F481760
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 809 | 342 | 796 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10197661|Ga0105248_101976613 |
| Length | 155 |
| Sequence | MNRKKEHRMPRQDPLRNFLFRLEIDGIQTAGFSEVSILETTTAAIDYREGTDPPHVRKLAGLTKYGNIALKRGVVAGSAALDLYHWHASVVTGGTQGSRRNIAIVVLSDDGNDQTRFIVSEAWPVKYASGPFNARGNEVLIELLELVNEGIQRVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 4 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 5 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 6 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 7 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 8 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 9 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 10 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 11 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 201 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 202 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 203 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 204 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 221 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 227 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 228 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 287 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 288 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 289 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 290 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 291 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 317 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 335 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 339 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 340 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 341 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 342 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.02 |
| Metatranscriptomes | 0.37 |
| Isolates | 1.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.48 |
| Nodule | 0.25 |
| Rhizoplane | 3.96 |
| Rhizosphere | 90.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1143410 | 2162886006 | Bacteria | 960 |
| 2 | SwRhRL2b_contig_3005271 | 2162886007 | Bacteria | 821 |
| 3 | rootL2_10020075 | 3300003322 | Bacteria | 3885 |
| 4 | rootL2_10251230 | 3300003322 | Bacteria | 1560 |
| 5 | rootL2_10251231 | 3300003322 | Bacteria | 1376 |
| 6 | JGI25160J50197_1033488 | 3300003354 | Bacteria | 1291 |
| 7 | Ga0007416J51690_1014507 | 3300003577 | Bacteria | 8646 |
| 8 | Ga0055526_1000001 | 3300003771 | Bacteria | 669703 |
| 9 | Ga0065714_10193689 | 3300005288 | Bacteria | 919 |
| 10 | Ga0065714_10281034 | 3300005288 | Unclassified | 721 |
| 11 | Ga0065704_10299499 | 3300005289 | Bacteria | 888 |
| 12 | Ga0065704_10328536 | 3300005289 | Bacteria | 841 |
| 13 | Ga0065704_10334449 | 3300005289 | Bacteria | 833 |
| 14 | Ga0065704_10714107 | 3300005289 | Unclassified | 556 |
| 15 | Ga0065712_10003972 | 3300005290 | Bacteria | 5717 |
| 16 | Ga0065712_10087908 | 3300005290 | Bacteria | 2548 |
| 17 | Ga0065712_10268973 | 3300005290 | Unclassified | 920 |
| 18 | Ga0065715_10001891 | 3300005293 | Bacteria | 7194 |
| 19 | Ga0065715_10091491 | 3300005293 | Bacteria | 5752 |
| 20 | Ga0065715_10318694 | 3300005293 | Bacteria | 1006 |
| 21 | Ga0065715_10864599 | 3300005293 | Unclassified | 554 |
| 22 | Ga0065715_11048134 | 3300005293 | Bacteria | 530 |
| 23 | Ga0065707_10141047 | 3300005295 | Bacteria | 1772 |
| 24 | Ga0065707_10215133 | 3300005295 | Bacteria | 1248 |
| 25 | Ga0065707_10307784 | 3300005295 | Bacteria | 991 |
| 26 | Ga0070683_100311295 | 3300005329 | Bacteria | 1498 |
| 27 | Ga0070690_100117157 | 3300005330 | Bacteria | 1784 |
| 28 | Ga0070690_100261937 | 3300005330 | Bacteria | 1227 |
| 29 | Ga0070690_100326463 | 3300005330 | Unclassified | 1107 |
| 30 | Ga0070690_100467140 | 3300005330 | Unclassified | 938 |
| 31 | Ga0070690_100632833 | 3300005330 | Bacteria | 815 |
| 32 | Ga0070690_101170258 | 3300005330 | Unclassified | 612 |
| 33 | Ga0070670_100019552 | 3300005331 | Bacteria | 5813 |
| 34 | Ga0070670_100060675 | 3300005331 | Bacteria | 3247 |
| 35 | Ga0070670_100064761 | 3300005331 | Bacteria | 3136 |
| 36 | Ga0070670_100198931 | 3300005331 | Bacteria | 1741 |
| 37 | Ga0070670_100473024 | 3300005331 | Bacteria | 1112 |
| 38 | Ga0070670_101436273 | 3300005331 | Bacteria | 633 |
| 39 | Ga0068869_100025548 | 3300005334 | Bacteria | 4102 |
| 40 | Ga0068869_100330816 | 3300005334 | Bacteria | 1238 |
| 41 | Ga0068869_101403701 | 3300005334 | Unclassified | 618 |
| 42 | Ga0070666_10015226 | 3300005335 | Unclassified | 4904 |
| 43 | Ga0070666_10614075 | 3300005335 | Bacteria | 794 |
| 44 | Ga0070666_10714375 | 3300005335 | Bacteria | 735 |
| 45 | Ga0070666_10833053 | 3300005335 | Bacteria | 680 |
| 46 | Ga0070682_101462485 | 3300005337 | Unclassified | 586 |
| 47 | Ga0070682_101669420 | 3300005337 | Bacteria | 553 |
| 48 | Ga0068868_100080420 | 3300005338 | Bacteria | 2612 |
| 49 | Ga0068868_100417539 | 3300005338 | Bacteria | 1161 |
| 50 | Ga0070689_100049952 | 3300005340 | Bacteria | 3230 |
| 51 | Ga0070689_100225668 | 3300005340 | Bacteria | 1538 |
| 52 | Ga0070689_100579805 | 3300005340 | Bacteria | 969 |
| 53 | Ga0070689_100664357 | 3300005340 | Bacteria | 908 |
| 54 | Ga0070691_10460067 | 3300005341 | Unclassified | 728 |
| 55 | Ga0070687_100175777 | 3300005343 | Bacteria | 1278 |
| 56 | Ga0070661_100022563 | 3300005344 | Bacteria | 4507 |
| 57 | Ga0070661_101014259 | 3300005344 | Bacteria | 689 |
| 58 | Ga0070692_10061309 | 3300005345 | Unclassified | 1982 |
| 59 | Ga0070692_10419773 | 3300005345 | Bacteria | 849 |
| 60 | Ga0070692_10652528 | 3300005345 | Bacteria | 703 |
| 61 | Ga0070692_10692711 | 3300005345 | Unclassified | 685 |
| 62 | Ga0070668_100064495 | 3300005347 | Unclassified | 2840 |
| 63 | Ga0070668_100133764 | 3300005347 | Bacteria | 1992 |
| 64 | Ga0070668_100957650 | 3300005347 | Bacteria | 767 |
| 65 | Ga0070669_100021146 | 3300005353 | Bacteria | 4650 |
| 66 | Ga0070675_100333062 | 3300005354 | Unclassified | 1343 |
| 67 | Ga0070675_100419559 | 3300005354 | Bacteria | 1196 |
| 68 | Ga0070675_100495886 | 3300005354 | Bacteria | 1100 |
| 69 | Ga0070671_100076924 | 3300005355 | Bacteria | 2788 |
| 70 | Ga0070671_100164216 | 3300005355 | Bacteria | 1877 |
| 71 | Ga0070671_100244360 | 3300005355 | Bacteria | 1524 |
| 72 | Ga0070674_100688019 | 3300005356 | Unclassified | 873 |
| 73 | Ga0070673_100082756 | 3300005364 | Bacteria | 2606 |
| 74 | Ga0070673_100700372 | 3300005364 | Bacteria | 930 |
| 75 | Ga0070673_101706394 | 3300005364 | Unclassified | 596 |
| 76 | Ga0070688_100358533 | 3300005365 | Bacteria | 1069 |
| 77 | Ga0070659_100311764 | 3300005366 | Bacteria | 1314 |
| 78 | Ga0070659_100870743 | 3300005366 | Bacteria | 786 |
| 79 | Ga0070667_100071012 | 3300005367 | Unclassified | 2965 |
| 80 | Ga0070667_100097205 | 3300005367 | Unclassified | 2540 |
| 81 | Ga0070667_100968357 | 3300005367 | Bacteria | 793 |
| 82 | Ga0070703_10000109 | 3300005406 | Bacteria | 42760 |
| 83 | Ga0070713_100341741 | 3300005436 | Unclassified | 1387 |
| 84 | Ga0070710_10712412 | 3300005437 | Unclassified | 709 |
| 85 | Ga0070701_10013835 | 3300005438 | Bacteria | 3682 |
| 86 | Ga0070701_10332859 | 3300005438 | Bacteria | 943 |
| 87 | Ga0070711_101035559 | 3300005439 | Bacteria | 705 |
| 88 | Ga0070711_101505641 | 3300005439 | Bacteria | 587 |
| 89 | Ga0070705_100521061 | 3300005440 | Unclassified | 906 |
| 90 | Ga0070705_101139255 | 3300005440 | Bacteria | 640 |
| 91 | Ga0070700_100013206 | 3300005441 | Bacteria | 4634 |
| 92 | Ga0070700_100030838 | 3300005441 | Bacteria | 3208 |
| 93 | Ga0070694_100000051 | 3300005444 | Bacteria | 54318 |
| 94 | Ga0070694_100014694 | 3300005444 | Viruses | 4905 |
| 95 | Ga0070694_100190914 | 3300005444 | Bacteria | 1521 |
| 96 | Ga0070694_100534020 | 3300005444 | Bacteria | 937 |
| 97 | Ga0070708_100048652 | 3300005445 | Unclassified | 3749 |
| 98 | Ga0070678_100719089 | 3300005456 | Bacteria | 901 |
| 99 | Ga0070678_100875195 | 3300005456 | Bacteria | 820 |
| 100 | Ga0070678_101006416 | 3300005456 | Bacteria | 766 |
| 101 | Ga0070662_100152761 | 3300005457 | Bacteria | 1799 |
| 102 | Ga0070662_101232072 | 3300005457 | Unclassified | 643 |
| 103 | Ga0070681_10006958 | 3300005458 | Bacteria | 11006 |
| 104 | Ga0070681_10571501 | 3300005458 | Bacteria | 1044 |
| 105 | Ga0068867_100051885 | 3300005459 | Bacteria | 3025 |
| 106 | Ga0068867_100061946 | 3300005459 | Unclassified | 2779 |
| 107 | Ga0068867_100063410 | 3300005459 | Unclassified | 2747 |
| 108 | Ga0068867_101401778 | 3300005459 | Bacteria | 648 |
| 109 | Ga0070685_10370529 | 3300005466 | Unclassified | 984 |
| 110 | Ga0070706_100084939 | 3300005467 | Unclassified | 2933 |
| 111 | Ga0070707_100026693 | 3300005468 | Bacteria | 5486 |
| 112 | Ga0070707_100440069 | 3300005468 | Unclassified | 1264 |
| 113 | Ga0070707_100567079 | 3300005468 | Bacteria | 1097 |
| 114 | Ga0070707_100950918 | 3300005468 | Bacteria | 824 |
| 115 | Ga0070698_100002168 | 3300005471 | Bacteria | 21783 |
| 116 | Ga0070698_100020984 | 3300005471 | Bacteria | 6845 |
| 117 | Ga0070698_100066293 | 3300005471 | Unclassified | 3635 |
| 118 | Ga0070698_100085037 | 3300005471 | Bacteria | 3151 |
| 119 | Ga0070698_100143983 | 3300005471 | Bacteria | 2333 |
| 120 | Ga0070698_100422670 | 3300005471 | Unclassified | 1267 |
| 121 | Ga0070699_100003516 | 3300005518 | Bacteria | 13846 |
| 122 | Ga0070699_100097247 | 3300005518 | Bacteria | 2579 |
| 123 | Ga0070699_100105456 | 3300005518 | Bacteria | 2473 |
| 124 | Ga0070699_100442480 | 3300005518 | Bacteria | 1178 |
| 125 | Ga0070684_100083859 | 3300005535 | Bacteria | 2824 |
| 126 | Ga0070684_101657087 | 3300005535 | Viruses | 603 |
| 127 | Ga0070684_101674523 | 3300005535 | Bacteria | 600 |
| 128 | Ga0070697_100119900 | 3300005536 | Bacteria | 2200 |
| 129 | Ga0070697_100138929 | 3300005536 | Bacteria | 2042 |
| 130 | Ga0070697_100235312 | 3300005536 | Bacteria | 1563 |
| 131 | Ga0070697_100255869 | 3300005536 | Bacteria | 1498 |
| 132 | Ga0070697_100276592 | 3300005536 | Unclassified | 1440 |
| 133 | Ga0070697_100456749 | 3300005536 | Bacteria | 1113 |
| 134 | Ga0068853_100160911 | 3300005539 | Bacteria | 2026 |
| 135 | Ga0068853_100398291 | 3300005539 | Bacteria | 1288 |
| 136 | Ga0068853_100663120 | 3300005539 | Bacteria | 993 |
| 137 | Ga0068853_101111251 | 3300005539 | Bacteria | 762 |
| 138 | Ga0070672_100011579 | 3300005543 | Bacteria | 6155 |
| 139 | Ga0070672_100076552 | 3300005543 | Bacteria | 2673 |
| 140 | Ga0070672_100644420 | 3300005543 | Bacteria | 925 |
| 141 | Ga0070672_101172514 | 3300005543 | Viruses | 684 |
| 142 | Ga0070686_100000059 | 3300005544 | Bacteria | 84781 |
| 143 | Ga0070686_100154460 | 3300005544 | Bacteria | 1610 |
| 144 | Ga0070686_100701560 | 3300005544 | Viruses | 807 |
| 145 | Ga0070695_100000132 | 3300005545 | Bacteria | 34051 |
| 146 | Ga0070695_100019038 | 3300005545 | Bacteria | 4175 |
| 147 | Ga0070695_100100854 | 3300005545 | Bacteria | 1944 |
| 148 | Ga0070695_100123890 | 3300005545 | Bacteria | 1772 |
| 149 | Ga0070695_100345641 | 3300005545 | Bacteria | 1113 |
| 150 | Ga0070695_100723226 | 3300005545 | Bacteria | 792 |
| 151 | Ga0070696_100101723 | 3300005546 | Bacteria | 2060 |
| 152 | Ga0070696_100128334 | 3300005546 | Bacteria | 1842 |
| 153 | Ga0070696_100814502 | 3300005546 | Bacteria | 769 |
| 154 | Ga0070696_101048010 | 3300005546 | Unclassified | 683 |
| 155 | Ga0070696_101208066 | 3300005546 | Bacteria | 639 |
| 156 | Ga0070696_101654709 | 3300005546 | Unclassified | 551 |
| 157 | Ga0070693_100000459 | 3300005547 | Bacteria | 18304 |
| 158 | Ga0070693_100043145 | 3300005547 | Bacteria | 2546 |
| 159 | Ga0070693_100074042 | 3300005547 | Bacteria | 2013 |
| 160 | Ga0070693_100134923 | 3300005547 | Unclassified | 1547 |
| 161 | Ga0070693_100634256 | 3300005547 | Bacteria | 775 |
| 162 | Ga0070693_100714658 | 3300005547 | Viruses | 735 |
| 163 | Ga0070665_100000024 | 3300005548 | Bacteria | 374559 |
| 164 | Ga0070665_100684853 | 3300005548 | Unclassified | 1038 |
| 165 | Ga0070665_101140354 | 3300005548 | Bacteria | 791 |
| 166 | Ga0070704_100325643 | 3300005549 | Bacteria | 1289 |
| 167 | Ga0070704_101983031 | 3300005549 | Bacteria | 540 |
| 168 | Ga0068855_101090799 | 3300005563 | Bacteria | 835 |
| 169 | Ga0070664_100000591 | 3300005564 | Bacteria | 27629 |
| 170 | Ga0070664_100024412 | 3300005564 | Bacteria | 5000 |
| 171 | Ga0070664_100043844 | 3300005564 | Bacteria | 3776 |
| 172 | Ga0070664_100267599 | 3300005564 | Bacteria | 1539 |
| 173 | Ga0070664_100526304 | 3300005564 | Bacteria | 1092 |
| 174 | Ga0070664_100734049 | 3300005564 | Bacteria | 921 |
| 175 | Ga0070664_101292748 | 3300005564 | Bacteria | 689 |
| 176 | Ga0068857_101131452 | 3300005577 | Bacteria | 757 |
| 177 | Ga0068854_100143907 | 3300005578 | Bacteria | 1832 |
| 178 | Ga0068854_100334341 | 3300005578 | Unclassified | 1235 |
| 179 | Ga0068854_100462277 | 3300005578 | Bacteria | 1062 |
| 180 | Ga0068854_100535946 | 3300005578 | Bacteria | 991 |
| 181 | Ga0068854_100699319 | 3300005578 | Bacteria | 875 |
| 182 | Ga0068856_100269060 | 3300005614 | Bacteria | 1720 |
| 183 | Ga0068856_100376830 | 3300005614 | Unclassified | 1438 |
| 184 | Ga0070702_100190815 | 3300005615 | Bacteria | 1348 |
| 185 | Ga0068852_100366708 | 3300005616 | Bacteria | 1410 |
| 186 | Ga0068852_101008758 | 3300005616 | Unclassified | 851 |
| 187 | Ga0068852_102140237 | 3300005616 | Viruses | 581 |
| 188 | Ga0068859_100028784 | 3300005617 | Bacteria | 5570 |
| 189 | Ga0068859_100056239 | 3300005617 | Bacteria | 3959 |
| 190 | Ga0068859_100169870 | 3300005617 | Bacteria | 2261 |
| 191 | Ga0068859_100665352 | 3300005617 | Bacteria | 1133 |
| 192 | Ga0068859_101349662 | 3300005617 | Bacteria | 786 |
| 193 | Ga0068859_102133441 | 3300005617 | Bacteria | 618 |
