F481834

General Info

Members Datasets Scaffolds Average Seq Length
811 258 1622 92

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100971050|Ga0070682_1009710502
Length 100
Sequence MGANAMATNQSDAESGQQGVVDRLFLEHPRSLGMTWSGHGAGAVKIGAELLGAGCAALVHAAVPVWFTDTAGRTVARIYDHIQSRKAAAPNPENWPDYEI

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
193 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
233 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
234 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
235 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
236 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
237 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
238 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
239 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
240 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
241 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
244 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
245 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
246 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
247 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
248 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
249 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
250 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
251 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 3.33
Rhizosphere 96.05
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100971050 3300005337 Bacteria 703
2 JGI24736J21556_1007176 3300001904 Unclassified 1876
3 JGI24741J21665_1008775 3300001915 Bacteria 1891
4 JGI24740J21852_10001193 3300001979 Bacteria 11725
5 JGI24740J21852_10054256 3300001979 Bacteria 1133
6 JGI24740J21852_10061032 3300001979 Bacteria 1039
7 JGI24739J22299_10004656 3300001989 Bacteria 5245
8 JGI24739J22299_10106725 3300001989 Bacteria 842
9 JGI24739J22299_10114597 3300001989 Bacteria 808
10 JGI24737J22298_10000395 3300001990 Bacteria 14836
11 JGI24737J22298_10041436 3300001990 Bacteria 1412
12 JGI24735J21928_10023753 3300002067 Bacteria 1858
13 JGI24738J21930_10000605 3300002075 Bacteria 10272
14 JGI24738J21930_10012607 3300002075 Unclassified 1844
15 JGI24738J21930_10037453 3300002075 Bacteria 986
16 JGI24749J21850_1078748 3300002076 Bacteria 516
17 JGI24035J26624_1005687 3300002126 Bacteria 1196
18 Ga0065712_10009479 3300005290 Bacteria 4118
19 Ga0065712_10531585 3300005290 Bacteria 629
20 Ga0065715_10169723 3300005293 Bacteria 1557
21 Ga0065715_10316522 3300005293 Bacteria 1010
22 Ga0065715_10560742 3300005293 Bacteria 734
23 Ga0070658_10030005 3300005327 Bacteria 4369
24 Ga0070658_10099453 3300005327 Bacteria 2403
25 Ga0070658_10232703 3300005327 Bacteria 1560
26 Ga0070658_10262576 3300005327 Bacteria 1467
27 Ga0070658_10338636 3300005327 Bacteria 1286
28 Ga0070676_10001065 3300005328 Bacteria 13674
29 Ga0070676_10053129 3300005328 Bacteria 2385
30 Ga0070676_10090451 3300005328 Bacteria 1874
31 Ga0070676_10175196 3300005328 Bacteria 1390
32 Ga0070676_10248584 3300005328 Bacteria 1186
33 Ga0070676_10740950 3300005328 Bacteria 721
34 Ga0070683_101067812 3300005329 Bacteria 775
35 Ga0070670_100000518 3300005331 Bacteria 30878
36 Ga0070670_100006442 3300005331 Bacteria 9938
37 Ga0070670_100032436 3300005331 Bacteria 4499
38 Ga0070670_100142006 3300005331 Bacteria 2077
39 Ga0070670_100197496 3300005331 Bacteria 1748
40 Ga0070670_100260867 3300005331 Bacteria 1510
41 Ga0070670_100515296 3300005331 Bacteria 1065
42 Ga0070677_10011636 3300005333 Bacteria 3040
43 Ga0070677_10335561 3300005333 Bacteria 779
44 Ga0068869_100007282 3300005334 Bacteria 7051
45 Ga0068869_100508371 3300005334 Bacteria 1007
46 Ga0068869_100888311 3300005334 Bacteria 771
47 Ga0068869_101329808 3300005334 Bacteria 634
48 Ga0070666_10014482 3300005335 Bacteria 5024
49 Ga0070666_10046848 3300005335 Bacteria 2902
50 Ga0070666_10174972 3300005335 Bacteria 1504
51 Ga0070680_100254973 3300005336 Bacteria 1484
52 Ga0070680_100409282 3300005336 Bacteria 1157
53 Ga0070680_101217017 3300005336 Bacteria 651
54 Ga0070682_100177055 3300005337 Bacteria 1487
55 Ga0070682_100630560 3300005337 Bacteria 851
56 Ga0070682_101298571 3300005337 Bacteria 618
57 Ga0068868_100000214 3300005338 Bacteria 39101
58 Ga0068868_100096862 3300005338 Bacteria 2384
59 Ga0068868_100312714 3300005338 Bacteria 1337
60 Ga0068868_100562104 3300005338 Bacteria 1006
61 Ga0070660_100008113 3300005339 Bacteria 7339
62 Ga0070660_100008192 3300005339 Bacteria 7306
63 Ga0070660_100025004 3300005339 Bacteria 4435
64 Ga0070660_100097598 3300005339 Bacteria 2325
65 Ga0070660_100353400 3300005339 Bacteria 1211
66 Ga0070660_100422740 3300005339 Bacteria 1104
67 Ga0070660_100481152 3300005339 Bacteria 1032
68 Ga0070660_100766459 3300005339 Bacteria 811
69 Ga0070660_101278373 3300005339 Bacteria 623
70 Ga0070689_100061123 3300005340 Bacteria 2930
71 Ga0070689_100223692 3300005340 Bacteria 1545
72 Ga0070689_100488772 3300005340 Bacteria 1053
73 Ga0070689_101273554 3300005340 Bacteria 662
74 Ga0070687_100075597 3300005343 Bacteria 1822
75 Ga0070687_100334678 3300005343 Bacteria 972
76 Ga0070687_100589352 3300005343 Unclassified 762
77 Ga0070661_100026043 3300005344 Bacteria 4204
78 Ga0070661_100097893 3300005344 Bacteria 2179
79 Ga0070661_100132035 3300005344 Bacteria 1877
80 Ga0070661_100139620 3300005344 Bacteria 1825
81 Ga0070661_100171900 3300005344 Bacteria 1646
82 Ga0070661_100252434 3300005344 Bacteria 1361
83 Ga0070661_100525563 3300005344 Bacteria 949
84 Ga0070661_101023997 3300005344 Bacteria 686
85 Ga0070661_101324411 3300005344 Bacteria 605
86 Ga0070661_101674762 3300005344 Bacteria 539
87 Ga0070661_101794046 3300005344 Bacteria 521
88 Ga0070692_10080769 3300005345 Bacteria 1751
89 Ga0070692_10177342 3300005345 Bacteria 1233
90 Ga0070668_100019385 3300005347 Bacteria 5120
91 Ga0070668_100037106 3300005347 Bacteria 3720
92 Ga0070668_100065772 3300005347 Bacteria 2812
93 Ga0070668_101842107 3300005347 Unclassified 557
94 Ga0070669_100001233 3300005353 Bacteria 18559
95 Ga0070669_100045036 3300005353 Bacteria 3214
96 Ga0070669_100052935 3300005353 Bacteria 2970
97 Ga0070669_101225412 3300005353 Bacteria 649
98 Ga0070669_101414686 3300005353 Bacteria 603
99 Ga0070669_101772071 3300005353 Bacteria 539
100 Ga0070675_100006405 3300005354 Bacteria 9033
101 Ga0070675_100019336 3300005354 Bacteria 5426
102 Ga0070675_100046384 3300005354 Bacteria 3557
103 Ga0070675_100061140 3300005354 Bacteria 3110
104 Ga0070675_100287768 3300005354 Bacteria 1446
105 Ga0070671_100002731 3300005355 Bacteria 13704
106 Ga0070671_100003321 3300005355 Bacteria 12556
107 Ga0070671_100041808 3300005355 Bacteria 3809
108 Ga0070671_100084596 3300005355 Bacteria 2653
109 Ga0070671_102033131 3300005355 Bacteria 512
110 Ga0070674_100002539 3300005356 Bacteria 10111
111 Ga0070674_100015434 3300005356 Bacteria 4768
112 Ga0070674_100416882 3300005356 Bacteria 1101
113 Ga0070673_100000537 3300005364 Bacteria 20426
114 Ga0070673_100002233 3300005364 Bacteria 11722
115 Ga0070673_100004199 3300005364 Bacteria 9081
116 Ga0070673_100187887 3300005364 Bacteria 1773
117 Ga0070673_100305031 3300005364 Bacteria 1403
118 Ga0070673_100406950 3300005364 Bacteria 1218
119 Ga0070673_100501633 3300005364 Bacteria 1098
120 Ga0070673_100546803 3300005364 Bacteria 1051
121 Ga0070659_100001927 3300005366 Bacteria 14828
122 Ga0070659_100003141 3300005366 Bacteria 11763
123 Ga0070659_100014104 3300005366 Bacteria 5964
124 Ga0070659_100111038 3300005366 Bacteria 2213
125 Ga0070659_100134846 3300005366 Bacteria 2007
