 6136
365 Ga0163162_10076339 3300013306 Bacteria 3412
366 Ga0163162_10096704 3300013306 Bacteria 3041
367 Ga0163162_10096814 3300013306 Bacteria 3039
368 Ga0163162_10274383 3300013306 Bacteria 1818
369 Ga0157372_10036367 3300013307 Bacteria 5427
370 Ga0157372_10233647 3300013307 Bacteria 2132
371 Ga0157372_10476927 3300013307 Bacteria 1454
372 Ga0157375_10002103 3300013308 Bacteria 17179
373 Ga0157375_10002145 3300013308 Bacteria 17041
374 Ga0157375_10007613 3300013308 Bacteria 9473
375 Ga0157375_10007724 3300013308 Bacteria 9414
376 Ga0157375_10009633 3300013308 Bacteria 8489
377 Ga0157375_10065220 3300013308 Bacteria 3630
378 Ga0157375_10074631 3300013308 Bacteria 3413
379 Ga0157375_10091057 3300013308 Bacteria 3110
380 Ga0157375_10326004 3300013308 Unclassified 1700
381 Ga0157375_10429539 3300013308 Bacteria 1487
382 Ga0163163_10178409 3300014325 Bacteria 2171
383 Ga0163163_10262610 3300014325 Unclassified 1778
384 Ga0163163_10639788 3300014325 Bacteria 1127
385 Ga0157380_11681875 3300014326 Unclassified 692
386 Ga0182008_10022323 3300014497 Bacteria 3242
387 Ga0157377_10118189 3300014745 Unclassified 1603
388 Ga0157377_10168089 3300014745 Bacteria 1369
389 Ga0157379_10368660 3300014968 Unclassified 1317
390 Ga0157379_10498264 3300014968 Unclassified 1129
391 Ga0157376_10001598 3300014969 Bacteria 14997
392 Ga0157376_10003774 3300014969 Bacteria 10473
393 Ga0157376_10077971 3300014969 Bacteria 2835
394 Ga0157376_10130270 3300014969 Bacteria 2243
395 Ga0157376_10218726 3300014969 Bacteria 1763
396 Ga0157376_10420639 3300014969 Bacteria 1297
397 Ga0157376_10508480 3300014969 Unclassified 1185
398 Ga0182006_1131722 3300015261 Unclassified 860
399 Ga0163161_10003776 3300017792 Bacteria 10610
400 Ga0163161_10013881 3300017792 Bacteria 5612
401 Ga0213874_10062731 3300021377 Bacteria 1168
402 Ga0207666_1000587 3300025271 Bacteria 4375
403 Ga0207673_1001785 3300025290 Unclassified 2389
404 Ga0207673_1006360 3300025290 Unclassified 1460
405 Ga0207673_1006829 3300025290 Bacteria 1421
406 Ga0207697_10000281 3300025315 Bacteria 28268
407 Ga0207697_10000496 3300025315 Bacteria 22132
408 Ga0207697_10000868 3300025315 Bacteria 17109
409 Ga0207697_10000876 3300025315 Bacteria 17049
410 Ga0207697_10001461 3300025315 Bacteria 12903
411 Ga0207697_10007026 3300025315 Bacteria 5041
412 Ga0207697_10016269 3300025315 Bacteria 3064
413 Ga0207697_10026017 3300025315 Unclassified 2393
414 Ga0207697_10048027 3300025315 Bacteria 1760
415 Ga0207653_10009899 3300025885 Bacteria 2973
416 Ga0207682_10009209 3300025893 Bacteria 3900
417 Ga0207682_10140594 3300025893 Unclassified 1083
418 Ga0207692_10064018 3300025898 Bacteria 1913
419 Ga0207692_10089602 3300025898 Bacteria 1665
420 Ga0207642_10285994 3300025899 Bacteria 950
421 Ga0207688_10003305 3300025901 Bacteria 8812
422 Ga0207688_10185043 3300025901 Unclassified 1243
423 Ga0207680_10001473 3300025903 Bacteria 11150
424 Ga0207680_10096509 3300025903 Bacteria 1891
425 Ga0207680_10415348 3300025903 Unclassified 952
426 Ga0207647_10034060 3300025904 Bacteria 3255
427 Ga0207685_10109286 3300025905 Bacteria 1196
428 Ga0207699_10513232 3300025906 Bacteria 866
429 Ga0207645_10004008 3300025907 Bacteria 10980
430 Ga0207645_10005947 3300025907 Bacteria 8793
431 Ga0207645_10026736 3300025907 Bacteria 3728
432 Ga0207645_10063650 3300025907 Bacteria 2357
433 Ga0207645_10131366 3300025907 Unclassified 1630
434 Ga0207645_10215034 3300025907 Bacteria 1266
435 Ga0207684_10000205 3300025910 Bacteria 91547
436 Ga0207684_10002005 3300025910 Bacteria 20962
437 Ga0207684_10003655 3300025910 Bacteria 14946
438 Ga0207684_10028263 3300025910 Unclassified 4778
439 Ga0207684_10032430 3300025910 Unclassified 4442
440 Ga0207684_10032588 3300025910 Unclassified 4430
441 Ga0207684_10084831 3300025910 Bacteria 2698
442 Ga0207684_10103635 3300025910 Bacteria 2433
443 Ga0207684_10214066 3300025910 Unclassified 1662
444 Ga0207684_10308167 3300025910 Bacteria 1365
445 Ga0207684_10347487 3300025910 Bacteria 1277
446 Ga0207684_10481335 3300025910 Unclassified 1065
447 Ga0207684_10494042 3300025910 Unclassified 1049
448 Ga0207684_10617966 3300025910 Bacteria 925
449 Ga0207684_10626171 3300025910 Bacteria 918
450 Ga0207707_10079230 3300025912 Unclassified 2868
451 Ga0207695_10009328 3300025913 Bacteria 12144
452 Ga0207695_10062816 3300025913 Bacteria 3831
453 Ga0207671_10011128 3300025914 Bacteria 7352
454 Ga0207693_10006434 3300025915 Bacteria 9731
455 Ga0207693_10008083 3300025915 Bacteria 8629
456 Ga0207693_10011275 3300025915 Bacteria 7236
457 Ga0207693_10021447 3300025915 Bacteria 5132
458 Ga0207693_10140540 3300025915 Bacteria 1899
459 Ga0207693_10205768 3300025915 Unclassified 1547
460 Ga0207693_10669106 3300025915 Bacteria 806
461 Ga0207663_10394868 3300025916 Bacteria 1056
462 Ga0207660_10506889 3300025917 Bacteria 979
463 Ga0207662_10000089 3300025918 Bacteria 43194
464 Ga0207662_10133324 3300025918 Bacteria 1568
465 Ga0207657_10075271 3300025919 Bacteria 2849
466 Ga0207649_10112684 3300025920 Bacteria 1820
467 Ga0207649_10189288 3300025920 Bacteria 1446
468 Ga0207646_10000925 3300025922 Bacteria 37781
469 Ga0207646_10018784 3300025922 Bacteria 6441
470 Ga0207646_10018999 3300025922 Bacteria 6399
471 Ga0207646_10049477 3300025922 Unclassified 3765
472 Ga0207646_10088317 3300025922 Bacteria 2774
473 Ga0207646_10105923 3300025922 Unclassified 2522
474 Ga0207646_10264346 3300025922 Bacteria 1555
475 Ga0207646_10477104 3300025922 Unclassified 1125
476 Ga0207646_10549703 3300025922 Bacteria 1038
477 Ga0207681_10006654 3300025923 Bacteria 7097
478 Ga0207681_10046696 3300025923 Unclassified 2914
479 Ga0207681_10159312 3300025923 Unclassified 1699
480 Ga0207681_10163087 3300025923 Unclassified 1682
481 Ga0207681_10255155 3300025923 Unclassified 1371
482 Ga0207681_10476512 3300025923 Bacteria 1019
483 Ga0207650_10071088 3300025925 Bacteria 2617
484 Ga0207650_10075546 3300025925 Unclassified 2543
485 Ga0207659_10002784 3300025926 Bacteria 10428
486 Ga0207659_10005479 3300025926 Bacteria 7699
487 Ga0207659_10007171 3300025926 Bacteria 6842
488 Ga0207659_10048418 3300025926 Bacteria 3011
489 Ga0207659_10072306 3300025926 Bacteria 2521
490 Ga0207659_10074765 3300025926 Bacteria 2484
491 Ga0207659_10098027 3300025926 Bacteria 2203
492 Ga0207659_10107845 3300025926 Bacteria 2112
493 Ga0207659_10173548 3300025926 Bacteria 1702
494 Ga0207659_10175712 3300025926 Unclassified 1692
495 Ga0207659_10393346 3300025926 Unclassified 1158
496 Ga0207687_10205483 3300025927 Bacteria 1542
497 Ga0207687_10861319 3300025927 Unclassified 774
498 Ga0207700_10072142 3300025928 Bacteria 2661
499 Ga0207700_10158445 3300025928 Unclassified 1878
500 Ga0207700_10363522 3300025928 Bacteria 1262
501 Ga0207664_10037918 3300025929 Bacteria 3734
502 Ga0207664_10193629 3300025929 Bacteria 1751
503 Ga0207664_10533484 3300025929 Bacteria 1052
504 Ga0207644_10008161 3300025931 Bacteria 6859
505 Ga0207644_10109485 3300025931 Unclassified 2087
506 Ga0207644_10259397 3300025931 Bacteria 1389
507 Ga0207644_10262980 3300025931 Unclassified 1380
508 Ga0207690_10002749 3300025932 Bacteria 10627
509 Ga0207690_10023034 3300025932 Bacteria 3882
510 Ga0207690_10169693 3300025932 Bacteria 1633
511 Ga0207690_10403814 3300025932 Unclassified 1090
512 Ga0207706_10000188 3300025933 Bacteria 68890
513 Ga0207706_10016526 3300025933 Bacteria 6660
514 Ga0207706_10045646 3300025933 Bacteria 3881
515 Ga0207706_10076858 3300025933 Bacteria 2936
516 Ga0207706_10138950 3300025933 Bacteria 2137
517 Ga0207706_10172663 3300025933 Bacteria 1899
518 Ga0207706_10459746 3300025933 Bacteria 1100
519 Ga0207686_10005884 3300025934 Bacteria 6582
520 Ga0207686_10218869 3300025934 Bacteria 1373
521 Ga0207686_10294801 3300025934 Bacteria 1202
522 Ga0207709_10303355 3300025935 Unclassified 1188
523 Ga0207670_10019155 3300025936 Bacteria 4173
524 Ga0207670_10022746 3300025936 Bacteria 3890
525 Ga0207670_10397484 3300025936 Bacteria 1101
526 Ga0207669_10006416 3300025937 Bacteria 5374
527 Ga0207669_10013117 3300025937 Bacteria 4103
528 Ga0207669_10260257 3300025937 Unclassified 1297
529 Ga0207704_10119008 3300025938 Bacteria 1803
530 Ga0207704_10627582 3300025938 Bacteria 883
531 Ga0207665_10058162 3300025939 Bacteria 2613
532 Ga0207665_10060956 3300025939 Bacteria 2556
533 Ga0207665_10093409 3300025939 Bacteria 2089
534 Ga0207665_10108711 3300025939 Bacteria 1946
535 Ga0207665_10305575 3300025939 Unclassified 1190
536 Ga0207665_10378695 3300025939 Unclassified 1074
537 Ga0207691_10000701 3300025940 Bacteria 33170
538 Ga0207691_10015640 3300025940 Bacteria 7211
539 Ga0207691_10051282 3300025940 Bacteria 3773
540 Ga0207691_10069262 3300025940 Bacteria 3187
541 Ga0207691_10072407 3300025940 Bacteria 3108
542 Ga0207691_10087884 3300025940 Bacteria 2788
543 Ga0207691_10132486 3300025940 Unclassified 2201
544 Ga0207711_10178744 3300025941 Bacteria 1928
545 Ga0207689_10845754 3300025942 Bacteria 772
546 Ga0207661_10019238 3300025944 Bacteria 5086
547 Ga0207661_10122603 3300025944 Bacteria 2215
548 Ga0207661_10287921 3300025944 Bacteria 1470
549 Ga0207679_10058395 3300025945 Bacteria 2859
550 Ga0207679_10066701 3300025945 Bacteria 2697
551 Ga0207679_10413966 3300025945 Unclassified 1188
552 Ga0207651_10005845 3300025960 Bacteria 6361
553 Ga0207651_10020349 3300025960 Unclassified 4003
554 Ga0207651_10050688 3300025960 Bacteria 2820
555 Ga0207651_10259750 3300025960 Bacteria 1425
556 Ga0207651_10281618 3300025960 Unclassified 1374
557 Ga0207651_10288692 3300025960 Bacteria 1359
558 Ga0207651_10351669 3300025960 Bacteria 1241
559 Ga0207651_10371128 3300025960 Bacteria 1210
560 Ga0207712_10002700 3300025961 Bacteria 11328
561 Ga0207712_10022117 3300025961 Bacteria 4184
562 Ga0207712_10095695 3300025961 Bacteria 2196
563 Ga0207712_10439587 3300025961 Bacteria 1104
564 Ga0207668_10005123 3300025972 Bacteria 7710
565 Ga0207668_10031009 3300025972 Bacteria 3517
566 Ga0207668_10039445 3300025972 Bacteria 3179
567 Ga0207668_10116779 3300025972 Bacteria 2013
568 Ga0207658_10004530 3300025986 Bacteria 9650
569 Ga0207658_10015104 3300025986 Bacteria 5296
570 Ga0207658_10065267 3300025986 Bacteria 2733
571 Ga0207658_10300830 3300025986 Bacteria 1382
572 Ga0207658_10659906 3300025986 Unclassified 943
573 Ga0207677_10026383 3300026023 Unclassified 3642
574 Ga0207677_10175449 3300026023 Bacteria 1680
575 Ga0207677_10202382 3300026023 Bacteria 1579
576 Ga0207703_10003597 3300026035 Bacteria 12943
577 Ga0207703_10003667 3300026035 Bacteria 12802
578 Ga0207703_10740507 3300026035 Bacteria 936
579 Ga0207703_10996945 3300026035 Bacteria 804
580 Ga0207639_10103904 3300026041 Bacteria 2302
581 Ga0207678_10003433 3300026067 Bacteria 14278
582 Ga0207708_10064110 3300026075 Bacteria 2807
583 Ga0207702_10256284 3300026078 Bacteria 1645
584 Ga0207702_10515426 3300026078 Bacteria 1167
585 Ga0207641_10097556 3300026088 Bacteria 2583
586 Ga0207641_11220985 3300026088 Unclassified 752
587 Ga0207648_10005881 3300026089 Bacteria 12274
588 Ga0207648_10095028 3300026089 Bacteria 2607
589 Ga0207648_10210856 3300026089 Bacteria 1724
590 Ga0207648_10343891 3300026089 Unclassified 1344
591 Ga0207676_10301446 3300026095 Unclassified 1463
592 Ga0207676_10361470 3300026095 Unclassified 1345
593 Ga0207675_100271294 3300026118 Bacteria 1646
594 Ga0207675_100402868 3300026118 Bacteria 1348
595 Ga0207683_10000956 3300026121 Bacteria 26510
596 Ga0207683_10021156 3300026121 Bacteria 5567
597 Ga0207683_10058985 3300026121 Bacteria 3370
598 Ga0207683_10064527 3300026121 Unclassified 3227
599 Ga0207683_10154283 3300026121 Unclassified 2074
600 Ga0207683_10627132 3300026121 Bacteria 996
601 Ga0207698_10497392 3300026142 Bacteria 1186
602 Ga0209179_1059167 3300027512 Unclassified 830
603 Ga0209998_10053772 3300027717 Bacteria 937
604 Ga0209974_10006217 3300027876 Bacteria 4179
605 Ga0268266_10000031 3300028379 Bacteria 406292
606 Ga0268266_10004338 3300028379 Bacteria 13628
607 Ga0268266_10007108 3300028379 Bacteria 10155
608 Ga0268266_10194531 3300028379 Unclassified 1853
609 Ga0268266_10304443 3300028379 Bacteria 1488
610 Ga0268266_10324673 3300028379 Bacteria 1441
611 Ga0268266_10353031 3300028379 Bacteria 1382
612 Ga0268265_10026139 3300028380 Bacteria 4150
613 Ga0268265_10222869 3300028380 Unclassified 1651
614 Ga0268265_10361226 3300028380 Bacteria 1329
615 Ga0268264_10025901 3300028381 Unclassified 4788
616 Ga0268264_10101091 3300028381 Bacteria 2505
617 Ga0268264_10475400 3300028381 Bacteria 1215
618 Ga0316177_1042747 3300030731 Bacteria 843
619 Ga0307405_10326327 3300031731 Bacteria 1174
620 Ga0307413_10131017 3300031824 Bacteria 1716
621 Ga0307409_100531863 3300031995 Bacteria 1150
622 Ga0307416_100034273 3300032002 Bacteria 3861
623 Ga0307414_10114151 3300032004 Bacteria 2063
624 Ga0307415_101045744 3300032126 Bacteria 761
625 Ga0373934_0263216 3300035086 Unclassified 714
626 Ga0373944_0097695 3300035089 Bacteria 989
627 Ga0373923_0153933 3300035111 Bacteria 1046
628 Ga0373939_0069843 3300035114 Unclassified 1141
629 Ga0373941_0094849 3300035115 Bacteria 1030
630 Ga0373943_0076845 3300035170 Unclassified 1704
631 Ga0373943_0123301 3300035170 Bacteria 1379
632 Ga0373943_0235650 3300035170 Bacteria 1024
633 Ga0373943_0278161 3300035170 Unclassified 946
634 Ga0373946_0191322 3300035171 Bacteria 976
635 Ga0373955_0190003 3300035172 Unclassified 1221
636 Ga0373931_0052126 3300035691 Bacteria 2181
637 Ga0373931_0366462 3300035691 Unclassified 905
638 Ga0373935_0080670 3300035692 Bacteria 2114
639 Ga0373935_0187848 3300035692 Bacteria 1422
640 Ga0373935_0557542 3300035692 Bacteria 835
641 Ga0373927_0061848 3300035695 Bacteria 2422
642 Ga0373933_0189731 3300035724 Bacteria 1313
643 Ga0373947_0083067 3300035725 Unclassified 1986
644 Ga0373947_0086384 3300035725 Bacteria 1950
645 Ga0373947_0127835 3300035725 Bacteria 1620
646 Ga0373947_0130464 3300035725 Bacteria 1604
647 Ga0373947_0304246 3300035725 Bacteria 1064
648 Ga0373947_0414122 3300035725 Bacteria 910
649 Ga0373937_0111985 3300036401 Unclassified 2539
650 Ga0373925_0141207 3300037068 Bacteria 1885
651 Ga0373925_0500198 3300037068 Bacteria 998
652 Ga0373925_0780592 3300037068 Bacteria 788
653 Ga0395900_0004035 3300037418 Bacteria 15667
654 Ga0395900_0224499 3300037418 Bacteria 1892
655 Ga0395900_0361843 3300037418 Bacteria 1422
656 Ga0395898_0019143 3300037466 Bacteria 6970
657 Ga0395905_0196138 3300037471 Bacteria 1893
658 Ga0395905_0464077 3300037471 Bacteria 1165
659 Ga0395901_0000998 3300038443 Bacteria 30593
660 Ga0395901_0018822 3300038443 Bacteria 7059
661 Ga0395901_0066015 3300038443 Bacteria 3769
662 Ga0395901_0371114 3300038443 Bacteria 1474
663 Ga0400483_012820 3300039062 Bacteria 1186
664 Ga0400483_260540 3300039062 Unclassified 1372
665 Ga0436363_0483572 3300039450 Bacteria 1787
666 Ga0439465_0042900 3300041413 Bacteria 1467
667 Ga0451577_0046326 3300042876 Bacteria 3891
668 Ga0451577_0046605 3300042876 Bacteria 3878
669 Ga0439440_0015709 3300042993 Bacteria 1649
670 Ga0466965_0133134 3300044683 Bacteria 1290
671 Ga0466963_0075392 3300044694 Bacteria 2276
672 Ga0466963_0120377 3300044694 Bacteria 1806
673 Ga0466964_0041029 3300044706 Unclassified 1870
674 Ga0453684_0000737 3300044712 Bacteria 114674
675 Ga0453684_0036025 3300044712 Bacteria 6826
676 Ga0453684_0515898 3300044712 Bacteria 1321
677 Ga0466971_0001103 3300044719 Bacteria 11208
678 Ga0466968_0055095 3300044735 Bacteria 1706
679 Ga0451576_0161799 3300045051 Bacteria 2336
680 Ga0451576_0221092 3300045051 Bacteria 1977
681 Ga0451576_0469499 3300045051 Bacteria 1321
682 Ga0466967_0096957 3300045976 Unclassified 2691
683 Ga0466967_0223318 3300045976 Bacteria 1791
684 Ga0495592_0080290 3300046454 Unclassified 2360
685 Ga0495603_0461067 3300046455 Unclassified 728
686 Ga0495651_0270684 3300046462 Bacteria 1152
687 Ga0495580_0001088 3300046472 Bacteria 23858
688 Ga0495580_0300702 3300046472 Bacteria 1093
689 Ga0495582_0000609 3300046473 Bacteria 19727
690 Ga0495664_0347479 3300046477 Unclassified 893
691 Ga0495584_0414512 3300046491 Bacteria 685
692 Ga0495594_0000905 3300046499 Bacteria 15363
693 Ga0495608_0217808 3300046511 Bacteria 1199
694 Ga0495618_0108217 3300046514 Unclassified 1780
695 Ga0495618_0183398 3300046514 Bacteria 1329
696 Ga0495630_0142002 3300046517 Unclassified 1826
697 Ga0495643_0000114 3300046522 Bacteria 131108
698 Ga0495652_0100157 3300046529 Unclassified 2351
699 Ga0495652_0137704 3300046529 Unclassified 1924
700 Ga0495665_0293181 3300046531 Bacteria 834
701 Ga0495640_0114751 3300046533 Unclassified 1756
702 Ga0495586_0147613 3300046535 Bacteria 1322
703 Ga0495587_0075006 3300046536 Unclassified 1964
704 Ga0495587_0265497 3300046536 Bacteria 964
705 Ga0495587_0329282 3300046536 Unclassified 853
706 Ga0495598_0253384 3300046537 Bacteria 653
707 Ga0495645_0034806 3300046543 Bacteria 3672
708 Ga0495645_0252616 3300046543 Bacteria 1171
709 Ga0495667_0050374 3300046559 Unclassified 2750
710 Ga0495668_0533150 3300046616 Bacteria 648
711 Ga0495634_0218037 3300046642 Bacteria 1179
712 Ga0495635_0076852 3300046663 Unclassified 2288
713 Ga0495599_0009817 3300046678 Bacteria 5858
714 Ga0495623_0243615 3300046679 Unclassified 1014
715 Ga0495646_0200965 3300046680 Bacteria 1085
716 Ga0495647_0065125 3300046681 Unclassified 1447
717 Ga0495658_0021507 3300046683 Bacteria 3401
718 Ga0495669_0071474 3300046684 Bacteria 1582
719 Ga0495669_0079928 3300046684 Bacteria 1500
720 Ga0495624_0121367 3300046690 Unclassified 1605
721 Ga0495581_0102181 3300047315 Bacteria 1666
722 Ga0495604_0086851 3300047317 Unclassified 2331
723 Ga0495604_0450486 3300047317 Bacteria 841
724 Ga0495674_0170177 3300047319 Unclassified 1818
725 Ga0495674_0577336 3300047319 Bacteria 893
726 Ga0495675_0116630 3300047444 Unclassified 1665
727 Ga0495675_0135444 3300047444 Bacteria 1529
728 Ga0495675_0209418 3300047444 Bacteria 1184
729 Ga0495684_0026773 3300047471 Bacteria 4431
730 Ga0495684_0178662 3300047471 Unclassified 1574
731 Ga0495602_0136110 3300048088 Unclassified 1951
732 Ga0496100_0002862 3300048903 Bacteria 8839
733 Ga0496100_0761353 3300048903 Unclassified 758
734 Ga0496101_0053961 3300048904 Bacteria 2901
735 Ga0496101_0607484 3300048904 Bacteria 865
736 Ga0496102_0016965 3300048905 Bacteria 6372
737 Ga0496102_0099463 3300048905 Unclassified 2700
738 Ga0496102_0228962 3300048905 Bacteria 1752
739 Ga0496102_1206721 3300048905 Bacteria 676
740 Ga0496103_0021096 3300048906 Bacteria 3919
741 Ga0496104_0017668 3300048907 Bacteria 6501
742 Ga0496104_0069145 3300048907 Bacteria 3356
743 Ga0496104_0099240 3300048907 Unclassified 2788
744 Ga0496105_0067713 3300048908 Bacteria 2948
745 Ga0496105_0117254 3300048908 Unclassified 2196
746 Ga0496105_0357670 3300048908 Bacteria 1165
747 Ga0496105_0629537 3300048908 Unclassified 830
748 Ga0496106_0057256 3300048909 Bacteria 2947
749 Ga0496107_0010608 3300048910 Bacteria 6405
750 Ga0496107_0100637 3300048910 Unclassified 2119
751 Ga0496107_0375550 3300048910 Bacteria 1057
752 Ga0496107_0510062 3300048910 Unclassified 892
753 Ga0496108_0140860 3300048911 Unclassified 2078
754 Ga0496109_0061407 3300048912 Bacteria 3436
755 Ga0496109_0929166 3300048912 Unclassified 808
756 Ga0496110_0047306 3300048913 Bacteria 3766
757 Ga0496110_0262184 3300048913 Bacteria 1573
758 Ga0496110_0522475 3300048913 Unclassified 1080
759 Ga0496111_0152131 3300048914 Bacteria 1716
760 Ga0496112_0042820 3300048915 Unclassified 4431
761 Ga0496112_0090753 3300048915 Bacteria 3024
762 Ga0496112_0172086 3300048915 Bacteria 2131
763 Ga0496112_0255242 3300048915 Bacteria 1704
764 Ga0496112_0351301 3300048915 Unclassified 1417
765 Ga0496112_0355012 3300048915 Unclassified 1408
766 Ga0496112_0381012 3300048915 Bacteria 1351
767 Ga0496112_0437944 3300048915 Unclassified 1245
768 Ga0496113_0229935 3300048916 Bacteria 1479
769 Ga0496113_0552820 3300048916 Unclassified 923
770 Ga0496114_0018483 3300048917 Bacteria 5637
771 Ga0496114_0019073 3300048917 Bacteria 5558
772 Ga0496114_0109958 3300048917 Unclassified 2360
773 Ga0496114_0295367 3300048917 Bacteria 1430
774 Ga0496115_0004087 3300048918 Bacteria 10544
775 Ga0496115_0005586 3300048918 Bacteria 9152
776 Ga0496115_0083164 3300048918 Unclassified 2609
777 Ga0496115_0200715 3300048918 Bacteria 1648
778 Ga0496115_0255583 3300048918 Bacteria 1442
779 Ga0496115_0327778 3300048918 Bacteria 1251
780 Ga0496115_0782753 3300048918 Bacteria 744
781 Ga0501031_0024640 3300049568 Bacteria 3922
782 Ga0501032_0308430 3300049569 Unclassified 1022
783 Ga0501033_0000227 3300049570 Bacteria 54233
784 Ga0501036_0059603 3300049572 Bacteria 3234
785 Ga0501037_0000082 3300049573 Bacteria 86538
786 Ga0501038_0003342 3300049574 Bacteria 14958
787 Ga0501039_0001111 3300049575 Bacteria 19793
788 Ga0501043_0000170 3300049579 Bacteria 58695
789 Ga0501043_0008673 3300049579 Bacteria 8003
790 Ga0501047_0032352 3300049581 Bacteria 5048
791 Ga0501070_0137289 3300049586 Bacteria 2019
792 Ga0501071_0029657 3300049587 Bacteria 3863
793 Ga0501035_0000002 3300049822 Bacteria 585447
794 Ga0501044_0002437 3300049823 Bacteria 21218
795 nmdc:mga05p37_1728_c1 3300050507 Bacteria 25493
796 nmdc:mga05p37_222672_c1 3300050507 Bacteria 2276
797 nmdc:mga08y16_177878_c1 3300050511 Bacteria 2209
798 nmdc:mga08y16_363195_c1 3300050511 Bacteria 1486
799 nmdc:mga0n895_865536_c1 3300050512 Bacteria 891
800 nmdc:mga0rr50_1046161_c1 3300050513 Bacteria 695
801 nmdc:mga0rr50_191170_c1 3300050513 Unclassified 1677
802 nmdc:mga08x19_6381_c1 3300050514 Bacteria 6980
803 nmdc:mga0a205_309339_c1 3300050515 Unclassified 1452
804 nmdc:mga0a205_671309_c1 3300050515 Unclassified 887
805 Ga0495601_0007125 3300053077 Bacteria 6552
806 Ga0495601_0091758 3300053077 Unclassified 1956
807 Ga0495612_0039666 3300053078 Bacteria 1916
808 Ga0500555_000016 3300053103 Bacteria 203144
809 Ga0500616_0000988 3300053153 Bacteria 30726
810 Ga0500616_0025273 3300053153 Bacteria 3295
811 Ga0466962_0000080 3300061719 Bacteria 38429
812 Ga0373933_0224430
813 SwRhRL2b_contig_1925602
814 CNXas_1000032
815 JGI24746J21847_1004796
816 JGI24737J22298_10031574
817 JGI24737J22298_10112436
818 JGI24743J22301_10050390
819 JGI24035J26624_1001767
820 JGI24035J26624_1005034
821 JGI25406J46586_10000067
822 JGI25405J52794_10000545
823 Ga0065704_10002125
824 Ga0065704_10010972
825 Ga0065704_10100547
826 Ga0065704_10117366
827 Ga0065704_10127098
828 Ga0065712_10116444
829 Ga0065712_10145340
830 Ga0065712_10412688
831 Ga0065715_10005105
832 Ga0065715_10021659
833 Ga0065715_10100199
834 Ga0065715_10263650
835 Ga0065715_10323647
836 Ga0065715_10329070
837 Ga0065707_10004715
838 Ga0065707_10037229
839 Ga0065707_10170990
840 Ga0065707_10246755
841 Ga0070676_10003991
842 Ga0070676_10060105
843 Ga0070676_10125997
844 Ga0070676_10240657
845 Ga0070676_10246248
846 Ga0070676_10516783
847 Ga0070683_100042548
848 Ga0070683_100094596
849 Ga0070683_100895519
850 Ga0070690_100062396
851 Ga0070690_100090341
852 Ga0070690_100103601
853 Ga0070690_100223846
854 Ga0070690_100260899
855 Ga0070670_100002690
856 Ga0070677_10014707
857 Ga0068869_100543509
858 Ga0070666_10002044
859 Ga0070666_10148094
860 Ga0070666_10185876
861 Ga0068868_100047031
862 Ga0068868_100128866
863 Ga0070660_100244259
864 Ga0070660_100741479
865 Ga0070689_100005579
866 Ga0070689_100011679
867 Ga0070689_100101999
868 Ga0070689_100985453
869 Ga0070689_101044459
870 Ga0070687_100000532
871 Ga0070687_100297117
872 Ga0070661_100036936
873 Ga0070661_100213856
874 Ga0070661_100256672
875 Ga0070692_10189823
876 Ga0070668_100003567
877 Ga0070668_100005061
878 Ga0070668_100014650
879 Ga0070668_100040112
880 Ga0070668_100286034
881 Ga0070668_100670126
882 Ga0070669_100012470
883 Ga0070669_100020039
884 Ga0070669_100027129
885 Ga0070669_100739206
886 Ga0070675_100000800
887 Ga0070675_100003333
888 Ga0070675_100018699
889 Ga0070675_100059661
890 Ga0070675_100059971
891 Ga0070675_100128420
892 Ga0070675_100158243
893 Ga0070675_100297309
894 Ga0070671_100003803
895 Ga0070671_100010844
896 Ga0070671_100033560
897 Ga0070671_100204669
898 Ga0070671_100350480
899 Ga0070671_100431036
900 Ga0070674_100007782
901 Ga0070674_100043245
902 Ga0070673_100004127
903 Ga0070673_100007695
904 Ga0070673_100021847
905 Ga0070673_100025303
906 Ga0070673_100097377
907 Ga0070673_100208643
908 Ga0070688_100000621
909 Ga0070688_100020654
910 Ga0070688_100046314
911 Ga0070688_100525831
912 Ga0070688_100534370
913 Ga0070659_100016047
914 Ga0070667_100009056
915 Ga0070667_100022604
916 Ga0070667_100034224
917 Ga0070667_100228150
918 Ga0070667_100240290
919 Ga0070667_100272573
920 Ga0070703_10006701
921 Ga0070703_10061495
922 Ga0070709_10040051
923 Ga0070714_100058473
924 Ga0070714_100141051
925 Ga0070714_100587793
926 Ga0070714_100798682
927 Ga0070713_100192867
928 Ga0070710_10630516
929 Ga0070701_10026804
930 Ga0070701_10062971
931 Ga0070711_100081920
932 Ga0070705_100244569
933 Ga0070705_100443943
934 Ga0070700_100029511
935 Ga0070694_100006500
936 Ga0070694_100034600
937 Ga0070708_100009081
938 Ga0070708_100013237
939 Ga0070708_100050292
940 Ga0070708_100059790
941 Ga0070708_100092401
942 Ga0070708_100181420
943 Ga0070708_100223150
944 Ga0070708_100312414
945 Ga0070708_100736785
946 Ga0070708_100855034
947 Ga0070708_100893936
948 Ga0070708_101270254
949 Ga0070663_100132282
950 Ga0070678_100002933
951 Ga0070678_100047630
952 Ga0070678_100343406
953 Ga0070662_100001248
954 Ga0070662_100190260
955 Ga0070662_100667563
956 Ga0070681_10025041
957 Ga0068867_100038574
958 Ga0068867_100045690
959 Ga0068867_100154449
960 Ga0070685_10022977
961 Ga0070685_10076742
962 Ga0070706_100000227
963 Ga0070706_100001536
964 Ga0070706_100006339
965 Ga0070706_100012642
966 Ga0070706_100033974
967 Ga0070706_100080958
968 Ga0070706_100094407
969 Ga0070706_100242806
970 Ga0070706_100265682
971 Ga0070706_100316879
972 Ga0070706_100355014
973 Ga0070706_100359938
974 Ga0070706_100619038
975 Ga0070707_100049683
976 Ga0070707_100052130
977 Ga0070707_100125418
978 Ga0070707_100132686
979 Ga0070707_100154274
980 Ga0070707_100234337
981 Ga0070707_100342903
982 Ga0070707_100424734
983 Ga0070707_100501440
984 Ga0070707_100647816
985 Ga0070707_100773660
986 Ga0070707_100817351
987 Ga0070698_100011183
988 Ga0070698_100012644
989 Ga0070698_100014761
990 Ga0070699_100057478
991 Ga0070699_100068033
992 Ga0070699_100083652
993 Ga0070699_100100250
994 Ga0070699_100151243
995 Ga0070699_100187658
996 Ga0070699_100621590
997 Ga0070679_100037540
998 Ga0070684_100000230
999 Ga0070684_100011931
1000 Ga0070684_100073522
1001 Ga0070684_100773643
1002 Ga0070697_100000640
1003 Ga0070697_100001810
1004 Ga0070697_100012250
1005 Ga0070697_100014557
1006 Ga0070697_100019134
1007 Ga0070697_100019752
1008 Ga0070697_100039216
1009 Ga0070697_100088907
1010 Ga0070697_100091775
1011 Ga0070697_100102487
1012 Ga0070697_100350587
1013 Ga0070697_100405974
1014 Ga0070672_100006079
1015 Ga0070672_100023736
1016 Ga0070672_100025838
1017 Ga0070672_100228567
1018 Ga0070672_100273200
1019 Ga0070672_100299164
1020 Ga0070686_100433967
1021 Ga0070695_100359243
1022 Ga0070696_100056918
1023 Ga0070693_100054334
1024 Ga0070665_100042759
1025 Ga0070665_100051907
1026 Ga0070665_100054112
1027 Ga0070665_100076204
1028 Ga0070665_100177204
1029 Ga0070665_100183921
1030 Ga0070665_100315931
1031 Ga0070665_100824782
1032 Ga0070704_100001031
1033 Ga0070704_100440432
1034 Ga0068855_100515826
1035 Ga0070664_100098766
1036 Ga0070664_100202370
1037 Ga0070664_100348878
1038 Ga0070664_100726141
1039 Ga0068856_100016596
1040 Ga0070702_100048251
1041 Ga0070702_100675412
1042 Ga0068852_100565794
1043 Ga0068864_100081207
1044 Ga0068866_10027744
1045 Ga0068866_10451087
1046 Ga0068863_100015159
1047 Ga0068858_100001678
1048 Ga0068858_100002353
1049 Ga0068858_100549661
1050 Ga0068860_100114018
1051 Ga0068860_100116100
1052 Ga0068860_100214393
1053 Ga0068860_100395673
1054 Ga0068862_100008618
1055 Ga0068862_100243203
1056 Ga0081455_10001703
1057 Ga0081455_10001745
1058 Ga0081455_10010995
1059 Ga0081455_10074912
1060 Ga0081455_10118118
1061 Ga0081455_10177519
1062 Ga0081455_10459080
1063 Ga0081540_1000437
1064 Ga0081540_1007907
1065 Ga0081540_1062621
1066 Ga0081539_10000287
1067 Ga0081539_10000621
1068 Ga0081539_10025018
1069 Ga0081539_10051779
1070 Ga0070717_10005952
1071 Ga0070717_10024471
1072 Ga0070717_10048500
1073 Ga0070717_10055646
1074 Ga0070717_10057975
1075 Ga0070717_10104447
1076 Ga0070717_10112906
1077 Ga0070717_10234777
1078 Ga0070717_10270190
1079 Ga0070717_10414115
1080 Ga0070717_10682713
1081 Ga0070715_10336635
1082 Ga0070716_100112460
1083 Ga0070716_100120800
1084 Ga0070716_100251424
1085 Ga0070712_100032172
1086 Ga0070712_100056078
1087 Ga0070712_100075678
1088 Ga0070712_100078432
1089 Ga0070712_100080217
1090 Ga0070712_100117694
1091 Ga0070712_100198204
1092 Ga0070712_100375735
1093 Ga0070712_100636899
1094 Ga0070712_100845427
1095 Ga0097621_100017406
1096 Ga0097621_100088344
1097 Ga0097621_100130785
1098 Ga0068871_100010934
1099 Ga0068871_100050694
1100 Ga0068871_100162593
1101 Ga0068871_100435588
1102 Ga0068871_100494899
1103 Ga0068871_100675311
1104 Ga0075433_10184947
1105 Ga0075433_10237240
1106 Ga0075433_10313871
1107 Ga0075434_100476365
1108 Ga0075434_101071184
1109 Ga0068865_100168209
1110 Ga0075436_100010844
1111 Ga0075436_100129430
1112 Ga0075435_100272786
1113 Ga0075435_100327447
1114 Ga0099795_10089245
1115 Ga0099795_10340755
1116 Ga0105240_10029117
1117 Ga0105240_10409715
1118 Ga0111539_10201444
1119 Ga0105245_10010327
1120 Ga0105247_10112987
1121 Ga0114129_10004895
1122 Ga0114129_10280608
1123 Ga0114129_10537557
1124 Ga0105243_10342715
1125 Ga0105242_10008800
1126 Ga0105242_10171629
1127 Ga0105242_10383673
1128 Ga0105248_10085246
1129 Ga0105248_11057800
1130 Ga0105237_10020734
1131 Ga0105237_10241007
1132 Ga0105237_10968854
1133 Ga0105249_10003062
1134 Ga0105249_10034778
1135 Ga0105249_10060224
1136 Ga0099796_10146036
1137 Ga0105239_10012805
1138 Ga0105239_10035273
1139 Ga0105239_10375110
1140 Ga0105239_10516453
1141 Ga0105239_10705775
1142 Ga0105239_10734157
1143 Ga0157346_1010875
1144 Ga0157347_1025576
1145 Ga0157371_10213717
1146 Ga0157371_10453814
1147 Ga0157370_10185263
1148 Ga0157374_10000068
1149 Ga0157374_10004587
1150 Ga0157374_10005441
1151 Ga0157374_10015983
1152 Ga0157374_10040135
1153 Ga0157374_10058052
1154 Ga0157374_10086120
1155 Ga0157374_10195063
1156 Ga0157374_10255521
1157 Ga0157374_10274258
1158 Ga0157374_10429921
1159 Ga0157378_10005429
1160 Ga0157378_10016462
1161 Ga0157378_10033584
1162 Ga0157378_10036119
1163 Ga0157378_10041698
1164 Ga0157378_10044064
1165 Ga0157378_10157817
1166 Ga0157378_10165237
1167 Ga0157378_10175101
1168 Ga0157378_10202204
1169 Ga0157378_10314914
1170 Ga0157378_10357537
1171 Ga0157378_10799979
1172 Ga0163162_10002701
1173 Ga0163162_10007809
1174 Ga0163162_10011424
1175 Ga0163162_10023089
1176 Ga0163162_10076339
1177 Ga0163162_10096704
1178 Ga0163162_10096814
1179 Ga0163162_10274383
1180 Ga0157372_10036367
1181 Ga0157372_10233647
1182 Ga0157372_10476927
1183 Ga0157375_10002103
1184 Ga0157375_10002145
1185 Ga0157375_10007613
1186 Ga0157375_10007724
1187 Ga0157375_10009633
1188 Ga0157375_10065220
1189 Ga0157375_10074631
1190 Ga0157375_10091057
1191 Ga0157375_10326004
1192 Ga0157375_10429539
1193 Ga0163163_10178409
1194 Ga0163163_10262610
1195 Ga0163163_10639788
1196 Ga0157380_11681875
1197 Ga0182008_10022323
1198 Ga0157377_10118189
1199 Ga0157377_10168089
1200 Ga0157379_10368660
1201 Ga0157379_10498264
1202 Ga0157376_10001598
1203 Ga0157376_10003774
1204 Ga0157376_10077971
1205 Ga0157376_10130270
1206 Ga0157376_10218726
1207 Ga0157376_10420639
1208 Ga0157376_10508480
1209 Ga0182006_1131722
1210 Ga0163161_10003776
1211 Ga0163161_10013881
1212 Ga0213874_10062731
1213 Ga0207666_1000587
1214 Ga0207673_1001785
1215 Ga0207673_1006360
1216 Ga0207673_1006829
1217 Ga0207697_10000281
1218 Ga0207697_10000496
1219 Ga0207697_10000868
1220 Ga0207697_10000876
1221 Ga0207697_10001461
1222 Ga0207697_10007026
1223 Ga0207697_10016269
1224 Ga0207697_10026017
1225 Ga0207697_10048027
1226 Ga0207653_10009899
1227 Ga0207682_10009209
1228 Ga0207682_10140594
1229 Ga0207692_10064018
1230 Ga0207692_10089602
1231 Ga0207642_10285994
1232 Ga0207688_10003305
1233 Ga0207688_10185043
1234 Ga0207680_10001473
1235 Ga0207680_10096509
1236 Ga0207680_10415348
1237 Ga0207647_10034060
1238 Ga0207685_10109286
1239 Ga0207699_10513232
1240 Ga0207645_10004008
1241 Ga0207645_10005947
1242 Ga0207645_10026736
1243 Ga0207645_10063650
1244 Ga0207645_10131366
1245 Ga0207645_10215034
1246 Ga0207684_10000205
1247 Ga0207684_10002005
1248 Ga0207684_10003655
1249 Ga0207684_10028263
1250 Ga0207684_10032430
1251 Ga0207684_10032588
1252 Ga0207684_10084831
1253 Ga0207684_10103635
1254 Ga0207684_10214066
1255 Ga0207684_10308167
1256 Ga0207684_10347487
1257 Ga0207684_10481335
1258 Ga0207684_10494042
1259 Ga0207684_10617966
1260 Ga0207684_10626171
1261 Ga0207707_10079230
1262 Ga0207695_10009328
1263 Ga0207695_10062816
1264 Ga0207671_10011128
1265 Ga0207693_10006434
1266 Ga0207693_10008083
1267 Ga0207693_10011275
1268 Ga0207693_10021447
1269 Ga0207693_10140540
1270 Ga0207693_10205768
1271 Ga0207693_10669106
1272 Ga0207663_10394868
1273 Ga0207660_10506889
1274 Ga0207662_10000089
1275 Ga0207662_10133324
1276 Ga0207657_10075271
1277 Ga0207649_10112684
1278 Ga0207649_10189288
1279 Ga0207646_10000925
1280 Ga0207646_10018784
1281 Ga0207646_10018999
1282 Ga0207646_10049477
1283 Ga0207646_10088317
1284 Ga0207646_10105923
1285 Ga0207646_10264346
1286 Ga0207646_10477104
1287 Ga0207646_10549703
1288 Ga0207681_10006654
1289 Ga0207681_10046696
1290 Ga0207681_10159312
1291 Ga0207681_10163087
1292 Ga0207681_10255155
1293 Ga0207681_10476512
1294 Ga0207650_10071088
1295 Ga0207650_10075546
1296 Ga0207659_10002784
1297 Ga0207659_10005479
1298 Ga0207659_10007171
1299 Ga0207659_10048418
1300 Ga0207659_10072306
1301 Ga0207659_10074765
1302 Ga0207659_10098027
1303 Ga0207659_10107845
1304 Ga0207659_10173548
1305 Ga0207659_10175712
1306 Ga0207659_10393346
1307 Ga0207687_10205483
1308 Ga0207687_10861319
1309 Ga0207700_10072142
1310 Ga0207700_10158445
1311 Ga0207700_10363522
1312 Ga0207664_10037918
1313 Ga0207664_10193629
1314 Ga0207664_10533484
1315 Ga0207644_10008161
1316 Ga0207644_10109485
1317 Ga0207644_10259397
1318 Ga0207644_10262980
1319 Ga0207690_10002749
1320 Ga0207690_10023034
1321 Ga0207690_10169693
1322 Ga0207690_10403814
1323 Ga0207706_10000188
1324 Ga0207706_10016526
1325 Ga0207706_10045646
1326 Ga0207706_10076858
1327 Ga0207706_10138950
1328 Ga0207706_10172663
1329 Ga0207706_10459746
1330 Ga0207686_10005884
1331 Ga0207686_10218869
1332 Ga0207686_10294801
1333 Ga0207709_10303355
1334 Ga0207670_10019155
1335 Ga0207670_10022746
1336 Ga0207670_10397484
1337 Ga0207669_10006416
1338 Ga0207669_10013117
1339 Ga0207669_10260257
1340 Ga0207704_10119008
1341 Ga0207704_10627582
1342 Ga0207665_10058162
1343 Ga0207665_10060956
1344 Ga0207665_10093409
1345 Ga0207665_10108711
1346 Ga0207665_10305575
1347 Ga0207665_10378695
1348 Ga0207691_10000701
1349 Ga0207691_10015640
1350 Ga0207691_10051282
1351 Ga0207691_10069262
1352 Ga0207691_10072407
1353 Ga0207691_10087884
1354 Ga0207691_10132486
1355 Ga0207711_10178744
1356 Ga0207689_10845754
1357 Ga0207661_10019238
1358 Ga0207661_10122603
1359 Ga0207661_10287921
1360 Ga0207679_10058395
1361 Ga0207679_10066701
1362 Ga0207679_10413966
1363 Ga0207651_10005845
1364 Ga0207651_10020349
1365 Ga0207651_10050688
1366 Ga0207651_10259750
1367 Ga0207651_10281618
1368 Ga0207651_10288692
1369 Ga0207651_10351669
1370 Ga0207651_10371128
1371 Ga0207712_10002700
1372 Ga0207712_10022117