| 194 | Ga0068864_100000481 | 3300005618 | Bacteria | 34602 |
| 195 | Ga0068864_100011188 | 3300005618 | Bacteria | 7415 |
| 196 | Ga0068864_100018567 | 3300005618 | Bacteria | 5812 |
| 197 | Ga0068864_100037713 | 3300005618 | Bacteria | 4126 |
| 198 | Ga0068864_100042855 | 3300005618 | Bacteria | 3873 |
| 199 | Ga0068864_100062948 | 3300005618 | Bacteria | 3215 |
| 200 | Ga0068864_100147223 | 3300005618 | Bacteria | 2130 |
| 201 | Ga0068864_100510955 | 3300005618 | Bacteria | 1157 |
| 202 | Ga0068864_100633147 | 3300005618 | Bacteria | 1040 |
| 203 | Ga0068864_100683362 | 3300005618 | Bacteria | 1001 |
| 204 | Ga0068864_101026832 | 3300005618 | Unclassified | 818 |
| 205 | Ga0068866_10308977 | 3300005718 | Bacteria | 990 |
| 206 | Ga0068866_10357681 | 3300005718 | Unclassified | 930 |
| 207 | Ga0068861_100004876 | 3300005719 | Bacteria | 9030 |
| 208 | Ga0068861_100009178 | 3300005719 | Bacteria | 6821 |
| 209 | Ga0068861_100017766 | 3300005719 | Bacteria | 5053 |
| 210 | Ga0068861_100070833 | 3300005719 | Unclassified | 2701 |
| 211 | Ga0068861_100522956 | 3300005719 | Bacteria | 1076 |
| 212 | Ga0068861_100582524 | 3300005719 | Bacteria | 1024 |
| 213 | Ga0068861_102081321 | 3300005719 | Viruses | 567 |
| 214 | Ga0068851_10072702 | 3300005834 | Bacteria | 1782 |
| 215 | Ga0068851_10109206 | 3300005834 | Unclassified | 1475 |
| 216 | Ga0068870_10193769 | 3300005840 | Unclassified | 1228 |
| 217 | Ga0068870_10379969 | 3300005840 | Bacteria | 914 |
| 218 | Ga0068870_10878616 | 3300005840 | Bacteria | 632 |
| 219 | Ga0068870_10883197 | 3300005840 | Bacteria | 630 |
| 220 | Ga0068863_100056704 | 3300005841 | Bacteria | 3709 |
| 221 | Ga0068863_100257659 | 3300005841 | Unclassified | 1686 |
| 222 | Ga0068863_100326465 | 3300005841 | Bacteria | 1491 |
| 223 | Ga0068863_100362118 | 3300005841 | Bacteria | 1414 |
| 224 | Ga0068863_100744549 | 3300005841 | Bacteria | 976 |
| 225 | Ga0068863_101109021 | 3300005841 | Bacteria | 796 |
| 226 | Ga0068863_101881912 | 3300005841 | Unclassified | 608 |
| 227 | Ga0068858_100000647 | 3300005842 | Bacteria | 36268 |
| 228 | Ga0068858_100002332 | 3300005842 | Bacteria | 19193 |
| 229 | Ga0068858_100009884 | 3300005842 | Bacteria | 9064 |
| 230 | Ga0068858_100015004 | 3300005842 | Bacteria | 7289 |
| 231 | Ga0068858_100021480 | 3300005842 | Bacteria | 6031 |
| 232 | Ga0068858_100036806 | 3300005842 | Bacteria | 4537 |
| 233 | Ga0068858_100066563 | 3300005842 | Unclassified | 3336 |
| 234 | Ga0068858_100239525 | 3300005842 | Bacteria | 1721 |
| 235 | Ga0068858_100283307 | 3300005842 | Bacteria | 1578 |
| 236 | Ga0068858_101368653 | 3300005842 | Bacteria | 697 |
| 237 | Ga0068858_101770097 | 3300005842 | Unclassified | 610 |
| 238 | Ga0068860_100039803 | 3300005843 | Bacteria | 4496 |
| 239 | Ga0068860_100219183 | 3300005843 | Bacteria | 1847 |
| 240 | Ga0068860_100309218 | 3300005843 | Bacteria | 1549 |
| 241 | Ga0068860_100505424 | 3300005843 | Unclassified | 1207 |
| 242 | Ga0068860_101097493 | 3300005843 | Bacteria | 815 |
| 243 | Ga0068862_100227281 | 3300005844 | Bacteria | 1691 |
| 244 | Ga0068862_101409704 | 3300005844 | Bacteria | 700 |
| 245 | Ga0081538_10013855 | 3300005981 | Bacteria | 6359 |
| 246 | Ga0075363_100040425 | 3300006048 | Bacteria | 2458 |
| 247 | Ga0097621_100377811 | 3300006237 | Bacteria | 1265 |
| 248 | Ga0097621_100438755 | 3300006237 | Bacteria | 1175 |
| 249 | Ga0097621_100588800 | 3300006237 | Bacteria | 1016 |
| 250 | Ga0075370_10066885 | 3300006353 | Unclassified | 2051 |
| 251 | Ga0068871_100187407 | 3300006358 | Bacteria | 1780 |
| 252 | Ga0068871_100634676 | 3300006358 | Bacteria | 974 |
| 253 | Ga0068871_100889487 | 3300006358 | Bacteria | 825 |
| 254 | Ga0068871_101587963 | 3300006358 | Bacteria | 619 |
| 255 | Ga0075428_100807302 | 3300006844 | Bacteria | 997 |
| 256 | Ga0075430_100018478 | 3300006846 | Bacteria | 5932 |
| 257 | Ga0075430_100111101 | 3300006846 | Bacteria | 2285 |
| 258 | Ga0075431_100033343 | 3300006847 | Bacteria | 5308 |
| 259 | Ga0075431_100045805 | 3300006847 | Bacteria | 4508 |
| 260 | Ga0075431_100046677 | 3300006847 | Bacteria | 4467 |
| 261 | Ga0075431_100068580 | 3300006847 | Unclassified | 3660 |
| 262 | Ga0075431_100657677 | 3300006847 | Bacteria | 1028 |
| 263 | Ga0075433_10060594 | 3300006852 | Bacteria | 3314 |
| 264 | Ga0075433_10223889 | 3300006852 | Bacteria | 1671 |
| 265 | Ga0075433_10332519 | 3300006852 | Bacteria | 1343 |
| 266 | Ga0075433_10572262 | 3300006852 | Bacteria | 992 |
| 267 | Ga0075434_100142855 | 3300006871 | Bacteria | 2414 |
| 268 | Ga0075434_101632336 | 3300006871 | Unclassified | 653 |
| 269 | Ga0075429_100100874 | 3300006880 | Bacteria | 2520 |
| 270 | Ga0075429_100130506 | 3300006880 | Bacteria | 2198 |
| 271 | Ga0075429_100669920 | 3300006880 | Bacteria | 909 |
| 272 | Ga0075429_100768025 | 3300006880 | Bacteria | 844 |
| 273 | Ga0075429_101535986 | 3300006880 | Bacteria | 579 |
| 274 | Ga0068865_100082062 | 3300006881 | Bacteria | 2317 |
| 275 | Ga0068865_100118239 | 3300006881 | Bacteria | 1966 |
| 276 | Ga0068865_100701255 | 3300006881 | Bacteria | 865 |
| 277 | Ga0097620_100028784 | 3300006931 | Bacteria | 5570 |
| 278 | Ga0097620_100056237 | 3300006931 | Bacteria | 3959 |
| 279 | Ga0097620_100169876 | 3300006931 | Bacteria | 2261 |
| 280 | Ga0097620_100665286 | 3300006931 | Bacteria | 1133 |
| 281 | Ga0097620_101349659 | 3300006931 | Bacteria | 786 |
| 282 | Ga0097620_102133447 | 3300006931 | Bacteria | 618 |
| 283 | Ga0075435_100418927 | 3300007076 | Bacteria | 1153 |
| 284 | Ga0105251_10391407 | 3300009011 | Unclassified | 638 |
| 285 | Ga0105244_10043206 | 3300009036 | Bacteria | 2327 |
| 286 | Ga0105240_10668509 | 3300009093 | Bacteria | 1137 |
| 287 | Ga0105240_11158157 | 3300009093 | Viruses | 820 |
| 288 | Ga0105240_11391221 | 3300009093 | Unclassified | 738 |
| 289 | Ga0105240_11632713 | 3300009093 | Bacteria | 674 |
| 290 | Ga0105240_11717811 | 3300009093 | Unclassified | 655 |
| 291 | Ga0111539_10001077 | 3300009094 | Bacteria | 36044 |
| 292 | Ga0111539_10028193 | 3300009094 | Bacteria | 6853 |
| 293 | Ga0111539_10148303 | 3300009094 | Bacteria | 2746 |
| 294 | Ga0111539_10478413 | 3300009094 | Bacteria | 1450 |
| 295 | Ga0111539_12940322 | 3300009094 | Bacteria | 551 |
| 296 | Ga0105245_10095267 | 3300009098 | Bacteria | 2746 |
| 297 | Ga0105245_10297963 | 3300009098 | Bacteria | 1581 |
| 298 | Ga0105245_10410285 | 3300009098 | Unclassified | 1356 |
| 299 | Ga0105245_10562251 | 3300009098 | Bacteria | 1163 |
| 300 | Ga0105247_10000273 | 3300009101 | Bacteria | 47941 |
| 301 | Ga0105247_10001576 | 3300009101 | Bacteria | 16197 |
| 302 | Ga0105247_10003156 | 3300009101 | Bacteria | 10859 |
| 303 | Ga0105247_10597367 | 3300009101 | Unclassified | 818 |
| 304 | Ga0114129_10116337 | 3300009147 | Bacteria | 3685 |
| 305 | Ga0114129_10118185 | 3300009147 | Bacteria | 3652 |
| 306 | Ga0114129_10424672 | 3300009147 | Unclassified | 1748 |
| 307 | Ga0114129_11691241 | 3300009147 | Bacteria | 772 |
| 308 | Ga0114129_12490769 | 3300009147 | Bacteria | 619 |
| 309 | Ga0105243_10211308 | 3300009148 | Unclassified | 1709 |
| 310 | Ga0105243_10299252 | 3300009148 | Bacteria | 1457 |
| 311 | Ga0105243_10637430 | 3300009148 | Bacteria | 1031 |
| 312 | Ga0105243_13080245 | 3300009148 | Unclassified | 505 |
| 313 | Ga0105241_10012734 | 3300009174 | Bacteria | 6172 |
| 314 | Ga0105241_10070569 | 3300009174 | Bacteria | 2711 |
| 315 | Ga0105241_10299323 | 3300009174 | Bacteria | 1380 |
| 316 | Ga0105241_10871166 | 3300009174 | Bacteria | 834 |
| 317 | Ga0105242_10005795 | 3300009176 | Bacteria | 9515 |
| 318 | Ga0105242_10014921 | 3300009176 | Bacteria | 6022 |
| 319 | Ga0105242_10076851 | 3300009176 | Bacteria | 2784 |
| 320 | Ga0105242_10399300 | 3300009176 | Bacteria | 1283 |
| 321 | Ga0105242_10771581 | 3300009176 | Bacteria | 949 |
| 322 | Ga0105248_10002695 | 3300009177 | Bacteria | 19727 |
| 323 | Ga0105248_10051180 | 3300009177 | Bacteria | 4635 |
| 324 | Ga0105248_10072720 | 3300009177 | Unclassified | 3864 |
| 325 | Ga0105248_10171623 | 3300009177 | Bacteria | 2444 |
| 326 | Ga0105248_10197661 | 3300009177 | Bacteria | 2266 |
| 327 | Ga0105248_10315964 | 3300009177 | Bacteria | 1759 |
| 328 | Ga0105248_10425755 | 3300009177 | Bacteria | 1495 |
| 329 | Ga0105248_11961257 | 3300009177 | Unclassified | 665 |
| 330 | Ga0105237_10056495 | 3300009545 | Bacteria | 3929 |
| 331 | Ga0105237_10401498 | 3300009545 | Bacteria | 1375 |
| 332 | Ga0105237_10697554 | 3300009545 | Bacteria | 1022 |
| 333 | Ga0105238_10056355 | 3300009551 | Bacteria | 3943 |
| 334 | Ga0105238_10132532 | 3300009551 | Bacteria | 2470 |
| 335 | Ga0105238_10383913 | 3300009551 | Bacteria | 1396 |
| 336 | Ga0105238_11063457 | 3300009551 | Bacteria | 831 |
| 337 | Ga0105249_10097509 | 3300009553 | Bacteria | 2760 |
| 338 | Ga0105249_10384130 | 3300009553 | Bacteria | 1431 |
| 339 | Ga0105249_10567886 | 3300009553 | Bacteria | 1186 |
| 340 | Ga0105249_12167345 | 3300009553 | Bacteria | 629 |
| 341 | Ga0105249_13220114 | 3300009553 | Unclassified | 525 |
| 342 | Ga0105239_10206170 | 3300010375 | Unclassified | 2203 |
| 343 | Ga0105239_10312333 | 3300010375 | Bacteria | 1772 |
| 344 | Ga0105239_11123581 | 3300010375 | Bacteria | 905 |
| 345 | Ga0105239_12081696 | 3300010375 | Bacteria | 659 |
| 346 | Ga0105239_12295932 | 3300010375 | Bacteria | 628 |
| 347 | Ga0105246_10027855 | 3300011119 | Bacteria | 3707 |
| 348 | Ga0105246_10040583 | 3300011119 | Bacteria | 3142 |
| 349 | Ga0105246_10290976 | 3300011119 | Bacteria | 1314 |
| 350 | Ga0157373_10259966 | 3300013100 | Bacteria | 1228 |
| 351 | Ga0157373_10575733 | 3300013100 | Bacteria | 818 |
| 352 | Ga0157374_10084783 | 3300013296 | Bacteria | 3012 |
| 353 | Ga0157374_10213309 | 3300013296 | Bacteria | 1893 |
| 354 | Ga0157374_10670394 | 3300013296 | Bacteria | 1049 |
| 355 | Ga0157374_11480399 | 3300013296 | Unclassified | 702 |
| 356 | Ga0157378_10000039 | 3300013297 | Bacteria | 115427 |
| 357 | Ga0157378_10000400 | 3300013297 | Bacteria | 42656 |
| 358 | Ga0157378_10521209 | 3300013297 | Bacteria | 1190 |
| 359 | Ga0157378_10641930 | 3300013297 | Unclassified | 1076 |
| 360 | Ga0157378_11067393 | 3300013297 | Bacteria | 844 |
| 361 | Ga0157378_11228526 | 3300013297 | Unclassified | 789 |
| 362 | Ga0163162_10011088 | 3300013306 | Bacteria | 8781 |
| 363 | Ga0163162_10013174 | 3300013306 | Bacteria | 8076 |
| 364 | Ga0163162_10124312 | 3300013306 | Unclassified | 2685 |
| 365 | Ga0163162_10130263 | 3300013306 | Unclassified | 2624 |
| 366 | Ga0163162_10151649 | 3300013306 | Bacteria | 2436 |
| 367 | Ga0163162_10220355 | 3300013306 | Bacteria | 2027 |
| 368 | Ga0157372_10318342 | 3300013307 | Unclassified | 1811 |
| 369 | Ga0157372_10457238 | 3300013307 | Bacteria | 1488 |
| 370 | Ga0157372_10541770 | 3300013307 | Bacteria | 1357 |
| 371 | Ga0157372_10954050 | 3300013307 | Bacteria | 994 |
| 372 | Ga0157372_11626707 | 3300013307 | Bacteria | 743 |
| 373 | Ga0157375_10000009 | 3300013308 | Bacteria | 366440 |
| 374 | Ga0157375_10011917 | 3300013308 | Bacteria | 7693 |
| 375 | Ga0157375_10021084 | 3300013308 | Bacteria | 5968 |
| 376 | Ga0157375_10108149 | 3300013308 | Unclassified | 2875 |
| 377 | Ga0157375_10620782 | 3300013308 | Bacteria | 1239 |
| 378 | Ga0157375_11595069 | 3300013308 | Bacteria | 771 |
| 379 | Ga0157375_13111444 | 3300013308 | Bacteria | 554 |
| 380 | Ga0163163_10001662 | 3300014325 | Bacteria | 18755 |
| 381 | Ga0163163_10007673 | 3300014325 | Bacteria | 9531 |
| 382 | Ga0163163_10061011 | 3300014325 | Unclassified | 3735 |
| 383 | Ga0163163_10077127 | 3300014325 | Bacteria | 3328 |
| 384 | Ga0163163_10388414 | 3300014325 | Bacteria | 1453 |
| 385 | Ga0163163_10541986 | 3300014325 | Bacteria | 1226 |
| 386 | Ga0163163_11290125 | 3300014325 | Unclassified | 792 |
| 387 | Ga0163163_11370270 | 3300014325 | Bacteria | 769 |
| 388 | Ga0163163_11602154 | 3300014325 | Bacteria | 712 |
| 389 | Ga0157380_10136922 | 3300014326 | Bacteria | 2097 |
| 390 | Ga0157380_10148731 | 3300014326 | Bacteria | 2022 |
| 391 | Ga0157380_10217464 | 3300014326 | Bacteria | 1707 |
| 392 | Ga0157380_10226764 | 3300014326 | Bacteria | 1675 |
| 393 | Ga0182008_10010984 | 3300014497 | Bacteria | 4829 |
| 394 | Ga0157377_10096254 | 3300014745 | Bacteria | 1756 |
| 395 | Ga0157377_10660350 | 3300014745 | Bacteria | 754 |
| 396 | Ga0157379_10015503 | 3300014968 | Bacteria | 6690 |
| 397 | Ga0157379_10165294 | 3300014968 | Unclassified | 1997 |
| 398 | Ga0157379_11935660 | 3300014968 | Bacteria | 581 |
| 399 | Ga0157376_10084893 | 3300014969 | Bacteria | 2727 |
| 400 | Ga0157376_10136744 | 3300014969 | Bacteria | 2194 |
| 401 | Ga0157376_10191032 | 3300014969 | Unclassified | 1878 |
| 402 | Ga0157376_10656542 | 3300014969 | Bacteria | 1050 |
| 403 | Ga0157376_10967595 | 3300014969 | Unclassified | 872 |
| 404 | Ga0182007_10001949 | 3300015262 | Bacteria | 10677 |
| 405 | Ga0163161_10139738 | 3300017792 | Bacteria | 1833 |
| 406 | Ga0163161_10186038 | 3300017792 | Bacteria | 1594 |
| 407 | Ga0163161_10194286 | 3300017792 | Bacteria | 1561 |
| 408 | Ga0163161_10487202 | 3300017792 | Bacteria | 1002 |
| 409 | Ga0163161_11150767 | 3300017792 | Unclassified | 669 |
| 410 | Ga0163161_11449893 | 3300017792 | Bacteria | 601 |
| 411 | Ga0213876_10002509 | 3300021384 | Bacteria | 10768 |
| 412 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 413 | Ga0209758_1047713 | 3300025297 | Bacteria | 1529 |
| 414 | Ga0207426_1003661 | 3300025302 | Bacteria | 8101 |
| 415 | Ga0209257_1083322 | 3300025304 | Bacteria | 815 |
| 416 | Ga0207656_10234663 | 3300025321 | Unclassified | 895 |
| 417 | Ga0207696_1095900 | 3300025711 | Bacteria | 811 |
| 418 | Ga0207655_1065067 | 3300025728 | Bacteria | 1386 |
| 419 | Ga0207653_10000144 | 3300025885 | Bacteria | 50761 |