126 Ga0070659_100204710 3300005366 Bacteria 1625
127 Ga0070659_100489208 3300005366 Bacteria 1048
128 Ga0070659_101373164 3300005366 Bacteria 628
129 Ga0070659_102085469 3300005366 Bacteria 510
130 Ga0070667_100005468 3300005367 Bacteria 10607
131 Ga0070667_100010756 3300005367 Bacteria 7562
132 Ga0070667_100054763 3300005367 Bacteria 3368
133 Ga0070667_100070579 3300005367 Bacteria 2973
134 Ga0070667_100437808 3300005367 Bacteria 1193
135 Ga0070667_100447870 3300005367 Bacteria 1180
136 Ga0070667_100672738 3300005367 Bacteria 957
137 Ga0070667_100885748 3300005367 Bacteria 830
138 Ga0070714_100084652 3300005435 Bacteria 2768
139 Ga0070713_100025122 3300005436 Bacteria 4653
140 Ga0070694_100002713 3300005444 Bacteria 10502
141 Ga0070663_100019339 3300005455 Bacteria 4485
142 Ga0070663_100025864 3300005455 Bacteria 3967
143 Ga0070663_100056177 3300005455 Bacteria 2820
144 Ga0070663_100080131 3300005455 Bacteria 2397
145 Ga0070663_100176941 3300005455 Bacteria 1652
146 Ga0070678_100697006 3300005456 Bacteria 915
147 Ga0070678_101315444 3300005456 Bacteria 673
148 Ga0070662_100000242 3300005457 Bacteria 32222
149 Ga0070662_100006679 3300005457 Bacteria 7451
150 Ga0070662_100020512 3300005457 Bacteria 4500
151 Ga0070662_100023679 3300005457 Bacteria 4220
152 Ga0070662_100024431 3300005457 Bacteria 4163
153 Ga0070662_100078928 3300005457 Bacteria 2446
154 Ga0070662_100171972 3300005457 Bacteria 1702
155 Ga0070662_100239919 3300005457 Bacteria 1453
156 Ga0070681_10114927 3300005458 Bacteria 2630
157 Ga0070681_10305744 3300005458 Bacteria 1500
158 Ga0070681_10419819 3300005458 Bacteria 1250
159 Ga0070681_11412591 3300005458 Bacteria 620
160 Ga0070681_11505787 3300005458 Unclassified 597
161 Ga0068867_100000905 3300005459 Bacteria 20124
162 Ga0068867_100025194 3300005459 Bacteria 4268
163 Ga0068867_100108108 3300005459 Bacteria 2133
164 Ga0068867_100129071 3300005459 Bacteria 1963
165 Ga0070685_10319470 3300005466 Bacteria 1052
166 Ga0070679_100145218 3300005530 Bacteria 2350
167 Ga0070679_100279083 3300005530 Bacteria 1624
168 Ga0070679_100530019 3300005530 Bacteria 1122
169 Ga0070679_100660021 3300005530 Bacteria 988
170 Ga0068853_100250556 3300005539 Bacteria 1625
171 Ga0068853_100497519 3300005539 Bacteria 1151
172 Ga0068853_100651374 3300005539 Bacteria 1002
173 Ga0070672_100000341 3300005543 Bacteria 26875
174 Ga0070672_100001260 3300005543 Bacteria 15554
175 Ga0070672_100126846 3300005543 Bacteria 2094
176 Ga0070672_100464376 3300005543 Bacteria 1091
177 Ga0070672_100954825 3300005543 Bacteria 759
178 Ga0070695_100062862 3300005545 Bacteria 2412
179 Ga0070696_101904973 3300005546 Bacteria 515
180 Ga0070693_100059028 3300005547 Bacteria 2222
181 Ga0070665_100003779 3300005548 Bacteria 16019
182 Ga0070665_100012767 3300005548 Bacteria 8462
183 Ga0070665_101257269 3300005548 Bacteria 751
184 Ga0070704_100182534 3300005549 Bacteria 1679
185 Ga0068855_100019784 3300005563 Bacteria 8086
186 Ga0068855_100074552 3300005563 Bacteria 3941
187 Ga0068855_100390037 3300005563 Bacteria 1527
188 Ga0068855_101673463 3300005563 Bacteria 649
189 Ga0070664_100001413 3300005564 Bacteria 19196
190 Ga0070664_100001555 3300005564 Bacteria 18343
191 Ga0070664_100014592 3300005564 Bacteria 6409
192 Ga0070664_100025898 3300005564 Bacteria 4863
193 Ga0070664_100089714 3300005564 Bacteria 2660
194 Ga0070664_100101573 3300005564 Bacteria 2501
195 Ga0070664_100160100 3300005564 Bacteria 1991
196 Ga0070664_100498911 3300005564 Bacteria 1122
197 Ga0070664_100513239 3300005564 Bacteria 1106
198 Ga0070664_100513863 3300005564 Bacteria 1105
199 Ga0070664_100871306 3300005564 Bacteria 844
200 Ga0070664_101988824 3300005564 Bacteria 552
201 Ga0068857_100008239 3300005577 Bacteria 9007
202 Ga0068857_100017699 3300005577 Bacteria 6249
203 Ga0068857_100067419 3300005577 Bacteria 3185
204 Ga0068857_100121760 3300005577 Bacteria 2349
205 Ga0068857_100177709 3300005577 Bacteria 1937
206 Ga0068857_100472241 3300005577 Bacteria 1175
207 Ga0068857_101989733 3300005577 Bacteria 570
208 Ga0068854_100001247 3300005578 Bacteria 15269
209 Ga0068854_100010390 3300005578 Bacteria 6034
210 Ga0068854_100041246 3300005578 Bacteria 3261
211 Ga0068854_100079421 3300005578 Bacteria 2419
212 Ga0068854_100251354 3300005578 Bacteria 1412
213 Ga0068854_100597763 3300005578 Bacteria 942
214 Ga0068854_100848365 3300005578 Bacteria 800
215 Ga0068856_100053404 3300005614 Bacteria 3983
216 Ga0068856_100099010 3300005614 Bacteria 2906
217 Ga0068856_100139922 3300005614 Bacteria 2427
218 Ga0068856_100279615 3300005614 Bacteria 1686
219 Ga0068856_100802955 3300005614 Bacteria 961
220 Ga0070702_100793918 3300005615 Bacteria 731
221 Ga0068852_100049988 3300005616 Bacteria 3580
222 Ga0068852_100101672 3300005616 Bacteria 2596
223 Ga0068852_100144117 3300005616 Bacteria 2208
224 Ga0068852_100146549 3300005616 Bacteria 2190
225 Ga0068852_100146829 3300005616 Bacteria 2188
226 Ga0068852_100177779 3300005616 Bacteria 1999
227 Ga0068852_100314758 3300005616 Bacteria 1518
228 Ga0068852_100314819 3300005616 Bacteria 1518
229 Ga0068852_100352300 3300005616 Bacteria 1438
230 Ga0068852_100508394 3300005616 Bacteria 1201
231 Ga0068852_100745063 3300005616 Bacteria 992
232 Ga0068859_100000221 3300005617 Bacteria 56589
233 Ga0068859_100009553 3300005617 Bacteria 9791
234 Ga0068859_100010811 3300005617 Bacteria 9188
235 Ga0068859_100017045 3300005617 Bacteria 7294
236 Ga0068859_100306882 3300005617 Bacteria 1680
237 Ga0068859_101058965 3300005617 Bacteria 892
238 Ga0068864_100000324 3300005618 Bacteria 42149
239 Ga0068864_100000729 3300005618 Bacteria 27510
240 Ga0068864_100060921 3300005618 Bacteria 3268
241 Ga0068864_100163685 3300005618 Bacteria 2024
242 Ga0068864_100180509 3300005618 Bacteria 1930
243 Ga0068864_100717564 3300005618 Bacteria 978
244 Ga0068866_10011006 3300005718 Bacteria 3897
245 Ga0068866_10073909 3300005718 Bacteria 1811
246 Ga0068866_10262704 3300005718 Bacteria 1062
247 Ga0068861_100016640 3300005719 Bacteria 5207
248 Ga0068861_101713416 3300005719 Bacteria 622
249 Ga0068851_10031859 3300005834 Bacteria 2621
250 Ga0068851_10079041 3300005834 Bacteria 1715
251 Ga0068851_10140591 3300005834 Bacteria 1313
252 Ga0068851_10171772 3300005834 Bacteria 1197
253 Ga0068851_10342236 3300005834 Bacteria 868
254 Ga0068851_10645247 3300005834 Bacteria 648
255 Ga0068870_10047490 3300005840 Unclassified 2257
256 Ga0068870_10499893 3300005840 Bacteria 810
257 Ga0068863_100000988 3300005841 Bacteria 28552
258 Ga0068863_100005936 3300005841 Bacteria 11976
259 Ga0068863_100039526 3300005841 Bacteria 4488
260 Ga0068863_100045750 3300005841 Bacteria 4154
261 Ga0068863_100178999 3300005841 Bacteria 2035
262 Ga0068863_100483069 3300005841 Bacteria 1218
263 Ga0068858_100003387 3300005842 Bacteria 15866
264 Ga0068858_100003679 3300005842 Bacteria 15192
265 Ga0068858_100005718 3300005842 Bacteria 12151
266 Ga0068858_100344523 3300005842 Bacteria 1427
267 Ga0068858_100483097 3300005842 Bacteria 1196
268 Ga0068858_101188764 3300005842 Unclassified 749
269 Ga0068860_100009867 3300005843 Bacteria 9467
270 Ga0068860_100011771 3300005843 Bacteria 8622
271 Ga0068860_100015743 3300005843 Bacteria 7382
272 Ga0068860_100896644 3300005843 Bacteria 903
273 Ga0068862_100010153 3300005844 Bacteria 7769
274 Ga0068862_100182005 3300005844 Bacteria 1887
275 Ga0068862_100514962 3300005844 Bacteria 1138
276 Ga0068862_101011511 3300005844 Bacteria 822
277 Ga0075364_10258011 3300006051 Bacteria 1185
278 Ga0097621_100057915 3300006237 Bacteria 3170