1373 Ga0207712_10095695
1374 Ga0207712_10439587
1375 Ga0207668_10005123
1376 Ga0207668_10031009
1377 Ga0207668_10039445
1378 Ga0207668_10116779
1379 Ga0207658_10004530
1380 Ga0207658_10015104
1381 Ga0207658_10065267
1382 Ga0207658_10300830
1383 Ga0207658_10659906
1384 Ga0207677_10026383
1385 Ga0207677_10175449
1386 Ga0207677_10202382
1387 Ga0207703_10003597
1388 Ga0207703_10003667
1389 Ga0207703_10740507
1390 Ga0207703_10996945
1391 Ga0207639_10103904
1392 Ga0207678_10003433
1393 Ga0207708_10064110
1394 Ga0207702_10256284
1395 Ga0207702_10515426
1396 Ga0207641_10097556
1397 Ga0207641_11220985
1398 Ga0207648_10005881
1399 Ga0207648_10095028
1400 Ga0207648_10210856
1401 Ga0207648_10343891
1402 Ga0207676_10301446
1403 Ga0207676_10361470
1404 Ga0207675_100271294
1405 Ga0207675_100402868
1406 Ga0207683_10000956
1407 Ga0207683_10021156
1408 Ga0207683_10058985
1409 Ga0207683_10064527
1410 Ga0207683_10154283
1411 Ga0207683_10627132
1412 Ga0207698_10497392
1413 Ga0209179_1059167
1414 Ga0209998_10053772
1415 Ga0209974_10006217
1416 Ga0268266_10000031
1417 Ga0268266_10004338
1418 Ga0268266_10007108
1419 Ga0268266_10194531
1420 Ga0268266_10304443
1421 Ga0268266_10324673
1422 Ga0268266_10353031
1423 Ga0268265_10026139
1424 Ga0268265_10222869
1425 Ga0268265_10361226
1426 Ga0268264_10025901
1427 Ga0268264_10101091
1428 Ga0268264_10475400
1429 Ga0316177_1042747
1430 Ga0307405_10326327
1431 Ga0307413_10131017
1432 Ga0307409_100531863
1433 Ga0307416_100034273
1434 Ga0307414_10114151
1435 Ga0307415_101045744
1436 Ga0373934_0263216
1437 Ga0373944_0097695
1438 Ga0373923_0153933
1439 Ga0373939_0069843
1440 Ga0373941_0094849
1441 Ga0373943_0076845
1442 Ga0373943_0123301
1443 Ga0373943_0235650
1444 Ga0373943_0278161
1445 Ga0373946_0191322
1446 Ga0373955_0190003
1447 Ga0373931_0052126
1448 Ga0373931_0366462
1449 Ga0373935_0080670
1450 Ga0373935_0187848
1451 Ga0373935_0557542
1452 Ga0373927_0061848
1453 Ga0373933_0189731
1454 Ga0373947_0083067
1455 Ga0373947_0086384
1456 Ga0373947_0127835
1457 Ga0373947_0130464
1458 Ga0373947_0304246
1459 Ga0373947_0414122
1460 Ga0373937_0111985
1461 Ga0373925_0141207
1462 Ga0373925_0500198
1463 Ga0373925_0780592
1464 Ga0395900_0004035
1465 Ga0395900_0224499
1466 Ga0395900_0361843
1467 Ga0395898_0019143
1468 Ga0395905_0196138
1469 Ga0395905_0464077
1470 Ga0395901_0000998
1471 Ga0395901_0018822
1472 Ga0395901_0066015
1473 Ga0395901_0371114
1474 Ga0400483_012820
1475 Ga0400483_260540
1476 Ga0436363_0483572
1477 Ga0439465_0042900
1478 Ga0451577_0046326
1479 Ga0451577_0046605
1480 Ga0439440_0015709
1481 Ga0466965_0133134
1482 Ga0466963_0075392
1483 Ga0466963_0120377
1484 Ga0466964_0041029
1485 Ga0453684_0000737
1486 Ga0453684_0036025
1487 Ga0453684_0515898
1488 Ga0466971_0001103
1489 Ga0466968_0055095
1490 Ga0451576_0161799
1491 Ga0451576_0221092
1492 Ga0451576_0469499
1493 Ga0466967_0096957
1494 Ga0466967_0223318
1495 Ga0495592_0080290
1496 Ga0495603_0461067
1497 Ga0495651_0270684
1498 Ga0495580_0001088
1499 Ga0495580_0300702
1500 Ga0495582_0000609
1501 Ga0495664_0347479
1502 Ga0495584_0414512
1503 Ga0495594_0000905
1504 Ga0495608_0217808
1505 Ga0495618_0108217
1506 Ga0495618_0183398
1507 Ga0495630_0142002
1508 Ga0495643_0000114
1509 Ga0495652_0100157
1510 Ga0495652_0137704
1511 Ga0495665_0293181
1512 Ga0495640_0114751
1513 Ga0495586_0147613
1514 Ga0495587_0075006
1515 Ga0495587_0265497
1516 Ga0495587_0329282
1517 Ga0495598_0253384
1518 Ga0495645_0034806
1519 Ga0495645_0252616
1520 Ga0495667_0050374
1521 Ga0495668_0533150
1522 Ga0495634_0218037
1523 Ga0495635_0076852
1524 Ga0495599_0009817
1525 Ga0495623_0243615
1526 Ga0495646_0200965
1527 Ga0495647_0065125
1528 Ga0495658_0021507
1529 Ga0495669_0071474
1530 Ga0495669_0079928
1531 Ga0495624_0121367
1532 Ga0495581_0102181
1533 Ga0495604_0086851
1534 Ga0495604_0450486
1535 Ga0495674_0170177
1536 Ga0495674_0577336
1537 Ga0495675_0116630
1538 Ga0495675_0135444
1539 Ga0495675_0209418
1540 Ga0495684_0026773
1541 Ga0495684_0178662
1542 Ga0495602_0136110
1543 Ga0496100_0002862
1544 Ga0496100_0761353
1545 Ga0496101_0053961
1546 Ga0496101_0607484
1547 Ga0496102_0016965
1548 Ga0496102_0099463
1549 Ga0496102_0228962
1550 Ga0496102_1206721
1551 Ga0496103_0021096
1552 Ga0496104_0017668
1553 Ga0496104_0069145
1554 Ga0496104_0099240
1555 Ga0496105_0067713
1556 Ga0496105_0117254
1557 Ga0496105_0357670
1558 Ga0496105_0629537
1559 Ga0496106_0057256
1560 Ga0496107_0010608
1561 Ga0496107_0100637
1562 Ga0496107_0375550
1563 Ga0496107_0510062
1564 Ga0496108_0140860
1565 Ga0496109_0061407
1566 Ga0496109_0929166
1567 Ga0496110_0047306
1568 Ga0496110_0262184
1569 Ga0496110_0522475
1570 Ga0496111_0152131
1571 Ga0496112_0042820
1572 Ga0496112_0090753
1573 Ga0496112_0172086
1574 Ga0496112_0255242
1575 Ga0496112_0351301
1576 Ga0496112_0355012
1577 Ga0496112_0381012
1578 Ga0496112_0437944
1579 Ga0496113_0229935
1580 Ga0496113_0552820
1581 Ga0496114_0018483
1582 Ga0496114_0019073
1583 Ga0496114_0109958
1584 Ga0496114_0295367
1585 Ga0496115_0004087
1586 Ga0496115_0005586
1587 Ga0496115_0083164
1588 Ga0496115_0200715
1589 Ga0496115_0255583
1590 Ga0496115_0327778
1591 Ga0496115_0782753
1592 Ga0501031_0024640
1593 Ga0501032_0308430
1594 Ga0501033_0000227
1595 Ga0501036_0059603
1596 Ga0501037_0000082
1597 Ga0501038_0003342
1598 Ga0501039_0001111
1599 Ga0501043_0000170
1600 Ga0501043_0008673
1601 Ga0501047_0032352
1602 Ga0501070_0137289
1603 Ga0501071_0029657
1604 Ga0501035_0000002
1605 Ga0501044_0002437
1606 nmdc:mga05p37_1728_c1
1607 nmdc:mga05p37_222672_c1
1608 nmdc:mga08y16_177878_c1
1609 nmdc:mga08y16_363195_c1
1610 nmdc:mga0n895_865536_c1
1611 nmdc:mga0rr50_1046161_c1
1612 nmdc:mga0rr50_191170_c1
1613 nmdc:mga08x19_6381_c1
1614 nmdc:mga0a205_309339_c1
1615 nmdc:mga0a205_671309_c1
1616 Ga0495601_0007125
1617 Ga0495601_0091758
1618 Ga0495612_0039666
1619 Ga0500555_000016
1620 Ga0500616_0000988
1621 Ga0500616_0025273
1622 Ga0466962_0000080

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

41

101

0.98

PF07499

RuvA_C

RuvA, C-terminal domain

192

241

0.94

PF14520

HHH_5

Helix-hairpin-helix domain

111

170

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d8l-assembly1.cif.gz_A e. coli holliday junction binding protein ruva nh2 region lacking domain iii 0.9807 1 132
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9744 1 132
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.9683 1 132
2zte-assembly1.cif.gz_A mtruva form iv 0.9595 1 132
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9531 1 132
ID Description Score Start End Superfamily
1d8lB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9882 1 63 2.40.50.140
2ztdA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9732 1 63 2.40.50.140
1bvsA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9606 68 134 1.10.150.20
1d8lB01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9572 68 132 1.10.150.20
1bvsA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.954 1 64 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7W1KT27-F1-model_v4 Holliday junction branch migration protein RuvA 1.005 1 87 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A2V5L187-F1-model_v4 Holliday junction branch migration protein RuvA 1.002 1 125 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A382QH54-F1-model_v4 DNA helicase Holliday junction RuvA type domain-containing protein 1 1 61 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A660YIC9-F1-model_v4 Holliday junction branch migration protein RuvA 0.9931 1 102 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A358XVD5-F1-model_v4 Holliday junction branch migration protein RuvA 0.9929 1 62 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378

Map