| 420 | Ga0207642_10193921 | 3300025899 | Bacteria | 1117 |
| 421 | Ga0207710_10000267 | 3300025900 | Bacteria | 42967 |
| 422 | Ga0207710_10011723 | 3300025900 | Bacteria | 3687 |
| 423 | Ga0207710_10017024 | 3300025900 | Bacteria | 3080 |
| 424 | Ga0207688_10228492 | 3300025901 | Unclassified | 1123 |
| 425 | Ga0207680_10008927 | 3300025903 | Unclassified | 4944 |
| 426 | Ga0207680_10333845 | 3300025903 | Bacteria | 1062 |
| 427 | Ga0207680_10591076 | 3300025903 | Bacteria | 794 |
| 428 | Ga0207647_10058800 | 3300025904 | Unclassified | 2353 |
| 429 | Ga0207645_10640720 | 3300025907 | Unclassified | 722 |
| 430 | Ga0207645_10856567 | 3300025907 | Bacteria | 618 |
| 431 | Ga0207643_10884818 | 3300025908 | Bacteria | 579 |
| 432 | Ga0207684_10177228 | 3300025910 | Unclassified | 1838 |
| 433 | Ga0207654_10094646 | 3300025911 | Bacteria | 1828 |
| 434 | Ga0207654_10213117 | 3300025911 | Bacteria | 1277 |
| 435 | Ga0207654_10242720 | 3300025911 | Bacteria | 1204 |
| 436 | Ga0207654_10371269 | 3300025911 | Bacteria | 989 |
| 437 | Ga0207654_10389690 | 3300025911 | Bacteria | 967 |
| 438 | Ga0207707_10131605 | 3300025912 | Bacteria | 2188 |
| 439 | Ga0207707_10510635 | 3300025912 | Bacteria | 1024 |
| 440 | Ga0207707_11193069 | 3300025912 | Bacteria | 616 |
| 441 | Ga0207695_10195015 | 3300025913 | Bacteria | 1941 |
| 442 | Ga0207695_10984169 | 3300025913 | Unclassified | 723 |
| 443 | Ga0207695_11056227 | 3300025913 | Bacteria | 692 |
| 444 | Ga0207671_10370037 | 3300025914 | Unclassified | 1138 |
| 445 | Ga0207660_10252802 | 3300025917 | Bacteria | 1391 |
| 446 | Ga0207649_10247675 | 3300025920 | Bacteria | 1282 |
| 447 | Ga0207649_10391053 | 3300025920 | Bacteria | 1038 |
| 448 | Ga0207652_10410414 | 3300025921 | Bacteria | 1222 |
| 449 | Ga0207646_10033887 | 3300025922 | Bacteria | 4615 |
| 450 | Ga0207646_10542032 | 3300025922 | Unclassified | 1047 |
| 451 | Ga0207646_10581975 | 3300025922 | Bacteria | 1005 |
| 452 | Ga0207681_10131564 | 3300025923 | Bacteria | 1851 |
| 453 | Ga0207681_10207671 | 3300025923 | Bacteria | 1507 |
| 454 | Ga0207681_11465193 | 3300025923 | Unclassified | 573 |
| 455 | Ga0207694_10085544 | 3300025924 | Bacteria | 2482 |
| 456 | Ga0207694_10485918 | 3300025924 | Bacteria | 1033 |
| 457 | Ga0207650_10019210 | 3300025925 | Bacteria | 4799 |
| 458 | Ga0207650_10053843 | 3300025925 | Unclassified | 2983 |
| 459 | Ga0207650_10080579 | 3300025925 | Unclassified | 2468 |
| 460 | Ga0207650_10144700 | 3300025925 | Unclassified | 1871 |
| 461 | Ga0207650_10398360 | 3300025925 | Bacteria | 1139 |
| 462 | Ga0207650_10792948 | 3300025925 | Bacteria | 803 |
| 463 | Ga0207650_11476129 | 3300025925 | Bacteria | 578 |
| 464 | Ga0207659_10049027 | 3300025926 | Bacteria | 2994 |
| 465 | Ga0207659_10850922 | 3300025926 | Unclassified | 784 |
| 466 | Ga0207687_10012665 | 3300025927 | Bacteria | 5511 |
| 467 | Ga0207687_10153159 | 3300025927 | Bacteria | 1761 |
| 468 | Ga0207687_10325980 | 3300025927 | Unclassified | 1244 |
| 469 | Ga0207644_10035812 | 3300025931 | Bacteria | 3480 |
| 470 | Ga0207644_10219381 | 3300025931 | Bacteria | 1507 |
| 471 | Ga0207644_10323950 | 3300025931 | Bacteria | 1246 |
| 472 | Ga0207690_10761504 | 3300025932 | Bacteria | 799 |
| 473 | Ga0207706_10087051 | 3300025933 | Unclassified | 2746 |
| 474 | Ga0207706_10784823 | 3300025933 | Bacteria | 810 |
| 475 | Ga0207706_10856895 | 3300025933 | Unclassified | 769 |
| 476 | Ga0207686_10002732 | 3300025934 | Bacteria | 9562 |
| 477 | Ga0207686_10085321 | 3300025934 | Bacteria | 2071 |
| 478 | Ga0207686_10091839 | 3300025934 | Bacteria | 2006 |
| 479 | Ga0207709_10104665 | 3300025935 | Bacteria | 1879 |
| 480 | Ga0207709_10163948 | 3300025935 | Bacteria | 1553 |
| 481 | Ga0207709_10589716 | 3300025935 | Bacteria | 879 |
| 482 | Ga0207670_10017537 | 3300025936 | Bacteria | 4329 |
| 483 | Ga0207670_10059695 | 3300025936 | Bacteria | 2595 |
| 484 | Ga0207670_11607525 | 3300025936 | Viruses | 553 |
| 485 | Ga0207669_11004598 | 3300025937 | Bacteria | 701 |
| 486 | Ga0207704_10079714 | 3300025938 | Bacteria | 2111 |
| 487 | Ga0207704_10290733 | 3300025938 | Bacteria | 1247 |
| 488 | Ga0207691_10021460 | 3300025940 | Bacteria | 6097 |
| 489 | Ga0207691_10248005 | 3300025940 | Bacteria | 1538 |
| 490 | Ga0207691_10290018 | 3300025940 | Bacteria | 1407 |
| 491 | Ga0207691_10379426 | 3300025940 | Bacteria | 1207 |
| 492 | Ga0207691_10579027 | 3300025940 | Bacteria | 951 |
| 493 | Ga0207711_10004193 | 3300025941 | Bacteria | 12342 |
| 494 | Ga0207711_10006657 | 3300025941 | Bacteria | 9729 |
| 495 | Ga0207711_10076160 | 3300025941 | Unclassified | 2921 |
| 496 | Ga0207711_11390131 | 3300025941 | Unclassified | 644 |
| 497 | Ga0207689_10060802 | 3300025942 | Bacteria | 3107 |
| 498 | Ga0207689_10176976 | 3300025942 | Bacteria | 1759 |
| 499 | Ga0207689_10354938 | 3300025942 | Bacteria | 1219 |
| 500 | Ga0207689_10518006 | 3300025942 | Bacteria | 1000 |
| 501 | Ga0207661_10418764 | 3300025944 | Bacteria | 1216 |
| 502 | Ga0207679_10018522 | 3300025945 | Bacteria | 4667 |
| 503 | Ga0207679_10061630 | 3300025945 | Bacteria | 2793 |
| 504 | Ga0207679_10146993 | 3300025945 | Bacteria | 1913 |
| 505 | Ga0207679_10187472 | 3300025945 | Bacteria | 1716 |
| 506 | Ga0207679_10194880 | 3300025945 | Bacteria | 1688 |
| 507 | Ga0207667_10278298 | 3300025949 | Unclassified | 1710 |
| 508 | Ga0207651_10009816 | 3300025960 | Bacteria | 5267 |
| 509 | Ga0207651_10035627 | 3300025960 | Bacteria | 3239 |
| 510 | Ga0207651_10069277 | 3300025960 | Unclassified | 2490 |
| 511 | Ga0207651_10366832 | 3300025960 | Bacteria | 1217 |
| 512 | Ga0207651_10583219 | 3300025960 | Bacteria | 976 |
| 513 | Ga0207651_10672841 | 3300025960 | Unclassified | 910 |
| 514 | Ga0207651_10992845 | 3300025960 | Bacteria | 750 |
| 515 | Ga0207712_10008554 | 3300025961 | Bacteria | 6471 |
| 516 | Ga0207712_10155016 | 3300025961 | Bacteria | 1773 |
| 517 | Ga0207712_10451543 | 3300025961 | Bacteria | 1090 |
| 518 | Ga0207668_10119569 | 3300025972 | Unclassified | 1992 |
| 519 | Ga0207640_10532947 | 3300025981 | Bacteria | 983 |
| 520 | Ga0207658_10095418 | 3300025986 | Bacteria | 2317 |
| 521 | Ga0207658_10111846 | 3300025986 | Unclassified | 2160 |
| 522 | Ga0207677_10059741 | 3300026023 | Bacteria | 2631 |
| 523 | Ga0207677_10396175 | 3300026023 | Bacteria | 1170 |
| 524 | Ga0207703_10000601 | 3300026035 | Bacteria | 36559 |
| 525 | Ga0207703_10003386 | 3300026035 | Bacteria | 13388 |
| 526 | Ga0207703_10007165 | 3300026035 | Bacteria | 8871 |
| 527 | Ga0207703_10043975 | 3300026035 | Bacteria | 3587 |
| 528 | Ga0207703_10080875 | 3300026035 | Bacteria | 2707 |
| 529 | Ga0207703_10111175 | 3300026035 | Unclassified | 2338 |
| 530 | Ga0207703_10349519 | 3300026035 | Bacteria | 1361 |
| 531 | Ga0207703_10526108 | 3300026035 | Bacteria | 1113 |
| 532 | Ga0207703_10864146 | 3300026035 | Bacteria | 865 |
| 533 | Ga0207639_10242095 | 3300026041 | Bacteria | 1569 |
| 534 | Ga0207639_11018091 | 3300026041 | Bacteria | 776 |
| 535 | Ga0207678_10654099 | 3300026067 | Bacteria | 923 |
| 536 | Ga0207708_10003525 | 3300026075 | Bacteria | 11528 |
| 537 | Ga0207708_10058377 | 3300026075 | Unclassified | 2944 |
| 538 | Ga0207702_10432504 | 3300026078 | Bacteria | 1274 |
| 539 | Ga0207641_10044187 | 3300026088 | Bacteria | 3746 |
| 540 | Ga0207641_10097202 | 3300026088 | Bacteria | 2588 |
| 541 | Ga0207641_10674581 | 3300026088 | Bacteria | 1016 |
| 542 | Ga0207641_10846834 | 3300026088 | Unclassified | 906 |
| 543 | Ga0207641_10970012 | 3300026088 | Bacteria | 846 |
| 544 | Ga0207641_11707946 | 3300026088 | Unclassified | 631 |
| 545 | Ga0207648_10051149 | 3300026089 | Bacteria | 3611 |
| 546 | Ga0207648_10079721 | 3300026089 | Bacteria | 2856 |
| 547 | Ga0207648_10833317 | 3300026089 | Unclassified | 860 |
| 548 | Ga0207648_11311688 | 3300026089 | Bacteria | 680 |
| 549 | Ga0207676_10001144 | 3300026095 | Bacteria | 19991 |
| 550 | Ga0207676_10034819 | 3300026095 | Bacteria | 3815 |
| 551 | Ga0207676_10053202 | 3300026095 | Bacteria | 3168 |
| 552 | Ga0207676_10074156 | 3300026095 | Unclassified | 2740 |
| 553 | Ga0207676_10083064 | 3300026095 | Bacteria | 2607 |
| 554 | Ga0207676_10194974 | 3300026095 | Bacteria | 1785 |
| 555 | Ga0207676_10611334 | 3300026095 | Bacteria | 1048 |
| 556 | Ga0207676_11826696 | 3300026095 | Bacteria | 606 |
| 557 | Ga0207674_10712270 | 3300026116 | Bacteria | 969 |
| 558 | Ga0207675_100024155 | 3300026118 | Bacteria | 5651 |
| 559 | Ga0207675_100027018 | 3300026118 | Bacteria | 5344 |
| 560 | Ga0207675_100027936 | 3300026118 | Bacteria | 5254 |
| 561 | Ga0207675_100090805 | 3300026118 | Unclassified | 2872 |
| 562 | Ga0207675_100749863 | 3300026118 | Bacteria | 988 |
| 563 | Ga0207675_100879073 | 3300026118 | Bacteria | 912 |
| 564 | Ga0207675_101475941 | 3300026118 | Bacteria | 701 |
| 565 | Ga0207675_102051966 | 3300026118 | Bacteria | 589 |
| 566 | Ga0207683_10378909 | 3300026121 | Bacteria | 1300 |
| 567 | Ga0207683_11453795 | 3300026121 | Bacteria | 633 |
| 568 | Ga0207698_10031691 | 3300026142 | Bacteria | 3820 |
| 569 | Ga0207698_10049237 | 3300026142 | Bacteria | 3206 |
| 570 | Ga0207698_10316047 | 3300026142 | Bacteria | 1461 |
| 571 | Ga0207698_10342532 | 3300026142 | Bacteria | 1409 |
| 572 | Ga0207428_10002218 | 3300027907 | Bacteria | 19493 |
| 573 | Ga0207428_10568409 | 3300027907 | Bacteria | 819 |
| 574 | Ga0268266_10000019 | 3300028379 | Bacteria | 556465 |
| 575 | Ga0268266_10031992 | 3300028379 | Bacteria | 4470 |
| 576 | Ga0268265_10338949 | 3300028380 | Bacteria | 1368 |
| 577 | Ga0268264_10019695 | 3300028381 | Bacteria | 5512 |
| 578 | Ga0268264_10085525 | 3300028381 | Bacteria | 2707 |
| 579 | Ga0268264_10127293 | 3300028381 | Bacteria | 2253 |
| 580 | Ga0268264_10995914 | 3300028381 | Bacteria | 844 |
| 581 | Ga0265318_10004703 | 3300028577 | Bacteria | 6548 |
| 582 | Ga0307517_10004922 | 3300028786 | Bacteria | 20357 |
| 583 | Ga0307517_10064807 | 3300028786 | Bacteria | 3391 |
| 584 | Ga0307517_10221631 | 3300028786 | Bacteria | 1149 |
| 585 | Ga0307515_10025310 | 3300028794 | Bacteria | 10277 |
| 586 | Ga0307515_10160591 | 3300028794 | Bacteria | 2294 |
| 587 | Ga0307512_10244797 | 3300030522 | Bacteria | 902 |
| 588 | Ga0314311_1202169 | 3300030733 | Bacteria | 3204 |
| 589 | Ga0316178_1063384 | 3300030735 | Bacteria | 2063 |
| 590 | Ga0307513_10197669 | 3300031456 | Bacteria | 1855 |
| 591 | Ga0307513_10329799 | 3300031456 | Unclassified | 1281 |
| 592 | Ga0307513_10698862 | 3300031456 | Bacteria | 720 |
| 593 | Ga0307509_10099786 | 3300031507 | Bacteria | 2944 |
| 594 | Ga0307408_100281127 | 3300031548 | Bacteria | 1386 |
| 595 | Ga0265313_10024087 | 3300031595 | Bacteria | 3260 |
| 596 | Ga0307508_10001461 | 3300031616 | Bacteria | 26492 |
| 597 | Ga0307508_10235936 | 3300031616 | Bacteria | 1427 |
| 598 | Ga0307413_10852878 | 3300031824 | Bacteria | 770 |
| 599 | Ga0307406_11698466 | 3300031901 | Bacteria | 559 |
| 600 | Ga0307407_10226502 | 3300031903 | Bacteria | 1267 |
| 601 | Ga0307416_102363145 | 3300032002 | Unclassified | 631 |
| 602 | Ga0307411_10095974 | 3300032005 | Bacteria | 2083 |
| 603 | Ga0316588_1005801 | 3300033528 | Archaea | 2431 |
| 604 | Ga0373951_0010188 | 3300035091 | Bacteria | 2110 |
| 605 | Ga0373955_0267385 | 3300035172 | Bacteria | 1027 |
| 606 | Ga0373933_0691823 | 3300035724 | Unclassified | 670 |
| 607 | Ga0395900_0366567 | 3300037418 | Bacteria | 1411 |
| 608 | Ga0395898_1424865 | 3300037466 | Bacteria | 620 |
| 609 | Ga0395905_0119273 | 3300037471 | Bacteria | 2479 |
| 610 | Ga0242422_00030 | 3300038699 | Bacteria | 5467 |
| 611 | Ga0242420_001615 | 3300038996 | Unclassified | 3052 |
| 612 | Ga0436365_1337852 | 3300039437 | Bacteria | 17594 |
| 613 | Ga0436363_0136866 | 3300039450 | Bacteria | 806 |
| 614 | Ga0439453_0034934 | 3300041408 | Bacteria | 967 |
| 615 | Ga0439449_0007120 | 3300042007 | Bacteria | 4257 |
| 616 | Ga0439462_0016909 | 3300042015 | Bacteria | 1888 |
| 617 | Ga0439435_0027473 | 3300042436 | Bacteria | 1523 |
| 618 | Ga0439459_0021464 | 3300042438 | Bacteria | 1240 |
| 619 | Ga0451577_0124136 | 3300042876 | Bacteria | 2313 |
| 620 | Ga0439440_0032114 | 3300042993 | Bacteria | 1245 |
| 621 | Ga0453684_0123612 | 3300044712 | Bacteria | 3119 |
| 622 | Ga0451576_0142094 | 3300045051 | Unclassified | 2503 |
| 623 | Ga0451576_0172877 | 3300045051 | Unclassified | 2255 |
| 624 | Ga0451576_0331855 | 3300045051 | Bacteria | 1592 |
| 625 | Ga0495603_0242384 | 3300046455 | Bacteria | 1038 |
| 626 | Ga0495590_0000646 | 3300046457 | Bacteria | 16170 |
| 627 | Ga0495590_0164459 | 3300046457 | Bacteria | 807 |
| 628 | Ga0495638_0026825 | 3300046460 | Bacteria | 3732 |
| 629 | Ga0495651_0928089 | 3300046462 | Bacteria | 531 |
| 630 | Ga0495653_0014403 | 3300046463 | Bacteria | 6452 |
| 631 | Ga0495580_0053592 | 3300046472 | Bacteria | 2846 |
| 632 | Ga0495580_0082119 | 3300046472 | Bacteria | 2246 |
| 633 | Ga0495605_0061696 | 3300046474 | Bacteria | 1793 |
| 634 | Ga0495584_0000095 | 3300046491 | Bacteria | 60048 |
| 635 | Ga0495585_0000428 | 3300046492 | Bacteria | 40340 |
| 636 | Ga0495585_0007809 | 3300046492 | Bacteria | 6513 |
| 637 | Ga0495596_0003769 | 3300046500 | Bacteria | 7566 |
| 638 | Ga0495607_0163268 | 3300046501 | Bacteria | 1130 |
| 639 | Ga0495583_0000620 | 3300046506 | Bacteria | 47709 |
| 640 | Ga0495583_0007506 | 3300046506 | Bacteria | 6830 |
| 641 | Ga0495616_0000052 | 3300046513 | Bacteria | 105258 |
| 642 | Ga0495616_0000447 | 3300046513 | Bacteria | 31451 |
| 643 | Ga0495616_0001194 | 3300046513 | Bacteria | 18313 |
| 644 | Ga0495632_0000082 | 3300046519 | Bacteria | 97726 |
| 645 | Ga0495632_0132721 | 3300046519 | Bacteria | 1158 |
| 646 | Ga0495632_0165107 | 3300046519 | Bacteria | 1018 |
| 647 | Ga0495637_0230618 | 3300046520 | Bacteria | 671 |
| 648 | Ga0495643_0000079 | 3300046522 | Bacteria | 162735 |