279 Ga0097621_100280848 3300006237 Bacteria 1466
280 Ga0068871_100102366 3300006358 Bacteria 2401
281 Ga0068871_100174154 3300006358 Bacteria 1846
282 Ga0068871_101380972 3300006358 Bacteria 664
283 Ga0075428_100895355 3300006844 Unclassified 941
284 Ga0075433_10005238 3300006852 Bacteria 10166
285 Ga0068865_100000731 3300006881 Bacteria 18482
286 Ga0097620_100000221 3300006931 Bacteria 56589
287 Ga0097620_100009553 3300006931 Bacteria 9791
288 Ga0097620_100010811 3300006931 Bacteria 9188
289 Ga0097620_100017045 3300006931 Bacteria 7294
290 Ga0097620_100306892 3300006931 Bacteria 1680
291 Ga0097620_101059021 3300006931 Bacteria 892
292 Ga0075435_100320610 3300007076 Bacteria 1326
293 Ga0105250_10015159 3300009092 Bacteria 3157
294 Ga0105240_10243931 3300009093 Bacteria 2081
295 Ga0105240_11241559 3300009093 Bacteria 788
296 Ga0105240_11262435 3300009093 Unclassified 780
297 Ga0105240_11534816 3300009093 Bacteria 698
298 Ga0111539_10525078 3300009094 Bacteria 1379
299 Ga0105245_10000928 3300009098 Bacteria 26607
300 Ga0105245_10206359 3300009098 Bacteria 1889
301 Ga0105245_11992883 3300009098 Bacteria 634
302 Ga0105247_10122332 3300009101 Bacteria 1688
303 Ga0105243_10009114 3300009148 Bacteria 7578
304 Ga0105243_10222259 3300009148 Bacteria 1670
305 Ga0105241_10034740 3300009174 Bacteria 3790
306 Ga0105241_10103609 3300009174 Bacteria 2266
307 Ga0105241_11344476 3300009174 Bacteria 682
308 Ga0105242_10008972 3300009176 Bacteria 7679
309 Ga0105248_10001342 3300009177 Bacteria 27431
310 Ga0105248_10001601 3300009177 Bacteria 25161
311 Ga0105248_10007952 3300009177 Bacteria 11656
312 Ga0105248_10008131 3300009177 Bacteria 11517
313 Ga0105248_10008243 3300009177 Bacteria 11448
314 Ga0105248_10048859 3300009177 Bacteria 4745
315 Ga0105248_10130143 3300009177 Bacteria 2839
316 Ga0105248_10363101 3300009177 Bacteria 1630
317 Ga0105248_11732506 3300009177 Bacteria 708
318 Ga0105238_10008220 3300009551 Bacteria 10438
319 Ga0105238_10135286 3300009551 Bacteria 2442
320 Ga0105238_10294424 3300009551 Bacteria 1606
321 Ga0105238_10306255 3300009551 Bacteria 1573
322 Ga0105238_12179402 3300009551 Bacteria 589
323 Ga0105249_10011978 3300009553 Bacteria 7628
324 Ga0105249_10042181 3300009553 Bacteria 4149
325 Ga0105249_10084649 3300009553 Bacteria 2954
326 Ga0105249_10086233 3300009553 Bacteria 2928
327 Ga0105239_10093355 3300010375 Bacteria 3323
328 Ga0105239_10254105 3300010375 Bacteria 1974
329 Ga0105246_10002010 3300011119 Bacteria 12283
330 Ga0105246_10095415 3300011119 Bacteria 2153
331 Ga0105246_10736681 3300011119 Bacteria 868
332 Ga0157373_10008311 3300013100 Bacteria 7711
333 Ga0157373_10025642 3300013100 Bacteria 4262
334 Ga0157373_10068106 3300013100 Bacteria 2516
335 Ga0157373_10076020 3300013100 Bacteria 2370
336 Ga0157373_10117482 3300013100 Bacteria 1869
337 Ga0157373_10197757 3300013100 Bacteria 1417
338 Ga0157373_10541272 3300013100 Bacteria 844
339 Ga0157373_11019459 3300013100 Bacteria 618
340 Ga0157371_10004597 3300013102 Bacteria 11982
341 Ga0157371_10056524 3300013102 Bacteria 2784
342 Ga0157371_10059692 3300013102 Bacteria 2704
343 Ga0157371_10092517 3300013102 Bacteria 2142
344 Ga0157371_10353199 3300013102 Bacteria 1070
345 Ga0157371_10611857 3300013102 Bacteria 811
346 Ga0157371_11193813 3300013102 Unclassified 586
347 Ga0157370_10314229 3300013104 Bacteria 1446
348 Ga0157370_10526892 3300013104 Bacteria 1084
349 Ga0157370_10529502 3300013104 Bacteria 1081
350 Ga0157370_11553697 3300013104 Bacteria 595
351 Ga0157369_10056022 3300013105 Bacteria 4254
352 Ga0157369_10144172 3300013105 Bacteria 2518
353 Ga0157369_11538100 3300013105 Unclassified 677
354 Ga0157374_12462706 3300013296 Bacteria 548
355 Ga0157378_10010504 3300013297 Bacteria 8090
356 Ga0157378_10446408 3300013297 Bacteria 1283
357 Ga0157378_11835717 3300013297 Bacteria 655
358 Ga0163162_10034916 3300013306 Bacteria 5006
359 Ga0163162_10088997 3300013306 Bacteria 3167
360 Ga0163162_10103137 3300013306 Bacteria 2946
361 Ga0163162_10106943 3300013306 Bacteria 2893
362 Ga0163162_10624941 3300013306 Bacteria 1202
363 Ga0157372_10055134 3300013307 Bacteria 4438
364 Ga0157372_10264071 3300013307 Bacteria 1999
365 Ga0157372_10281738 3300013307 Bacteria 1932
366 Ga0157372_10441190 3300013307 Bacteria 1517
367 Ga0157372_11047065 3300013307 Bacteria 944
368 Ga0157375_10067924 3300013308 Bacteria 3564
369 Ga0157375_10074445 3300013308 Bacteria 3417
370 Ga0157375_10162490 3300013308 Bacteria 2376
371 Ga0157375_11089238 3300013308 Bacteria 935
372 Ga0163163_10000489 3300014325 Bacteria 35830
373 Ga0163163_10177361 3300014325 Bacteria 2178
374 Ga0163163_10259304 3300014325 Bacteria 1789
375 Ga0163163_10509512 3300014325 Bacteria 1265
376 Ga0182008_10253672 3300014497 Bacteria 908
377 Ga0157377_10018052 3300014745 Bacteria 3661
378 Ga0157379_10027396 3300014968 Bacteria 5075
379 Ga0157379_10490137 3300014968 Bacteria 1138
380 Ga0157379_10574433 3300014968 Bacteria 1051
381 Ga0157379_11019937 3300014968 Bacteria 789
382 Ga0157376_11073977 3300014969 Bacteria 830
383 Ga0163161_10010745 3300017792 Bacteria 6342
384 Ga0207666_1009591 3300025271 Bacteria 1311
385 Ga0207673_1055428 3300025290 Bacteria 563
386 Ga0207697_10000249 3300025315 Bacteria 29649
387 Ga0207697_10283895 3300025315 Bacteria 734
388 Ga0207656_10253640 3300025321 Bacteria 862
389 Ga0207696_1061262 3300025711 Bacteria 1058
390 Ga0207682_10563901 3300025893 Bacteria 538
391 Ga0207710_10124638 3300025900 Bacteria 1233
392 Ga0207688_10003672 3300025901 Bacteria 8379
393 Ga0207688_10054109 3300025901 Bacteria 2251
394 Ga0207688_10096875 3300025901 Bacteria 1699
395 Ga0207688_10247450 3300025901 Bacteria 1079
396 Ga0207680_10174742 3300025903 Bacteria 1449
397 Ga0207647_10000661 3300025904 Bacteria 26938
398 Ga0207647_10033480 3300025904 Bacteria 3291
399 Ga0207645_10003537 3300025907 Bacteria 11819
400 Ga0207645_10017801 3300025907 Bacteria 4684
401 Ga0207645_10115482 3300025907 Bacteria 1740
402 Ga0207643_10337185 3300025908 Bacteria 944
403 Ga0207643_10545967 3300025908 Bacteria 743
404 Ga0207705_10004344 3300025909 Bacteria 10723
405 Ga0207705_10038002 3300025909 Bacteria 3446
406 Ga0207705_10058106 3300025909 Bacteria 2790
407 Ga0207705_10237655 3300025909 Bacteria 1387
408 Ga0207705_10436833 3300025909 Bacteria 1014
409 Ga0207705_10673694 3300025909 Bacteria 804
410 Ga0207705_10757495 3300025909 Bacteria 754
411 Ga0207705_10964048 3300025909 Bacteria 659
412 Ga0207654_10062612 3300025911 Bacteria 2180
413 Ga0207707_10170793 3300025912 Bacteria 1900
414 Ga0207707_10178899 3300025912 Bacteria 1852
415 Ga0207707_10199811 3300025912 Bacteria 1743
416 Ga0207660_10515063 3300025917 Bacteria 971
417 Ga0207660_10532706 3300025917 Bacteria 954
418 Ga0207660_10598316 3300025917 Bacteria 898
419 Ga0207662_10279131 3300025918 Bacteria 1105
420 Ga0207657_10003268 3300025919 Bacteria 17348
421 Ga0207657_10051832 3300025919 Bacteria 3565
422 Ga0207657_10074562 3300025919 Bacteria 2865
423 Ga0207657_10076142 3300025919 Bacteria 2831
424 Ga0207657_10090059 3300025919 Bacteria 2561
425 Ga0207657_10488251 3300025919 Bacteria 965
426 Ga0207657_10864584 3300025919 Bacteria 697
427 Ga0207649_10065966 3300025920 Bacteria 2293
428 Ga0207649_10066355 3300025920 Bacteria 2287
429 Ga0207649_10078977 3300025920 Bacteria 2124
430 Ga0207649_10098256 3300025920 Bacteria 1932
431 Ga0207649_10155021 3300025920 Bacteria 1581
432 Ga0207649_10577760 3300025920 Bacteria 862
433 Ga0207649_10766741 3300025920 Bacteria 751
434 Ga0207649_10964159 3300025920 Bacteria 670
435 Ga0207649_10984671 3300025920 Bacteria 663
436 Ga0207652_10269655 3300025921 Bacteria 1535
437 Ga0207652_11096949 3300025921 Bacteria 696
438 Ga0207652_11487546 3300025921 Bacteria 581
439 Ga0207681_10028840 3300025923 Bacteria 3598
440 Ga0207681_10029425 3300025923 Bacteria 3567
441 Ga0207681_10054602 3300025923 Bacteria 2717
442 Ga0207681_10065961 3300025923 Bacteria 2504
443 Ga0207681_10248298 3300025923 Bacteria 1388
444 Ga0207681_10762000 3300025923 Bacteria 807
445 Ga0207694_10070719 3300025924 Bacteria 2727
446 Ga0207694_10093372 3300025924 Bacteria 2377
447 Ga0207694_11126366 3300025924 Bacteria 664
448 Ga0207650_10024185 3300025925 Bacteria 4315
449 Ga0207650_10037423 3300025925 Bacteria 3536
450 Ga0207650_10060394 3300025925 Bacteria 2829
451 Ga0207650_10643851 3300025925 Bacteria 893
452 Ga0207650_10980244 3300025925 Bacteria 719
453 Ga0207650_11287582 3300025925 Bacteria 622
454 Ga0207659_10012290 3300025926 Bacteria 5441
455 Ga0207659_10037185 3300025926 Bacteria 3378
456 Ga0207659_10077438 3300025926 Bacteria 2447
457 Ga0207659_10206390 3300025926 Unclassified 1572
458 Ga0207687_10053632 3300025927 Bacteria 2818
459 Ga0207700_10073574 3300025928 Bacteria 2639
460 Ga0207664_10411274 3300025929 Bacteria 1204
461 Ga0207644_10006043 3300025931 Bacteria 7894
462 Ga0207644_10008001 3300025931 Bacteria 6915
463 Ga0207644_10074116 3300025931 Bacteria 2497
464 Ga0207644_10531336 3300025931 Bacteria 972
465 Ga0207690_10003218 3300025932 Bacteria 9799
466 Ga0207690_10208846 3300025932 Bacteria 1487
467 Ga0207690_10332583 3300025932 Bacteria 1197
468 Ga0207690_10408308 3300025932 Bacteria 1084
469 Ga0207690_10593900 3300025932 Bacteria 903
470 Ga0207690_10720101 3300025932 Bacteria 821
471 Ga0207690_10795391 3300025932 Bacteria 781
472 Ga0207690_11337478 3300025932 Bacteria 599
473 Ga0207706_10000661 3300025933 Bacteria 36281
474 Ga0207706_10001273 3300025933 Bacteria 25438
475 Ga0207706_10007227 3300025933 Bacteria 10269
476 Ga0207706_10024247 3300025933 Bacteria 5438
477 Ga0207706_10056240 3300025933 Bacteria 3469
478 Ga0207706_10134039 3300025933 Bacteria 2179
479 Ga0207706_10720033 3300025933 Bacteria 852
480 Ga0207706_10734243 3300025933 Bacteria 842
481 Ga0207686_10638539 3300025934 Bacteria 841
482 Ga0207709_10016457 3300025935 Bacteria 4111
483 Ga0207670_10057756 3300025936 Bacteria 2633
484 Ga0207670_10513301 3300025936 Bacteria 975
485 Ga0207704_10006622 3300025938 Bacteria 5421
486 Ga0207691_10001406 3300025940 Bacteria 24040
487 Ga0207691_10004714 3300025940 Bacteria 13196
488 Ga0207691_10010260 3300025940 Bacteria 8987
489 Ga0207691_10088954 3300025940 Bacteria 2769
490 Ga0207691_10122709 3300025940 Bacteria 2300
491 Ga0207691_10451210 3300025940 Bacteria 1094
492 Ga0207691_10874189 3300025940 Bacteria 753
493 Ga0207711_10000042 3300025941 Bacteria 158782
494 Ga0207711_10004762 3300025941 Bacteria 11517
495 Ga0207711_10007788 3300025941 Bacteria 8954
496 Ga0207711_10054807 3300025941 Bacteria 3422
497 Ga0207711_10605180 3300025941 Bacteria 1023
498 Ga0207689_10000580 3300025942 Bacteria 34954
499 Ga0207689_10023546 3300025942 Bacteria 5167
500 Ga0207689_10507731 3300025942 Bacteria 1010
501 Ga0207661_10098025 3300025944 Bacteria 2456
502 Ga0207661_11740368 3300025944 Bacteria 569
503 Ga0207679_10003410 3300025945 Bacteria 9805
504 Ga0207679_10045406 3300025945 Bacteria 3177
505 Ga0207679_10193890 3300025945 Bacteria 1691
506 Ga0207679_10570259 3300025945 Bacteria 1017
507 Ga0207679_10612106 3300025945 Bacteria 982
508 Ga0207679_10637192 3300025945 Bacteria 963
509 Ga0207679_10723193 3300025945 Bacteria 904
510 Ga0207679_11560069 3300025945 Bacteria 605
511 Ga0207667_10341252 3300025949 Bacteria 1529
512 Ga0207667_10447894 3300025949 Bacteria 1312
513 Ga0207651_10003806 3300025960 Bacteria 7476
514 Ga0207651_10018664 3300025960 Bacteria 4135
515 Ga0207651_10051185 3300025960 Bacteria 2808
516 Ga0207651_11633536 3300025960 Bacteria 580
517 Ga0207712_10153074 3300025961 Bacteria 1783
518 Ga0207712_10165722 3300025961 Bacteria 1722
519 Ga0207668_10038742 3300025972 Bacteria 3202
520 Ga0207668_10395275 3300025972 Bacteria 1167
521 Ga0207668_11694493 3300025972 Unclassified 571
522 Ga0207640_10017244 3300025981 Bacteria 4221
523 Ga0207640_10026196 3300025981 Bacteria 3537
524 Ga0207640_11137118 3300025981 Bacteria 692
525 Ga0207640_11507176 3300025981 Bacteria 604
526 Ga0207658_10005319 3300025986 Bacteria 8849
527 Ga0207658_10011931 3300025986 Bacteria 5924
528 Ga0207658_10027155 3300025986 Bacteria 4020
529 Ga0207658_10127970 3300025986 Bacteria 2035
530 Ga0207658_10458723 3300025986 Bacteria 1129
531 Ga0207658_10544111 3300025986 Bacteria 1038
532 Ga0207658_10579561 3300025986 Bacteria 1006
533 Ga0207658_10630080 3300025986 Bacteria 965
534 Ga0207658_10804984 3300025986 Bacteria 853
535 Ga0207677_10000642 3300026023 Bacteria 21060
536 Ga0207677_10064405 3300026023 Bacteria 2553
537 Ga0207677_10067874 3300026023 Bacteria 2500
538 Ga0207677_11139905 3300026023 Bacteria 712
539 Ga0207703_10001009 3300026035 Bacteria 27028
540 Ga0207703_10012169 3300026035 Bacteria 6707
541 Ga0207703_10012252 3300026035 Bacteria 6686
542 Ga0207703_10015871 3300026035 Bacteria 5876
543 Ga0207703_10033051 3300026035 Bacteria 4098
544 Ga0207639_10015409 3300026041 Bacteria 5395
545 Ga0207639_10174890 3300026041 Bacteria 1822
546 Ga0207639_10326418 3300026041 Bacteria 1364
547 Ga0207639_10582035 3300026041 Bacteria 1030
548 Ga0207678_10021099 3300026067 Bacteria 5709
549 Ga0207678_10025299 3300026067 Bacteria 5182
550 Ga0207678_10099343 3300026067 Bacteria 2486
551 Ga0207678_10369744 3300026067 Bacteria 1238
552 Ga0207678_10876409 3300026067 Bacteria 793
553 Ga0207702_10020138 3300026078 Bacteria 5526
554 Ga0207702_10123670 3300026078 Bacteria 2319
555 Ga0207702_10155963 3300026078 Bacteria 2081
556 Ga0207702_10352276 3300026078 Bacteria 1409
557 Ga0207641_10000927 3300026088 Bacteria 30260
558 Ga0207641_10007401 3300026088 Bacteria 9132
559 Ga0207641_10035477 3300026088 Bacteria 4155
560 Ga0207641_10043167 3300026088 Bacteria 3785
561 Ga0207641_10372324 3300026088 Bacteria 1366
562 Ga0207648_10000800 3300026089 Bacteria 35460
563 Ga0207648_10030383 3300026089 Bacteria 4785
564 Ga0207648_10042995 3300026089 Bacteria 3968
565 Ga0207676_10000550 3300026095 Bacteria 31298
566 Ga0207676_10005158 3300026095 Bacteria 9245
567 Ga0207676_10011163 3300026095 Bacteria 6414
568 Ga0207676_10078391 3300026095 Bacteria 2676
569 Ga0207676_10598879 3300026095 Bacteria 1058
570 Ga0207674_10000283 3300026116 Bacteria 64153
571 Ga0207674_10004577 3300026116 Bacteria 16604
572 Ga0207674_10022612 3300026116 Bacteria 6747
573 Ga0207674_10035277 3300026116 Bacteria 5222
574 Ga0207674_10083379 3300026116 Bacteria 3196
575 Ga0207674_10299345 3300026116 Bacteria 1557
576 Ga0207674_10537311 3300026116 Bacteria 1129
577 Ga0207674_11481652 3300026116 Bacteria 648
578 Ga0207675_100021115 3300026118 Bacteria 6068
579 Ga0207675_100029176 3300026118 Bacteria 5141
580 Ga0207675_100169330 3300026118 Bacteria 2087
581 Ga0207698_10043910 3300026142 Bacteria 3353
582 Ga0207698_10065035 3300026142 Bacteria 2862
583 Ga0207698_10105507 3300026142 Bacteria 2348
584 Ga0207698_10174445 3300026142 Bacteria 1897
585 Ga0207698_10361245 3300026142 Bacteria 1375
586 Ga0207698_10389810 3300026142 Bacteria 1328
587 Ga0207698_10493600 3300026142 Bacteria 1190
588 Ga0207698_10678154 3300026142 Bacteria 1024
589 Ga0207698_10681436 3300026142 Bacteria 1021
590 Ga0207698_10948373 3300026142 Bacteria 869
591 Ga0207698_11684799 3300026142 Bacteria 649
592 Ga0209974_10412501 3300027876 Bacteria 532
593 Ga0268266_10003459 3300028379 Bacteria 15752
594 Ga0268266_10568749 3300028379 Bacteria 1087
595 Ga0268266_10574462 3300028379 Bacteria 1081
596 Ga0268265_10013136 3300028380 Bacteria 5625
597 Ga0268265_10071267 3300028380 Bacteria 2706
598 Ga0268265_10142369 3300028380 Bacteria 2009
599 Ga0268265_10334496 3300028380 Bacteria 1376
600 Ga0268265_10703359 3300028380 Bacteria 976
601 Ga0268264_10003399 3300028381 Bacteria 13738
602 Ga0268264_10020729 3300028381 Bacteria 5371
603 Ga0307513_10208468 3300031456 Bacteria 1788
604 Ga0307408_100018240 3300031548 Bacteria 4710
605 Ga0307408_100146366 3300031548 Bacteria 1860
606 Ga0307405_10004362 3300031731 Bacteria 6672
607 Ga0307405_10540797 3300031731 Bacteria 941
608 Ga0307405_10681602 3300031731 Bacteria 849
609 Ga0307413_10015262 3300031824 Bacteria 3931
610 Ga0307413_10015893 3300031824 Bacteria 3870
611 Ga0307413_10047127 3300031824 Bacteria 2568
612 Ga0307413_11147383 3300031824 Bacteria 673
613 Ga0307410_10006185 3300031852 Bacteria 6431
614 Ga0307410_10046896 3300031852 Bacteria 2885
615 Ga0307410_10072828 3300031852 Bacteria 2387
616 Ga0307410_10077733 3300031852 Bacteria 2321
617 Ga0307410_10081265 3300031852 Bacteria 2276
618 Ga0307410_10261189 3300031852 Bacteria 1350
619 Ga0307406_10456314 3300031901 Bacteria 1026
620 Ga0307406_11040008 3300031901 Bacteria 704
621 Ga0307406_11499378 3300031901 Bacteria 593
622 Ga0307407_10035107 3300031903 Bacteria 2751
623 Ga0307407_10130962 3300031903 Unclassified 1604
624 Ga0307407_10699114 3300031903 Bacteria 763
625 Ga0307412_10140240 3300031911 Bacteria 1769
626 Ga0307412_11405912 3300031911 Bacteria 631
627 Ga0307409_100007535 3300031995 Bacteria 6521
628 Ga0307409_100026230 3300031995 Bacteria 4105
629 Ga0307409_100374924 3300031995 Bacteria 1350
630 Ga0307409_100488403 3300031995 Bacteria 1196
631 Ga0307409_100489198 3300031995 Bacteria 1195
632 Ga0307409_100545761 3300031995 Bacteria 1137
633 Ga0307416_100010216 3300032002 Bacteria 6190
634 Ga0307416_100015950 3300032002 Bacteria 5205
635 Ga0307416_100040354 3300032002 Bacteria 3625
636 Ga0307414_10024161 3300032004 Bacteria 3870
637 Ga0307414_10097302 3300032004 Bacteria 2204
638 Ga0307414_10603484 3300032004 Bacteria 984
639 Ga0307414_10848097 3300032004 Bacteria 835
640 Ga0307411_10007483 3300032005 Bacteria 5569
641 Ga0307411_10022405 3300032005 Bacteria 3718
642 Ga0307411_10031604 3300032005 Bacteria 3260
643 Ga0307411_10161469 3300032005 Bacteria 1679
644 Ga0307411_10195447 3300032005 Bacteria 1548
645 Ga0307411_10751044 3300032005 Bacteria 854
646 Ga0307415_100000374 3300032126 Bacteria 19118
647 Ga0307415_100097093 3300032126 Bacteria 2149
648 Ga0307415_100360509 3300032126 Bacteria 1227
649 Ga0307415_100415194 3300032126 Bacteria 1153
650 Ga0307415_102349606 3300032126 Bacteria 524
651 Ga0373949_0239890 3300035090 Bacteria 557
652 Ga0373951_0226036 3300035091 Bacteria 554
653 Ga0373939_0263942 3300035114 Bacteria 675
654 Ga0373939_0456948 3300035114 Bacteria 538
655 Ga0373961_0193245 3300035241 Bacteria 715
656 Ga0373931_1254348 3300035691 Bacteria 509
657 Ga0395899_0046610 3300037312 Bacteria 3229
658 Ga0395899_0060677 3300037312 Bacteria 2786
659 Ga0395899_0143826 3300037312 Bacteria 1695
660 Ga0395899_0352830 3300037312 Unclassified 983
661 Ga0395900_0001168 3300037418 Bacteria 32771
662 Ga0395900_0004297 3300037418 Bacteria 15108
663 Ga0395900_0009144 3300037418 Bacteria 10148
664 Ga0395900_0042482 3300037418 Bacteria 4685
665 Ga0395900_0055337 3300037418 Bacteria 4086
666 Ga0395900_0182612 3300037418 Bacteria 2131
667 Ga0395900_0369879 3300037418 Bacteria 1403
668 Ga0395900_0738636 3300037418 Bacteria 915
669 Ga0395900_1339581 3300037418 Bacteria 629
670 Ga0395898_0208028 3300037466 Bacteria 1867
671 Ga0395898_0494830 3300037466 Bacteria 1163
672 Ga0395905_0001952 3300037471 Bacteria 23608
673 Ga0395905_0004681 3300037471 Bacteria 14148
674 Ga0395905_0017498 3300037471 Bacteria 6804
675 Ga0395905_0018224 3300037471 Bacteria 6663
676 Ga0395905_0048166 3300037471 Bacteria 3995
677 Ga0395905_0059465 3300037471 Bacteria 3572
678 Ga0395905_0084287 3300037471 Bacteria 2977
679 Ga0395905_0146467 3300037471 Bacteria 2222
680 Ga0395905_0249712 3300037471 Bacteria 1657
681 Ga0395905_0311858 3300037471 Bacteria 1462
682 Ga0395905_0398298 3300037471 Bacteria 1271
683 Ga0395905_0419274 3300037471 Bacteria 1234
684 Ga0395905_0441585 3300037471 Bacteria 1198
685 Ga0395905_0551883 3300037471 Bacteria 1053
686 Ga0395905_0628135 3300037471 Bacteria 976
687 Ga0395905_0743451 3300037471 Bacteria 883
688 Ga0395905_0822967 3300037471 Bacteria 831
689 Ga0395905_0843137 3300037471 Bacteria 819
690 Ga0395905_0956574 3300037471 Bacteria 759
691 Ga0395905_0965008 3300037471 Bacteria 755
692 Ga0436364_0657331 3300037853 Bacteria 614
693 Ga0395901_0022600 3300038443 Bacteria 6447
694 Ga0395901_0034872 3300038443 Bacteria 5197
695 Ga0395901_0066808 3300038443 Bacteria 3745
696 Ga0395901_0235046 3300038443 Bacteria 1913
697 Ga0395901_0271296 3300038443 Bacteria 1764
698 Ga0395901_0388065 3300038443 Bacteria 1436
699 Ga0395901_0552823 3300038443 Bacteria 1166
700 Ga0395901_0642293 3300038443 Bacteria 1065
701 Ga0395901_1357349 3300038443 Bacteria 671
702 Ga0436365_1127438 3300039437 Bacteria 768
703 Ga0439445_0032207 3300042004 Bacteria 1366
704 Ga0439432_007258 3300042006 Bacteria 3935
705 Ga0439432_007343 3300042006 Bacteria 3907
706 Ga0439432_019889 3300042006 Bacteria 2234
707 Ga0439452_049045 3300042010 Bacteria 972
708 Ga0450918_022039 3300042531 Bacteria 1113
709 Ga0466969_0062485 3300044656 Bacteria 1807
710 Ga0466965_0842930 3300044683 Bacteria 532
711 Ga0466966_0025274 3300044684 Bacteria 3880
712 Ga0466966_0335887 3300044684 Bacteria 908
713 Ga0466961_0019328 3300044693 Bacteria 4383
714 Ga0466961_0028793 3300044693 Bacteria 3573
715 Ga0466963_0021066 3300044694 Bacteria 4108
716 Ga0466963_0663926 3300044694 Unclassified 736
717 Ga0466963_0835882 3300044694 Bacteria 649
718 Ga0466964_0402092 3300044706 Bacteria 716
719 Ga0466971_0098139 3300044719 Bacteria 1345
720 Ga0466971_0234827 3300044719 Bacteria 871
721 Ga0466957_0274674 3300044842 Bacteria 1126
722 Ga0466957_0711996 3300044842 Unclassified 709
723 Ga0466957_0785089 3300044842 Bacteria 676
724 Ga0466957_1189631 3300044842 Bacteria 551
725 Ga0466960_0023373 3300044901 Bacteria 2775
726 Ga0466959_0072057 3300045049 Bacteria 2501
727 Ga0466958_0153646 3300045836 Bacteria 1452
728 Ga0466967_0030782 3300045976 Bacteria 4507
729 Ga0466967_0036201 3300045976 Bacteria 4211
730 Ga0466967_0194067 3300045976 Bacteria 1920
731 Ga0466967_0262535 3300045976 Bacteria 1652
732 Ga0466967_0560970 3300045976 Bacteria 1124
733 Ga0466967_1047943 3300045976 Bacteria 812
734 Ga0466967_2526561 3300045976 Unclassified 508
735 Ga0495629_0377905 3300046459 Bacteria 964
736 Ga0495585_0151630 3300046492 Bacteria 1208
737 Ga0495585_0189994 3300046492 Bacteria 1051
738 Ga0495663_0009980 3300046525 Bacteria 2635
739 Ga0495663_0057812 3300046525 Bacteria 1214
740 Ga0495598_0002927 3300046537 Bacteria 3580
741 Ga0495621_0049317 3300046539 Bacteria 1501
742 Ga0495621_0241248 3300046539 Bacteria 736
743 Ga0495633_0027445 3300046558 Bacteria 2783
744 Ga0495668_0162532 3300046616 Bacteria 1223
745 Ga0495625_0156402 3300046660 Bacteria 1529
746 Ga0495647_0431325 3300046681 Bacteria 608
747 Ga0495669_0027147 3300046684 Bacteria 2504
748 Ga0495669_0038516 3300046684 Bacteria 2117
749 Ga0495669_0071611 3300046684 Unclassified 1581
750 Ga0495670_0354696 3300046691 Bacteria 789
751 Ga0495677_0020796 3300047445 Bacteria 2378
752 Ga0495677_0068637 3300047445 Bacteria 1320
753 Ga0495615_0078470 3300048090 Bacteria 902
754 Ga0496100_0038276 3300048903 Bacteria 3039
755 Ga0496102_0683202 3300048905 Bacteria 950
756 Ga0496102_1201720 3300048905 Bacteria 678
757 Ga0496102_1815209 3300048905 Bacteria 527
758 Ga0496104_1534399 3300048907 Bacteria 569
759 Ga0496106_0911247 3300048909 Bacteria 694
760 Ga0496107_0042994 3300048910 Bacteria 3246
761 Ga0496107_0224630 3300048910 Bacteria 1397
762 Ga0496107_0774155 3300048910 Bacteria 703
763 Ga0496108_0111090 3300048911 Bacteria 2344
764 Ga0496108_0186575 3300048911 Bacteria 1796
765 Ga0496109_0015514 3300048912 Bacteria 6642
766 Ga0496109_0102088 3300048912 Bacteria 2662
767 Ga0496109_0105264 3300048912 Bacteria 2620
768 Ga0496109_0299343 3300048912 Bacteria 1516
769 Ga0496109_0613163 3300048912 Bacteria 1025
770 Ga0496109_1494438 3300048912 Bacteria 610
771 Ga0496109_1728021 3300048912 Bacteria 559
772 Ga0496110_0005070 3300048913 Bacteria 10293
773 Ga0496110_0023922 3300048913 Bacteria 5201
774 Ga0496110_0483849 3300048913 Bacteria 1127
775 Ga0496111_0007627 3300048914 Bacteria 7112
776 Ga0496111_0011207 3300048914 Bacteria 6034
777 Ga0496112_0194725 3300048915 Bacteria 1988
778 Ga0496112_0249970 3300048915 Bacteria 1724
779 Ga0496112_0964370 3300048915 Bacteria 773
780 Ga0496113_0040494 3300048916 Bacteria 3433
781 Ga0501070_0146064 3300049586 Bacteria 1952
782 Ga0501071_0119141 3300049587 Bacteria 1956
783 Ga0501202_003386 3300049652 Bacteria 2729
784 Ga0501206_106806 3300049653 Bacteria 513
785 Ga0501214_041197 3300049659 Bacteria 671
786 Ga0501223_013012 3300049663 Bacteria 1659
787 Ga0501230_091948 3300049667 Unclassified 646
788 Ga0501233_104644 3300049668 Bacteria 752
789 Ga0501240_073057 3300049673 Bacteria 624
790 Ga0501249_037061 3300049679 Bacteria 1100
791 Ga0501249_145743 3300049679 Bacteria 593
792 Ga0501258_025216 3300049687 Bacteria 722
793 Ga0501221_024100 3300049704 Bacteria 1219
794 Ga0501221_201106 3300049704 Bacteria 554
795 Ga0501225_0035655 3300049705 Bacteria 1370
796 Ga0501245_031923 3300049708 Bacteria 874
797 Ga0501263_023920 3300049760 Bacteria 835
798 Ga0501266_027933 3300049763 Bacteria 795
799 Ga0501267_037472 3300049764 Bacteria 593
800 Ga0501268_003834 3300049765 Bacteria 2084
801 Ga0501272_033964 3300049769 Bacteria 658
802 Ga0501273_017622 3300049770 Bacteria 945
803 Ga0501283_005380 3300049779 Bacteria 1759
804 Ga0501212_079917 3300049851 Bacteria 590
805 nmdc:mga00v17_116086_c1 3300050491 Bacteria 1701
806 nmdc:mga09592_1084765_c1 3300050508 Unclassified 666
807 nmdc:mga08y16_413823_c1 3300050511 Bacteria 1378
808 nmdc:mga0n895_1417005_c1 3300050512 Unclassified 663
809 nmdc:mga0a205_5110_c1 3300050515 Bacteria 11802
810 Ga0590075_079034 3300059424 Bacteria 852
811 Ga0466962_0476108 3300061719 Bacteria 630
812 Ga0070682_100971050
813 JGI24736J21556_1007176
814 JGI24741J21665_1008775
815 JGI24740J21852_10001193
816 JGI24740J21852_10054256
817 JGI24740J21852_10061032
818 JGI24739J22299_10004656
819 JGI24739J22299_10106725
820 JGI24739J22299_10114597
821 JGI24737J22298_10000395
822 JGI24737J22298_10041436
823 JGI24735J21928_10023753
824 JGI24738J21930_10000605
825 JGI24738J21930_10012607
826 JGI24738J21930_10037453
827 JGI24749J21850_1078748
828 JGI24035J26624_1005687
829 Ga0065712_10009479
830 Ga0065712_10531585
831 Ga0065715_10169723
832 Ga0065715_10316522
833 Ga0065715_10560742
834 Ga0070658_10030005
835 Ga0070658_10099453
836 Ga0070658_10232703
837 Ga0070658_10262576
838 Ga0070658_10338636
839 Ga0070676_10001065
840 Ga0070676_10053129
841 Ga0070676_10090451
842 Ga0070676_10175196
843 Ga0070676_10248584
844 Ga0070676_10740950
845 Ga0070683_101067812
846 Ga0070670_100000518
847 Ga0070670_100006442
848 Ga0070670_100032436
849 Ga0070670_100142006
850 Ga0070670_100197496
851 Ga0070670_100260867
852 Ga0070670_100515296
853 Ga0070677_10011636
854 Ga0070677_10335561
855 Ga0068869_100007282
856 Ga0068869_100508371
857 Ga0068869_100888311
858 Ga0068869_101329808
859 Ga0070666_10014482
860 Ga0070666_10046848
861 Ga0070666_10174972
862 Ga0070680_100254973
863 Ga0070680_100409282
864 Ga0070680_101217017
865 Ga0070682_100177055
866 Ga0070682_100630560
867 Ga0070682_101298571
868 Ga0068868_100000214
869 Ga0068868_100096862
870 Ga0068868_100312714
871 Ga0068868_100562104
872 Ga0070660_100008113
873 Ga0070660_100008192
874 Ga0070660_100025004
875 Ga0070660_100097598
876 Ga0070660_100353400
877 Ga0070660_100422740
878 Ga0070660_100481152
879 Ga0070660_100766459
880 Ga0070660_101278373
881 Ga0070689_100061123
882 Ga0070689_100223692
883 Ga0070689_100488772
884 Ga0070689_101273554
885 Ga0070687_100075597
886 Ga0070687_100334678
887 Ga0070687_100589352
888 Ga0070661_100026043
889 Ga0070661_100097893
890 Ga0070661_100132035
891 Ga0070661_100139620
892 Ga0070661_100171900
893 Ga0070661_100252434
894 Ga0070661_100525563
895 Ga0070661_101023997
896 Ga0070661_101324411
897 Ga0070661_101674762
898 Ga0070661_101794046
899 Ga0070692_10080769
900 Ga0070692_10177342
901 Ga0070668_100019385
902 Ga0070668_100037106
903 Ga0070668_100065772
904 Ga0070668_101842107
905 Ga0070669_100001233
906 Ga0070669_100045036
907 Ga0070669_100052935
908 Ga0070669_101225412
909 Ga0070669_101414686
910 Ga0070669_101772071
911 Ga0070675_100006405
912 Ga0070675_100019336
913 Ga0070675_100046384
914 Ga0070675_100061140
915 Ga0070675_100287768
916 Ga0070671_100002731
917 Ga0070671_100003321
918 Ga0070671_100041808
919 Ga0070671_100084596
920 Ga0070671_102033131
921 Ga0070674_100002539
922 Ga0070674_100015434
923 Ga0070674_100416882
924 Ga0070673_100000537
925 Ga0070673_100002233
926 Ga0070673_100004199
927 Ga0070673_100187887
928 Ga0070673_100305031
929 Ga0070673_100406950
930 Ga0070673_100501633
931 Ga0070673_100546803
932 Ga0070659_100001927
933 Ga0070659_100003141
934 Ga0070659_100014104
935 Ga0070659_100111038
936 Ga0070659_100134846
937 Ga0070659_100204710
938 Ga0070659_100489208
939 Ga0070659_101373164
940 Ga0070659_102085469
941 Ga0070667_100005468
942 Ga0070667_100010756
943 Ga0070667_100054763
944 Ga0070667_100070579
945 Ga0070667_100437808
946 Ga0070667_100447870
947 Ga0070667_100672738
948 Ga0070667_100885748
949 Ga0070714_100084652
950 Ga0070713_100025122
951 Ga0070694_100002713
952 Ga0070663_100019339
953 Ga0070663_100025864
954 Ga0070663_100056177
955 Ga0070663_100080131
956 Ga0070663_100176941
957 Ga0070678_100697006
958 Ga0070678_101315444
959 Ga0070662_100000242
960 Ga0070662_100006679
961 Ga0070662_100020512
962 Ga0070662_100023679
963 Ga0070662_100024431
964 Ga0070662_100078928
965 Ga0070662_100171972
966 Ga0070662_100239919
967 Ga0070681_10114927
968 Ga0070681_10305744
969 Ga0070681_10419819
970 Ga0070681_11412591
971 Ga0070681_11505787
972 Ga0068867_100000905
973 Ga0068867_100025194
974 Ga0068867_100108108
975 Ga0068867_100129071
976 Ga0070685_10319470
977 Ga0070679_100145218
978 Ga0070679_100279083
979 Ga0070679_100530019
980 Ga0070679_100660021
981 Ga0068853_100250556
982 Ga0068853_100497519
983 Ga0068853_100651374
984 Ga0070672_100000341
985 Ga0070672_100001260
986 Ga0070672_100126846
987 Ga0070672_100464376
988 Ga0070672_100954825
989 Ga0070695_100062862
990 Ga0070696_101904973
991 Ga0070693_100059028
992 Ga0070665_100003779
993 Ga0070665_100012767
994 Ga0070665_101257269
995 Ga0070704_100182534
996 Ga0068855_100019784
997 Ga0068855_100074552
998 Ga0068855_100390037
999 Ga0068855_101673463
1000 Ga0070664_100001413
1001 Ga0070664_100001555
1002 Ga0070664_100014592
1003 Ga0070664_100025898
1004 Ga0070664_100089714
1005 Ga0070664_100101573
1006 Ga0070664_100160100
1007 Ga0070664_100498911
1008 Ga0070664_100513239
1009 Ga0070664_100513863
1010 Ga0070664_100871306
1011 Ga0070664_101988824
1012 Ga0068857_100008239
1013 Ga0068857_100017699
1014 Ga0068857_100067419
1015 Ga0068857_100121760
1016 Ga0068857_100177709
1017 Ga0068857_100472241
1018 Ga0068857_101989733
1019 Ga0068854_100001247
1020 Ga0068854_100010390
1021 Ga0068854_100041246
1022 Ga0068854_100079421
1023 Ga0068854_100251354
1024 Ga0068854_100597763
1025 Ga0068854_100848365
1026 Ga0068856_100053404
1027 Ga0068856_100099010
1028 Ga0068856_100139922
1029 Ga0068856_100279615
1030 Ga0068856_100802955
1031 Ga0070702_100793918
1032 Ga0068852_100049988
1033 Ga0068852_100101672
1034 Ga0068852_100144117
1035 Ga0068852_100146549
1036 Ga0068852_100146829
1037 Ga0068852_100177779
1038 Ga0068852_100314758
1039 Ga0068852_100314819
1040 Ga0068852_100352300
1041 Ga0068852_100508394
1042 Ga0068852_100745063
1043 Ga0068859_100000221
1044 Ga0068859_100009553
1045 Ga0068859_100010811
1046 Ga0068859_100017045
1047 Ga0068859_100306882
1048 Ga0068859_101058965
1049 Ga0068864_100000324
1050 Ga0068864_100000729
1051 Ga0068864_100060921
1052 Ga0068864_100163685
1053 Ga0068864_100180509
1054 Ga0068864_100717564
1055 Ga0068866_10011006
1056 Ga0068866_10073909
1057 Ga0068866_10262704
1058 Ga0068861_100016640
1059 Ga0068861_101713416
1060 Ga0068851_10031859
1061 Ga0068851_10079041
1062 Ga0068851_10140591
1063 Ga0068851_10171772
1064 Ga0068851_10342236
1065 Ga0068851_10645247
1066 Ga0068870_10047490
1067 Ga0068870_10499893
1068 Ga0068863_100000988
1069 Ga0068863_100005936
1070 Ga0068863_100039526
1071 Ga0068863_100045750
1072 Ga0068863_100178999
1073 Ga0068863_100483069
1074 Ga0068858_100003387
1075 Ga0068858_100003679
1076 Ga0068858_100005718
1077 Ga0068858_100344523
1078 Ga0068858_100483097
1079 Ga0068858_101188764
1080 Ga0068860_100009867
1081 Ga0068860_100011771
1082 Ga0068860_100015743
1083 Ga0068860_100896644
1084 Ga0068862_100010153
1085 Ga0068862_100182005
1086 Ga0068862_100514962
1087 Ga0068862_101011511
1088 Ga0075364_10258011
1089 Ga0097621_100057915
1090 Ga0097621_100280848
1091 Ga0068871_100102366
1092 Ga0068871_100174154
1093 Ga0068871_101380972
1094 Ga0075428_100895355
1095 Ga0075433_10005238
1096 Ga0068865_100000731
1097 Ga0097620_100000221
1098 Ga0097620_100009553
1099 Ga0097620_100010811
1100 Ga0097620_100017045
1101 Ga0097620_100306892
1102 Ga0097620_101059021
1103 Ga0075435_100320610
1104 Ga0105250_10015159
1105 Ga0105240_10243931
1106 Ga0105240_11241559
1107 Ga0105240_11262435
1108 Ga0105240_11534816
1109 Ga0111539_10525078
1110 Ga0105245_10000928
1111 Ga0105245_10206359
1112 Ga0105245_11992883
1113 Ga0105247_10122332
1114 Ga0105243_10009114
1115 Ga0105243_10222259
1116 Ga0105241_10034740
1117 Ga0105241_10103609
1118 Ga0105241_11344476
1119 Ga0105242_10008972
1120 Ga0105248_10001342
1121 Ga0105248_10001601
1122 Ga0105248_10007952
1123 Ga0105248_10008131
1124 Ga0105248_10008243
1125 Ga0105248_10048859
1126 Ga0105248_10130143
1127 Ga0105248_10363101
1128 Ga0105248_11732506
1129 Ga0105238_10008220
1130 Ga0105238_10135286
1131 Ga0105238_10294424
1132 Ga0105238_10306255
1133 Ga0105238_12179402
1134 Ga0105249_10011978
1135 Ga0105249_10042181
1136 Ga0105249_10084649
1137 Ga0105249_10086233
1138 Ga0105239_10093355
1139 Ga0105239_10254105
1140 Ga0105246_10002010
1141 Ga0105246_10095415
1142 Ga0105246_10736681
1143 Ga0157373_10008311
1144 Ga0157373_10025642
1145 Ga0157373_10068106
1146 Ga0157373_10076020
1147 Ga0157373_10117482
1148 Ga0157373_10197757
1149 Ga0157373_10541272
1150 Ga0157373_11019459
1151 Ga0157371_10004597
1152 Ga0157371_10056524
1153 Ga0157371_10059692
1154 Ga0157371_10092517
1155 Ga0157371_10353199
1156 Ga0157371_10611857
1157 Ga0157371_11193813
1158 Ga0157370_10314229
1159 Ga0157370_10526892
1160 Ga0157370_10529502
1161 Ga0157370_11553697
1162 Ga0157369_10056022
1163 Ga0157369_10144172
1164 Ga0157369_11538100
1165 Ga0157374_12462706
1166 Ga0157378_10010504
1167 Ga0157378_10446408
1168 Ga0157378_11835717
1169 Ga0163162_10034916
1170 Ga0163162_10088997
1171 Ga0163162_10103137
1172 Ga0163162_10106943
1173 Ga0163162_10624941
1174 Ga0157372_10055134
1175 Ga0157372_10264071
1176 Ga0157372_10281738
1177 Ga0157372_10441190
1178 Ga0157372_11047065
1179 Ga0157375_10067924
1180 Ga0157375_10074445
1181 Ga0157375_10162490
1182 Ga0157375_11089238
1183 Ga0163163_10000489
1184 Ga0163163_10177361
1185 Ga0163163_10259304
1186 Ga0163163_10509512
1187 Ga0182008_10253672
1188 Ga0157377_10018052
1189 Ga0157379_10027396
1190 Ga0157379_10490137
1191 Ga0157379_10574433
1192 Ga0157379_11019937
1193 Ga0157376_11073977
1194 Ga0163161_10010745
1195 Ga0207666_1009591
1196 Ga0207673_1055428
1197 Ga0207697_10000249
1198 Ga0207697_10283895
1199 Ga0207656_10253640
1200 Ga0207696_1061262
1201 Ga0207682_10563901
1202 Ga0207710_10124638
1203 Ga0207688_10003672
1204 Ga0207688_10054109
1205 Ga0207688_10096875
1206 Ga0207688_10247450
1207 Ga0207680_10174742
1208 Ga0207647_10000661
1209 Ga0207647_10033480
1210 Ga0207645_10003537
1211 Ga0207645_10017801
1212 Ga0207645_10115482
1213 Ga0207643_10337185
1214 Ga0207643_10545967
1215 Ga0207705_10004344
1216 Ga0207705_10038002
1217 Ga0207705_10058106
1218 Ga0207705_10237655
1219 Ga0207705_10436833
1220 Ga0207705_10673694
1221 Ga0207705_10757495
1222 Ga0207705_10964048
1223 Ga0207654_10062612
1224 Ga0207707_10170793
1225 Ga0207707_10178899
1226 Ga0207707_10199811
1227 Ga0207660_10515063
1228 Ga0207660_10532706
1229 Ga0207660_10598316
1230 Ga0207662_10279131
1231 Ga0207657_10003268
1232 Ga0207657_10051832
1233 Ga0207657_10074562
1234 Ga0207657_10076142
1235 Ga0207657_10090059
1236 Ga0207657_10488251
1237 Ga0207657_10864584
1238 Ga0207649_10065966
1239 Ga0207649_10066355
1240 Ga0207649_10078977
1241 Ga0207649_10098256
1242 Ga0207649_10155021
1243 Ga0207649_10577760
1244 Ga0207649_10766741
1245 Ga0207649_10964159
1246 Ga0207649_10984671
1247 Ga0207652_10269655
1248 Ga0207652_11096949
1249 Ga0207652_11487546
1250 Ga0207681_10028840
1251 Ga0207681_10029425
1252 Ga0207681_10054602
1253 Ga0207681_10065961
1254 Ga0207681_10248298
1255 Ga0207681_10762000
1256 Ga0207694_10070719
1257 Ga0207694_10093372
1258 Ga0207694_11126366
1259 Ga0207650_10024185
1260 Ga0207650_10037423
1261 Ga0207650_10060394
1262 Ga0207650_10643851
1263 Ga0207650_10980244
1264 Ga0207650_11287582
1265 Ga0207659_10012290
1266 Ga0207659_10037185
1267 Ga0207659_10077438
1268 Ga0207659_10206390
1269 Ga0207687_10053632
1270 Ga0207700_10073574
1271 Ga0207664_10411274
1272 Ga0207644_10006043
1273 Ga0207644_10008001
1274 Ga0207644_10074116
1275 Ga0207644_10531336
1276 Ga0207690_10003218
1277 Ga0207690_10208846
1278 Ga0207690_10332583
1279 Ga0207690_10408308
1280 Ga0207690_10593900
1281 Ga0207690_10720101
1282 Ga0207690_10795391
1283 Ga0207690_11337478
1284 Ga0207706_10000661
1285 Ga0207706_10001273
1286 Ga0207706_10007227
1287 Ga0207706_10024247
1288 Ga0207706_10056240
1289 Ga0207706_10134039
1290 Ga0207706_10720033
1291 Ga0207706_10734243
1292 Ga0207686_10638539
1293 Ga0207709_10016457
1294 Ga0207670_10057756
1295 Ga0207670_10513301
1296 Ga0207704_10006622
1297 Ga0207691_10001406
1298 Ga0207691_10004714
1299 Ga0207691_10010260
1300 Ga0207691_10088954
1301 Ga0207691_10122709
1302 Ga0207691_10451210
1303 Ga0207691_10874189
1304 Ga0207711_10000042
1305 Ga0207711_10004762
1306 Ga0207711_10007788
1307 Ga0207711_10054807
1308 Ga0207711_10605180
1309 Ga0207689_10000580
1310 Ga0207689_10023546
1311 Ga0207689_10507731
1312 Ga0207661_10098025
1313 Ga0207661_11740368
1314 Ga0207679_10003410
1315 Ga0207679_10045406
1316 Ga0207679_10193890
1317 Ga0207679_10570259
1318 Ga0207679_10612106
1319 Ga0207679_10637192
1320 Ga0207679_10723193
1321 Ga0207679_11560069
1322 Ga0207667_10341252
1323 Ga0207667_10447894
1324 Ga0207651_10003806
1325 Ga0207651_10018664
1326 Ga0207651_10051185
1327 Ga0207651_11633536
1328 Ga0207712_10153074
1329 Ga0207712_10165722
1330 Ga0207668_10038742
1331 Ga0207668_10395275
1332 Ga0207668_11694493
1333 Ga0207640_10017244
1334 Ga0207640_10026196
1335 Ga0207640_11137118
1336 Ga0207640_11507176
1337 Ga0207658_10005319
1338 Ga0207658_10011931
1339 Ga0207658_10027155
1340 Ga0207658_10127970
1341 Ga0207658_10458723
1342 Ga0207658_10544111
1343 Ga0207658_10579561
1344 Ga0207658_10630080
1345 Ga0207658_10804984
1346 Ga0207677_10000642
1347 Ga0207677_10064405
1348 Ga0207677_10067874
1349 Ga0207677_11139905
1350 Ga0207703_10001009
1351 Ga0207703_10012169
1352 Ga0207703_10012252
1353 Ga0207703_10015871
1354 Ga0207703_10033051
1355 Ga0207639_10015409
1356 Ga0207639_10174890
1357 Ga0207639_10326418
1358 Ga0207639_10582035
1359 Ga0207678_10021099
1360 Ga0207678_10025299
1361 Ga0207678_10099343
1362 Ga0207678_10369744
1363 Ga0207678_10876409
1364 Ga0207702_10020138
1365 Ga0207702_10123670
1366 Ga0207702_10155963
1367 Ga0207702_10352276
1368 Ga0207641_10000927
1369 Ga0207641_10007401
1370 Ga0207641_10035477
1371 Ga0207641_10043167
1372 Ga0207641_10372324
1373 Ga0207648_10000800
1374 Ga0207648_10030383
1375 Ga0207648_10042995
1376 Ga0207676_10000550
1377 Ga0207676_10005158
1378 Ga0207676_10011163
1379 Ga0207676_10078391
1380 Ga0207676_10598879
1381 Ga0207674_10000283
1382 Ga0207674_10004577
1383 Ga0207674_10022612
1384 Ga0207674_10035277
1385 Ga0207674_10083379
1386 Ga0207674_10299345
1387 Ga0207674_10537311
1388 Ga0207674_11481652
1389 Ga0207675_100021115
1390 Ga0207675_100029176
1391 Ga0207675_100169330
1392 Ga0207698_10043910
1393 Ga0207698_10065035
1394 Ga0207698_10105507
1395 Ga0207698_10174445
1396 Ga0207698_10361245
1397 Ga0207698_10389810
1398 Ga0207698_10493600
1399 Ga0207698_10678154
1400 Ga0207698_10681436
1401 Ga0207698_10948373
1402 Ga0207698_11684799
1403 Ga0209974_10412501
1404 Ga0268266_10003459
1405 Ga0268266_10568749
1406 Ga0268266_10574462
1407 Ga0268265_10013136
1408 Ga0268265_10071267
1409 Ga0268265_10142369
1410 Ga0268265_10334496
1411 Ga0268265_10703359
1412 Ga0268264_10003399
1413 Ga0268264_10020729
1414 Ga0307513_10208468
1415 Ga0307408_100018240
1416 Ga0307408_100146366
1417 Ga0307405_10004362
1418 Ga0307405_10540797
1419 Ga0307405_10681602
1420 Ga0307413_10015262
1421 Ga0307413_10015893
1422 Ga0307413_10047127
1423 Ga0307413_11147383
1424 Ga0307410_10006185
1425 Ga0307410_10046896
1426 Ga0307410_10072828
1427 Ga0307410_10077733
1428 Ga0307410_10081265
1429 Ga0307410_10261189
1430 Ga0307406_10456314
1431 Ga0307406_11040008
1432 Ga0307406_11499378
1433 Ga0307407_10035107
1434 Ga0307407_10130962
1435 Ga0307407_10699114
1436 Ga0307412_10140240
1437 Ga0307412_11405912
1438 Ga0307409_100007535
1439 Ga0307409_100026230
1440 Ga0307409_100374924
1441 Ga0307409_100488403
1442 Ga0307409_100489198
1443 Ga0307409_100545761
1444 Ga0307416_100010216
1445 Ga0307416_100015950
1446 Ga0307416_100040354
1447 Ga0307414_10024161
1448 Ga0307414_10097302
1449 Ga0307414_10603484
1450 Ga0307414_10848097
1451 Ga0307411_10007483
1452 Ga0307411_10022405
1453 Ga0307411_10031604
1454 Ga0307411_10161469
1455 Ga0307411_10195447
1456 Ga0307411_10751044
1457 Ga0307415_100000374
1458 Ga0307415_100097093
1459 Ga0307415_100360509
1460 Ga0307415_100415194
1461 Ga0307415_102349606
1462 Ga0373949_0239890
1463 Ga0373951_0226036
1464 Ga0373939_0263942
1465 Ga0373939_0456948
1466 Ga0373961_0193245
1467 Ga0373931_1254348
1468 Ga0395899_0046610
1469 Ga0395899_0060677
1470 Ga0395899_0143826
1471 Ga0395899_0352830
1472 Ga0395900_0001168
1473 Ga0395900_0004297
1474 Ga0395900_0009144
1475 Ga0395900_0042482
1476 Ga0395900_0055337
1477 Ga0395900_0182612
1478 Ga0395900_0369879
1479 Ga0395900_0738636
1480 Ga0395900_1339581
1481 Ga0395898_0208028
1482 Ga0395898_0494830
1483 Ga0395905_0001952
1484 Ga0395905_0004681
1485 Ga0395905_0017498
1486 Ga0395905_0018224
1487 Ga0395905_0048166
1488 Ga0395905_0059465
1489 Ga0395905_0084287
1490 Ga0395905_0146467
1491 Ga0395905_0249712
1492 Ga0395905_0311858
1493 Ga0395905_0398298
1494 Ga0395905_0419274
1495 Ga0395905_0441585
1496 Ga0395905_0551883
1497 Ga0395905_0628135
1498 Ga0395905_0743451
1499 Ga0395905_0822967
1500 Ga0395905_0843137
1501 Ga0395905_0956574
1502 Ga0395905_0965008
1503 Ga0436364_0657331
1504 Ga0395901_0022600
1505 Ga0395901_0034872
1506 Ga0395901_0066808
1507 Ga0395901_0235046
1508 Ga0395901_0271296
1509 Ga0395901_0388065
1510 Ga0395901_0552823
1511 Ga0395901_0642293
1512 Ga0395901_1357349
1513 Ga0436365_1127438
1514 Ga0439445_0032207
1515 Ga0439432_007258
1516 Ga0439432_007343
1517 Ga0439432_019889
1518 Ga0439452_049045
1519 Ga0450918_022039
1520 Ga0466969_0062485
1521 Ga0466965_0842930
1522 Ga0466966_0025274
1523 Ga0466966_0335887
1524 Ga0466961_0019328
1525 Ga0466961_0028793
1526 Ga0466963_0021066
1527 Ga0466963_0663926
1528 Ga0466963_0835882
1529 Ga0466964_0402092
1530 Ga0466971_0098139
1531 Ga0466971_0234827
1532 Ga0466957_0274674
1533 Ga0466957_0711996
1534 Ga0466957_0785089
1535 Ga0466957_1189631
1536 Ga0466960_0023373
1537 Ga0466959_0072057
1538 Ga0466958_0153646
1539 Ga0466967_0030782
1540 Ga0466967_0036201
1541 Ga0466967_0194067
1542 Ga0466967_0262535
1543 Ga0466967_0560970
1544 Ga0466967_1047943
1545 Ga0466967_2526561
1546 Ga0495629_0377905
1547 Ga0495585_0151630
1548 Ga0495585_0189994
1549 Ga0495663_0009980
1550 Ga0495663_0057812
1551 Ga0495598_0002927
1552 Ga0495621_0049317
1553 Ga0495621_0241248
1554 Ga0495633_0027445
1555 Ga0495668_0162532
1556 Ga0495625_0156402
1557 Ga0495647_0431325
1558 Ga0495669_0027147
1559 Ga0495669_0038516
1560 Ga0495669_0071611
1561 Ga0495670_0354696
1562 Ga0495677_0020796
1563 Ga0495677_0068637
1564 Ga0495615_0078470
1565 Ga0496100_0038276
1566 Ga0496102_0683202
1567 Ga0496102_1201720
1568 Ga0496102_1815209
1569 Ga0496104_1534399
1570 Ga0496106_0911247
1571 Ga0496107_0042994
1572 Ga0496107_0224630
1573 Ga0496107_0774155
1574 Ga0496108_0111090
1575 Ga0496108_0186575
1576 Ga0496109_0015514
1577 Ga0496109_0102088
1578 Ga0496109_0105264
1579 Ga0496109_0299343
1580 Ga0496109_0613163
1581 Ga0496109_1494438
1582 Ga0496109_1728021
1583 Ga0496110_0005070
1584 Ga0496110_0023922
1585 Ga0496110_0483849
1586 Ga0496111_0007627
1587 Ga0496111_0011207
1588 Ga0496112_0194725
1589 Ga0496112_0249970
1590 Ga0496112_0964370
1591 Ga0496113_0040494
1592 Ga0501070_0146064
1593 Ga0501071_0119141
1594 Ga0501202_003386
1595 Ga0501206_106806
1596 Ga0501214_041197
1597 Ga0501223_013012
1598 Ga0501230_091948
1599 Ga0501233_104644
1600 Ga0501240_073057
1601 Ga0501249_037061
1602 Ga0501249_145743
1603 Ga0501258_025216
1604 Ga0501221_024100
1605 Ga0501221_201106
1606 Ga0501225_0035655
1607 Ga0501245_031923
1608 Ga0501263_023920
1609 Ga0501266_027933
1610 Ga0501267_037472
1611 Ga0501268_003834
1612 Ga0501272_033964
1613 Ga0501273_017622
1614 Ga0501283_005380
1615 Ga0501212_079917
1616 nmdc:mga00v17_116086_c1
1617 nmdc:mga09592_1084765_c1
1618 nmdc:mga08y16_413823_c1
1619 nmdc:mga0n895_1417005_c1
1620 nmdc:mga0a205_5110_c1
1621 Ga0590075_079034
1622 Ga0466962_0476108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19883

DUF6356

Family of unknown function (DUF6356)

22

86

0.97

Map