| 649 | Ga0495648_0000774 | 3300046524 | Bacteria | 34103 |
| 650 | Ga0495642_0122561 | 3300046528 | Bacteria | 1116 |
| 651 | Ga0495642_0453983 | 3300046528 | Unclassified | 566 |
| 652 | Ga0495654_0142333 | 3300046530 | Bacteria | 1068 |
| 653 | Ga0495609_0024437 | 3300046538 | Bacteria | 2772 |
| 654 | Ga0495609_0294846 | 3300046538 | Unclassified | 661 |
| 655 | Ga0495621_0146152 | 3300046539 | Bacteria | 928 |
| 656 | Ga0495597_0068321 | 3300046542 | Bacteria | 1536 |
| 657 | Ga0495633_0000640 | 3300046558 | Bacteria | 32688 |
| 658 | Ga0495668_0006667 | 3300046616 | Bacteria | 7520 |
| 659 | Ga0495625_0026470 | 3300046660 | Bacteria | 4383 |
| 660 | Ga0495625_0039775 | 3300046660 | Bacteria | 3432 |
| 661 | Ga0495625_0084504 | 3300046660 | Bacteria | 2204 |
| 662 | Ga0495625_0132540 | 3300046660 | Bacteria | 1687 |
| 663 | Ga0495625_0164908 | 3300046660 | Bacteria | 1482 |
| 664 | Ga0495625_0457777 | 3300046660 | Bacteria | 787 |
| 665 | Ga0495661_0034421 | 3300046665 | Bacteria | 3188 |
| 666 | Ga0495658_0051899 | 3300046683 | Unclassified | 2324 |
| 667 | Ga0495670_0023487 | 3300046691 | Bacteria | 3043 |
| 668 | Ga0495649_0001576 | 3300046694 | Bacteria | 17070 |
| 669 | Ga0495589_0526790 | 3300046794 | Unclassified | 539 |
| 670 | Ga0495660_0006120 | 3300046810 | Bacteria | 7144 |
| 671 | Ga0495660_0017469 | 3300046810 | Bacteria | 4129 |
| 672 | Ga0495680_0315989 | 3300047322 | Bacteria | 1094 |
| 673 | Ga0495683_0000157 | 3300047323 | Bacteria | 66884 |
| 674 | Ga0495683_0016588 | 3300047323 | Bacteria | 3824 |
| 675 | Ga0495687_000187 | 3300047443 | Bacteria | 90147 |
| 676 | Ga0495679_008567 | 3300047446 | Bacteria | 4146 |
| 677 | Ga0495673_0003872 | 3300047469 | Bacteria | 9636 |
| 678 | Ga0495593_0117580 | 3300047673 | Bacteria | 1354 |
| 679 | Ga0495602_0008918 | 3300048088 | Bacteria | 10456 |
| 680 | Ga0495626_0047699 | 3300048091 | Bacteria | 1990 |
| 681 | Ga0495626_0163821 | 3300048091 | Unclassified | 931 |
| 682 | Ga0496100_0076667 | 3300048903 | Bacteria | 2245 |
| 683 | Ga0496101_0034270 | 3300048904 | Bacteria | 3585 |
| 684 | Ga0496101_0667122 | 3300048904 | Bacteria | 821 |
| 685 | Ga0496102_0004345 | 3300048905 | Bacteria | 11980 |
| 686 | Ga0496104_0006833 | 3300048907 | Bacteria | 10054 |
| 687 | Ga0496104_0019564 | 3300048907 | Bacteria | 6198 |
| 688 | Ga0496104_0114200 | 3300048907 | Bacteria | 2590 |
| 689 | Ga0496104_1261294 | 3300048907 | Bacteria | 642 |
| 690 | Ga0496105_0187045 | 3300048908 | Unclassified | 1695 |
| 691 | Ga0496106_0010643 | 3300048909 | Bacteria | 6797 |
| 692 | Ga0496106_0012662 | 3300048909 | Bacteria | 6232 |
| 693 | Ga0496106_0029673 | 3300048909 | Unclassified | 4078 |
| 694 | Ga0496107_0508336 | 3300048910 | Bacteria | 893 |
| 695 | Ga0496107_0919245 | 3300048910 | Unclassified | 637 |
| 696 | Ga0496108_0002232 | 3300048911 | Bacteria | 15524 |
| 697 | Ga0496108_0006449 | 3300048911 | Bacteria | 9510 |
| 698 | Ga0496108_0034344 | 3300048911 | Unclassified | 4214 |
| 699 | Ga0496108_0752787 | 3300048911 | Unclassified | 843 |
| 700 | Ga0496109_0015121 | 3300048912 | Bacteria | 6717 |
| 701 | Ga0496109_0104250 | 3300048912 | Bacteria | 2633 |
| 702 | Ga0496110_0000753 | 3300048913 | Bacteria | 22414 |
| 703 | Ga0496110_0005940 | 3300048913 | Bacteria | 9609 |
| 704 | Ga0496110_0014596 | 3300048913 | Bacteria | 6527 |
| 705 | Ga0496110_0798857 | 3300048913 | Bacteria | 848 |
| 706 | Ga0496110_1117781 | 3300048913 | Bacteria | 696 |
| 707 | Ga0496112_0000842 | 3300048915 | Bacteria | 21887 |
| 708 | Ga0496112_0011469 | 3300048915 | Bacteria | 8094 |
| 709 | Ga0496112_0044731 | 3300048915 | Bacteria | 4339 |
| 710 | Ga0496112_0488317 | 3300048915 | Unclassified | 1168 |
| 711 | Ga0496113_0022989 | 3300048916 | Bacteria | 4418 |
| 712 | Ga0496114_0282651 | 3300048917 | Bacteria | 1463 |
| 713 | Ga0496115_0011104 | 3300048918 | Bacteria | 6749 |
| 714 | Ga0496116_0019997 | 3300048919 | Bacteria | 5101 |
| 715 | Ga0496121_0428193 | 3300048924 | Bacteria | 859 |
| 716 | Ga0496122_0028361 | 3300048925 | Bacteria | 4753 |
| 717 | Ga0496122_0290019 | 3300048925 | Bacteria | 889 |
| 718 | Ga0496123_0145087 | 3300048926 | Bacteria | 1291 |
| 719 | Ga0496124_0026185 | 3300048927 | Bacteria | 5265 |
| 720 | Ga0496124_0143649 | 3300048927 | Bacteria | 1880 |
| 721 | Ga0496125_0000220 | 3300048928 | Bacteria | 116658 |
| 722 | Ga0496126_0079815 | 3300048929 | Bacteria | 2896 |
| 723 | Ga0496126_1345879 | 3300048929 | Bacteria | 518 |
| 724 | Ga0495678_000102 | 3300049459 | Bacteria | 104107 |
| 725 | Ga0495682_0008455 | 3300049460 | Bacteria | 4054 |
| 726 | Ga0501031_0003222 | 3300049568 | Bacteria | 10479 |
| 727 | Ga0501032_0183046 | 3300049569 | Bacteria | 1371 |
| 728 | Ga0501033_0034215 | 3300049570 | Bacteria | 3813 |
| 729 | Ga0501036_0013733 | 3300049572 | Bacteria | 6733 |
| 730 | Ga0501037_0045053 | 3300049573 | Bacteria | 3238 |
| 731 | Ga0501038_0002779 | 3300049574 | Bacteria | 16282 |
| 732 | Ga0501039_0004728 | 3300049575 | Bacteria | 10309 |
| 733 | Ga0501039_0687517 | 3300049575 | Bacteria | 800 |
| 734 | Ga0501040_0003596 | 3300049576 | Bacteria | 10025 |
| 735 | Ga0501041_0001971 | 3300049577 | Bacteria | 11543 |
| 736 | Ga0501042_0005861 | 3300049578 | Bacteria | 7940 |
| 737 | Ga0501042_0436467 | 3300049578 | Bacteria | 949 |
| 738 | Ga0501042_0883087 | 3300049578 | Bacteria | 651 |
| 739 | Ga0501042_1112942 | 3300049578 | Unclassified | 576 |
| 740 | Ga0501043_0024564 | 3300049579 | Bacteria | 4729 |
| 741 | Ga0501046_0007376 | 3300049580 | Bacteria | 9671 |
| 742 | Ga0501046_1252100 | 3300049580 | Bacteria | 508 |
| 743 | Ga0501048_0001573 | 3300049582 | Bacteria | 17350 |
| 744 | Ga0501048_0906655 | 3300049582 | Unclassified | 634 |
| 745 | Ga0501071_0000078 | 3300049587 | Bacteria | 34978 |
| 746 | Ga0501072_0001519 | 3300049588 | Bacteria | 17373 |
| 747 | Ga0501073_0163667 | 3300049589 | Bacteria | 1541 |
| 748 | Ga0501074_0006511 | 3300049590 | Bacteria | 8431 |
| 749 | Ga0501075_0013392 | 3300049591 | Bacteria | 5853 |
| 750 | Ga0501076_0007831 | 3300049592 | Bacteria | 7785 |
| 751 | Ga0501077_0000219 | 3300049593 | Bacteria | 33570 |
| 752 | Ga0501227_198553 | 3300049665 | Unclassified | 568 |
| 753 | Ga0501249_003389 | 3300049679 | Bacteria | 3197 |
| 754 | Ga0501079_0000213 | 3300049741 | Bacteria | 34053 |
| 755 | Ga0501079_0584631 | 3300049741 | Bacteria | 879 |
| 756 | Ga0501080_0179110 | 3300049742 | Bacteria | 1951 |
| 757 | Ga0501081_0081832 | 3300049743 | Bacteria | 2261 |
| 758 | Ga0501083_0002560 | 3300049744 | Bacteria | 12495 |
| 759 | Ga0501035_0013752 | 3300049822 | Bacteria | 7471 |
| 760 | Ga0501044_0211462 | 3300049823 | Bacteria | 1894 |
| 761 | Ga0501045_0000197 | 3300049824 | Bacteria | 34275 |
| 762 | Ga0501045_0177739 | 3300049824 | Bacteria | 1586 |
| 763 | Ga0501045_0544803 | 3300049824 | Bacteria | 861 |
| 764 | nmdc:mga03n38_1501_c1 | 3300050490 | Bacteria | 3688 |
| 765 | nmdc:mga07m45_365696_c1 | 3300050496 | Bacteria | 838 |
| 766 | nmdc:mga05p37_1552306_c1 | 3300050507 | Bacteria | 656 |
| 767 | nmdc:mga05p37_246970_c1 | 3300050507 | Unclassified | 2142 |
| 768 | nmdc:mga05p37_425178_c1 | 3300050507 | Bacteria | 1545 |
| 769 | nmdc:mga09592_125810_c1 | 3300050508 | Bacteria | 2203 |
| 770 | nmdc:mga09592_149922_c1 | 3300050508 | Bacteria | 2012 |
| 771 | nmdc:mga09592_342448_c1 | 3300050508 | Bacteria | 1294 |
| 772 | nmdc:mga0qj67_14754_c1 | 3300050509 | Bacteria | 5906 |
| 773 | nmdc:mga0qj67_65342_c1 | 3300050509 | Unclassified | 2896 |
| 774 | nmdc:mga06r32_114677_c1 | 3300050510 | Bacteria | 2653 |
| 775 | nmdc:mga06r32_133702_c1 | 3300050510 | Bacteria | 2454 |
| 776 | nmdc:mga06r32_39519_c1 | 3300050510 | Bacteria | 4477 |
| 777 | nmdc:mga06r32_52810_c1 | 3300050510 | Unclassified | 3893 |
| 778 | nmdc:mga06r32_848192_c1 | 3300050510 | Bacteria | 872 |
| 779 | nmdc:mga08y16_124873_c1 | 3300050511 | Bacteria | 2677 |
| 780 | nmdc:mga08y16_1629977_c1 | 3300050511 | Bacteria | 602 |
| 781 | nmdc:mga08y16_236228_c1 | 3300050511 | Bacteria | 1890 |
| 782 | nmdc:mga08y16_371_c1 | 3300050511 | Bacteria | 40737 |
| 783 | nmdc:mga0n895_1398660_c1 | 3300050512 | Unclassified | 668 |
| 784 | nmdc:mga0n895_789211_c1 | 3300050512 | Bacteria | 941 |
| 785 | nmdc:mga0n895_805168_c1 | 3300050512 | Bacteria | 930 |
| 786 | nmdc:mga0a205_19971_c1 | 3300050515 | Bacteria | 6321 |
| 787 | Ga0495655_0000033 | 3300053083 | Bacteria | 29905 |
| 788 | Ga0500568_0003238 | 3300053139 | Bacteria | 9207 |
| 789 | Ga0500568_0033636 | 3300053139 | Bacteria | 2102 |
| 790 | Ga0501084_0000612 | 3300054114 | Bacteria | 27182 |
| 791 | Ga0501084_0008906 | 3300054114 | Bacteria | 8304 |
| 792 | Ga0501084_1367790 | 3300054114 | Bacteria | 593 |
| 793 | Ga0587084_059589 | 3300059477 | Bacteria | 697 |
| 794 | Ga0501082_0001948 | 3300060353 | Bacteria | 18166 |
| 795 | Ga0530510_0003941 | 3300061734 | Bacteria | 10235 |
| 796 | Ga0530510_0278976 | 3300061734 | Bacteria | 1248 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005459 | Ga0068867_101401778 | Ga0068867_1014017781 | 129 |
| 2 | 3300026089 | Ga0207648_11311688 | Ga0207648_113116882 | 129 |
| 3 | 3300006880 | Ga0075429_100669920 | Ga0075429_1006699202 | 130 |
| 4 | 3300050508 | nmdc:mga09592_342448_c1 | nmdc:mga09592_342448_c1_681_1115 | 130 |
| 5 | 3300005354 | Ga0070675_100495886 | Ga0070675_1004958862 | 131 |
| 6 | 3300048907 | Ga0496104_1261294 | Ga0496104_1261294_139_588 | 131 |
| 7 | 3300005444 | Ga0070694_100190914 | Ga0070694_1001909141 | 134 |
| 8 | 3300005549 | Ga0070704_101983031 | Ga0070704_1019830311 | 134 |
| 9 | 3300009094 | Ga0111539_10478413 | Ga0111539_104784132 | 134 |
| 10 | 3300009147 | Ga0114129_12490769 | Ga0114129_124907691 | 134 |
| 11 | 3300009553 | Ga0105249_10567886 | Ga0105249_105678862 | 134 |
| 12 | 3300009553 | Ga0105249_12167345 | Ga0105249_121673451 | 134 |
| 13 | 3300017792 | Ga0163161_10139738 | Ga0163161_101397382 | 134 |
| 14 | 3300025961 | Ga0207712_10451543 | Ga0207712_104515433 | 134 |
| 15 | 3300046474 | Ga0495605_0061696 | Ga0495605_0061696_126_530 | 134 |
| 16 | 3300005337 | Ga0070682_101462485 | Ga0070682_1014624852 | 136 |
| 17 | 3300005546 | Ga0070696_101208066 | Ga0070696_1012080662 | 137 |
| 18 | 3300009036 | Ga0105244_10043206 | Ga0105244_100432062 | 137 |
| 19 | 3300025728 | Ga0207655_1065067 | Ga0207655_10650672 | 137 |
| 20 | 3300031824 | Ga0307413_10852878 | Ga0307413_108528782 | 137 |
| 21 | 3300046462 | Ga0495651_0928089 | Ga0495651_0928089_47_493 | 137 |
| 22 | 3300005334 | Ga0068869_100025548 | Ga0068869_1000255486 | 138 |
| 23 | 3300007076 | Ga0075435_100418927 | Ga0075435_1004189273 | 138 |
| 24 | 3300009098 | Ga0105245_10095267 | Ga0105245_100952672 | 138 |
| 25 | 3300009176 | Ga0105242_10005795 | Ga0105242_100057959 | 138 |
| 26 | 3300013306 | Ga0163162_10151649 | Ga0163162_101516495 | 138 |
| 27 | 3300025927 | Ga0207687_10153159 | Ga0207687_101531592 | 138 |
| 28 | 3300025934 | Ga0207686_10002732 | Ga0207686_100027326 | 138 |
| 29 | 3300025942 | Ga0207689_10060802 | Ga0207689_100608026 | 138 |
| 30 | 3300046522 | Ga0495643_0000079 | Ga0495643_0000079_114224_114667 | 138 |
| 31 | 3300049578 | Ga0501042_0436467 | Ga0501042_0436467_355_789 | 138 |
| 32 | 3300049679 | Ga0501249_003389 | Ga0501249_003389_1166_1609 | 138 |
| 33 | 3300005345 | Ga0070692_10419773 | Ga0070692_104197731 | 139 |
| 34 | 3300005440 | Ga0070705_101139255 | Ga0070705_1011392552 | 139 |
| 35 | 3300005546 | Ga0070696_101048010 | Ga0070696_1010480101 | 139 |
| 36 | 3300005578 | Ga0068854_100143907 | Ga0068854_1001439074 | 139 |
| 37 | 3300005615 | Ga0070702_100190815 | Ga0070702_1001908152 | 139 |
| 38 | 3300009147 | Ga0114129_10116337 | Ga0114129_101163372 | 139 |
| 39 | 3300009147 | Ga0114129_11691241 | Ga0114129_116912412 | 139 |
| 40 | 3300025942 | Ga0207689_10518006 | Ga0207689_105180062 | 139 |
| 41 | 3300050507 | nmdc:mga05p37_1552306_c1 | nmdc:mga05p37_1552306_c1_99_542 | 139 |
| 42 | 3300003771 | Ga0055526_1000001 | Ga0055526_1000001121 | 140 |
| 43 | 3300005981 | Ga0081538_10013855 | Ga0081538_100138555 | 140 |
| 44 | 3300006847 | Ga0075431_100033343 | Ga0075431_1000333432 | 140 |
| 45 | 3300025295 | Ga0209564_1000002 | Ga0209564_1000002444 | 140 |
| 46 | 3300042876 | Ga0451577_0124136 | Ga0451577_0124136_215_658 | 140 |
| 47 | 3300044712 | Ga0453684_0123612 | Ga0453684_0123612_256_699 | 140 |
| 48 | 3300050510 | nmdc:mga06r32_133702_c1 | nmdc:mga06r32_133702_c1_1750_2193 | 140 |
| 49 | iso_pu_bacteria | 2857472729 | 2857478133 | 140 |
| 50 | iso_pu_bacteria | 2865002811 | 2865005470 | 140 |
| 51 | iso_pu_bacteria | 8002317523 | 8002319669 | 140 |
| 52 | iso_pu_bacteria | 8046991243 | 8046998562 | 140 |
| 53 | iso_pu_bacteria | 8054795415 | 8054796463 | 140 |
| 54 | 2162886007 | SwRhRL2b_contig_3005271 | SwRhRL2b_0915.00008020 | 141 |
| 55 | 3300005288 | Ga0065714_10193689 | Ga0065714_101936892 | 141 |
| 56 | 3300005289 | Ga0065704_10328536 | Ga0065704_103285362 | 141 |
| 57 | 3300005289 | Ga0065704_10334449 | Ga0065704_103344491 | 141 |
| 58 | 3300005290 | Ga0065712_10003972 | Ga0065712_100039724 | 141 |
| 59 | 3300005293 | Ga0065715_10091491 | Ga0065715_100914918 | 141 |
| 60 | 3300005295 | Ga0065707_10141047 | Ga0065707_101410472 | 141 |
| 61 | 3300005295 | Ga0065707_10307784 | Ga0065707_103077841 | 141 |
| 62 | 3300005330 | Ga0070690_100117157 | Ga0070690_1001171572 | 141 |
| 63 | 3300005331 | Ga0070670_100064761 | Ga0070670_1000647613 | 141 |
| 64 | 3300005331 | Ga0070670_100473024 | Ga0070670_1004730241 | 141 |
| 65 | 3300005340 | Ga0070689_100225668 | Ga0070689_1002256682 | 141 |
| 66 | 3300005343 | Ga0070687_100175777 | Ga0070687_1001757772 | 141 |
| 67 | 3300005354 | Ga0070675_100419559 | Ga0070675_1004195592 | 141 |
| 68 | 3300005365 | Ga0070688_100358533 | Ga0070688_1003585331 | 141 |
| 69 | 3300005366 | Ga0070659_100870743 | Ga0070659_1008707432 | 141 |
| 70 | 3300005438 | Ga0070701_10013835 | Ga0070701_100138355 | 141 |
| 71 | 3300005471 | Ga0070698_100002168 | Ga0070698_1000021687 | 141 |
| 72 | 3300005543 | Ga0070672_101172514 | Ga0070672_1011725141 | 141 |
| 73 | 3300005545 | Ga0070695_100019038 | Ga0070695_1000190383 | 141 |
| 74 | 3300005545 | Ga0070695_100123890 | Ga0070695_1001238902 | 141 |
| 75 | 3300005547 | Ga0070693_100134923 | Ga0070693_1001349234 | 141 |
| 76 | 3300005548 | Ga0070665_101140354 | Ga0070665_1011403542 | 141 |
| 77 | 3300005616 | Ga0068852_102140237 | Ga0068852_1021402372 | 141 |
| 78 | 3300005617 | Ga0068859_100028784 | Ga0068859_1000287849 | 141 |
| 79 | 3300005618 | Ga0068864_100000481 | Ga0068864_10000048116 | 141 |
| 80 | 3300005618 | Ga0068864_100633147 | Ga0068864_1006331472 | 141 |
| 81 | 3300005719 | Ga0068861_102081321 | Ga0068861_1020813211 | 141 |
| 82 | 3300005834 | Ga0068851_10072702 | Ga0068851_100727022 | 141 |
| 83 | 3300005840 | Ga0068870_10883197 | Ga0068870_108831972 | 141 |
| 84 | 3300005842 | Ga0068858_100009884 | Ga0068858_1000098849 | 141 |
| 85 | 3300005843 | Ga0068860_100039803 | Ga0068860_1000398036 | 141 |
| 86 | 3300005844 | Ga0068862_101409704 | Ga0068862_1014097042 | 141 |
| 87 | 3300006852 | Ga0075433_10223889 | Ga0075433_102238891 | 141 |
| 88 | 3300006931 | Ga0097620_100028784 | Ga0097620_1000287842 | 141 |
| 89 | 3300009094 | Ga0111539_10001077 | Ga0111539_1000107710 | 141 |
| 90 | 3300009101 | Ga0105247_10000273 | Ga0105247_1000027313 | 141 |
| 91 | 3300009147 | Ga0114129_10118185 | Ga0114129_101181855 | 141 |
| 92 | 3300009177 | Ga0105248_10315964 | Ga0105248_103159644 | 141 |
| 93 | 3300009545 | Ga0105237_10056495 | Ga0105237_100564952 | 141 |
| 94 | 3300009553 | Ga0105249_13220114 | Ga0105249_132201142 | 141 |
| 95 | 3300011119 | Ga0105246_10027855 | Ga0105246_100278552 | 141 |
| 96 | 3300013306 | Ga0163162_10220355 | Ga0163162_102203552 | 141 |
| 97 | 3300013307 | Ga0157372_10541770 | Ga0157372_105417701 | 141 |
| 98 | 3300014325 | Ga0163163_11290125 | Ga0163163_112901252 | 141 |
| 99 | 3300014325 | Ga0163163_11370270 | Ga0163163_113702702 | 141 |
| 100 | 3300025900 | Ga0207710_10000267 | Ga0207710_1000026713 | 141 |
| 101 | 3300025925 | Ga0207650_10080579 | Ga0207650_100805793 | 141 |
| 102 | 3300025925 | Ga0207650_10398360 | Ga0207650_103983602 | 141 |
| 103 | 3300025932 | Ga0207690_10761504 | Ga0207690_107615042 | 141 |
| 104 | 3300025933 | Ga0207706_10784823 | Ga0207706_107848231 | 141 |
| 105 | 3300025935 | Ga0207709_10589716 | Ga0207709_105897162 | 141 |
| 106 | 3300025936 | Ga0207670_11607525 | Ga0207670_116075251 | 141 |
| 107 | 3300025940 | Ga0207691_10248005 | Ga0207691_102480052 | 141 |
| 108 | 3300026035 | Ga0207703_10349519 | Ga0207703_103495192 | 141 |
| 109 | 3300026095 | Ga0207676_10001144 | Ga0207676_1000114418 | 141 |
| 110 | 3300026095 | Ga0207676_10611334 | Ga0207676_106113342 | 141 |
| 111 | 3300026118 | Ga0207675_100749863 | Ga0207675_1007498632 | 141 |
| 112 | 3300027907 | Ga0207428_10002218 | Ga0207428_1000221810 | 141 |
| 113 | 3300028381 | Ga0268264_10085525 | Ga0268264_100855252 | 141 |
| 114 | 3300028577 | Ga0265318_10004703 | Ga0265318_100047032 | 141 |
| 115 | 3300031548 | Ga0307408_100281127 | Ga0307408_1002811272 | 141 |
| 116 | 3300031595 | Ga0265313_10024087 | Ga0265313_100240873 | 141 |
| 117 | 3300035091 | Ga0373951_0010188 | Ga0373951_0010188_1566_1991 | 141 |
| 118 | 3300037418 | Ga0395900_0366567 | Ga0395900_0366567_247_672 | 141 |
| 119 | 3300037466 | Ga0395898_1424865 | Ga0395898_1424865_158_583 | 141 |
| 120 | 3300041408 | Ga0439453_0034934 | Ga0439453_0034934_529_954 | 141 |
| 121 | 3300042436 | Ga0439435_0027473 | Ga0439435_0027473_322_747 | 141 |
| 122 | 3300042438 | Ga0439459_0021464 | Ga0439459_0021464_511_936 | 141 |
| 123 | 3300042993 | Ga0439440_0032114 | Ga0439440_0032114_80_505 | 141 |
| 124 | 3300045051 | Ga0451576_0172877 | Ga0451576_0172877_1688_2122 | 141 |
| 125 | 3300046455 | Ga0495603_0242384 | Ga0495603_0242384_395_820 | 141 |
| 126 | 3300046528 | Ga0495642_0453983 | Ga0495642_0453983_49_474 | 141 |
| 127 | 3300046539 | Ga0495621_0146152 | Ga0495621_0146152_302_727 | 141 |
| 128 | 3300050507 | nmdc:mga05p37_425178_c1 | nmdc:mga05p37_425178_c1_507_932 | 141 |
| 129 | 3300050511 | nmdc:mga08y16_371_c1 | nmdc:mga08y16_371_c1_8450_8881 | 141 |
| 130 | 3300061734 | Ga0530510_0278976 | Ga0530510_0278976_777_1211 | 141 |
| 131 | 3300003322 | rootL2_10020075 | rootL2_100200752 | 142 |
| 132 | 3300005289 | Ga0065704_10714107 | Ga0065704_107141071 | 142 |
| 133 | 3300005290 | Ga0065712_10268973 | Ga0065712_102689732 | 142 |
| 134 | 3300005293 | Ga0065715_10001891 | Ga0065715_100018916 | 142 |
| 135 | 3300005293 | Ga0065715_10318694 | Ga0065715_103186942 | 142 |
| 136 | 3300005293 | Ga0065715_11048134 | Ga0065715_110481341 | 142 |
| 137 | 3300005330 | Ga0070690_100261937 | Ga0070690_1002619373 | 142 |
| 138 | 3300005330 | Ga0070690_100326463 | Ga0070690_1003264632 | 142 |
| 139 | 3300005330 | Ga0070690_101170258 | Ga0070690_1011702581 | 142 |
| 140 | 3300005331 | Ga0070670_100198931 | Ga0070670_1001989312 | 142 |
| 141 | 3300005334 | Ga0068869_101403701 | Ga0068869_1014037011 | 142 |
| 142 | 3300005335 | Ga0070666_10015226 | Ga0070666_100152263 | 142 |
| 143 | 3300005338 | Ga0068868_100080420 | Ga0068868_1000804202 | 142 |
| 144 | 3300005340 | Ga0070689_100664357 | Ga0070689_1006643572 | 142 |
| 145 | 3300005341 | Ga0070691_10460067 | Ga0070691_104600671 | 142 |
| 146 | 3300005345 | Ga0070692_10061309 | Ga0070692_100613094 | 142 |
| 147 | 3300005345 | Ga0070692_10692711 | Ga0070692_106927112 | 142 |
| 148 | 3300005353 | Ga0070669_100021146 | Ga0070669_1000211465 | 142 |
| 149 | 3300005354 | Ga0070675_100333062 | Ga0070675_1003330622 | 142 |
| 150 | 3300005355 | Ga0070671_100164216 | Ga0070671_1001642162 | 142 |
| 151 | 3300005356 | Ga0070674_100688019 | Ga0070674_1006880191 | 142 |
| 152 | 3300005364 | Ga0070673_100082756 | Ga0070673_1000827562 | 142 |
| 153 | 3300005366 | Ga0070659_100311764 | Ga0070659_1003117644 | 142 |
| 154 | 3300005367 | Ga0070667_100097205 | Ga0070667_1000972053 | 142 |
| 155 | 3300005406 | Ga0070703_10000109 | Ga0070703_100001092 | 142 |
| 156 | 3300005438 | Ga0070701_10332859 | Ga0070701_103328592 | 142 |
| 157 | 3300005439 | Ga0070711_101505641 | Ga0070711_1015056411 | 142 |
| 158 | 3300005440 | Ga0070705_100521061 | Ga0070705_1005210612 | 142 |
| 159 | 3300005441 | Ga0070700_100030838 | Ga0070700_1000308384 | 142 |
| 160 | 3300005444 | Ga0070694_100534020 | Ga0070694_1005340201 | 142 |
| 161 | 3300005445 | Ga0070708_100048652 | Ga0070708_1000486524 | 142 |
| 162 | 3300005457 | Ga0070662_101232072 | Ga0070662_1012320722 | 142 |
| 163 | 3300005459 | Ga0068867_100051885 | Ga0068867_1000518853 | 142 |
| 164 | 3300005459 | Ga0068867_100061946 | Ga0068867_1000619463 | 142 |
| 165 | 3300005466 | Ga0070685_10370529 | Ga0070685_103705292 | 142 |
| 166 | 3300005467 | Ga0070706_100084939 | Ga0070706_1000849392 | 142 |
| 167 | 3300005468 | Ga0070707_100950918 | Ga0070707_1009509181 | 142 |
| 168 | 3300005471 | Ga0070698_100066293 | Ga0070698_1000662933 | 142 |
| 169 | 3300005471 | Ga0070698_100422670 | Ga0070698_1004226701 | 142 |
| 170 | 3300005518 | Ga0070699_100097247 | Ga0070699_1000972474 | 142 |
| 171 | 3300005518 | Ga0070699_100105456 | Ga0070699_1001054562 | 142 |
| 172 | 3300005535 | Ga0070684_101657087 | Ga0070684_1016570871 | 142 |
| 173 | 3300005536 | Ga0070697_100235312 | Ga0070697_1002353122 | 142 |
| 174 | 3300005536 | Ga0070697_100255869 | Ga0070697_1002558694 | 142 |
| 175 | 3300005539 | Ga0068853_100398291 | Ga0068853_1003982911 | 142 |
| 176 | 3300005544 | Ga0070686_100701560 | Ga0070686_1007015601 | 142 |
| 177 | 3300005546 | Ga0070696_100128334 | Ga0070696_1001283341 | 142 |
| 178 | 3300005547 | Ga0070693_100714658 | Ga0070693_1007146582 | 142 |
| 179 | 3300005548 | Ga0070665_100684853 | Ga0070665_1006848532 | 142 |
| 180 | 3300005564 | Ga0070664_100043844 | Ga0070664_1000438443 | 142 |
| 181 | 3300005577 | Ga0068857_101131452 | Ga0068857_1011314522 | 142 |
| 182 | 3300005578 | Ga0068854_100334341 | Ga0068854_1003343412 | 142 |
| 183 | 3300005578 | Ga0068854_100462277 | Ga0068854_1004622772 | 142 |
| 184 | 3300005578 | Ga0068854_100535946 | Ga0068854_1005359462 | 142 |
| 185 | 3300005614 | Ga0068856_100376830 | Ga0068856_1003768302 | 142 |
| 186 | 3300005616 | Ga0068852_100366708 | Ga0068852_1003667082 | 142 |
| 187 | 3300005616 | Ga0068852_101008758 | Ga0068852_1010087582 | 142 |
| 188 | 3300005617 | Ga0068859_100056239 | Ga0068859_1000562393 | 142 |
| 189 | 3300005617 | Ga0068859_100169870 | Ga0068859_1001698704 | 142 |
| 190 | 3300005617 | Ga0068859_102133441 | Ga0068859_1021334411 | 142 |
| 191 | 3300005618 | Ga0068864_100018567 | Ga0068864_1000185672 | 142 |
| 192 | 3300005618 | Ga0068864_100042855 | Ga0068864_1000428552 | 142 |
| 193 | 3300005618 | Ga0068864_100683362 | Ga0068864_1006833622 | 142 |
| 194 | 3300005618 | Ga0068864_101026832 | Ga0068864_1010268322 | 142 |
| 195 | 3300005718 | Ga0068866_10357681 | Ga0068866_103576812 | 142 |
| 196 | 3300005719 | Ga0068861_100017766 | Ga0068861_1000177664 | 142 |
| 197 | 3300005719 | Ga0068861_100070833 | Ga0068861_1000708332 | 142 |
| 198 | 3300005834 | Ga0068851_10109206 | Ga0068851_101092062 | 142 |
| 199 | 3300005840 | Ga0068870_10193769 | Ga0068870_101937692 | 142 |
| 200 | 3300005840 | Ga0068870_10878616 | Ga0068870_108786162 | 142 |
| 201 | 3300005841 | Ga0068863_100257659 | Ga0068863_1002576594 | 142 |
| 202 | 3300005841 | Ga0068863_101881912 | Ga0068863_1018819122 | 142 |
| 203 | 3300005842 | Ga0068858_100021480 | Ga0068858_1000214804 | 142 |
| 204 | 3300005842 | Ga0068858_100036806 | Ga0068858_1000368066 | 142 |
| 205 | 3300005842 | Ga0068858_100066563 | Ga0068858_1000665632 | 142 |
| 206 | 3300005843 | Ga0068860_100219183 | Ga0068860_1002191832 | 142 |
| 207 | 3300005843 | Ga0068860_100505424 | Ga0068860_1005054242 | 142 |
| 208 | 3300005844 | Ga0068862_100227281 | Ga0068862_1002272812 | 142 |
| 209 | 3300006358 | Ga0068871_100634676 | Ga0068871_1006346762 | 142 |
| 210 | 3300006846 | Ga0075430_100018478 | Ga0075430_1000184785 | 142 |
| 211 | 3300006846 | Ga0075430_100111101 | Ga0075430_1001111012 | 142 |
| 212 | 3300006847 | Ga0075431_100045805 | Ga0075431_1000458052 | 142 |
| 213 | 3300006847 | Ga0075431_100068580 | Ga0075431_1000685804 | 142 |
| 214 | 3300006852 | Ga0075433_10060594 | Ga0075433_100605943 | 142 |
| 215 | 3300006852 | Ga0075433_10332519 | Ga0075433_103325192 | 142 |
| 216 | 3300006880 | Ga0075429_100100874 | Ga0075429_1001008745 | 142 |
| 217 | 3300006880 | Ga0075429_100130506 | Ga0075429_1001305062 | 142 |
| 218 | 3300006881 | Ga0068865_100082062 | Ga0068865_1000820622 | 142 |
| 219 | 3300006881 | Ga0068865_100118239 | Ga0068865_1001182392 | 142 |
| 220 | 3300006931 | Ga0097620_100056237 | Ga0097620_1000562375 | 142 |
| 221 | 3300006931 | Ga0097620_100169876 | Ga0097620_1001698764 | 142 |
| 222 | 3300006931 | Ga0097620_102133447 | Ga0097620_1021334471 | 142 |
| 223 | 3300009011 | Ga0105251_10391407 | Ga0105251_103914072 | 142 |
| 224 | 3300009093 | Ga0105240_11391221 | Ga0105240_113912211 | 142 |
| 225 | 3300009093 | Ga0105240_11632713 | Ga0105240_116327131 | 142 |
| 226 | 3300009093 | Ga0105240_11717811 | Ga0105240_117178112 | 142 |
| 227 | 3300009094 | Ga0111539_10148303 | Ga0111539_101483033 | 142 |
| 228 | 3300009094 | Ga0111539_12940322 | Ga0111539_129403221 | 142 |
| 229 | 3300009098 | Ga0105245_10297963 | Ga0105245_102979632 | 142 |
| 230 | 3300009098 | Ga0105245_10410285 | Ga0105245_104102852 | 142 |
| 231 | 3300009101 | Ga0105247_10597367 | Ga0105247_105973672 | 142 |
| 232 | 3300009148 | Ga0105243_10211308 | Ga0105243_102113083 | 142 |
| 233 | 3300009148 | Ga0105243_10637430 | Ga0105243_106374303 | 142 |
| 234 | 3300009148 | Ga0105243_13080245 | Ga0105243_130802451 | 142 |
| 235 | 3300009174 | Ga0105241_10299323 | Ga0105241_102993232 | 142 |
| 236 | 3300009176 | Ga0105242_10014921 | Ga0105242_100149216 | 142 |
| 237 | 3300009176 | Ga0105242_10076851 | Ga0105242_100768514 | 142 |
| 238 | 3300009177 | Ga0105248_10072720 | Ga0105248_100727204 | 142 |
| 239 | 3300009177 | Ga0105248_10425755 | Ga0105248_104257554 | 142 |
| 240 | 3300009177 | Ga0105248_11961257 | Ga0105248_119612572 | 142 |
| 241 | 3300009545 | Ga0105237_10401498 | Ga0105237_104014982 | 142 |
| 242 | 3300009545 | Ga0105237_10697554 | Ga0105237_106975541 | 142 |
| 243 | 3300009551 | Ga0105238_10132532 | Ga0105238_101325322 | 142 |
| 244 | 3300009553 | Ga0105249_10097509 | Ga0105249_100975092 | 142 |
| 245 | 3300010375 | Ga0105239_10206170 | Ga0105239_102061702 | 142 |
| 246 | 3300010375 | Ga0105239_10312333 | Ga0105239_103123333 | 142 |
| 247 | 3300010375 | Ga0105239_11123581 | Ga0105239_111235812 | 142 |
| 248 | 3300011119 | Ga0105246_10290976 | Ga0105246_102909763 | 142 |
| 249 | 3300013296 | Ga0157374_10084783 | Ga0157374_100847832 | 142 |
| 250 | 3300013296 | Ga0157374_10213309 | Ga0157374_102133092 | 142 |
| 251 | 3300013296 | Ga0157374_11480399 | Ga0157374_114803992 | 142 |
| 252 | 3300013297 | Ga0157378_10641930 | Ga0157378_106419302 | 142 |
| 253 | 3300013306 | Ga0163162_10011088 | Ga0163162_100110887 | 142 |
| 254 | 3300013306 | Ga0163162_10124312 | Ga0163162_101243122 | 142 |
| 255 | 3300013307 | Ga0157372_10318342 | Ga0157372_103183422 | 142 |
| 256 | 3300013308 | Ga0157375_10011917 | Ga0157375_1001191710 | 142 |
| 257 | 3300013308 | Ga0157375_10108149 | Ga0157375_101081492 | 142 |
| 258 | 3300013308 | Ga0157375_13111444 | Ga0157375_131114441 | 142 |
| 259 | 3300014325 | Ga0163163_10001662 | Ga0163163_1000166210 | 142 |
| 260 | 3300014325 | Ga0163163_10061011 | Ga0163163_100610116 | 142 |
| 261 | 3300014325 | Ga0163163_10541986 | Ga0163163_105419862 | 142 |
| 262 | 3300014326 | Ga0157380_10148731 | Ga0157380_101487312 | 142 |
| 263 | 3300014326 | Ga0157380_10217464 | Ga0157380_102174642 | 142 |
| 264 | 3300014745 | Ga0157377_10096254 | Ga0157377_100962542 | 142 |
| 265 | 3300014968 | Ga0157379_10165294 | Ga0157379_101652942 | 142 |
| 266 | 3300014968 | Ga0157379_11935660 | Ga0157379_119356601 | 142 |
| 267 | 3300014969 | Ga0157376_10084893 | Ga0157376_100848933 | 142 |
| 268 | 3300014969 | Ga0157376_10191032 | Ga0157376_101910323 | 142 |
| 269 | 3300014969 | Ga0157376_10967595 | Ga0157376_109675952 | 142 |
| 270 | 3300017792 | Ga0163161_10487202 | Ga0163161_104872021 | 142 |
| 271 | 3300017792 | Ga0163161_11150767 | Ga0163161_111507672 | 142 |
| 272 | 3300025304 | Ga0209257_1083322 | Ga0209257_10833222 | 142 |
| 273 | 3300025321 | Ga0207656_10234663 | Ga0207656_102346632 | 142 |
| 274 | 3300025711 | Ga0207696_1095900 | Ga0207696_10959001 | 142 |
| 275 | 3300025885 | Ga0207653_10000144 | Ga0207653_1000014430 | 142 |
| 276 | 3300025901 | Ga0207688_10228492 | Ga0207688_102284922 | 142 |
| 277 | 3300025903 | Ga0207680_10008927 | Ga0207680_100089273 | 142 |
| 278 | 3300025904 | Ga0207647_10058800 | Ga0207647_100588003 | 142 |
| 279 | 3300025907 | Ga0207645_10640720 | Ga0207645_106407202 | 142 |
| 280 | 3300025910 | Ga0207684_10177228 | Ga0207684_101772283 | 142 |
| 281 | 3300025911 | Ga0207654_10213117 | Ga0207654_102131172 | 142 |
| 282 | 3300025911 | Ga0207654_10389690 | Ga0207654_103896902 | 142 |
| 283 | 3300025913 | Ga0207695_10984169 | Ga0207695_109841692 | 142 |
| 284 | 3300025913 | Ga0207695_11056227 | Ga0207695_110562272 | 142 |
| 285 | 3300025914 | Ga0207671_10370037 | Ga0207671_103700372 | 142 |
| 286 | 3300025922 | Ga0207646_10581975 | Ga0207646_105819751 | 142 |
| 287 | 3300025923 | Ga0207681_10131564 | Ga0207681_101315642 | 142 |
| 288 | 3300025923 | Ga0207681_10207671 | Ga0207681_102076714 | 142 |
| 289 | 3300025923 | Ga0207681_11465193 | Ga0207681_114651931 | 142 |
| 290 | 3300025924 | Ga0207694_10085544 | Ga0207694_100855442 | 142 |
| 291 | 3300025926 | Ga0207659_10850922 | Ga0207659_108509221 | 142 |
| 292 | 3300025927 | Ga0207687_10325980 | Ga0207687_103259802 | 142 |
| 293 | 3300025931 | Ga0207644_10323950 | Ga0207644_103239501 | 142 |
| 294 | 3300025933 | Ga0207706_10856895 | Ga0207706_108568951 | 142 |
| 295 | 3300025934 | Ga0207686_10085321 | Ga0207686_100853212 | 142 |
| 296 | 3300025934 | Ga0207686_10091839 | Ga0207686_100918391 | 142 |
| 297 | 3300025935 | Ga0207709_10104665 | Ga0207709_101046654 | 142 |
| 298 | 3300025938 | Ga0207704_10079714 | Ga0207704_100797142 | 142 |
| 299 | 3300025941 | Ga0207711_10006657 | Ga0207711_100066574 | 142 |
| 300 | 3300025941 | Ga0207711_11390131 | Ga0207711_113901312 | 142 |
| 301 | 3300025945 | Ga0207679_10061630 | Ga0207679_100616304 | 142 |
| 302 | 3300025949 | Ga0207667_10278298 | Ga0207667_102782982 | 142 |
| 303 | 3300025960 | Ga0207651_10009816 | Ga0207651_100098166 | 142 |
| 304 | 3300025960 | Ga0207651_10035627 | Ga0207651_100356273 | 142 |
| 305 | 3300025960 | Ga0207651_10366832 | Ga0207651_103668322 | 142 |
| 306 | 3300025961 | Ga0207712_10008554 | Ga0207712_100085543 | 142 |
| 307 | 3300025981 | Ga0207640_10532947 | Ga0207640_105329472 | 142 |
| 308 | 3300025986 | Ga0207658_10095418 | Ga0207658_100954182 | 142 |
| 309 | 3300026023 | Ga0207677_10059741 | Ga0207677_100597412 | 142 |
| 310 | 3300026035 | Ga0207703_10043975 | Ga0207703_100439756 | 142 |
| 311 | 3300026035 | Ga0207703_10111175 | Ga0207703_101111752 | 142 |
| 312 | 3300026035 | Ga0207703_10864146 | Ga0207703_108641462 | 142 |
| 313 | 3300026075 | Ga0207708_10003525 | Ga0207708_100035256 | 142 |
| 314 | 3300026075 | Ga0207708_10058377 | Ga0207708_100583774 | 142 |
| 315 | 3300026088 | Ga0207641_10846834 | Ga0207641_108468342 | 142 |
| 316 | 3300026088 | Ga0207641_11707946 | Ga0207641_117079461 | 142 |
| 317 | 3300026089 | Ga0207648_10051149 | Ga0207648_100511495 | 142 |
| 318 | 3300026089 | Ga0207648_10833317 | Ga0207648_108333172 | 142 |
| 319 | 3300026095 | Ga0207676_10053202 | Ga0207676_100532022 | 142 |
| 320 | 3300026095 | Ga0207676_10074156 | Ga0207676_100741562 | 142 |
| 321 | 3300026095 | Ga0207676_10194974 | Ga0207676_101949744 | 142 |
| 322 | 3300026116 | Ga0207674_10712270 | Ga0207674_107122702 | 142 |
| 323 | 3300026118 | Ga0207675_100024155 | Ga0207675_1000241555 | 142 |
| 324 | 3300026118 | Ga0207675_100090805 | Ga0207675_1000908054 | 142 |
| 325 | 3300026142 | Ga0207698_10031691 | Ga0207698_100316913 | 142 |
| 326 | 3300026142 | Ga0207698_10316047 | Ga0207698_103160473 | 142 |
| 327 | 3300026142 | Ga0207698_10342532 | Ga0207698_103425322 | 142 |
| 328 | 3300028379 | Ga0268266_10031992 | Ga0268266_100319923 | 142 |
| 329 | 3300028380 | Ga0268265_10338949 | Ga0268265_103389492 | 142 |
| 330 | 3300028381 | Ga0268264_10019695 | Ga0268264_100196952 | 142 |
| 331 | 3300028381 | Ga0268264_10127293 | Ga0268264_101272932 | 142 |
| 332 | 3300030733 | Ga0314311_1202169 | Ga0314311_12021693 | 142 |
| 333 | 3300030735 | Ga0316178_1063384 | Ga0316178_10633842 | 142 |
| 334 | 3300035724 | Ga0373933_0691823 | Ga0373933_0691823_151_579 | 142 |
| 335 | 3300038699 | Ga0242422_00030 | Ga0242422_00030_2949_3380 | 142 |
| 336 | 3300038996 | Ga0242420_001615 | Ga0242420_001615_865_1296 | 142 |
| 337 | 3300042015 | Ga0439462_0016909 | Ga0439462_0016909_396_827 | 142 |
| 338 | 3300045051 | Ga0451576_0142094 | Ga0451576_0142094_1813_2244 | 142 |
| 339 | 3300045051 | Ga0451576_0331855 | Ga0451576_0331855_402_830 | 142 |
| 340 | 3300046683 | Ga0495658_0051899 | Ga0495658_0051899_242_670 | 142 |
| 341 | 3300048908 | Ga0496105_0187045 | Ga0496105_0187045_461_889 | 142 |
| 342 | 3300048909 | Ga0496106_0029673 | Ga0496106_0029673_3407_3838 | 142 |
| 343 | 3300048910 | Ga0496107_0919245 | Ga0496107_0919245_46_477 | 142 |
| 344 | 3300048911 | Ga0496108_0034344 | Ga0496108_0034344_3294_3725 | 142 |
| 345 | 3300048911 | Ga0496108_0752787 | Ga0496108_0752787_165_593 | 142 |
| 346 | 3300048913 | Ga0496110_0000753 | Ga0496110_0000753_19010_19444 | 142 |
| 347 | 3300048915 | Ga0496112_0044731 | Ga0496112_0044731_2034_2462 | 142 |
| 348 | 3300048915 | Ga0496112_0488317 | Ga0496112_0488317_682_1113 | 142 |
| 349 | 3300048919 | Ga0496116_0019997 | Ga0496116_0019997_1363_1797 | 142 |
| 350 | 3300048924 | Ga0496121_0428193 | Ga0496121_0428193_90_524 | 142 |
| 351 | 3300048927 | Ga0496124_0026185 | Ga0496124_0026185_292_726 | 142 |
| 352 | 3300049582 | Ga0501048_0906655 | Ga0501048_0906655_72_500 | 142 |
| 353 | 3300049824 | Ga0501045_0177739 | Ga0501045_0177739_824_1252 | 142 |
| 354 | 3300050508 | nmdc:mga09592_125810_c1 | nmdc:mga09592_125810_c1_269_700 | 142 |
| 355 | 3300050508 | nmdc:mga09592_149922_c1 | nmdc:mga09592_149922_c1_1057_1485 | 142 |
| 356 | 3300050509 | nmdc:mga0qj67_14754_c1 | nmdc:mga0qj67_14754_c1_4083_4514 | 142 |
| 357 | 3300050509 | nmdc:mga0qj67_65342_c1 | nmdc:mga0qj67_65342_c1_567_995 | 142 |
| 358 | 3300050510 | nmdc:mga06r32_114677_c1 | nmdc:mga06r32_114677_c1_1372_1803 | 142 |
| 359 | 3300050510 | nmdc:mga06r32_52810_c1 | nmdc:mga06r32_52810_c1_1643_2071 | 142 |
| 360 | 3300050511 | nmdc:mga08y16_124873_c1 | nmdc:mga08y16_124873_c1_1115_1543 | 142 |
| 361 | 3300050511 | nmdc:mga08y16_1629977_c1 | nmdc:mga08y16_1629977_c1_151_579 | 142 |
| 362 | 3300050512 | nmdc:mga0n895_805168_c1 | nmdc:mga0n895_805168_c1_318_746 | 142 |
| 363 | 3300050515 | nmdc:mga0a205_19971_c1 | nmdc:mga0a205_19971_c1_2545_2973 | 142 |
| 364 | 3300059477 | Ga0587084_059589 | Ga0587084_059589_151_582 | 142 |
| 365 | iso_pu_bacteria | 2548877040 | 2550906685 | 142 |
| 366 | iso_pu_bacteria | 2728368933 | 2728530758 | 142 |
| 367 | iso_pu_bacteria | 2938649242 | 2938652384 | 142 |
| 368 | iso_pu_bacteria | 2968558590 | 2968562765 | 142 |
| 369 | iso_pu_bacteria | 2988225383 | 2988230663 | 142 |
| 370 | iso_pu_bacteria | 2996632988 | 2996638378 | 142 |
| 371 | iso_pu_bacteria | 8054465665 | 8054469325 | 142 |
| 372 | 3300005718 | Ga0068866_10308977 | Ga0068866_103089772 | 143 |
| 373 | 3300005719 | Ga0068861_100522956 | Ga0068861_1005229562 | 143 |
| 374 | 3300025899 | Ga0207642_10193921 | Ga0207642_101939211 | 143 |
| 375 | 3300026118 | Ga0207675_101475941 | Ga0207675_1014759412 | 143 |
| 376 | iso_pu_bacteria | 2932784394 | 2932792742 | 143 |
| 377 | 3300003322 | rootL2_10251231 | rootL2_102512312 | 144 |
| 378 | 3300003354 | JGI25160J50197_1033488 | JGI25160J50197_10334882 | 144 |
| 379 | 3300005288 | Ga0065714_10281034 | Ga0065714_102810341 | 144 |
| 380 | 3300005329 | Ga0070683_100311295 | Ga0070683_1003112952 | 144 |
| 381 | 3300005330 | Ga0070690_100467140 | Ga0070690_1004671401 | 144 |
| 382 | 3300005335 | Ga0070666_10614075 | Ga0070666_106140752 | 144 |
| 383 | 3300005337 | Ga0070682_101669420 | Ga0070682_1016694201 | 144 |
| 384 | 3300005345 | Ga0070692_10652528 | Ga0070692_106525281 | 144 |
| 385 | 3300005364 | Ga0070673_100700372 | Ga0070673_1007003721 | 144 |
| 386 | 3300005367 | Ga0070667_100968357 | Ga0070667_1009683572 | 144 |
| 387 | 3300005436 | Ga0070713_100341741 | Ga0070713_1003417411 | 144 |
| 388 | 3300005437 | Ga0070710_10712412 | Ga0070710_107124122 | 144 |
| 389 | 3300005439 | Ga0070711_101035559 | Ga0070711_1010355591 | 144 |
| 390 | 3300005468 | Ga0070707_100440069 | Ga0070707_1004400693 | 144 |
| 391 | 3300005468 | Ga0070707_100567079 | Ga0070707_1005670791 | 144 |
| 392 | 3300005471 | Ga0070698_100085037 | Ga0070698_1000850374 | 144 |
| 393 | 3300005535 | Ga0070684_100083859 | Ga0070684_1000838594 | 144 |
| 394 | 3300005536 | Ga0070697_100276592 | Ga0070697_1002765923 | 144 |
| 395 | 3300005539 | Ga0068853_100663120 | Ga0068853_1006631202 | 144 |
| 396 | 3300005544 | Ga0070686_100000059 | Ga0070686_10000005977 | 144 |
| 397 | 3300005547 | Ga0070693_100074042 | Ga0070693_1000740425 | 144 |
| 398 | 3300005548 | Ga0070665_100000024 | Ga0070665_10000002423 | 144 |
| 399 | 3300005563 | Ga0068855_101090799 | Ga0068855_1010907992 | 144 |
| 400 | 3300005564 | Ga0070664_101292748 | Ga0070664_1012927481 | 144 |
| 401 | 3300005578 | Ga0068854_100699319 | Ga0068854_1006993192 | 144 |
| 402 | 3300005614 | Ga0068856_100269060 | Ga0068856_1002690604 | 144 |
| 403 | 3300005617 | Ga0068859_100665352 | Ga0068859_1006653521 | 144 |
| 404 | 3300005618 | Ga0068864_100510955 | Ga0068864_1005109552 | 144 |
| 405 | 3300005842 | Ga0068858_100000647 | Ga0068858_10000064730 | 144 |
| 406 | 3300005842 | Ga0068858_101368653 | Ga0068858_1013686532 | 144 |
| 407 | 3300006353 | Ga0075370_10066885 | Ga0075370_100668853 | 144 |
| 408 | 3300006358 | Ga0068871_100889487 | Ga0068871_1008894871 | 144 |
| 409 | 3300006847 | Ga0075431_100657677 | Ga0075431_1006576772 | 144 |
| 410 | 3300006871 | Ga0075434_100142855 | Ga0075434_1001428555 | 144 |
| 411 | 3300006880 | Ga0075429_100768025 | Ga0075429_1007680251 | 144 |
| 412 | 3300006881 | Ga0068865_100701255 | Ga0068865_1007012552 | 144 |
| 413 | 3300006931 | Ga0097620_100665286 | Ga0097620_1006652861 | 144 |
| 414 | 3300009093 | Ga0105240_10668509 | Ga0105240_106685092 | 144 |
| 415 | 3300009093 | Ga0105240_11158157 | Ga0105240_111581572 | 144 |
| 416 | 3300009098 | Ga0105245_10562251 | Ga0105245_105622512 | 144 |
| 417 | 3300009101 | Ga0105247_10003156 | Ga0105247_100031564 | 144 |
| 418 | 3300009147 | Ga0114129_10424672 | Ga0114129_104246722 | 144 |
| 419 | 3300009148 | Ga0105243_10299252 | Ga0105243_102992522 | 144 |
| 420 | 3300009174 | Ga0105241_10871166 | Ga0105241_108711662 | 144 |
| 421 | 3300009176 | Ga0105242_10399300 | Ga0105242_103993002 | 144 |
| 422 | 3300009177 | Ga0105248_10171623 | Ga0105248_101716233 | 144 |
| 423 | 3300009551 | Ga0105238_10056355 | Ga0105238_100563554 | 144 |
| 424 | 3300010375 | Ga0105239_12081696 | Ga0105239_120816962 | 144 |
| 425 | 3300013100 | Ga0157373_10259966 | Ga0157373_102599662 | 144 |
| 426 | 3300013307 | Ga0157372_10457238 | Ga0157372_104572382 | 144 |
| 427 | 3300014325 | Ga0163163_11602154 | Ga0163163_116021541 | 144 |
| 428 | 3300014497 | Ga0182008_10010984 | Ga0182008_100109849 | 144 |
| 429 | 3300014745 | Ga0157377_10660350 | Ga0157377_106603502 | 144 |
| 430 | 3300015262 | Ga0182007_10001949 | Ga0182007_100019493 | 144 |
| 431 | 3300021384 | Ga0213876_10002509 | Ga0213876_1000250910 | 144 |
| 432 | 3300025297 | Ga0209758_1047713 | Ga0209758_10477133 | 144 |
| 433 | 3300025302 | Ga0207426_1003661 | Ga0207426_10036612 | 144 |
| 434 | 3300025900 | Ga0207710_10011723 | Ga0207710_100117231 | 144 |
| 435 | 3300025907 | Ga0207645_10856567 | Ga0207645_108565672 | 144 |
| 436 | 3300025911 | Ga0207654_10371269 | Ga0207654_103712692 | 144 |
| 437 | 3300025912 | Ga0207707_10131605 | Ga0207707_101316052 | 144 |
| 438 | 3300025920 | Ga0207649_10391053 | Ga0207649_103910532 | 144 |
| 439 | 3300025922 | Ga0207646_10542032 | Ga0207646_105420322 | 144 |
| 440 | 3300025924 | Ga0207694_10485918 | Ga0207694_104859182 | 144 |
| 441 | 3300025935 | Ga0207709_10163948 | Ga0207709_101639482 | 144 |
| 442 | 3300025938 | Ga0207704_10290733 | Ga0207704_102907332 | 144 |
| 443 | 3300025940 | Ga0207691_10379426 | Ga0207691_103794262 | 144 |
| 444 | 3300025942 | Ga0207689_10176976 | Ga0207689_101769762 | 144 |
| 445 | 3300025944 | Ga0207661_10418764 | Ga0207661_104187642 | 144 |
| 446 | 3300025945 | Ga0207679_10194880 | Ga0207679_101948802 | 144 |
| 447 | 3300025960 | Ga0207651_10583219 | Ga0207651_105832192 | 144 |
| 448 | 3300026035 | Ga0207703_10003386 | Ga0207703_1000338611 | 144 |
| 449 | 3300026078 | Ga0207702_10432504 | Ga0207702_104325042 | 144 |
| 450 | 3300026118 | Ga0207675_102051966 | Ga0207675_1020519661 | 144 |
| 451 | 3300026142 | Ga0207698_10049237 | Ga0207698_100492375 | 144 |
| 452 | 3300028379 | Ga0268266_10000019 | Ga0268266_10000019339 | 144 |
| 453 | 3300028786 | Ga0307517_10004922 | Ga0307517_1000492213 | 144 |
| 454 | 3300028786 | Ga0307517_10064807 | Ga0307517_100648073 | 144 |
| 455 | 3300028794 | Ga0307515_10025310 | Ga0307515_100253102 | 144 |
| 456 | 3300028794 | Ga0307515_10160591 | Ga0307515_101605913 | 144 |
| 457 | 3300031456 | Ga0307513_10197669 | Ga0307513_101976693 | 144 |
| 458 | 3300031456 | Ga0307513_10329799 | Ga0307513_103297992 | 144 |
| 459 | 3300031507 | Ga0307509_10099786 | Ga0307509_100997862 | 144 |
| 460 | 3300031616 | Ga0307508_10001461 | Ga0307508_1000146124 | 144 |
| 461 | 3300031901 | Ga0307406_11698466 | Ga0307406_116984661 | 144 |
| 462 | 3300033528 | Ga0316588_1005801 | Ga0316588_10058012 | 144 |
| 463 | 3300039437 | Ga0436365_1337852 | Ga0436365_1337852_2193_2627 | 144 |
| 464 | 3300039450 | Ga0436363_0136866 | Ga0436363_0136866_74_508 | 144 |
| 465 | 3300046457 | Ga0495590_0164459 | Ga0495590_0164459_43_486 | 144 |
| 466 | 3300046472 | Ga0495580_0053592 | Ga0495580_0053592_608_1048 | 144 |
| 467 | 3300046506 | Ga0495583_0000620 | Ga0495583_0000620_38349_38789 | 144 |
| 468 | 3300046520 | Ga0495637_0230618 | Ga0495637_0230618_148_591 | 144 |
| 469 | 3300046524 | Ga0495648_0000774 | Ga0495648_0000774_8938_9378 | 144 |
| 470 | 3300046660 | Ga0495625_0132540 | Ga0495625_0132540_861_1295 | 144 |
| 471 | 3300046660 | Ga0495625_0164908 | Ga0495625_0164908_401_835 | 144 |
| 472 | 3300046694 | Ga0495649_0001576 | Ga0495649_0001576_8777_9217 | 144 |
| 473 | 3300046810 | Ga0495660_0017469 | Ga0495660_0017469_1066_1509 | 144 |
| 474 | 3300047323 | Ga0495683_0016588 | Ga0495683_0016588_1878_2318 | 144 |
| 475 | 3300047469 | Ga0495673_0003872 | Ga0495673_0003872_6435_6875 | 144 |
| 476 | 3300048904 | Ga0496101_0667122 | Ga0496101_0667122_96_533 | 144 |
| 477 | 3300048925 | Ga0496122_0028361 | Ga0496122_0028361_1579_2022 | 144 |
| 478 | 3300048928 | Ga0496125_0000220 | Ga0496125_0000220_28470_28907 | 144 |
| 479 | 3300048929 | Ga0496126_0079815 | Ga0496126_0079815_1828_2265 | 144 |
| 480 | 3300048929 | Ga0496126_1345879 | Ga0496126_1345879_27_470 | 144 |
| 481 | 3300049460 | Ga0495682_0008455 | Ga0495682_0008455_2244_2684 | 144 |
| 482 | 3300049568 | Ga0501031_0003222 | Ga0501031_0003222_5446_5880 | 144 |
| 483 | 3300049569 | Ga0501032_0183046 | Ga0501032_0183046_493_927 | 144 |
| 484 | 3300049570 | Ga0501033_0034215 | Ga0501033_0034215_394_828 | 144 |
| 485 | 3300049572 | Ga0501036_0013733 | Ga0501036_0013733_3638_4072 | 144 |
| 486 | 3300049573 | Ga0501037_0045053 | Ga0501037_0045053_2305_2739 | 144 |
| 487 | 3300049574 | Ga0501038_0002779 | Ga0501038_0002779_532_966 | 144 |
| 488 | 3300049575 | Ga0501039_0004728 | Ga0501039_0004728_8537_8971 | 144 |
| 489 | 3300049576 | Ga0501040_0003596 | Ga0501040_0003596_2667_3101 | 144 |
| 490 | 3300049577 | Ga0501041_0001971 | Ga0501041_0001971_564_998 | 144 |
| 491 | 3300049578 | Ga0501042_0005861 | Ga0501042_0005861_675_1109 | 144 |
| 492 | 3300049578 | Ga0501042_1112942 | Ga0501042_1112942_59_493 | 144 |
| 493 | 3300049579 | Ga0501043_0024564 | Ga0501043_0024564_535_969 | 144 |
| 494 | 3300049580 | Ga0501046_0007376 | Ga0501046_0007376_321_755 | 144 |
| 495 | 3300049580 | Ga0501046_1252100 | Ga0501046_1252100_45_479 | 144 |
| 496 | 3300049582 | Ga0501048_0001573 | Ga0501048_0001573_13000_13434 | 144 |
| 497 | 3300049587 | Ga0501071_0000078 | Ga0501071_0000078_34013_34447 | 144 |
| 498 | 3300049588 | Ga0501072_0001519 | Ga0501072_0001519_5133_5567 | 144 |
| 499 | 3300049589 | Ga0501073_0163667 | Ga0501073_0163667_711_1145 | 144 |
| 500 | 3300049590 | Ga0501074_0006511 | Ga0501074_0006511_5356_5790 | 144 |
| 501 | 3300049591 | Ga0501075_0013392 | Ga0501075_0013392_5275_5709 | 144 |
| 502 | 3300049592 | Ga0501076_0007831 | Ga0501076_0007831_6805_7239 | 144 |
| 503 | 3300049593 | Ga0501077_0000219 | Ga0501077_0000219_3289_3723 | 144 |
| 504 | 3300049741 | Ga0501079_0000213 | Ga0501079_0000213_32863_33297 | 144 |
| 505 | 3300049742 | Ga0501080_0179110 | Ga0501080_0179110_490_924 | 144 |
| 506 | 3300049743 | Ga0501081_0081832 | Ga0501081_0081832_1257_1691 | 144 |
| 507 | 3300049744 | Ga0501083_0002560 | Ga0501083_0002560_3926_4360 | 144 |
| 508 | 3300049822 | Ga0501035_0013752 | Ga0501035_0013752_6767_7201 | 144 |
| 509 | 3300049823 | Ga0501044_0211462 | Ga0501044_0211462_1113_1547 | 144 |
| 510 | 3300049824 | Ga0501045_0000197 | Ga0501045_0000197_10715_11149 | 144 |
| 511 | 3300050496 | nmdc:mga07m45_365696_c1 | nmdc:mga07m45_365696_c1_201_635 | 144 |
| 512 | 3300050507 | nmdc:mga05p37_246970_c1 | nmdc:mga05p37_246970_c1_436_870 | 144 |
| 513 | 3300050510 | nmdc:mga06r32_848192_c1 | nmdc:mga06r32_848192_c1_67_501 | 144 |
| 514 | 3300050512 | nmdc:mga0n895_789211_c1 | nmdc:mga0n895_789211_c1_313_747 | 144 |
| 515 | 3300054114 | Ga0501084_0000612 | Ga0501084_0000612_15659_16093 | 144 |
| 516 | 3300054114 | Ga0501084_1367790 | Ga0501084_1367790_57_491 | 144 |
| 517 | 3300060353 | Ga0501082_0001948 | Ga0501082_0001948_8468_8902 | 144 |
| 518 | 3300061734 | Ga0530510_0003941 | Ga0530510_0003941_554_988 | 144 |
| 519 | 3300049665 | Ga0501227_198553 | Ga0501227_198553_23_466 | 145 |
| 520 | 3300049741 | Ga0501079_0584631 | Ga0501079_0584631_314_751 | 145 |
| 521 | 3300005293 | Ga0065715_10864599 | Ga0065715_108645991 | 146 |
| 522 | 3300005518 | Ga0070699_100442480 | Ga0070699_1004424802 | 146 |
| 523 | 3300005536 | Ga0070697_100119900 | Ga0070697_1001199004 | 146 |
| 524 | 3300005546 | Ga0070696_100101723 | Ga0070696_1001017235 | 146 |
| 525 | 3300046660 | Ga0495625_0039775 | Ga0495625_0039775_1031_1474 | 146 |
| 526 | 3300003322 | rootL2_10251230 | rootL2_102512303 | 147 |
| 527 | 3300003577 | Ga0007416J51690_1014507 | Ga0007416J51690_10145076 | 147 |
| 528 | 3300005290 | Ga0065712_10087908 | Ga0065712_100879082 | 147 |
| 529 | 3300005330 | Ga0070690_100632833 | Ga0070690_1006328332 | 147 |
| 530 | 3300005331 | Ga0070670_100019552 | Ga0070670_1000195526 | 147 |
| 531 | 3300005331 | Ga0070670_100060675 | Ga0070670_1000606754 | 147 |
| 532 | 3300005331 | Ga0070670_101436273 | Ga0070670_1014362731 | 147 |
| 533 | 3300005334 | Ga0068869_100330816 | Ga0068869_1003308163 | 147 |
| 534 | 3300005335 | Ga0070666_10714375 | Ga0070666_107143752 | 147 |
| 535 | 3300005335 | Ga0070666_10833053 | Ga0070666_108330532 | 147 |
| 536 | 3300005338 | Ga0068868_100417539 | Ga0068868_1004175392 | 147 |
| 537 | 3300005340 | Ga0070689_100049952 | Ga0070689_1000499522 | 147 |
| 538 | 3300005340 | Ga0070689_100579805 | Ga0070689_1005798051 | 147 |
| 539 | 3300005344 | Ga0070661_100022563 | Ga0070661_1000225635 | 147 |
| 540 | 3300005344 | Ga0070661_101014259 | Ga0070661_1010142591 | 147 |
| 541 | 3300005347 | Ga0070668_100064495 | Ga0070668_1000644953 | 147 |
| 542 | 3300005347 | Ga0070668_100133764 | Ga0070668_1001337642 | 147 |
| 543 | 3300005347 | Ga0070668_100957650 | Ga0070668_1009576501 | 147 |
| 544 | 3300005355 | Ga0070671_100076924 | Ga0070671_1000769243 | 147 |
| 545 | 3300005355 | Ga0070671_100244360 | Ga0070671_1002443604 | 147 |
| 546 | 3300005364 | Ga0070673_101706394 | Ga0070673_1017063941 | 147 |
| 547 | 3300005367 | Ga0070667_100071012 | Ga0070667_1000710123 | 147 |
| 548 | 3300005441 | Ga0070700_100013206 | Ga0070700_1000132063 | 147 |
| 549 | 3300005444 | Ga0070694_100000051 | Ga0070694_10000005119 | 147 |
| 550 | 3300005444 | Ga0070694_100014694 | Ga0070694_1000146947 | 147 |
| 551 | 3300005456 | Ga0070678_100719089 | Ga0070678_1007190891 | 147 |
| 552 | 3300005456 | Ga0070678_100875195 | Ga0070678_1008751952 | 147 |
| 553 | 3300005456 | Ga0070678_101006416 | Ga0070678_1010064161 | 147 |
| 554 | 3300005457 | Ga0070662_100152761 | Ga0070662_1001527613 | 147 |
| 555 | 3300005458 | Ga0070681_10006958 | Ga0070681_1000695811 | 147 |
| 556 | 3300005458 | Ga0070681_10571501 | Ga0070681_105715012 | 147 |
| 557 | 3300005459 | Ga0068867_100063410 | Ga0068867_1000634104 | 147 |
| 558 | 3300005468 | Ga0070707_100026693 | Ga0070707_1000266934 | 147 |
| 559 | 3300005471 | Ga0070698_100020984 | Ga0070698_1000209846 | 147 |
| 560 | 3300005471 | Ga0070698_100143983 | Ga0070698_1001439832 | 147 |
| 561 | 3300005518 | Ga0070699_100003516 | Ga0070699_1000035164 | 147 |
| 562 | 3300005535 | Ga0070684_101674523 | Ga0070684_1016745232 | 147 |
| 563 | 3300005536 | Ga0070697_100138929 | Ga0070697_1001389292 | 147 |
| 564 | 3300005536 | Ga0070697_100456749 | Ga0070697_1004567491 | 147 |
| 565 | 3300005539 | Ga0068853_100160911 | Ga0068853_1001609112 | 147 |
| 566 | 3300005539 | Ga0068853_101111251 | Ga0068853_1011112511 | 147 |
| 567 | 3300005543 | Ga0070672_100011579 | Ga0070672_1000115795 | 147 |
| 568 | 3300005543 | Ga0070672_100076552 | Ga0070672_1000765526 | 147 |
| 569 | 3300005543 | Ga0070672_100644420 | Ga0070672_1006444202 | 147 |
| 570 | 3300005544 | Ga0070686_100154460 | Ga0070686_1001544604 | 147 |
| 571 | 3300005545 | Ga0070695_100000132 | Ga0070695_1000001329 | 147 |
| 572 | 3300005545 | Ga0070695_100100854 | Ga0070695_1001008542 | 147 |
| 573 | 3300005545 | Ga0070695_100345641 | Ga0070695_1003456412 | 147 |
| 574 | 3300005545 | Ga0070695_100723226 | Ga0070695_1007232261 | 147 |
| 575 | 3300005546 | Ga0070696_100814502 | Ga0070696_1008145022 | 147 |
| 576 | 3300005546 | Ga0070696_101654709 | Ga0070696_1016547091 | 147 |
| 577 | 3300005547 | Ga0070693_100000459 | Ga0070693_10000045915 | 147 |
| 578 | 3300005547 | Ga0070693_100043145 | Ga0070693_1000431454 | 147 |
| 579 | 3300005547 | Ga0070693_100634256 | Ga0070693_1006342561 | 147 |
| 580 | 3300005549 | Ga0070704_100325643 | Ga0070704_1003256431 | 147 |
| 581 | 3300005564 | Ga0070664_100000591 | Ga0070664_10000059116 | 147 |
| 582 | 3300005564 | Ga0070664_100024412 | Ga0070664_1000244124 | 147 |
| 583 | 3300005564 | Ga0070664_100267599 | Ga0070664_1002675994 | 147 |
| 584 | 3300005564 | Ga0070664_100526304 | Ga0070664_1005263042 | 147 |
| 585 | 3300005564 | Ga0070664_100734049 | Ga0070664_1007340492 | 147 |
| 586 | 3300005617 | Ga0068859_101349662 | Ga0068859_1013496622 | 147 |
| 587 | 3300005618 | Ga0068864_100011188 | Ga0068864_1000111882 | 147 |
| 588 | 3300005618 | Ga0068864_100037713 | Ga0068864_1000377134 | 147 |
| 589 | 3300005618 | Ga0068864_100062948 | Ga0068864_1000629483 | 147 |
| 590 | 3300005618 | Ga0068864_100147223 | Ga0068864_1001472234 | 147 |
| 591 | 3300005719 | Ga0068861_100004876 | Ga0068861_1000048764 | 147 |
| 592 | 3300005719 | Ga0068861_100009178 | Ga0068861_1000091785 | 147 |
| 593 | 3300005719 | Ga0068861_100582524 | Ga0068861_1005825242 | 147 |
| 594 | 3300005840 | Ga0068870_10379969 | Ga0068870_103799692 | 147 |
| 595 | 3300005841 | Ga0068863_100056704 | Ga0068863_1000567047 | 147 |
| 596 | 3300005841 | Ga0068863_100326465 | Ga0068863_1003264652 | 147 |
| 597 | 3300005841 | Ga0068863_100362118 | Ga0068863_1003621183 | 147 |
| 598 | 3300005841 | Ga0068863_100744549 | Ga0068863_1007445492 | 147 |
| 599 | 3300005841 | Ga0068863_101109021 | Ga0068863_1011090212 | 147 |
| 600 | 3300005842 | Ga0068858_100002332 | Ga0068858_1000023325 | 147 |
| 601 | 3300005842 | Ga0068858_100015004 | Ga0068858_1000150046 | 147 |
| 602 | 3300005842 | Ga0068858_100239525 | Ga0068858_1002395253 | 147 |
| 603 | 3300005842 | Ga0068858_100283307 | Ga0068858_1002833072 | 147 |
| 604 | 3300005842 | Ga0068858_101770097 | Ga0068858_1017700971 | 147 |
| 605 | 3300005843 | Ga0068860_100309218 | Ga0068860_1003092181 | 147 |
| 606 | 3300005843 | Ga0068860_101097493 | Ga0068860_1010974932 | 147 |
| 607 | 3300006048 | Ga0075363_100040425 | Ga0075363_1000404255 | 147 |
| 608 | 3300006237 | Ga0097621_100377811 | Ga0097621_1003778112 | 147 |
| 609 | 3300006237 | Ga0097621_100438755 | Ga0097621_1004387552 | 147 |
| 610 | 3300006237 | Ga0097621_100588800 | Ga0097621_1005888002 | 147 |
| 611 | 3300006358 | Ga0068871_100187407 | Ga0068871_1001874072 | 147 |
| 612 | 3300006358 | Ga0068871_101587963 | Ga0068871_1015879632 | 147 |
| 613 | 3300006844 | Ga0075428_100807302 | Ga0075428_1008073022 | 147 |
| 614 | 3300006847 | Ga0075431_100046677 | Ga0075431_1000466774 | 147 |
| 615 | 3300006852 | Ga0075433_10572262 | Ga0075433_105722621 | 147 |
| 616 | 3300006871 | Ga0075434_101632336 | Ga0075434_1016323361 | 147 |
| 617 | 3300006880 | Ga0075429_101535986 | Ga0075429_1015359861 | 147 |
| 618 | 3300006931 | Ga0097620_101349659 | Ga0097620_1013496592 | 147 |
| 619 | 3300009094 | Ga0111539_10028193 | Ga0111539_100281934 | 147 |
| 620 | 3300009101 | Ga0105247_10001576 | Ga0105247_1000157613 | 147 |
| 621 | 3300009174 | Ga0105241_10012734 | Ga0105241_100127346 | 147 |
| 622 | 3300009174 | Ga0105241_10070569 | Ga0105241_100705692 | 147 |
| 623 | 3300009176 | Ga0105242_10771581 | Ga0105242_107715812 | 147 |
| 624 | 3300009177 | Ga0105248_10002695 | Ga0105248_100026953 | 147 |
| 625 | 3300009177 | Ga0105248_10051180 | Ga0105248_100511805 | 147 |
| 626 | 3300009177 | Ga0105248_10197661 | Ga0105248_101976613 | 147 |
| 627 | 3300009551 | Ga0105238_10383913 | Ga0105238_103839131 | 147 |
| 628 | 3300009551 | Ga0105238_11063457 | Ga0105238_110634572 | 147 |
| 629 | 3300009553 | Ga0105249_10384130 | Ga0105249_103841302 | 147 |
| 630 | 3300010375 | Ga0105239_12295932 | Ga0105239_122959321 | 147 |
| 631 | 3300011119 | Ga0105246_10040583 | Ga0105246_100405833 | 147 |
| 632 | 3300013100 | Ga0157373_10575733 | Ga0157373_105757332 | 147 |
| 633 | 3300013296 | Ga0157374_10670394 | Ga0157374_106703942 | 147 |
| 634 | 3300013297 | Ga0157378_10000039 | Ga0157378_1000003981 | 147 |
| 635 | 3300013297 | Ga0157378_10000400 | Ga0157378_1000040034 | 147 |
| 636 | 3300013297 | Ga0157378_10521209 | Ga0157378_105212092 | 147 |
| 637 | 3300013297 | Ga0157378_11067393 | Ga0157378_110673932 | 147 |
| 638 | 3300013297 | Ga0157378_11228526 | Ga0157378_112285261 | 147 |
| 639 | 3300013306 | Ga0163162_10013174 | Ga0163162_100131745 | 147 |
| 640 | 3300013306 | Ga0163162_10130263 | Ga0163162_101302633 | 147 |
| 641 | 3300013307 | Ga0157372_10954050 | Ga0157372_109540502 | 147 |
| 642 | 3300013307 | Ga0157372_11626707 | Ga0157372_116267072 | 147 |
| 643 | 3300013308 | Ga0157375_10000009 | Ga0157375_10000009216 | 147 |
| 644 | 3300013308 | Ga0157375_10021084 | Ga0157375_100210843 | 147 |
| 645 | 3300013308 | Ga0157375_10620782 | Ga0157375_106207824 | 147 |
| 646 | 3300013308 | Ga0157375_11595069 | Ga0157375_115950692 | 147 |
| 647 | 3300014325 | Ga0163163_10007673 | Ga0163163_100076734 | 147 |
| 648 | 3300014325 | Ga0163163_10077127 | Ga0163163_100771273 | 147 |
| 649 | 3300014325 | Ga0163163_10388414 | Ga0163163_103884142 | 147 |
| 650 | 3300014326 | Ga0157380_10136922 | Ga0157380_101369223 | 147 |
| 651 | 3300014326 | Ga0157380_10226764 | Ga0157380_102267642 | 147 |
| 652 | 3300014968 | Ga0157379_10015503 | Ga0157379_100155033 | 147 |
| 653 | 3300014969 | Ga0157376_10136744 | Ga0157376_101367445 | 147 |
| 654 | 3300014969 | Ga0157376_10656542 | Ga0157376_106565421 | 147 |
| 655 | 3300017792 | Ga0163161_10186038 | Ga0163161_101860382 | 147 |
| 656 | 3300017792 | Ga0163161_10194286 | Ga0163161_101942862 | 147 |
| 657 | 3300017792 | Ga0163161_11449893 | Ga0163161_114498931 | 147 |
| 658 | 3300025900 | Ga0207710_10017024 | Ga0207710_100170244 | 147 |
| 659 | 3300025903 | Ga0207680_10333845 | Ga0207680_103338452 | 147 |
| 660 | 3300025903 | Ga0207680_10591076 | Ga0207680_105910762 | 147 |
| 661 | 3300025908 | Ga0207643_10884818 | Ga0207643_108848181 | 147 |
| 662 | 3300025911 | Ga0207654_10094646 | Ga0207654_100946462 | 147 |
| 663 | 3300025911 | Ga0207654_10242720 | Ga0207654_102427202 | 147 |
| 664 | 3300025912 | Ga0207707_10510635 | Ga0207707_105106352 | 147 |
| 665 | 3300025912 | Ga0207707_11193069 | Ga0207707_111930692 | 147 |
| 666 | 3300025913 | Ga0207695_10195015 | Ga0207695_101950152 | 147 |
| 667 | 3300025917 | Ga0207660_10252802 | Ga0207660_102528024 | 147 |
| 668 | 3300025920 | Ga0207649_10247675 | Ga0207649_102476752 | 147 |
| 669 | 3300025921 | Ga0207652_10410414 | Ga0207652_104104142 | 147 |
| 670 | 3300025922 | Ga0207646_10033887 | Ga0207646_100338871 | 147 |
| 671 | 3300025925 | Ga0207650_10019210 | Ga0207650_100192103 | 147 |
| 672 | 3300025925 | Ga0207650_10053843 | Ga0207650_100538432 | 147 |
| 673 | 3300025925 | Ga0207650_10144700 | Ga0207650_101447002 | 147 |
| 674 | 3300025925 | Ga0207650_10792948 | Ga0207650_107929482 | 147 |
| 675 | 3300025925 | Ga0207650_11476129 | Ga0207650_114761291 | 147 |
| 676 | 3300025926 | Ga0207659_10049027 | Ga0207659_100490275 | 147 |
| 677 | 3300025927 | Ga0207687_10012665 | Ga0207687_100126656 | 147 |
| 678 | 3300025931 | Ga0207644_10035812 | Ga0207644_100358124 | 147 |
| 679 | 3300025931 | Ga0207644_10219381 | Ga0207644_102193812 | 147 |
| 680 | 3300025933 | Ga0207706_10087051 | Ga0207706_100870513 | 147 |
| 681 | 3300025936 | Ga0207670_10017537 | Ga0207670_100175373 | 147 |
| 682 | 3300025936 | Ga0207670_10059695 | Ga0207670_100596952 | 147 |
| 683 | 3300025937 | Ga0207669_11004598 | Ga0207669_110045981 | 147 |
| 684 | 3300025940 | Ga0207691_10021460 | Ga0207691_100214607 | 147 |
| 685 | 3300025940 | Ga0207691_10290018 | Ga0207691_102900184 | 147 |
| 686 | 3300025940 | Ga0207691_10579027 | Ga0207691_105790272 | 147 |
| 687 | 3300025941 | Ga0207711_10004193 | Ga0207711_100041938 | 147 |
| 688 | 3300025941 | Ga0207711_10076160 | Ga0207711_100761603 | 147 |
| 689 | 3300025942 | Ga0207689_10354938 | Ga0207689_103549381 | 147 |
| 690 | 3300025945 | Ga0207679_10018522 | Ga0207679_100185228 | 147 |
| 691 | 3300025945 | Ga0207679_10146993 | Ga0207679_101469932 | 147 |
| 692 | 3300025945 | Ga0207679_10187472 | Ga0207679_101874721 | 147 |
| 693 | 3300025960 | Ga0207651_10069277 | Ga0207651_100692774 | 147 |
| 694 | 3300025960 | Ga0207651_10672841 | Ga0207651_106728411 | 147 |
| 695 | 3300025960 | Ga0207651_10992845 | Ga0207651_109928451 | 147 |
| 696 | 3300025961 | Ga0207712_10155016 | Ga0207712_101550162 | 147 |
| 697 | 3300025972 | Ga0207668_10119569 | Ga0207668_101195692 | 147 |
| 698 | 3300025986 | Ga0207658_10111846 | Ga0207658_101118462 | 147 |
| 699 | 3300026023 | Ga0207677_10396175 | Ga0207677_103961753 | 147 |
| 700 | 3300026035 | Ga0207703_10000601 | Ga0207703_100006015 | 147 |
| 701 | 3300026035 | Ga0207703_10007165 | Ga0207703_1000716510 | 147 |
| 702 | 3300026035 | Ga0207703_10080875 | Ga0207703_100808752 | 147 |
| 703 | 3300026035 | Ga0207703_10526108 | Ga0207703_105261081 | 147 |
| 704 | 3300026041 | Ga0207639_10242095 | Ga0207639_102420954 | 147 |
| 705 | 3300026041 | Ga0207639_11018091 | Ga0207639_110180911 | 147 |
| 706 | 3300026067 | Ga0207678_10654099 | Ga0207678_106540992 | 147 |
| 707 | 3300026088 | Ga0207641_10044187 | Ga0207641_100441872 | 147 |
| 708 | 3300026088 | Ga0207641_10097202 | Ga0207641_100972022 | 147 |
| 709 | 3300026088 | Ga0207641_10674581 | Ga0207641_106745811 | 147 |
| 710 | 3300026088 | Ga0207641_10970012 | Ga0207641_109700121 | 147 |
| 711 | 3300026089 | Ga0207648_10079721 | Ga0207648_100797215 | 147 |
| 712 | 3300026095 | Ga0207676_10034819 | Ga0207676_100348195 | 147 |
| 713 | 3300026095 | Ga0207676_10083064 | Ga0207676_100830643 | 147 |
| 714 | 3300026095 | Ga0207676_11826696 | Ga0207676_118266961 | 147 |
| 715 | 3300026118 | Ga0207675_100027018 | Ga0207675_1000270184 | 147 |
| 716 | 3300026118 | Ga0207675_100027936 | Ga0207675_1000279365 | 147 |
| 717 | 3300026118 | Ga0207675_100879073 | Ga0207675_1008790731 | 147 |
| 718 | 3300026121 | Ga0207683_10378909 | Ga0207683_103789092 | 147 |
| 719 | 3300026121 | Ga0207683_11453795 | Ga0207683_114537952 | 147 |
| 720 | 3300027907 | Ga0207428_10568409 | Ga0207428_105684091 | 147 |
| 721 | 3300028381 | Ga0268264_10995914 | Ga0268264_109959142 | 147 |
| 722 | 3300028786 | Ga0307517_10221631 | Ga0307517_102216313 | 147 |
| 723 | 3300030522 | Ga0307512_10244797 | Ga0307512_102447972 | 147 |
| 724 | 3300031456 | Ga0307513_10698862 | Ga0307513_106988621 | 147 |
| 725 | 3300031616 | Ga0307508_10235936 | Ga0307508_102359362 | 147 |
| 726 | 3300031903 | Ga0307407_10226502 | Ga0307407_102265023 | 147 |
| 727 | 3300032002 | Ga0307416_102363145 | Ga0307416_1023631452 | 147 |
| 728 | 3300032005 | Ga0307411_10095974 | Ga0307411_100959742 | 147 |
| 729 | 3300035172 | Ga0373955_0267385 | Ga0373955_0267385_88_531 | 147 |
| 730 | 3300037471 | Ga0395905_0119273 | Ga0395905_0119273_456_899 | 147 |
| 731 | 3300042007 | Ga0439449_0007120 | Ga0439449_0007120_497_940 | 147 |
| 732 | 3300046457 | Ga0495590_0000646 | Ga0495590_0000646_2094_2537 | 147 |
| 733 | 3300046460 | Ga0495638_0026825 | Ga0495638_0026825_1831_2274 | 147 |
| 734 | 3300046463 | Ga0495653_0014403 | Ga0495653_0014403_4687_5133 | 147 |
| 735 | 3300046472 | Ga0495580_0082119 | Ga0495580_0082119_885_1328 | 147 |
| 736 | 3300046491 | Ga0495584_0000095 | Ga0495584_0000095_42243_42686 | 147 |
| 737 | 3300046492 | Ga0495585_0000428 | Ga0495585_0000428_22535_22978 | 147 |
| 738 | 3300046492 | Ga0495585_0007809 | Ga0495585_0007809_924_1370 | 147 |
| 739 | 3300046500 | Ga0495596_0003769 | Ga0495596_0003769_1959_2402 | 147 |
| 740 | 3300046501 | Ga0495607_0163268 | Ga0495607_0163268_553_999 | 147 |
| 741 | 3300046506 | Ga0495583_0007506 | Ga0495583_0007506_1038_1481 | 147 |
| 742 | 3300046513 | Ga0495616_0000052 | Ga0495616_0000052_66143_66586 | 147 |
| 743 | 3300046513 | Ga0495616_0000447 | Ga0495616_0000447_9822_10265 | 147 |
| 744 | 3300046513 | Ga0495616_0001194 | Ga0495616_0001194_12754_13197 | 147 |
| 745 | 3300046519 | Ga0495632_0000082 | Ga0495632_0000082_91574_92020 | 147 |
| 746 | 3300046519 | Ga0495632_0132721 | Ga0495632_0132721_656_1099 | 147 |
| 747 | 3300046519 | Ga0495632_0165107 | Ga0495632_0165107_476_919 | 147 |
| 748 | 3300046528 | Ga0495642_0122561 | Ga0495642_0122561_471_914 | 147 |
| 749 | 3300046530 | Ga0495654_0142333 | Ga0495654_0142333_271_714 | 147 |
| 750 | 3300046538 | Ga0495609_0024437 | Ga0495609_0024437_1791_2234 | 147 |
| 751 | 3300046538 | Ga0495609_0294846 | Ga0495609_0294846_184_627 | 147 |
| 752 | 3300046542 | Ga0495597_0068321 | Ga0495597_0068321_131_574 | 147 |
| 753 | 3300046558 | Ga0495633_0000640 | Ga0495633_0000640_9781_10224 | 147 |
| 754 | 3300046616 | Ga0495668_0006667 | Ga0495668_0006667_1437_1883 | 147 |
| 755 | 3300046660 | Ga0495625_0026470 | Ga0495625_0026470_2119_2568 | 147 |
| 756 | 3300046660 | Ga0495625_0084504 | Ga0495625_0084504_887_1330 | 147 |
| 757 | 3300046660 | Ga0495625_0457777 | Ga0495625_0457777_162_605 | 147 |
| 758 | 3300046665 | Ga0495661_0034421 | Ga0495661_0034421_1253_1696 | 147 |
| 759 | 3300046691 | Ga0495670_0023487 | Ga0495670_0023487_1422_1865 | 147 |
| 760 | 3300046794 | Ga0495589_0526790 | Ga0495589_0526790_85_528 | 147 |
| 761 | 3300046810 | Ga0495660_0006120 | Ga0495660_0006120_2565_3011 | 147 |
| 762 | 3300047322 | Ga0495680_0315989 | Ga0495680_0315989_380_823 | 147 |
| 763 | 3300047323 | Ga0495683_0000157 | Ga0495683_0000157_47148_47591 | 147 |
| 764 | 3300047443 | Ga0495687_000187 | Ga0495687_000187_62350_62793 | 147 |
| 765 | 3300047446 | Ga0495679_008567 | Ga0495679_008567_2420_2863 | 147 |
| 766 | 3300047673 | Ga0495593_0117580 | Ga0495593_0117580_395_841 | 147 |
| 767 | 3300048088 | Ga0495602_0008918 | Ga0495602_0008918_8462_8908 | 147 |
| 768 | 3300048091 | Ga0495626_0047699 | Ga0495626_0047699_1376_1822 | 147 |
| 769 | 3300048091 | Ga0495626_0163821 | Ga0495626_0163821_305_751 | 147 |
| 770 | 3300048903 | Ga0496100_0076667 | Ga0496100_0076667_148_591 | 147 |
| 771 | 3300048904 | Ga0496101_0034270 | Ga0496101_0034270_328_771 | 147 |
| 772 | 3300048905 | Ga0496102_0004345 | Ga0496102_0004345_4880_5323 | 147 |
| 773 | 3300048907 | Ga0496104_0006833 | Ga0496104_0006833_736_1179 | 147 |
| 774 | 3300048907 | Ga0496104_0019564 | Ga0496104_0019564_761_1204 | 147 |
| 775 | 3300048907 | Ga0496104_0114200 | Ga0496104_0114200_1130_1573 | 147 |
| 776 | 3300048909 | Ga0496106_0010643 | Ga0496106_0010643_4535_4978 | 147 |
| 777 | 3300048909 | Ga0496106_0012662 | Ga0496106_0012662_3968_4411 | 147 |
| 778 | 3300048910 | Ga0496107_0508336 | Ga0496107_0508336_347_790 | 147 |
| 779 | 3300048911 | Ga0496108_0002232 | Ga0496108_0002232_8843_9286 | 147 |
| 780 | 3300048911 | Ga0496108_0006449 | Ga0496108_0006449_1608_2051 | 147 |
| 781 | 3300048912 | Ga0496109_0015121 | Ga0496109_0015121_3171_3614 | 147 |
| 782 | 3300048912 | Ga0496109_0104250 | Ga0496109_0104250_1007_1450 | 147 |
| 783 | 3300048913 | Ga0496110_0005940 | Ga0496110_0005940_6023_6466 | 147 |
| 784 | 3300048913 | Ga0496110_0014596 | Ga0496110_0014596_4836_5279 | 147 |
| 785 | 3300048913 | Ga0496110_0798857 | Ga0496110_0798857_353_796 | 147 |
| 786 | 3300048913 | Ga0496110_1117781 | Ga0496110_1117781_129_572 | 147 |
| 787 | 3300048915 | Ga0496112_0000842 | Ga0496112_0000842_12606_13049 | 147 |
| 788 | 3300048915 | Ga0496112_0011469 | Ga0496112_0011469_451_894 | 147 |
| 789 | 3300048916 | Ga0496113_0022989 | Ga0496113_0022989_1227_1670 | 147 |
| 790 | 3300048917 | Ga0496114_0282651 | Ga0496114_0282651_724_1167 | 147 |
| 791 | 3300048918 | Ga0496115_0011104 | Ga0496115_0011104_1961_2404 | 147 |
| 792 | 3300048925 | Ga0496122_0290019 | Ga0496122_0290019_79_525 | 147 |
| 793 | 3300048926 | Ga0496123_0145087 | Ga0496123_0145087_102_548 | 147 |
| 794 | 3300048927 | Ga0496124_0143649 | Ga0496124_0143649_804_1250 | 147 |
| 795 | 3300049459 | Ga0495678_000102 | Ga0495678_000102_97955_98401 | 147 |
| 796 | 3300049575 | Ga0501039_0687517 | Ga0501039_0687517_309_752 | 147 |
| 797 | 3300049578 | Ga0501042_0883087 | Ga0501042_0883087_190_633 | 147 |
| 798 | 3300049824 | Ga0501045_0544803 | Ga0501045_0544803_155_598 | 147 |
| 799 | 3300050490 | nmdc:mga03n38_1501_c1 | nmdc:mga03n38_1501_c1_1840_2283 | 147 |
| 800 | 3300050510 | nmdc:mga06r32_39519_c1 | nmdc:mga06r32_39519_c1_3176_3619 | 147 |
| 801 | 3300050511 | nmdc:mga08y16_236228_c1 | nmdc:mga08y16_236228_c1_1366_1809 | 147 |
| 802 | 3300050512 | nmdc:mga0n895_1398660_c1 | nmdc:mga0n895_1398660_c1_159_602 | 147 |
| 803 | 3300053083 | Ga0495655_0000033 | Ga0495655_0000033_27886_28329 | 147 |
| 804 | 3300053139 | Ga0500568_0003238 | Ga0500568_0003238_7226_7669 | 147 |
| 805 | 3300053139 | Ga0500568_0033636 | Ga0500568_0033636_901_1344 | 147 |
| 806 | 3300054114 | Ga0501084_0008906 | Ga0501084_0008906_1031_1474 | 147 |
| 807 | 2162886006 | SwRhRL3b_contig_1143410 | SwRhRL3b_0090.00000980 | 148 |
| 808 | 3300005289 | Ga0065704_10299499 | Ga0065704_102994992 | 148 |
| 809 | 3300005295 | Ga0065707_10215133 | Ga0065707_102151332 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j0b-assembly1.cif.gz_a | cryo-em structure of an extracellular contractile injection system, pvc sheath-tube complex in extended state | 0.6503 | 10 | 148 |
| 6j0f-assembly1.cif.gz_a | cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state | 0.6401 | 10 | 148 |
| 1xf8-assembly1.cif.gz_A | crystal structure of weissella viridescens femx (y254f) mutant | 0.6289 | 88 | 125 |
| 6bdc-assembly1.cif.gz_A | structure of hcp1 from flavobacterium johnsoniae | 0.6173 | 10 | 147 |
| 6j0f-assembly1.cif.gz_a | cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state | 0.6054 | 10 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06136_158_460_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.78 | 90 | 113 | 3.40.630.30 |
| af_Q2FWJ9_318_422_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.7676 | 115 | 142 | 3.30.70.260 |
| af_Q5SZD4_150_264_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.6696 | 94 | 114 | 3.40.630.30 |
| af_Q2FYR1_1_132_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.65 | 81 | 113 | 3.40.630.30 |
| af_Q54YS7_422_509_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.6452 | 116 | 138 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A426U0G8-F1-model_v4 | Phage tail protein | 0.8146 | 1 | 147 |
GO:0005198
|
| AF-A0A426U0G8-F1-model_v4 | Phage tail protein | 0.7948 | 1 | 147 |
GO:0005198
|
| AF-A0A6B3HRY7-F1-model_v4 | Phage tail protein | 0.7706 | 75 | 146 |
GO:0005198
|
| AF-A0A3C0E4N7-F1-model_v4 | Phage tail protein | 0.766 | 9 | 148 |
GO:0005198
|
| AF-A0A6H9LDH8-F1-model_v4 | deleted | 0.7636 | 9 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar