F481760

General Info

Members Datasets Scaffolds Average Seq Length
809 342 796 144

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10197661|Ga0105248_101976613
Length 155
Sequence MNRKKEHRMPRQDPLRNFLFRLEIDGIQTAGFSEVSILETTTAAIDYREGTDPPHVRKLAGLTKYGNIALKRGVVAGSAALDLYHWHASVVTGGTQGSRRNIAIVVLSDDGNDQTRFIVSEAWPVKYASGPFNARGNEVLIELLELVNEGIQRVE

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
4 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
5 2857472729 Cohnella sp. R-74144 Isolate Unclassified
6 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
7 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
8 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
9 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
10 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
11 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
201 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
202 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
221 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
227 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
228 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
249 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
250 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
267 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
294 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
316 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
334 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
339 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
340 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
341 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
342 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0.37
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0.25
Rhizoplane 3.96
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1143410 2162886006 Bacteria 960
2 SwRhRL2b_contig_3005271 2162886007 Bacteria 821
3 rootL2_10020075 3300003322 Bacteria 3885
4 rootL2_10251230 3300003322 Bacteria 1560
5 rootL2_10251231 3300003322 Bacteria 1376
6 JGI25160J50197_1033488 3300003354 Bacteria 1291
7 Ga0007416J51690_1014507 3300003577 Bacteria 8646
8 Ga0055526_1000001 3300003771 Bacteria 669703
9 Ga0065714_10193689 3300005288 Bacteria 919
10 Ga0065714_10281034 3300005288 Unclassified 721
11 Ga0065704_10299499 3300005289 Bacteria 888
12 Ga0065704_10328536 3300005289 Bacteria 841
13 Ga0065704_10334449 3300005289 Bacteria 833
14 Ga0065704_10714107 3300005289 Unclassified 556
15 Ga0065712_10003972 3300005290 Bacteria 5717
16 Ga0065712_10087908 3300005290 Bacteria 2548
17 Ga0065712_10268973 3300005290 Unclassified 920
18 Ga0065715_10001891 3300005293 Bacteria 7194
19 Ga0065715_10091491 3300005293 Bacteria 5752
20 Ga0065715_10318694 3300005293 Bacteria 1006
21 Ga0065715_10864599 3300005293 Unclassified 554
22 Ga0065715_11048134 3300005293 Bacteria 530
23 Ga0065707_10141047 3300005295 Bacteria 1772
24 Ga0065707_10215133 3300005295 Bacteria 1248
25 Ga0065707_10307784 3300005295 Bacteria 991
26 Ga0070683_100311295 3300005329 Bacteria 1498
27 Ga0070690_100117157 3300005330 Bacteria 1784
28 Ga0070690_100261937 3300005330 Bacteria 1227
29 Ga0070690_100326463 3300005330 Unclassified 1107
30 Ga0070690_100467140 3300005330 Unclassified 938
31 Ga0070690_100632833 3300005330 Bacteria 815
32 Ga0070690_101170258 3300005330 Unclassified 612
33 Ga0070670_100019552 3300005331 Bacteria 5813
34 Ga0070670_100060675 3300005331 Bacteria 3247
35 Ga0070670_100064761 3300005331 Bacteria 3136
36 Ga0070670_100198931 3300005331 Bacteria 1741
37 Ga0070670_100473024 3300005331 Bacteria 1112
38 Ga0070670_101436273 3300005331 Bacteria 633
39 Ga0068869_100025548 3300005334 Bacteria 4102
40 Ga0068869_100330816 3300005334 Bacteria 1238
41 Ga0068869_101403701 3300005334 Unclassified 618
42 Ga0070666_10015226 3300005335 Unclassified 4904
43 Ga0070666_10614075 3300005335 Bacteria 794
44 Ga0070666_10714375 3300005335 Bacteria 735
45 Ga0070666_10833053 3300005335 Bacteria 680
46 Ga0070682_101462485 3300005337 Unclassified 586
47 Ga0070682_101669420 3300005337 Bacteria 553
48 Ga0068868_100080420 3300005338 Bacteria 2612
49 Ga0068868_100417539 3300005338 Bacteria 1161
50 Ga0070689_100049952 3300005340 Bacteria 3230
51 Ga0070689_100225668 3300005340 Bacteria 1538
52 Ga0070689_100579805 3300005340 Bacteria 969
53 Ga0070689_100664357 3300005340 Bacteria 908
54 Ga0070691_10460067 3300005341 Unclassified 728
55 Ga0070687_100175777 3300005343 Bacteria 1278
56 Ga0070661_100022563 3300005344 Bacteria 4507
57 Ga0070661_101014259 3300005344 Bacteria 689
58 Ga0070692_10061309 3300005345 Unclassified 1982
59 Ga0070692_10419773 3300005345 Bacteria 849
60 Ga0070692_10652528 3300005345 Bacteria 703
61 Ga0070692_10692711 3300005345 Unclassified 685
62 Ga0070668_100064495 3300005347 Unclassified 2840
63 Ga0070668_100133764 3300005347 Bacteria 1992
64 Ga0070668_100957650 3300005347 Bacteria 767
65 Ga0070669_100021146 3300005353 Bacteria 4650
66 Ga0070675_100333062 3300005354 Unclassified 1343
67 Ga0070675_100419559 3300005354 Bacteria 1196
68 Ga0070675_100495886 3300005354 Bacteria 1100
69 Ga0070671_100076924 3300005355 Bacteria 2788
70 Ga0070671_100164216 3300005355 Bacteria 1877
71 Ga0070671_100244360 3300005355 Bacteria 1524
72 Ga0070674_100688019 3300005356 Unclassified 873
73 Ga0070673_100082756 3300005364 Bacteria 2606
74 Ga0070673_100700372 3300005364 Bacteria 930
75 Ga0070673_101706394 3300005364 Unclassified 596
76 Ga0070688_100358533 3300005365 Bacteria 1069
77 Ga0070659_100311764 3300005366 Bacteria 1314
78 Ga0070659_100870743 3300005366 Bacteria 786
79 Ga0070667_100071012 3300005367 Unclassified 2965
80 Ga0070667_100097205 3300005367 Unclassified 2540
81 Ga0070667_100968357 3300005367 Bacteria 793
82 Ga0070703_10000109 3300005406 Bacteria 42760
83 Ga0070713_100341741 3300005436 Unclassified 1387
84 Ga0070710_10712412 3300005437 Unclassified 709
85 Ga0070701_10013835 3300005438 Bacteria 3682
86 Ga0070701_10332859 3300005438 Bacteria 943
87 Ga0070711_101035559 3300005439 Bacteria 705
88 Ga0070711_101505641 3300005439 Bacteria 587
89 Ga0070705_100521061 3300005440 Unclassified 906
90 Ga0070705_101139255 3300005440 Bacteria 640
91 Ga0070700_100013206 3300005441 Bacteria 4634
92 Ga0070700_100030838 3300005441 Bacteria 3208
93 Ga0070694_100000051 3300005444 Bacteria 54318
94 Ga0070694_100014694 3300005444 Viruses 4905
95 Ga0070694_100190914 3300005444 Bacteria 1521
96 Ga0070694_100534020 3300005444 Bacteria 937
97 Ga0070708_100048652 3300005445 Unclassified 3749
98 Ga0070678_100719089 3300005456 Bacteria 901
99 Ga0070678_100875195 3300005456 Bacteria 820
100 Ga0070678_101006416 3300005456 Bacteria 766
101 Ga0070662_100152761 3300005457 Bacteria 1799
102 Ga0070662_101232072 3300005457 Unclassified 643
103 Ga0070681_10006958 3300005458 Bacteria 11006
104 Ga0070681_10571501 3300005458 Bacteria 1044
105 Ga0068867_100051885 3300005459 Bacteria 3025
106 Ga0068867_100061946 3300005459 Unclassified 2779
107 Ga0068867_100063410 3300005459 Unclassified 2747
108 Ga0068867_101401778 3300005459 Bacteria 648
109 Ga0070685_10370529 3300005466 Unclassified 984
110 Ga0070706_100084939 3300005467 Unclassified 2933
111 Ga0070707_100026693 3300005468 Bacteria 5486
112 Ga0070707_100440069 3300005468 Unclassified 1264
113 Ga0070707_100567079 3300005468 Bacteria 1097
114 Ga0070707_100950918 3300005468 Bacteria 824
115 Ga0070698_100002168 3300005471 Bacteria 21783
116 Ga0070698_100020984 3300005471 Bacteria 6845
117 Ga0070698_100066293 3300005471 Unclassified 3635
118 Ga0070698_100085037 3300005471 Bacteria 3151
119 Ga0070698_100143983 3300005471 Bacteria 2333
120 Ga0070698_100422670 3300005471 Unclassified 1267
121 Ga0070699_100003516 3300005518 Bacteria 13846
122 Ga0070699_100097247 3300005518 Bacteria 2579
123 Ga0070699_100105456 3300005518 Bacteria 2473
124 Ga0070699_100442480 3300005518 Bacteria 1178
125 Ga0070684_100083859 3300005535 Bacteria 2824
126 Ga0070684_101657087 3300005535 Viruses 603
127 Ga0070684_101674523 3300005535 Bacteria 600
128 Ga0070697_100119900 3300005536 Bacteria 2200
129 Ga0070697_100138929 3300005536 Bacteria 2042
130 Ga0070697_100235312 3300005536 Bacteria 1563
131 Ga0070697_100255869 3300005536 Bacteria 1498
132 Ga0070697_100276592 3300005536 Unclassified 1440
133 Ga0070697_100456749 3300005536 Bacteria 1113
134 Ga0068853_100160911 3300005539 Bacteria 2026
135 Ga0068853_100398291 3300005539 Bacteria 1288
136 Ga0068853_100663120 3300005539 Bacteria 993
137 Ga0068853_101111251 3300005539 Bacteria 762
138 Ga0070672_100011579 3300005543 Bacteria 6155
139 Ga0070672_100076552 3300005543 Bacteria 2673
140 Ga0070672_100644420 3300005543 Bacteria 925
141 Ga0070672_101172514 3300005543 Viruses 684
142 Ga0070686_100000059 3300005544 Bacteria 84781
143 Ga0070686_100154460 3300005544 Bacteria 1610
144 Ga0070686_100701560 3300005544 Viruses 807
145 Ga0070695_100000132 3300005545 Bacteria 34051
146 Ga0070695_100019038 3300005545 Bacteria 4175
147 Ga0070695_100100854 3300005545 Bacteria 1944
148 Ga0070695_100123890 3300005545 Bacteria 1772
149 Ga0070695_100345641 3300005545 Bacteria 1113
150 Ga0070695_100723226 3300005545 Bacteria 792
151 Ga0070696_100101723 3300005546 Bacteria 2060
152 Ga0070696_100128334 3300005546 Bacteria 1842
153 Ga0070696_100814502 3300005546 Bacteria 769
154 Ga0070696_101048010 3300005546 Unclassified 683
155 Ga0070696_101208066 3300005546 Bacteria 639
156 Ga0070696_101654709 3300005546 Unclassified 551
157 Ga0070693_100000459 3300005547 Bacteria 18304
158 Ga0070693_100043145 3300005547 Bacteria 2546
159 Ga0070693_100074042 3300005547 Bacteria 2013
160 Ga0070693_100134923 3300005547 Unclassified 1547
161 Ga0070693_100634256 3300005547 Bacteria 775
162 Ga0070693_100714658 3300005547 Viruses 735
163 Ga0070665_100000024 3300005548 Bacteria 374559
164 Ga0070665_100684853 3300005548 Unclassified 1038
165 Ga0070665_101140354 3300005548 Bacteria 791
166 Ga0070704_100325643 3300005549 Bacteria 1289
167 Ga0070704_101983031 3300005549 Bacteria 540
168 Ga0068855_101090799 3300005563 Bacteria 835
169 Ga0070664_100000591 3300005564 Bacteria 27629
170 Ga0070664_100024412 3300005564 Bacteria 5000
171 Ga0070664_100043844 3300005564 Bacteria 3776
172 Ga0070664_100267599 3300005564 Bacteria 1539
173 Ga0070664_100526304 3300005564 Bacteria 1092
174 Ga0070664_100734049 3300005564 Bacteria 921
175 Ga0070664_101292748 3300005564 Bacteria 689
176 Ga0068857_101131452 3300005577 Bacteria 757
177 Ga0068854_100143907 3300005578 Bacteria 1832
178 Ga0068854_100334341 3300005578 Unclassified 1235
179 Ga0068854_100462277 3300005578 Bacteria 1062
180 Ga0068854_100535946 3300005578 Bacteria 991
181 Ga0068854_100699319 3300005578 Bacteria 875
182 Ga0068856_100269060 3300005614 Bacteria 1720
183 Ga0068856_100376830 3300005614 Unclassified 1438
184 Ga0070702_100190815 3300005615 Bacteria 1348
185 Ga0068852_100366708 3300005616 Bacteria 1410
186 Ga0068852_101008758 3300005616 Unclassified 851
187 Ga0068852_102140237 3300005616 Viruses 581
188 Ga0068859_100028784 3300005617 Bacteria 5570
189 Ga0068859_100056239 3300005617 Bacteria 3959
190 Ga0068859_100169870 3300005617 Bacteria 2261
191 Ga0068859_100665352 3300005617 Bacteria 1133
192 Ga0068859_101349662 3300005617 Bacteria 786
193 Ga0068859_102133441 3300005617 Bacteria 618
194 Ga0068864_100000481 3300005618 Bacteria 34602
195 Ga0068864_100011188 3300005618 Bacteria 7415
196 Ga0068864_100018567 3300005618 Bacteria 5812
197 Ga0068864_100037713 3300005618 Bacteria 4126
198 Ga0068864_100042855 3300005618 Bacteria 3873
199 Ga0068864_100062948 3300005618 Bacteria 3215
200 Ga0068864_100147223 3300005618 Bacteria 2130
201 Ga0068864_100510955 3300005618 Bacteria 1157
202 Ga0068864_100633147 3300005618 Bacteria 1040
203 Ga0068864_100683362 3300005618 Bacteria 1001
204 Ga0068864_101026832 3300005618 Unclassified 818
205 Ga0068866_10308977 3300005718 Bacteria 990
206 Ga0068866_10357681 3300005718 Unclassified 930
207 Ga0068861_100004876 3300005719 Bacteria 9030
208 Ga0068861_100009178 3300005719 Bacteria 6821
209 Ga0068861_100017766 3300005719 Bacteria 5053
210 Ga0068861_100070833 3300005719 Unclassified 2701
211 Ga0068861_100522956 3300005719 Bacteria 1076
212 Ga0068861_100582524 3300005719 Bacteria 1024
213 Ga0068861_102081321 3300005719 Viruses 567
214 Ga0068851_10072702 3300005834 Bacteria 1782
215 Ga0068851_10109206 3300005834 Unclassified 1475
216 Ga0068870_10193769 3300005840 Unclassified 1228
217 Ga0068870_10379969 3300005840 Bacteria 914
218 Ga0068870_10878616 3300005840 Bacteria 632
219 Ga0068870_10883197 3300005840 Bacteria 630
220 Ga0068863_100056704 3300005841 Bacteria 3709
221 Ga0068863_100257659 3300005841 Unclassified 1686
222 Ga0068863_100326465 3300005841 Bacteria 1491
223 Ga0068863_100362118 3300005841 Bacteria 1414
224 Ga0068863_100744549 3300005841 Bacteria 976
225 Ga0068863_101109021 3300005841 Bacteria 796
226 Ga0068863_101881912 3300005841 Unclassified 608
227 Ga0068858_100000647 3300005842 Bacteria 36268
228 Ga0068858_100002332 3300005842 Bacteria 19193
229 Ga0068858_100009884 3300005842 Bacteria 9064
230 Ga0068858_100015004 3300005842 Bacteria 7289
231 Ga0068858_100021480 3300005842 Bacteria 6031
232 Ga0068858_100036806 3300005842 Bacteria 4537
233 Ga0068858_100066563 3300005842 Unclassified 3336
234 Ga0068858_100239525 3300005842 Bacteria 1721
235 Ga0068858_100283307 3300005842 Bacteria 1578
236 Ga0068858_101368653 3300005842 Bacteria 697
237 Ga0068858_101770097 3300005842 Unclassified 610
238 Ga0068860_100039803 3300005843 Bacteria 4496
239 Ga0068860_100219183 3300005843 Bacteria 1847
240 Ga0068860_100309218 3300005843 Bacteria 1549
241 Ga0068860_100505424 3300005843 Unclassified 1207
242 Ga0068860_101097493 3300005843 Bacteria 815
243 Ga0068862_100227281 3300005844 Bacteria 1691
244 Ga0068862_101409704 3300005844 Bacteria 700
245 Ga0081538_10013855 3300005981 Bacteria 6359
246 Ga0075363_100040425 3300006048 Bacteria 2458
247 Ga0097621_100377811 3300006237 Bacteria 1265
248 Ga0097621_100438755 3300006237 Bacteria 1175
249 Ga0097621_100588800 3300006237 Bacteria 1016
250 Ga0075370_10066885 3300006353 Unclassified 2051
251 Ga0068871_100187407 3300006358 Bacteria 1780
252 Ga0068871_100634676 3300006358 Bacteria 974
253 Ga0068871_100889487 3300006358 Bacteria 825
254 Ga0068871_101587963 3300006358 Bacteria 619
255 Ga0075428_100807302 3300006844 Bacteria 997
256 Ga0075430_100018478 3300006846 Bacteria 5932
257 Ga0075430_100111101 3300006846 Bacteria 2285
258 Ga0075431_100033343 3300006847 Bacteria 5308
259 Ga0075431_100045805 3300006847 Bacteria 4508
260 Ga0075431_100046677 3300006847 Bacteria 4467
261 Ga0075431_100068580 3300006847 Unclassified 3660
262 Ga0075431_100657677 3300006847 Bacteria 1028
263 Ga0075433_10060594 3300006852 Bacteria 3314
264 Ga0075433_10223889 3300006852 Bacteria 1671
265 Ga0075433_10332519 3300006852 Bacteria 1343
266 Ga0075433_10572262 3300006852 Bacteria 992
267 Ga0075434_100142855 3300006871 Bacteria 2414
268 Ga0075434_101632336 3300006871 Unclassified 653
269 Ga0075429_100100874 3300006880 Bacteria 2520
270 Ga0075429_100130506 3300006880 Bacteria 2198
271 Ga0075429_100669920 3300006880 Bacteria 909
272 Ga0075429_100768025 3300006880 Bacteria 844
273 Ga0075429_101535986 3300006880 Bacteria 579
274 Ga0068865_100082062 3300006881 Bacteria 2317
275 Ga0068865_100118239 3300006881 Bacteria 1966
276 Ga0068865_100701255 3300006881 Bacteria 865
277 Ga0097620_100028784 3300006931 Bacteria 5570
278 Ga0097620_100056237 3300006931 Bacteria 3959
279 Ga0097620_100169876 3300006931 Bacteria 2261
280 Ga0097620_100665286 3300006931 Bacteria 1133
281 Ga0097620_101349659 3300006931 Bacteria 786
282 Ga0097620_102133447 3300006931 Bacteria 618
283 Ga0075435_100418927 3300007076 Bacteria 1153
284 Ga0105251_10391407 3300009011 Unclassified 638
285 Ga0105244_10043206 3300009036 Bacteria 2327
286 Ga0105240_10668509 3300009093 Bacteria 1137
287 Ga0105240_11158157 3300009093 Viruses 820
288 Ga0105240_11391221 3300009093 Unclassified 738
289 Ga0105240_11632713 3300009093 Bacteria 674
290 Ga0105240_11717811 3300009093 Unclassified 655
291 Ga0111539_10001077 3300009094 Bacteria 36044
292 Ga0111539_10028193 3300009094 Bacteria 6853
293 Ga0111539_10148303 3300009094 Bacteria 2746
294 Ga0111539_10478413 3300009094 Bacteria 1450
295 Ga0111539_12940322 3300009094 Bacteria 551
296 Ga0105245_10095267 3300009098 Bacteria 2746
297 Ga0105245_10297963 3300009098 Bacteria 1581
298 Ga0105245_10410285 3300009098 Unclassified 1356
299 Ga0105245_10562251 3300009098 Bacteria 1163
300 Ga0105247_10000273 3300009101 Bacteria 47941
301 Ga0105247_10001576 3300009101 Bacteria 16197
302 Ga0105247_10003156 3300009101 Bacteria 10859
303 Ga0105247_10597367 3300009101 Unclassified 818
304 Ga0114129_10116337 3300009147 Bacteria 3685
305 Ga0114129_10118185 3300009147 Bacteria 3652
306 Ga0114129_10424672 3300009147 Unclassified 1748
307 Ga0114129_11691241 3300009147 Bacteria 772
308 Ga0114129_12490769 3300009147 Bacteria 619
309 Ga0105243_10211308 3300009148 Unclassified 1709
310 Ga0105243_10299252 3300009148 Bacteria 1457
311 Ga0105243_10637430 3300009148 Bacteria 1031
312 Ga0105243_13080245 3300009148 Unclassified 505
313 Ga0105241_10012734 3300009174 Bacteria 6172
314 Ga0105241_10070569 3300009174 Bacteria 2711
315 Ga0105241_10299323 3300009174 Bacteria 1380
316 Ga0105241_10871166 3300009174 Bacteria 834
317 Ga0105242_10005795 3300009176 Bacteria 9515
318 Ga0105242_10014921 3300009176 Bacteria 6022
319 Ga0105242_10076851 3300009176 Bacteria 2784
320 Ga0105242_10399300 3300009176 Bacteria 1283
321 Ga0105242_10771581 3300009176 Bacteria 949
322 Ga0105248_10002695 3300009177 Bacteria 19727
323 Ga0105248_10051180 3300009177 Bacteria 4635
324 Ga0105248_10072720 3300009177 Unclassified 3864
325 Ga0105248_10171623 3300009177 Bacteria 2444
326 Ga0105248_10197661 3300009177 Bacteria 2266
327 Ga0105248_10315964 3300009177 Bacteria 1759
328 Ga0105248_10425755 3300009177 Bacteria 1495
329 Ga0105248_11961257 3300009177 Unclassified 665
330 Ga0105237_10056495 3300009545 Bacteria 3929
331 Ga0105237_10401498 3300009545 Bacteria 1375
332 Ga0105237_10697554 3300009545 Bacteria 1022
333 Ga0105238_10056355 3300009551 Bacteria 3943
334 Ga0105238_10132532 3300009551 Bacteria 2470
335 Ga0105238_10383913 3300009551 Bacteria 1396
336 Ga0105238_11063457 3300009551 Bacteria 831
337 Ga0105249_10097509 3300009553 Bacteria 2760
338 Ga0105249_10384130 3300009553 Bacteria 1431
339 Ga0105249_10567886 3300009553 Bacteria 1186
340 Ga0105249_12167345 3300009553 Bacteria 629
341 Ga0105249_13220114 3300009553 Unclassified 525
342 Ga0105239_10206170 3300010375 Unclassified 2203
343 Ga0105239_10312333 3300010375 Bacteria 1772
344 Ga0105239_11123581 3300010375 Bacteria 905
345 Ga0105239_12081696 3300010375 Bacteria 659
346 Ga0105239_12295932 3300010375 Bacteria 628
347 Ga0105246_10027855 3300011119 Bacteria 3707
348 Ga0105246_10040583 3300011119 Bacteria 3142
349 Ga0105246_10290976 3300011119 Bacteria 1314
350 Ga0157373_10259966 3300013100 Bacteria 1228
351 Ga0157373_10575733 3300013100 Bacteria 818
352 Ga0157374_10084783 3300013296 Bacteria 3012
353 Ga0157374_10213309 3300013296 Bacteria 1893
354 Ga0157374_10670394 3300013296 Bacteria 1049
355 Ga0157374_11480399 3300013296 Unclassified 702
356 Ga0157378_10000039 3300013297 Bacteria 115427
357 Ga0157378_10000400 3300013297 Bacteria 42656
358 Ga0157378_10521209 3300013297 Bacteria 1190
359 Ga0157378_10641930 3300013297 Unclassified 1076
360 Ga0157378_11067393 3300013297 Bacteria 844
361 Ga0157378_11228526 3300013297 Unclassified 789
362 Ga0163162_10011088 3300013306 Bacteria 8781
363 Ga0163162_10013174 3300013306 Bacteria 8076
364 Ga0163162_10124312 3300013306 Unclassified 2685
365 Ga0163162_10130263 3300013306 Unclassified 2624
366 Ga0163162_10151649 3300013306 Bacteria 2436
367 Ga0163162_10220355 3300013306 Bacteria 2027
368 Ga0157372_10318342 3300013307 Unclassified 1811
369 Ga0157372_10457238 3300013307 Bacteria 1488
370 Ga0157372_10541770 3300013307 Bacteria 1357
371 Ga0157372_10954050 3300013307 Bacteria 994
372 Ga0157372_11626707 3300013307 Bacteria 743
373 Ga0157375_10000009 3300013308 Bacteria 366440
374 Ga0157375_10011917 3300013308 Bacteria 7693
375 Ga0157375_10021084 3300013308 Bacteria 5968
376 Ga0157375_10108149 3300013308 Unclassified 2875
377 Ga0157375_10620782 3300013308 Bacteria 1239
378 Ga0157375_11595069 3300013308 Bacteria 771
379 Ga0157375_13111444 3300013308 Bacteria 554
380 Ga0163163_10001662 3300014325 Bacteria 18755
381 Ga0163163_10007673 3300014325 Bacteria 9531
382 Ga0163163_10061011 3300014325 Unclassified 3735
383 Ga0163163_10077127 3300014325 Bacteria 3328
384 Ga0163163_10388414 3300014325 Bacteria 1453
385 Ga0163163_10541986 3300014325 Bacteria 1226
386 Ga0163163_11290125 3300014325 Unclassified 792
387 Ga0163163_11370270 3300014325 Bacteria 769
388 Ga0163163_11602154 3300014325 Bacteria 712
389 Ga0157380_10136922 3300014326 Bacteria 2097
390 Ga0157380_10148731 3300014326 Bacteria 2022
391 Ga0157380_10217464 3300014326 Bacteria 1707
392 Ga0157380_10226764 3300014326 Bacteria 1675
393 Ga0182008_10010984 3300014497 Bacteria 4829
394 Ga0157377_10096254 3300014745 Bacteria 1756
395 Ga0157377_10660350 3300014745 Bacteria 754
396 Ga0157379_10015503 3300014968 Bacteria 6690
397 Ga0157379_10165294 3300014968 Unclassified 1997
398 Ga0157379_11935660 3300014968 Bacteria 581
399 Ga0157376_10084893 3300014969 Bacteria 2727
400 Ga0157376_10136744 3300014969 Bacteria 2194
401 Ga0157376_10191032 3300014969 Unclassified 1878
402 Ga0157376_10656542 3300014969 Bacteria 1050
403 Ga0157376_10967595 3300014969 Unclassified 872
404 Ga0182007_10001949 3300015262 Bacteria 10677
405 Ga0163161_10139738 3300017792 Bacteria 1833
406 Ga0163161_10186038 3300017792 Bacteria 1594
407 Ga0163161_10194286 3300017792 Bacteria 1561
408 Ga0163161_10487202 3300017792 Bacteria 1002
409 Ga0163161_11150767 3300017792 Unclassified 669
410 Ga0163161_11449893 3300017792 Bacteria 601
411 Ga0213876_10002509 3300021384 Bacteria 10768
412 Ga0209564_1000002 3300025295 Bacteria 1636803
413 Ga0209758_1047713 3300025297 Bacteria 1529
414 Ga0207426_1003661 3300025302 Bacteria 8101
415 Ga0209257_1083322 3300025304 Bacteria 815
416 Ga0207656_10234663 3300025321 Unclassified 895
417 Ga0207696_1095900 3300025711 Bacteria 811
418 Ga0207655_1065067 3300025728 Bacteria 1386
419 Ga0207653_10000144 3300025885 Bacteria 50761
420 Ga0207642_10193921 3300025899 Bacteria 1117
421 Ga0207710_10000267 3300025900 Bacteria 42967
422 Ga0207710_10011723 3300025900 Bacteria 3687
423 Ga0207710_10017024 3300025900 Bacteria 3080
424 Ga0207688_10228492 3300025901 Unclassified 1123
425 Ga0207680_10008927 3300025903 Unclassified 4944
426 Ga0207680_10333845 3300025903 Bacteria 1062
427 Ga0207680_10591076 3300025903 Bacteria 794
428 Ga0207647_10058800 3300025904 Unclassified 2353
429 Ga0207645_10640720 3300025907 Unclassified 722
430 Ga0207645_10856567 3300025907 Bacteria 618
431 Ga0207643_10884818 3300025908 Bacteria 579
432 Ga0207684_10177228 3300025910 Unclassified 1838
433 Ga0207654_10094646 3300025911 Bacteria 1828
434 Ga0207654_10213117 3300025911 Bacteria 1277
435 Ga0207654_10242720 3300025911 Bacteria 1204
436 Ga0207654_10371269 3300025911 Bacteria 989
437 Ga0207654_10389690 3300025911 Bacteria 967
438 Ga0207707_10131605 3300025912 Bacteria 2188
439 Ga0207707_10510635 3300025912 Bacteria 1024
440 Ga0207707_11193069 3300025912 Bacteria 616
441 Ga0207695_10195015 3300025913 Bacteria 1941
442 Ga0207695_10984169 3300025913 Unclassified 723
443 Ga0207695_11056227 3300025913 Bacteria 692
444 Ga0207671_10370037 3300025914 Unclassified 1138
445 Ga0207660_10252802 3300025917 Bacteria 1391
446 Ga0207649_10247675 3300025920 Bacteria 1282
447 Ga0207649_10391053 3300025920 Bacteria 1038
448 Ga0207652_10410414 3300025921 Bacteria 1222
449 Ga0207646_10033887 3300025922 Bacteria 4615
450 Ga0207646_10542032 3300025922 Unclassified 1047
451 Ga0207646_10581975 3300025922 Bacteria 1005
452 Ga0207681_10131564 3300025923 Bacteria 1851
453 Ga0207681_10207671 3300025923 Bacteria 1507
454 Ga0207681_11465193 3300025923 Unclassified 573
455 Ga0207694_10085544 3300025924 Bacteria 2482
456 Ga0207694_10485918 3300025924 Bacteria 1033
457 Ga0207650_10019210 3300025925 Bacteria 4799
458 Ga0207650_10053843 3300025925 Unclassified 2983
459 Ga0207650_10080579 3300025925 Unclassified 2468
460 Ga0207650_10144700 3300025925 Unclassified 1871
461 Ga0207650_10398360 3300025925 Bacteria 1139
462 Ga0207650_10792948 3300025925 Bacteria 803
463 Ga0207650_11476129 3300025925 Bacteria 578
464 Ga0207659_10049027 3300025926 Bacteria 2994
465 Ga0207659_10850922 3300025926 Unclassified 784
466 Ga0207687_10012665 3300025927 Bacteria 5511
467 Ga0207687_10153159 3300025927 Bacteria 1761
468 Ga0207687_10325980 3300025927 Unclassified 1244
469 Ga0207644_10035812 3300025931 Bacteria 3480
470 Ga0207644_10219381 3300025931 Bacteria 1507
471 Ga0207644_10323950 3300025931 Bacteria 1246
472 Ga0207690_10761504 3300025932 Bacteria 799
473 Ga0207706_10087051 3300025933 Unclassified 2746
474 Ga0207706_10784823 3300025933 Bacteria 810
475 Ga0207706_10856895 3300025933 Unclassified 769
476 Ga0207686_10002732 3300025934 Bacteria 9562
477 Ga0207686_10085321 3300025934 Bacteria 2071
478 Ga0207686_10091839 3300025934 Bacteria 2006
479 Ga0207709_10104665 3300025935 Bacteria 1879
480 Ga0207709_10163948 3300025935 Bacteria 1553
481 Ga0207709_10589716 3300025935 Bacteria 879
482 Ga0207670_10017537 3300025936 Bacteria 4329
483 Ga0207670_10059695 3300025936 Bacteria 2595
484 Ga0207670_11607525 3300025936 Viruses 553
485 Ga0207669_11004598 3300025937 Bacteria 701
486 Ga0207704_10079714 3300025938 Bacteria 2111
487 Ga0207704_10290733 3300025938 Bacteria 1247
488 Ga0207691_10021460 3300025940 Bacteria 6097
489 Ga0207691_10248005 3300025940 Bacteria 1538
490 Ga0207691_10290018 3300025940 Bacteria 1407
491 Ga0207691_10379426 3300025940 Bacteria 1207
492 Ga0207691_10579027 3300025940 Bacteria 951
493 Ga0207711_10004193 3300025941 Bacteria 12342
494 Ga0207711_10006657 3300025941 Bacteria 9729
495 Ga0207711_10076160 3300025941 Unclassified 2921
496 Ga0207711_11390131 3300025941 Unclassified 644
497 Ga0207689_10060802 3300025942 Bacteria 3107
498 Ga0207689_10176976 3300025942 Bacteria 1759
499 Ga0207689_10354938 3300025942 Bacteria 1219
500 Ga0207689_10518006 3300025942 Bacteria 1000
501 Ga0207661_10418764 3300025944 Bacteria 1216
502 Ga0207679_10018522 3300025945 Bacteria 4667
503 Ga0207679_10061630 3300025945 Bacteria 2793
504 Ga0207679_10146993 3300025945 Bacteria 1913
505 Ga0207679_10187472 3300025945 Bacteria 1716
506 Ga0207679_10194880 3300025945 Bacteria 1688
507 Ga0207667_10278298 3300025949 Unclassified 1710
508 Ga0207651_10009816 3300025960 Bacteria 5267
509 Ga0207651_10035627 3300025960 Bacteria 3239
510 Ga0207651_10069277 3300025960 Unclassified 2490
511 Ga0207651_10366832 3300025960 Bacteria 1217
512 Ga0207651_10583219 3300025960 Bacteria 976
513 Ga0207651_10672841 3300025960 Unclassified 910
514 Ga0207651_10992845 3300025960 Bacteria 750
515 Ga0207712_10008554 3300025961 Bacteria 6471
516 Ga0207712_10155016 3300025961 Bacteria 1773
517 Ga0207712_10451543 3300025961 Bacteria 1090
518 Ga0207668_10119569 3300025972 Unclassified 1992
519 Ga0207640_10532947 3300025981 Bacteria 983
520 Ga0207658_10095418 3300025986 Bacteria 2317
521 Ga0207658_10111846 3300025986 Unclassified 2160
522 Ga0207677_10059741 3300026023 Bacteria 2631
523 Ga0207677_10396175 3300026023 Bacteria 1170
524 Ga0207703_10000601 3300026035 Bacteria 36559
525 Ga0207703_10003386 3300026035 Bacteria 13388
526 Ga0207703_10007165 3300026035 Bacteria 8871
527 Ga0207703_10043975 3300026035 Bacteria 3587
528 Ga0207703_10080875 3300026035 Bacteria 2707
529 Ga0207703_10111175 3300026035 Unclassified 2338
530 Ga0207703_10349519 3300026035 Bacteria 1361
531 Ga0207703_10526108 3300026035 Bacteria 1113
532 Ga0207703_10864146 3300026035 Bacteria 865
533 Ga0207639_10242095 3300026041 Bacteria 1569
534 Ga0207639_11018091 3300026041 Bacteria 776
535 Ga0207678_10654099 3300026067 Bacteria 923
536 Ga0207708_10003525 3300026075 Bacteria 11528
537 Ga0207708_10058377 3300026075 Unclassified 2944
538 Ga0207702_10432504 3300026078 Bacteria 1274
539 Ga0207641_10044187 3300026088 Bacteria 3746
540 Ga0207641_10097202 3300026088 Bacteria 2588
541 Ga0207641_10674581 3300026088 Bacteria 1016
542 Ga0207641_10846834 3300026088 Unclassified 906
543 Ga0207641_10970012 3300026088 Bacteria 846
544 Ga0207641_11707946 3300026088 Unclassified 631
545 Ga0207648_10051149 3300026089 Bacteria 3611
546 Ga0207648_10079721 3300026089 Bacteria 2856
547 Ga0207648_10833317 3300026089 Unclassified 860
548 Ga0207648_11311688 3300026089 Bacteria 680
549 Ga0207676_10001144 3300026095 Bacteria 19991
550 Ga0207676_10034819 3300026095 Bacteria 3815
551 Ga0207676_10053202 3300026095 Bacteria 3168
552 Ga0207676_10074156 3300026095 Unclassified 2740
553 Ga0207676_10083064 3300026095 Bacteria 2607
554 Ga0207676_10194974 3300026095 Bacteria 1785
555 Ga0207676_10611334 3300026095 Bacteria 1048
556 Ga0207676_11826696 3300026095 Bacteria 606
557 Ga0207674_10712270 3300026116 Bacteria 969
558 Ga0207675_100024155 3300026118 Bacteria 5651
559 Ga0207675_100027018 3300026118 Bacteria 5344
560 Ga0207675_100027936 3300026118 Bacteria 5254
561 Ga0207675_100090805 3300026118 Unclassified 2872
562 Ga0207675_100749863 3300026118 Bacteria 988
563 Ga0207675_100879073 3300026118 Bacteria 912
564 Ga0207675_101475941 3300026118 Bacteria 701
565 Ga0207675_102051966 3300026118 Bacteria 589
566 Ga0207683_10378909 3300026121 Bacteria 1300
567 Ga0207683_11453795 3300026121 Bacteria 633
568 Ga0207698_10031691 3300026142 Bacteria 3820
569 Ga0207698_10049237 3300026142 Bacteria 3206
570 Ga0207698_10316047 3300026142 Bacteria 1461
571 Ga0207698_10342532 3300026142 Bacteria 1409
572 Ga0207428_10002218 3300027907 Bacteria 19493
573 Ga0207428_10568409 3300027907 Bacteria 819
574 Ga0268266_10000019 3300028379 Bacteria 556465
575 Ga0268266_10031992 3300028379 Bacteria 4470
576 Ga0268265_10338949 3300028380 Bacteria 1368
577 Ga0268264_10019695 3300028381 Bacteria 5512
578 Ga0268264_10085525 3300028381 Bacteria 2707
579 Ga0268264_10127293 3300028381 Bacteria 2253
580 Ga0268264_10995914 3300028381 Bacteria 844
581 Ga0265318_10004703 3300028577 Bacteria 6548
582 Ga0307517_10004922 3300028786 Bacteria 20357
583 Ga0307517_10064807 3300028786 Bacteria 3391
584 Ga0307517_10221631 3300028786 Bacteria 1149
585 Ga0307515_10025310 3300028794 Bacteria 10277
586 Ga0307515_10160591 3300028794 Bacteria 2294
587 Ga0307512_10244797 3300030522 Bacteria 902
588 Ga0314311_1202169 3300030733 Bacteria 3204
589 Ga0316178_1063384 3300030735 Bacteria 2063
590 Ga0307513_10197669 3300031456 Bacteria 1855
591 Ga0307513_10329799 3300031456 Unclassified 1281
592 Ga0307513_10698862 3300031456 Bacteria 720
593 Ga0307509_10099786 3300031507 Bacteria 2944
594 Ga0307408_100281127 3300031548 Bacteria 1386
595 Ga0265313_10024087 3300031595 Bacteria 3260
596 Ga0307508_10001461 3300031616 Bacteria 26492
597 Ga0307508_10235936 3300031616 Bacteria 1427
598 Ga0307413_10852878 3300031824 Bacteria 770
599 Ga0307406_11698466 3300031901 Bacteria 559
600 Ga0307407_10226502 3300031903 Bacteria 1267
601 Ga0307416_102363145 3300032002 Unclassified 631
602 Ga0307411_10095974 3300032005 Bacteria 2083
603 Ga0316588_1005801 3300033528 Archaea 2431
604 Ga0373951_0010188 3300035091 Bacteria 2110
605 Ga0373955_0267385 3300035172 Bacteria 1027
606 Ga0373933_0691823 3300035724 Unclassified 670
607 Ga0395900_0366567 3300037418 Bacteria 1411
608 Ga0395898_1424865 3300037466 Bacteria 620
609 Ga0395905_0119273 3300037471 Bacteria 2479
610 Ga0242422_00030 3300038699 Bacteria 5467
611 Ga0242420_001615 3300038996 Unclassified 3052
612 Ga0436365_1337852 3300039437 Bacteria 17594
613 Ga0436363_0136866 3300039450 Bacteria 806
614 Ga0439453_0034934 3300041408 Bacteria 967
615 Ga0439449_0007120 3300042007 Bacteria 4257
616 Ga0439462_0016909 3300042015 Bacteria 1888
617 Ga0439435_0027473 3300042436 Bacteria 1523
618 Ga0439459_0021464 3300042438 Bacteria 1240
619 Ga0451577_0124136 3300042876 Bacteria 2313
620 Ga0439440_0032114 3300042993 Bacteria 1245
621 Ga0453684_0123612 3300044712 Bacteria 3119
622 Ga0451576_0142094 3300045051 Unclassified 2503
623 Ga0451576_0172877 3300045051 Unclassified 2255
624 Ga0451576_0331855 3300045051 Bacteria 1592
625 Ga0495603_0242384 3300046455 Bacteria 1038
626 Ga0495590_0000646 3300046457 Bacteria 16170
627 Ga0495590_0164459 3300046457 Bacteria 807
628 Ga0495638_0026825 3300046460 Bacteria 3732
629 Ga0495651_0928089 3300046462 Bacteria 531
630 Ga0495653_0014403 3300046463 Bacteria 6452
631 Ga0495580_0053592 3300046472 Bacteria 2846
632 Ga0495580_0082119 3300046472 Bacteria 2246
633 Ga0495605_0061696 3300046474 Bacteria 1793
634 Ga0495584_0000095 3300046491 Bacteria 60048
635 Ga0495585_0000428 3300046492 Bacteria 40340
636 Ga0495585_0007809 3300046492 Bacteria 6513
637 Ga0495596_0003769 3300046500 Bacteria 7566
638 Ga0495607_0163268 3300046501 Bacteria 1130
639 Ga0495583_0000620 3300046506 Bacteria 47709
640 Ga0495583_0007506 3300046506 Bacteria 6830
641 Ga0495616_0000052 3300046513 Bacteria 105258
642 Ga0495616_0000447 3300046513 Bacteria 31451
643 Ga0495616_0001194 3300046513 Bacteria 18313
644 Ga0495632_0000082 3300046519 Bacteria 97726
645 Ga0495632_0132721 3300046519 Bacteria 1158
646 Ga0495632_0165107 3300046519 Bacteria 1018
647 Ga0495637_0230618 3300046520 Bacteria 671
648 Ga0495643_0000079 3300046522 Bacteria 162735
649 Ga0495648_0000774 3300046524 Bacteria 34103
650 Ga0495642_0122561 3300046528 Bacteria 1116
651 Ga0495642_0453983 3300046528 Unclassified 566
652 Ga0495654_0142333 3300046530 Bacteria 1068
653 Ga0495609_0024437 3300046538 Bacteria 2772
654 Ga0495609_0294846 3300046538 Unclassified 661
655 Ga0495621_0146152 3300046539 Bacteria 928
656 Ga0495597_0068321 3300046542 Bacteria 1536
657 Ga0495633_0000640 3300046558 Bacteria 32688
658 Ga0495668_0006667 3300046616 Bacteria 7520
659 Ga0495625_0026470 3300046660 Bacteria 4383
660 Ga0495625_0039775 3300046660 Bacteria 3432
661 Ga0495625_0084504 3300046660 Bacteria 2204
662 Ga0495625_0132540 3300046660 Bacteria 1687
663 Ga0495625_0164908 3300046660 Bacteria 1482
664 Ga0495625_0457777 3300046660 Bacteria 787
665 Ga0495661_0034421 3300046665 Bacteria 3188
666 Ga0495658_0051899 3300046683 Unclassified 2324
667 Ga0495670_0023487 3300046691 Bacteria 3043
668 Ga0495649_0001576 3300046694 Bacteria 17070
669 Ga0495589_0526790 3300046794 Unclassified 539
670 Ga0495660_0006120 3300046810 Bacteria 7144
671 Ga0495660_0017469 3300046810 Bacteria 4129
672 Ga0495680_0315989 3300047322 Bacteria 1094
673 Ga0495683_0000157 3300047323 Bacteria 66884
674 Ga0495683_0016588 3300047323 Bacteria 3824
675 Ga0495687_000187 3300047443 Bacteria 90147
676 Ga0495679_008567 3300047446 Bacteria 4146
677 Ga0495673_0003872 3300047469 Bacteria 9636
678 Ga0495593_0117580 3300047673 Bacteria 1354
679 Ga0495602_0008918 3300048088 Bacteria 10456
680 Ga0495626_0047699 3300048091 Bacteria 1990
681 Ga0495626_0163821 3300048091 Unclassified 931
682 Ga0496100_0076667 3300048903 Bacteria 2245
683 Ga0496101_0034270 3300048904 Bacteria 3585
684 Ga0496101_0667122 3300048904 Bacteria 821
685 Ga0496102_0004345 3300048905 Bacteria 11980
686 Ga0496104_0006833 3300048907 Bacteria 10054
687 Ga0496104_0019564 3300048907 Bacteria 6198
688 Ga0496104_0114200 3300048907 Bacteria 2590
689 Ga0496104_1261294 3300048907 Bacteria 642
690 Ga0496105_0187045 3300048908 Unclassified 1695
691 Ga0496106_0010643 3300048909 Bacteria 6797
692 Ga0496106_0012662 3300048909 Bacteria 6232
693 Ga0496106_0029673 3300048909 Unclassified 4078
694 Ga0496107_0508336 3300048910 Bacteria 893
695 Ga0496107_0919245 3300048910 Unclassified 637
696 Ga0496108_0002232 3300048911 Bacteria 15524
697 Ga0496108_0006449 3300048911 Bacteria 9510
698 Ga0496108_0034344 3300048911 Unclassified 4214
699 Ga0496108_0752787 3300048911 Unclassified 843
700 Ga0496109_0015121 3300048912 Bacteria 6717
701 Ga0496109_0104250 3300048912 Bacteria 2633
702 Ga0496110_0000753 3300048913 Bacteria 22414
703 Ga0496110_0005940 3300048913 Bacteria 9609
704 Ga0496110_0014596 3300048913 Bacteria 6527
705 Ga0496110_0798857 3300048913 Bacteria 848
706 Ga0496110_1117781 3300048913 Bacteria 696
707 Ga0496112_0000842 3300048915 Bacteria 21887
708 Ga0496112_0011469 3300048915 Bacteria 8094
709 Ga0496112_0044731 3300048915 Bacteria 4339
710 Ga0496112_0488317 3300048915 Unclassified 1168
711 Ga0496113_0022989 3300048916 Bacteria 4418
712 Ga0496114_0282651 3300048917 Bacteria 1463
713 Ga0496115_0011104 3300048918 Bacteria 6749
714 Ga0496116_0019997 3300048919 Bacteria 5101
715 Ga0496121_0428193 3300048924 Bacteria 859
716 Ga0496122_0028361 3300048925 Bacteria 4753
717 Ga0496122_0290019 3300048925 Bacteria 889
718 Ga0496123_0145087 3300048926 Bacteria 1291
719 Ga0496124_0026185 3300048927 Bacteria 5265
720 Ga0496124_0143649 3300048927 Bacteria 1880
721 Ga0496125_0000220 3300048928 Bacteria 116658
722 Ga0496126_0079815 3300048929 Bacteria 2896
723 Ga0496126_1345879 3300048929 Bacteria 518
724 Ga0495678_000102 3300049459 Bacteria 104107
725 Ga0495682_0008455 3300049460 Bacteria 4054
726 Ga0501031_0003222 3300049568 Bacteria 10479
727 Ga0501032_0183046 3300049569 Bacteria 1371
728 Ga0501033_0034215 3300049570 Bacteria 3813
729 Ga0501036_0013733 3300049572 Bacteria 6733
730 Ga0501037_0045053 3300049573 Bacteria 3238
731 Ga0501038_0002779 3300049574 Bacteria 16282
732 Ga0501039_0004728 3300049575 Bacteria 10309
733 Ga0501039_0687517 3300049575 Bacteria 800
734 Ga0501040_0003596 3300049576 Bacteria 10025
735 Ga0501041_0001971 3300049577 Bacteria 11543
736 Ga0501042_0005861 3300049578 Bacteria 7940
737 Ga0501042_0436467 3300049578 Bacteria 949
738 Ga0501042_0883087 3300049578 Bacteria 651
739 Ga0501042_1112942 3300049578 Unclassified 576
740 Ga0501043_0024564 3300049579 Bacteria 4729
741 Ga0501046_0007376 3300049580 Bacteria 9671
742 Ga0501046_1252100 3300049580 Bacteria 508
743 Ga0501048_0001573 3300049582 Bacteria 17350
744 Ga0501048_0906655 3300049582 Unclassified 634
745 Ga0501071_0000078 3300049587 Bacteria 34978
746 Ga0501072_0001519 3300049588 Bacteria 17373
747 Ga0501073_0163667 3300049589 Bacteria 1541
748 Ga0501074_0006511 3300049590 Bacteria 8431
749 Ga0501075_0013392 3300049591 Bacteria 5853
750 Ga0501076_0007831 3300049592 Bacteria 7785
751 Ga0501077_0000219 3300049593 Bacteria 33570
752 Ga0501227_198553 3300049665 Unclassified 568
753 Ga0501249_003389 3300049679 Bacteria 3197
754 Ga0501079_0000213 3300049741 Bacteria 34053
755 Ga0501079_0584631 3300049741 Bacteria 879
756 Ga0501080_0179110 3300049742 Bacteria 1951
757 Ga0501081_0081832 3300049743 Bacteria 2261
758 Ga0501083_0002560 3300049744 Bacteria 12495
759 Ga0501035_0013752 3300049822 Bacteria 7471
760 Ga0501044_0211462 3300049823 Bacteria 1894
761 Ga0501045_0000197 3300049824 Bacteria 34275
762 Ga0501045_0177739 3300049824 Bacteria 1586
763 Ga0501045_0544803 3300049824 Bacteria 861
764 nmdc:mga03n38_1501_c1 3300050490 Bacteria 3688
765 nmdc:mga07m45_365696_c1 3300050496 Bacteria 838
766 nmdc:mga05p37_1552306_c1 3300050507 Bacteria 656
767 nmdc:mga05p37_246970_c1 3300050507 Unclassified 2142
768 nmdc:mga05p37_425178_c1 3300050507 Bacteria 1545
769 nmdc:mga09592_125810_c1 3300050508 Bacteria 2203
770 nmdc:mga09592_149922_c1 3300050508 Bacteria 2012
771 nmdc:mga09592_342448_c1 3300050508 Bacteria 1294
772 nmdc:mga0qj67_14754_c1 3300050509 Bacteria 5906
773 nmdc:mga0qj67_65342_c1 3300050509 Unclassified 2896
774 nmdc:mga06r32_114677_c1 3300050510 Bacteria 2653
775 nmdc:mga06r32_133702_c1 3300050510 Bacteria 2454
776 nmdc:mga06r32_39519_c1 3300050510 Bacteria 4477
777 nmdc:mga06r32_52810_c1 3300050510 Unclassified 3893
778 nmdc:mga06r32_848192_c1 3300050510 Bacteria 872
779 nmdc:mga08y16_124873_c1 3300050511 Bacteria 2677
780 nmdc:mga08y16_1629977_c1 3300050511 Bacteria 602
781 nmdc:mga08y16_236228_c1 3300050511 Bacteria 1890
782 nmdc:mga08y16_371_c1 3300050511 Bacteria 40737
783 nmdc:mga0n895_1398660_c1 3300050512 Unclassified 668
784 nmdc:mga0n895_789211_c1 3300050512 Bacteria 941
785 nmdc:mga0n895_805168_c1 3300050512 Bacteria 930
786 nmdc:mga0a205_19971_c1 3300050515 Bacteria 6321
787 Ga0495655_0000033 3300053083 Bacteria 29905
788 Ga0500568_0003238 3300053139 Bacteria 9207
789 Ga0500568_0033636 3300053139 Bacteria 2102
790 Ga0501084_0000612 3300054114 Bacteria 27182
791 Ga0501084_0008906 3300054114 Bacteria 8304
792 Ga0501084_1367790 3300054114 Bacteria 593
793 Ga0587084_059589 3300059477 Bacteria 697
794 Ga0501082_0001948 3300060353 Bacteria 18166
795 Ga0530510_0003941 3300061734 Bacteria 10235
796 Ga0530510_0278976 3300061734 Bacteria 1248

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_101401778 Ga0068867_1014017781 129
2 3300026089 Ga0207648_11311688 Ga0207648_113116882 129
3 3300006880 Ga0075429_100669920 Ga0075429_1006699202 130
4 3300050508 nmdc:mga09592_342448_c1 nmdc:mga09592_342448_c1_681_1115 130
5 3300005354 Ga0070675_100495886 Ga0070675_1004958862 131
6 3300048907 Ga0496104_1261294 Ga0496104_1261294_139_588 131
7 3300005444 Ga0070694_100190914 Ga0070694_1001909141 134
8 3300005549 Ga0070704_101983031 Ga0070704_1019830311 134
9 3300009094 Ga0111539_10478413 Ga0111539_104784132 134
10 3300009147 Ga0114129_12490769 Ga0114129_124907691 134
11 3300009553 Ga0105249_10567886 Ga0105249_105678862 134
12 3300009553 Ga0105249_12167345 Ga0105249_121673451 134
13 3300017792 Ga0163161_10139738 Ga0163161_101397382 134
14 3300025961 Ga0207712_10451543 Ga0207712_104515433 134
15 3300046474 Ga0495605_0061696 Ga0495605_0061696_126_530 134
16 3300005337 Ga0070682_101462485 Ga0070682_1014624852 136
17 3300005546 Ga0070696_101208066 Ga0070696_1012080662 137
18 3300009036 Ga0105244_10043206 Ga0105244_100432062 137
19 3300025728 Ga0207655_1065067 Ga0207655_10650672 137
20 3300031824 Ga0307413_10852878 Ga0307413_108528782 137
21 3300046462 Ga0495651_0928089 Ga0495651_0928089_47_493 137
22 3300005334 Ga0068869_100025548 Ga0068869_1000255486 138
23 3300007076 Ga0075435_100418927 Ga0075435_1004189273 138
24 3300009098 Ga0105245_10095267 Ga0105245_100952672 138
25 3300009176 Ga0105242_10005795 Ga0105242_100057959 138
26 3300013306 Ga0163162_10151649 Ga0163162_101516495 138
27 3300025927 Ga0207687_10153159 Ga0207687_101531592 138
28 3300025934 Ga0207686_10002732 Ga0207686_100027326 138
29 3300025942 Ga0207689_10060802 Ga0207689_100608026 138
30 3300046522 Ga0495643_0000079 Ga0495643_0000079_114224_114667 138
31 3300049578 Ga0501042_0436467 Ga0501042_0436467_355_789 138
32 3300049679 Ga0501249_003389 Ga0501249_003389_1166_1609 138
33 3300005345 Ga0070692_10419773 Ga0070692_104197731 139
34 3300005440 Ga0070705_101139255 Ga0070705_1011392552 139
35 3300005546 Ga0070696_101048010 Ga0070696_1010480101 139
36 3300005578 Ga0068854_100143907 Ga0068854_1001439074 139
37 3300005615 Ga0070702_100190815 Ga0070702_1001908152 139
38 3300009147 Ga0114129_10116337 Ga0114129_101163372 139
39 3300009147 Ga0114129_11691241 Ga0114129_116912412 139
40 3300025942 Ga0207689_10518006 Ga0207689_105180062 139
41 3300050507 nmdc:mga05p37_1552306_c1 nmdc:mga05p37_1552306_c1_99_542 139
42 3300003771 Ga0055526_1000001 Ga0055526_1000001121 140
43 3300005981 Ga0081538_10013855 Ga0081538_100138555 140
44 3300006847 Ga0075431_100033343 Ga0075431_1000333432 140
45 3300025295 Ga0209564_1000002 Ga0209564_1000002444 140
46 3300042876 Ga0451577_0124136 Ga0451577_0124136_215_658 140
47 3300044712 Ga0453684_0123612 Ga0453684_0123612_256_699 140
48 3300050510 nmdc:mga06r32_133702_c1 nmdc:mga06r32_133702_c1_1750_2193 140
49 iso_pu_bacteria 2857472729 2857478133 140
50 iso_pu_bacteria 2865002811 2865005470 140
51 iso_pu_bacteria 8002317523 8002319669 140
52 iso_pu_bacteria 8046991243 8046998562 140
53 iso_pu_bacteria 8054795415 8054796463 140
54 2162886007 SwRhRL2b_contig_3005271 SwRhRL2b_0915.00008020 141
55 3300005288 Ga0065714_10193689 Ga0065714_101936892 141
56 3300005289 Ga0065704_10328536 Ga0065704_103285362 141
57 3300005289 Ga0065704_10334449 Ga0065704_103344491 141
58 3300005290 Ga0065712_10003972 Ga0065712_100039724 141
59 3300005293 Ga0065715_10091491 Ga0065715_100914918 141
60 3300005295 Ga0065707_10141047 Ga0065707_101410472 141
61 3300005295 Ga0065707_10307784 Ga0065707_103077841 141
62 3300005330 Ga0070690_100117157 Ga0070690_1001171572 141
63 3300005331 Ga0070670_100064761 Ga0070670_1000647613 141
64 3300005331 Ga0070670_100473024 Ga0070670_1004730241 141
65 3300005340 Ga0070689_100225668 Ga0070689_1002256682 141
66 3300005343 Ga0070687_100175777 Ga0070687_1001757772 141
67 3300005354 Ga0070675_100419559 Ga0070675_1004195592 141
68 3300005365 Ga0070688_100358533 Ga0070688_1003585331 141
69 3300005366 Ga0070659_100870743 Ga0070659_1008707432 141
70 3300005438 Ga0070701_10013835 Ga0070701_100138355 141
71 3300005471 Ga0070698_100002168 Ga0070698_1000021687 141
72 3300005543 Ga0070672_101172514 Ga0070672_1011725141 141
73 3300005545 Ga0070695_100019038 Ga0070695_1000190383 141
74 3300005545 Ga0070695_100123890 Ga0070695_1001238902 141
75 3300005547 Ga0070693_100134923 Ga0070693_1001349234 141
76 3300005548 Ga0070665_101140354 Ga0070665_1011403542 141
77 3300005616 Ga0068852_102140237 Ga0068852_1021402372 141
78 3300005617 Ga0068859_100028784 Ga0068859_1000287849 141
79 3300005618 Ga0068864_100000481 Ga0068864_10000048116 141
80 3300005618 Ga0068864_100633147 Ga0068864_1006331472 141
81 3300005719 Ga0068861_102081321 Ga0068861_1020813211 141
82 3300005834 Ga0068851_10072702 Ga0068851_100727022 141
83 3300005840 Ga0068870_10883197 Ga0068870_108831972 141
84 3300005842 Ga0068858_100009884 Ga0068858_1000098849 141
85 3300005843 Ga0068860_100039803 Ga0068860_1000398036 141
86 3300005844 Ga0068862_101409704 Ga0068862_1014097042 141
87 3300006852 Ga0075433_10223889 Ga0075433_102238891 141
88 3300006931 Ga0097620_100028784 Ga0097620_1000287842 141
89 3300009094 Ga0111539_10001077 Ga0111539_1000107710 141
90 3300009101 Ga0105247_10000273 Ga0105247_1000027313 141
91 3300009147 Ga0114129_10118185 Ga0114129_101181855 141
92 3300009177 Ga0105248_10315964 Ga0105248_103159644 141
93 3300009545 Ga0105237_10056495 Ga0105237_100564952 141
94 3300009553 Ga0105249_13220114 Ga0105249_132201142 141
95 3300011119 Ga0105246_10027855 Ga0105246_100278552 141
96 3300013306 Ga0163162_10220355 Ga0163162_102203552 141
97 3300013307 Ga0157372_10541770 Ga0157372_105417701 141
98 3300014325 Ga0163163_11290125 Ga0163163_112901252 141
99 3300014325 Ga0163163_11370270 Ga0163163_113702702 141
100 3300025900 Ga0207710_10000267 Ga0207710_1000026713 141
101 3300025925 Ga0207650_10080579 Ga0207650_100805793 141
102 3300025925 Ga0207650_10398360 Ga0207650_103983602 141
103 3300025932 Ga0207690_10761504 Ga0207690_107615042 141
104 3300025933 Ga0207706_10784823 Ga0207706_107848231 141
105 3300025935 Ga0207709_10589716 Ga0207709_105897162 141
106 3300025936 Ga0207670_11607525 Ga0207670_116075251 141
107 3300025940 Ga0207691_10248005 Ga0207691_102480052 141
108 3300026035 Ga0207703_10349519 Ga0207703_103495192 141
109 3300026095 Ga0207676_10001144 Ga0207676_1000114418 141
110 3300026095 Ga0207676_10611334 Ga0207676_106113342 141
111 3300026118 Ga0207675_100749863 Ga0207675_1007498632 141
112 3300027907 Ga0207428_10002218 Ga0207428_1000221810 141
113 3300028381 Ga0268264_10085525 Ga0268264_100855252 141
114 3300028577 Ga0265318_10004703 Ga0265318_100047032 141
115 3300031548 Ga0307408_100281127 Ga0307408_1002811272 141
116 3300031595 Ga0265313_10024087 Ga0265313_100240873 141
117 3300035091 Ga0373951_0010188 Ga0373951_0010188_1566_1991 141
118 3300037418 Ga0395900_0366567 Ga0395900_0366567_247_672 141
119 3300037466 Ga0395898_1424865 Ga0395898_1424865_158_583 141
120 3300041408 Ga0439453_0034934 Ga0439453_0034934_529_954 141
121 3300042436 Ga0439435_0027473 Ga0439435_0027473_322_747 141
122 3300042438 Ga0439459_0021464 Ga0439459_0021464_511_936 141
123 3300042993 Ga0439440_0032114 Ga0439440_0032114_80_505 141
124 3300045051 Ga0451576_0172877 Ga0451576_0172877_1688_2122 141
125 3300046455 Ga0495603_0242384 Ga0495603_0242384_395_820 141
126 3300046528 Ga0495642_0453983 Ga0495642_0453983_49_474 141
127 3300046539 Ga0495621_0146152 Ga0495621_0146152_302_727 141
128 3300050507 nmdc:mga05p37_425178_c1 nmdc:mga05p37_425178_c1_507_932 141
129 3300050511 nmdc:mga08y16_371_c1 nmdc:mga08y16_371_c1_8450_8881 141
130 3300061734 Ga0530510_0278976 Ga0530510_0278976_777_1211 141
131 3300003322 rootL2_10020075 rootL2_100200752 142
132 3300005289 Ga0065704_10714107 Ga0065704_107141071 142
133 3300005290 Ga0065712_10268973 Ga0065712_102689732 142
134 3300005293 Ga0065715_10001891 Ga0065715_100018916 142
135 3300005293 Ga0065715_10318694 Ga0065715_103186942 142
136 3300005293 Ga0065715_11048134 Ga0065715_110481341 142
137 3300005330 Ga0070690_100261937 Ga0070690_1002619373 142
138 3300005330 Ga0070690_100326463 Ga0070690_1003264632 142
139 3300005330 Ga0070690_101170258 Ga0070690_1011702581 142
140 3300005331 Ga0070670_100198931 Ga0070670_1001989312 142
141 3300005334 Ga0068869_101403701 Ga0068869_1014037011 142
142 3300005335 Ga0070666_10015226 Ga0070666_100152263 142
143 3300005338 Ga0068868_100080420 Ga0068868_1000804202 142
144 3300005340 Ga0070689_100664357 Ga0070689_1006643572 142
145 3300005341 Ga0070691_10460067 Ga0070691_104600671 142
146 3300005345 Ga0070692_10061309 Ga0070692_100613094 142
147 3300005345 Ga0070692_10692711 Ga0070692_106927112 142
148 3300005353 Ga0070669_100021146 Ga0070669_1000211465 142
149 3300005354 Ga0070675_100333062 Ga0070675_1003330622 142
150 3300005355 Ga0070671_100164216 Ga0070671_1001642162 142
151 3300005356 Ga0070674_100688019 Ga0070674_1006880191 142
152 3300005364 Ga0070673_100082756 Ga0070673_1000827562 142
153 3300005366 Ga0070659_100311764 Ga0070659_1003117644 142
154 3300005367 Ga0070667_100097205 Ga0070667_1000972053 142
155 3300005406 Ga0070703_10000109 Ga0070703_100001092 142
156 3300005438 Ga0070701_10332859 Ga0070701_103328592 142
157 3300005439 Ga0070711_101505641 Ga0070711_1015056411 142
158 3300005440 Ga0070705_100521061 Ga0070705_1005210612 142
159 3300005441 Ga0070700_100030838 Ga0070700_1000308384 142
160 3300005444 Ga0070694_100534020 Ga0070694_1005340201 142
161 3300005445 Ga0070708_100048652 Ga0070708_1000486524 142
162 3300005457 Ga0070662_101232072 Ga0070662_1012320722 142
163 3300005459 Ga0068867_100051885 Ga0068867_1000518853 142
164 3300005459 Ga0068867_100061946 Ga0068867_1000619463 142
165 3300005466 Ga0070685_10370529 Ga0070685_103705292 142
166 3300005467 Ga0070706_100084939 Ga0070706_1000849392 142
167 3300005468 Ga0070707_100950918 Ga0070707_1009509181 142
168 3300005471 Ga0070698_100066293 Ga0070698_1000662933 142
169 3300005471 Ga0070698_100422670 Ga0070698_1004226701 142
170 3300005518 Ga0070699_100097247 Ga0070699_1000972474 142
171 3300005518 Ga0070699_100105456 Ga0070699_1001054562 142
172 3300005535 Ga0070684_101657087 Ga0070684_1016570871 142
173 3300005536 Ga0070697_100235312 Ga0070697_1002353122 142
174 3300005536 Ga0070697_100255869 Ga0070697_1002558694 142
175 3300005539 Ga0068853_100398291 Ga0068853_1003982911 142
176 3300005544 Ga0070686_100701560 Ga0070686_1007015601 142
177 3300005546 Ga0070696_100128334 Ga0070696_1001283341 142
178 3300005547 Ga0070693_100714658 Ga0070693_1007146582 142
179 3300005548 Ga0070665_100684853 Ga0070665_1006848532 142
180 3300005564 Ga0070664_100043844 Ga0070664_1000438443 142
181 3300005577 Ga0068857_101131452 Ga0068857_1011314522 142
182 3300005578 Ga0068854_100334341 Ga0068854_1003343412 142
183 3300005578 Ga0068854_100462277 Ga0068854_1004622772 142
184 3300005578 Ga0068854_100535946 Ga0068854_1005359462 142
185 3300005614 Ga0068856_100376830 Ga0068856_1003768302 142
186 3300005616 Ga0068852_100366708 Ga0068852_1003667082 142
187 3300005616 Ga0068852_101008758 Ga0068852_1010087582 142
188 3300005617 Ga0068859_100056239 Ga0068859_1000562393 142
189 3300005617 Ga0068859_100169870 Ga0068859_1001698704 142
190 3300005617 Ga0068859_102133441 Ga0068859_1021334411 142
191 3300005618 Ga0068864_100018567 Ga0068864_1000185672 142
192 3300005618 Ga0068864_100042855 Ga0068864_1000428552 142
193 3300005618 Ga0068864_100683362 Ga0068864_1006833622 142
194 3300005618 Ga0068864_101026832 Ga0068864_1010268322 142
195 3300005718 Ga0068866_10357681 Ga0068866_103576812 142
196 3300005719 Ga0068861_100017766 Ga0068861_1000177664 142
197 3300005719 Ga0068861_100070833 Ga0068861_1000708332 142
198 3300005834 Ga0068851_10109206 Ga0068851_101092062 142
199 3300005840 Ga0068870_10193769 Ga0068870_101937692 142
200 3300005840 Ga0068870_10878616 Ga0068870_108786162 142
201 3300005841 Ga0068863_100257659 Ga0068863_1002576594 142
202 3300005841 Ga0068863_101881912 Ga0068863_1018819122 142
203 3300005842 Ga0068858_100021480 Ga0068858_1000214804 142
204 3300005842 Ga0068858_100036806 Ga0068858_1000368066 142
205 3300005842 Ga0068858_100066563 Ga0068858_1000665632 142
206 3300005843 Ga0068860_100219183 Ga0068860_1002191832 142
207 3300005843 Ga0068860_100505424 Ga0068860_1005054242 142
208 3300005844 Ga0068862_100227281 Ga0068862_1002272812 142
209 3300006358 Ga0068871_100634676 Ga0068871_1006346762 142
210 3300006846 Ga0075430_100018478 Ga0075430_1000184785 142
211 3300006846 Ga0075430_100111101 Ga0075430_1001111012 142
212 3300006847 Ga0075431_100045805 Ga0075431_1000458052 142
213 3300006847 Ga0075431_100068580 Ga0075431_1000685804 142
214 3300006852 Ga0075433_10060594 Ga0075433_100605943 142
215 3300006852 Ga0075433_10332519 Ga0075433_103325192 142
216 3300006880 Ga0075429_100100874 Ga0075429_1001008745 142
217 3300006880 Ga0075429_100130506 Ga0075429_1001305062 142
218 3300006881 Ga0068865_100082062 Ga0068865_1000820622 142
219 3300006881 Ga0068865_100118239 Ga0068865_1001182392 142
220 3300006931 Ga0097620_100056237 Ga0097620_1000562375 142
221 3300006931 Ga0097620_100169876 Ga0097620_1001698764 142
222 3300006931 Ga0097620_102133447 Ga0097620_1021334471 142
223 3300009011 Ga0105251_10391407 Ga0105251_103914072 142
224 3300009093 Ga0105240_11391221 Ga0105240_113912211 142
225 3300009093 Ga0105240_11632713 Ga0105240_116327131 142
226 3300009093 Ga0105240_11717811 Ga0105240_117178112 142
227 3300009094 Ga0111539_10148303 Ga0111539_101483033 142
228 3300009094 Ga0111539_12940322 Ga0111539_129403221 142
229 3300009098 Ga0105245_10297963 Ga0105245_102979632 142
230 3300009098 Ga0105245_10410285 Ga0105245_104102852 142
231 3300009101 Ga0105247_10597367 Ga0105247_105973672 142
232 3300009148 Ga0105243_10211308 Ga0105243_102113083 142
233 3300009148 Ga0105243_10637430 Ga0105243_106374303 142
234 3300009148 Ga0105243_13080245 Ga0105243_130802451 142
235 3300009174 Ga0105241_10299323 Ga0105241_102993232 142
236 3300009176 Ga0105242_10014921 Ga0105242_100149216 142
237 3300009176 Ga0105242_10076851 Ga0105242_100768514 142
238 3300009177 Ga0105248_10072720 Ga0105248_100727204 142
239 3300009177 Ga0105248_10425755 Ga0105248_104257554 142
240 3300009177 Ga0105248_11961257 Ga0105248_119612572 142
241 3300009545 Ga0105237_10401498 Ga0105237_104014982 142
242 3300009545 Ga0105237_10697554 Ga0105237_106975541 142
243 3300009551 Ga0105238_10132532 Ga0105238_101325322 142
244 3300009553 Ga0105249_10097509 Ga0105249_100975092 142
245 3300010375 Ga0105239_10206170 Ga0105239_102061702 142
246 3300010375 Ga0105239_10312333 Ga0105239_103123333 142
247 3300010375 Ga0105239_11123581 Ga0105239_111235812 142
248 3300011119 Ga0105246_10290976 Ga0105246_102909763 142
249 3300013296 Ga0157374_10084783 Ga0157374_100847832 142
250 3300013296 Ga0157374_10213309 Ga0157374_102133092 142
251 3300013296 Ga0157374_11480399 Ga0157374_114803992 142
252 3300013297 Ga0157378_10641930 Ga0157378_106419302 142
253 3300013306 Ga0163162_10011088 Ga0163162_100110887 142
254 3300013306 Ga0163162_10124312 Ga0163162_101243122 142
255 3300013307 Ga0157372_10318342 Ga0157372_103183422 142
256 3300013308 Ga0157375_10011917 Ga0157375_1001191710 142
257 3300013308 Ga0157375_10108149 Ga0157375_101081492 142
258 3300013308 Ga0157375_13111444 Ga0157375_131114441 142
259 3300014325 Ga0163163_10001662 Ga0163163_1000166210 142
260 3300014325 Ga0163163_10061011 Ga0163163_100610116 142
261 3300014325 Ga0163163_10541986 Ga0163163_105419862 142
262 3300014326 Ga0157380_10148731 Ga0157380_101487312 142
263 3300014326 Ga0157380_10217464 Ga0157380_102174642 142
264 3300014745 Ga0157377_10096254 Ga0157377_100962542 142
265 3300014968 Ga0157379_10165294 Ga0157379_101652942 142
266 3300014968 Ga0157379_11935660 Ga0157379_119356601 142
267 3300014969 Ga0157376_10084893 Ga0157376_100848933 142
268 3300014969 Ga0157376_10191032 Ga0157376_101910323 142
269 3300014969 Ga0157376_10967595 Ga0157376_109675952 142
270 3300017792 Ga0163161_10487202 Ga0163161_104872021 142
271 3300017792 Ga0163161_11150767 Ga0163161_111507672 142
272 3300025304 Ga0209257_1083322 Ga0209257_10833222 142
273 3300025321 Ga0207656_10234663 Ga0207656_102346632 142
274 3300025711 Ga0207696_1095900 Ga0207696_10959001 142
275 3300025885 Ga0207653_10000144 Ga0207653_1000014430 142
276 3300025901 Ga0207688_10228492 Ga0207688_102284922 142
277 3300025903 Ga0207680_10008927 Ga0207680_100089273 142
278 3300025904 Ga0207647_10058800 Ga0207647_100588003 142
279 3300025907 Ga0207645_10640720 Ga0207645_106407202 142
280 3300025910 Ga0207684_10177228 Ga0207684_101772283 142
281 3300025911 Ga0207654_10213117 Ga0207654_102131172 142
282 3300025911 Ga0207654_10389690 Ga0207654_103896902 142
283 3300025913 Ga0207695_10984169 Ga0207695_109841692 142
284 3300025913 Ga0207695_11056227 Ga0207695_110562272 142
285 3300025914 Ga0207671_10370037 Ga0207671_103700372 142
286 3300025922 Ga0207646_10581975 Ga0207646_105819751 142
287 3300025923 Ga0207681_10131564 Ga0207681_101315642 142
288 3300025923 Ga0207681_10207671 Ga0207681_102076714 142
289 3300025923 Ga0207681_11465193 Ga0207681_114651931 142
290 3300025924 Ga0207694_10085544 Ga0207694_100855442 142
291 3300025926 Ga0207659_10850922 Ga0207659_108509221 142
292 3300025927 Ga0207687_10325980 Ga0207687_103259802 142
293 3300025931 Ga0207644_10323950 Ga0207644_103239501 142
294 3300025933 Ga0207706_10856895 Ga0207706_108568951 142
295 3300025934 Ga0207686_10085321 Ga0207686_100853212 142
296 3300025934 Ga0207686_10091839 Ga0207686_100918391 142
297 3300025935 Ga0207709_10104665 Ga0207709_101046654 142
298 3300025938 Ga0207704_10079714 Ga0207704_100797142 142
299 3300025941 Ga0207711_10006657 Ga0207711_100066574 142
300 3300025941 Ga0207711_11390131 Ga0207711_113901312 142
301 3300025945 Ga0207679_10061630 Ga0207679_100616304 142
302 3300025949 Ga0207667_10278298 Ga0207667_102782982 142
303 3300025960 Ga0207651_10009816 Ga0207651_100098166 142
304 3300025960 Ga0207651_10035627 Ga0207651_100356273 142
305 3300025960 Ga0207651_10366832 Ga0207651_103668322 142
306 3300025961 Ga0207712_10008554 Ga0207712_100085543 142
307 3300025981 Ga0207640_10532947 Ga0207640_105329472 142
308 3300025986 Ga0207658_10095418 Ga0207658_100954182 142
309 3300026023 Ga0207677_10059741 Ga0207677_100597412 142
310 3300026035 Ga0207703_10043975 Ga0207703_100439756 142
311 3300026035 Ga0207703_10111175 Ga0207703_101111752 142
312 3300026035 Ga0207703_10864146 Ga0207703_108641462 142
313 3300026075 Ga0207708_10003525 Ga0207708_100035256 142
314 3300026075 Ga0207708_10058377 Ga0207708_100583774 142
315 3300026088 Ga0207641_10846834 Ga0207641_108468342 142
316 3300026088 Ga0207641_11707946 Ga0207641_117079461 142
317 3300026089 Ga0207648_10051149 Ga0207648_100511495 142
318 3300026089 Ga0207648_10833317 Ga0207648_108333172 142
319 3300026095 Ga0207676_10053202 Ga0207676_100532022 142
320 3300026095 Ga0207676_10074156 Ga0207676_100741562 142
321 3300026095 Ga0207676_10194974 Ga0207676_101949744 142
322 3300026116 Ga0207674_10712270 Ga0207674_107122702 142
323 3300026118 Ga0207675_100024155 Ga0207675_1000241555 142
324 3300026118 Ga0207675_100090805 Ga0207675_1000908054 142
325 3300026142 Ga0207698_10031691 Ga0207698_100316913 142
326 3300026142 Ga0207698_10316047 Ga0207698_103160473 142
327 3300026142 Ga0207698_10342532 Ga0207698_103425322 142
328 3300028379 Ga0268266_10031992 Ga0268266_100319923 142
329 3300028380 Ga0268265_10338949 Ga0268265_103389492 142
330 3300028381 Ga0268264_10019695 Ga0268264_100196952 142
331 3300028381 Ga0268264_10127293 Ga0268264_101272932 142
332 3300030733 Ga0314311_1202169 Ga0314311_12021693 142
333 3300030735 Ga0316178_1063384 Ga0316178_10633842 142
334 3300035724 Ga0373933_0691823 Ga0373933_0691823_151_579 142
335 3300038699 Ga0242422_00030 Ga0242422_00030_2949_3380 142
336 3300038996 Ga0242420_001615 Ga0242420_001615_865_1296 142
337 3300042015 Ga0439462_0016909 Ga0439462_0016909_396_827 142
338 3300045051 Ga0451576_0142094 Ga0451576_0142094_1813_2244 142
339 3300045051 Ga0451576_0331855 Ga0451576_0331855_402_830 142
340 3300046683 Ga0495658_0051899 Ga0495658_0051899_242_670 142
341 3300048908 Ga0496105_0187045 Ga0496105_0187045_461_889 142
342 3300048909 Ga0496106_0029673 Ga0496106_0029673_3407_3838 142
343 3300048910 Ga0496107_0919245 Ga0496107_0919245_46_477 142
344 3300048911 Ga0496108_0034344 Ga0496108_0034344_3294_3725 142
345 3300048911 Ga0496108_0752787 Ga0496108_0752787_165_593 142
346 3300048913 Ga0496110_0000753 Ga0496110_0000753_19010_19444 142
347 3300048915 Ga0496112_0044731 Ga0496112_0044731_2034_2462 142
348 3300048915 Ga0496112_0488317 Ga0496112_0488317_682_1113 142
349 3300048919 Ga0496116_0019997 Ga0496116_0019997_1363_1797 142
350 3300048924 Ga0496121_0428193 Ga0496121_0428193_90_524 142
351 3300048927 Ga0496124_0026185 Ga0496124_0026185_292_726 142
352 3300049582 Ga0501048_0906655 Ga0501048_0906655_72_500 142
353 3300049824 Ga0501045_0177739 Ga0501045_0177739_824_1252 142
354 3300050508 nmdc:mga09592_125810_c1 nmdc:mga09592_125810_c1_269_700 142
355 3300050508 nmdc:mga09592_149922_c1 nmdc:mga09592_149922_c1_1057_1485 142
356 3300050509 nmdc:mga0qj67_14754_c1 nmdc:mga0qj67_14754_c1_4083_4514 142
357 3300050509 nmdc:mga0qj67_65342_c1 nmdc:mga0qj67_65342_c1_567_995 142
358 3300050510 nmdc:mga06r32_114677_c1 nmdc:mga06r32_114677_c1_1372_1803 142
359 3300050510 nmdc:mga06r32_52810_c1 nmdc:mga06r32_52810_c1_1643_2071 142
360 3300050511 nmdc:mga08y16_124873_c1 nmdc:mga08y16_124873_c1_1115_1543 142
361 3300050511 nmdc:mga08y16_1629977_c1 nmdc:mga08y16_1629977_c1_151_579 142
362 3300050512 nmdc:mga0n895_805168_c1 nmdc:mga0n895_805168_c1_318_746 142
363 3300050515 nmdc:mga0a205_19971_c1 nmdc:mga0a205_19971_c1_2545_2973 142
364 3300059477 Ga0587084_059589 Ga0587084_059589_151_582 142
365 iso_pu_bacteria 2548877040 2550906685 142
366 iso_pu_bacteria 2728368933 2728530758 142
367 iso_pu_bacteria 2938649242 2938652384 142
368 iso_pu_bacteria 2968558590 2968562765 142
369 iso_pu_bacteria 2988225383 2988230663 142
370 iso_pu_bacteria 2996632988 2996638378 142
371 iso_pu_bacteria 8054465665 8054469325 142
372 3300005718 Ga0068866_10308977 Ga0068866_103089772 143
373 3300005719 Ga0068861_100522956 Ga0068861_1005229562 143
374 3300025899 Ga0207642_10193921 Ga0207642_101939211 143
375 3300026118 Ga0207675_101475941 Ga0207675_1014759412 143
376 iso_pu_bacteria 2932784394 2932792742 143
377 3300003322 rootL2_10251231 rootL2_102512312 144
378 3300003354 JGI25160J50197_1033488 JGI25160J50197_10334882 144
379 3300005288 Ga0065714_10281034 Ga0065714_102810341 144
380 3300005329 Ga0070683_100311295 Ga0070683_1003112952 144
381 3300005330 Ga0070690_100467140 Ga0070690_1004671401 144
382 3300005335 Ga0070666_10614075 Ga0070666_106140752 144
383 3300005337 Ga0070682_101669420 Ga0070682_1016694201 144
384 3300005345 Ga0070692_10652528 Ga0070692_106525281 144
385 3300005364 Ga0070673_100700372 Ga0070673_1007003721 144
386 3300005367 Ga0070667_100968357 Ga0070667_1009683572 144
387 3300005436 Ga0070713_100341741 Ga0070713_1003417411 144
388 3300005437 Ga0070710_10712412 Ga0070710_107124122 144
389 3300005439 Ga0070711_101035559 Ga0070711_1010355591 144
390 3300005468 Ga0070707_100440069 Ga0070707_1004400693 144
391 3300005468 Ga0070707_100567079 Ga0070707_1005670791 144
392 3300005471 Ga0070698_100085037 Ga0070698_1000850374 144
393 3300005535 Ga0070684_100083859 Ga0070684_1000838594 144
394 3300005536 Ga0070697_100276592 Ga0070697_1002765923 144
395 3300005539 Ga0068853_100663120 Ga0068853_1006631202 144
396 3300005544 Ga0070686_100000059 Ga0070686_10000005977 144
397 3300005547 Ga0070693_100074042 Ga0070693_1000740425 144
398 3300005548 Ga0070665_100000024 Ga0070665_10000002423 144
399 3300005563 Ga0068855_101090799 Ga0068855_1010907992 144
400 3300005564 Ga0070664_101292748 Ga0070664_1012927481 144
401 3300005578 Ga0068854_100699319 Ga0068854_1006993192 144
402 3300005614 Ga0068856_100269060 Ga0068856_1002690604 144
403 3300005617 Ga0068859_100665352 Ga0068859_1006653521 144
404 3300005618 Ga0068864_100510955 Ga0068864_1005109552 144
405 3300005842 Ga0068858_100000647 Ga0068858_10000064730 144
406 3300005842 Ga0068858_101368653 Ga0068858_1013686532 144
407 3300006353 Ga0075370_10066885 Ga0075370_100668853 144
408 3300006358 Ga0068871_100889487 Ga0068871_1008894871 144
409 3300006847 Ga0075431_100657677 Ga0075431_1006576772 144
410 3300006871 Ga0075434_100142855 Ga0075434_1001428555 144
411 3300006880 Ga0075429_100768025 Ga0075429_1007680251 144
412 3300006881 Ga0068865_100701255 Ga0068865_1007012552 144
413 3300006931 Ga0097620_100665286 Ga0097620_1006652861 144
414 3300009093 Ga0105240_10668509 Ga0105240_106685092 144
415 3300009093 Ga0105240_11158157 Ga0105240_111581572 144
416 3300009098 Ga0105245_10562251 Ga0105245_105622512 144
417 3300009101 Ga0105247_10003156 Ga0105247_100031564 144
418 3300009147 Ga0114129_10424672 Ga0114129_104246722 144
419 3300009148 Ga0105243_10299252 Ga0105243_102992522 144
420 3300009174 Ga0105241_10871166 Ga0105241_108711662 144
421 3300009176 Ga0105242_10399300 Ga0105242_103993002 144
422 3300009177 Ga0105248_10171623 Ga0105248_101716233 144
423 3300009551 Ga0105238_10056355 Ga0105238_100563554 144
424 3300010375 Ga0105239_12081696 Ga0105239_120816962 144
425 3300013100 Ga0157373_10259966 Ga0157373_102599662 144
426 3300013307 Ga0157372_10457238 Ga0157372_104572382 144
427 3300014325 Ga0163163_11602154 Ga0163163_116021541 144
428 3300014497 Ga0182008_10010984 Ga0182008_100109849 144
429 3300014745 Ga0157377_10660350 Ga0157377_106603502 144
430 3300015262 Ga0182007_10001949 Ga0182007_100019493 144
431 3300021384 Ga0213876_10002509 Ga0213876_1000250910 144
432 3300025297 Ga0209758_1047713 Ga0209758_10477133 144
433 3300025302 Ga0207426_1003661 Ga0207426_10036612 144
434 3300025900 Ga0207710_10011723 Ga0207710_100117231 144
435 3300025907 Ga0207645_10856567 Ga0207645_108565672 144
436 3300025911 Ga0207654_10371269 Ga0207654_103712692 144
437 3300025912 Ga0207707_10131605 Ga0207707_101316052 144
438 3300025920 Ga0207649_10391053 Ga0207649_103910532 144
439 3300025922 Ga0207646_10542032 Ga0207646_105420322 144
440 3300025924 Ga0207694_10485918 Ga0207694_104859182 144
441 3300025935 Ga0207709_10163948 Ga0207709_101639482 144
442 3300025938 Ga0207704_10290733 Ga0207704_102907332 144
443 3300025940 Ga0207691_10379426 Ga0207691_103794262 144
444 3300025942 Ga0207689_10176976 Ga0207689_101769762 144
445 3300025944 Ga0207661_10418764 Ga0207661_104187642 144
446 3300025945 Ga0207679_10194880 Ga0207679_101948802 144
447 3300025960 Ga0207651_10583219 Ga0207651_105832192 144
448 3300026035 Ga0207703_10003386 Ga0207703_1000338611 144
449 3300026078 Ga0207702_10432504 Ga0207702_104325042 144
450 3300026118 Ga0207675_102051966 Ga0207675_1020519661 144
451 3300026142 Ga0207698_10049237 Ga0207698_100492375 144
452 3300028379 Ga0268266_10000019 Ga0268266_10000019339 144
453 3300028786 Ga0307517_10004922 Ga0307517_1000492213 144
454 3300028786 Ga0307517_10064807 Ga0307517_100648073 144
455 3300028794 Ga0307515_10025310 Ga0307515_100253102 144
456 3300028794 Ga0307515_10160591 Ga0307515_101605913 144
457 3300031456 Ga0307513_10197669 Ga0307513_101976693 144
458 3300031456 Ga0307513_10329799 Ga0307513_103297992 144
459 3300031507 Ga0307509_10099786 Ga0307509_100997862 144
460 3300031616 Ga0307508_10001461 Ga0307508_1000146124 144
461 3300031901 Ga0307406_11698466 Ga0307406_116984661 144
462 3300033528 Ga0316588_1005801 Ga0316588_10058012 144
463 3300039437 Ga0436365_1337852 Ga0436365_1337852_2193_2627 144
464 3300039450 Ga0436363_0136866 Ga0436363_0136866_74_508 144
465 3300046457 Ga0495590_0164459 Ga0495590_0164459_43_486 144
466 3300046472 Ga0495580_0053592 Ga0495580_0053592_608_1048 144
467 3300046506 Ga0495583_0000620 Ga0495583_0000620_38349_38789 144
468 3300046520 Ga0495637_0230618 Ga0495637_0230618_148_591 144
469 3300046524 Ga0495648_0000774 Ga0495648_0000774_8938_9378 144
470 3300046660 Ga0495625_0132540 Ga0495625_0132540_861_1295 144
471 3300046660 Ga0495625_0164908 Ga0495625_0164908_401_835 144
472 3300046694 Ga0495649_0001576 Ga0495649_0001576_8777_9217 144
473 3300046810 Ga0495660_0017469 Ga0495660_0017469_1066_1509 144
474 3300047323 Ga0495683_0016588 Ga0495683_0016588_1878_2318 144
475 3300047469 Ga0495673_0003872 Ga0495673_0003872_6435_6875 144
476 3300048904 Ga0496101_0667122 Ga0496101_0667122_96_533 144
477 3300048925 Ga0496122_0028361 Ga0496122_0028361_1579_2022 144
478 3300048928 Ga0496125_0000220 Ga0496125_0000220_28470_28907 144
479 3300048929 Ga0496126_0079815 Ga0496126_0079815_1828_2265 144
480 3300048929 Ga0496126_1345879 Ga0496126_1345879_27_470 144
481 3300049460 Ga0495682_0008455 Ga0495682_0008455_2244_2684 144
482 3300049568 Ga0501031_0003222 Ga0501031_0003222_5446_5880 144
483 3300049569 Ga0501032_0183046 Ga0501032_0183046_493_927 144
484 3300049570 Ga0501033_0034215 Ga0501033_0034215_394_828 144
485 3300049572 Ga0501036_0013733 Ga0501036_0013733_3638_4072 144
486 3300049573 Ga0501037_0045053 Ga0501037_0045053_2305_2739 144
487 3300049574 Ga0501038_0002779 Ga0501038_0002779_532_966 144
488 3300049575 Ga0501039_0004728 Ga0501039_0004728_8537_8971 144
489 3300049576 Ga0501040_0003596 Ga0501040_0003596_2667_3101 144
490 3300049577 Ga0501041_0001971 Ga0501041_0001971_564_998 144
491 3300049578 Ga0501042_0005861 Ga0501042_0005861_675_1109 144
492 3300049578 Ga0501042_1112942 Ga0501042_1112942_59_493 144
493 3300049579 Ga0501043_0024564 Ga0501043_0024564_535_969 144
494 3300049580 Ga0501046_0007376 Ga0501046_0007376_321_755 144
495 3300049580 Ga0501046_1252100 Ga0501046_1252100_45_479 144
496 3300049582 Ga0501048_0001573 Ga0501048_0001573_13000_13434 144
497 3300049587 Ga0501071_0000078 Ga0501071_0000078_34013_34447 144
498 3300049588 Ga0501072_0001519 Ga0501072_0001519_5133_5567 144
499 3300049589 Ga0501073_0163667 Ga0501073_0163667_711_1145 144
500 3300049590 Ga0501074_0006511 Ga0501074_0006511_5356_5790 144
501 3300049591 Ga0501075_0013392 Ga0501075_0013392_5275_5709 144
502 3300049592 Ga0501076_0007831 Ga0501076_0007831_6805_7239 144
503 3300049593 Ga0501077_0000219 Ga0501077_0000219_3289_3723 144
504 3300049741 Ga0501079_0000213 Ga0501079_0000213_32863_33297 144
505 3300049742 Ga0501080_0179110 Ga0501080_0179110_490_924 144
506 3300049743 Ga0501081_0081832 Ga0501081_0081832_1257_1691 144
507 3300049744 Ga0501083_0002560 Ga0501083_0002560_3926_4360 144
508 3300049822 Ga0501035_0013752 Ga0501035_0013752_6767_7201 144
509 3300049823 Ga0501044_0211462 Ga0501044_0211462_1113_1547 144
510 3300049824 Ga0501045_0000197 Ga0501045_0000197_10715_11149 144
511 3300050496 nmdc:mga07m45_365696_c1 nmdc:mga07m45_365696_c1_201_635 144
512 3300050507 nmdc:mga05p37_246970_c1 nmdc:mga05p37_246970_c1_436_870 144
513 3300050510 nmdc:mga06r32_848192_c1 nmdc:mga06r32_848192_c1_67_501 144
514 3300050512 nmdc:mga0n895_789211_c1 nmdc:mga0n895_789211_c1_313_747 144
515 3300054114 Ga0501084_0000612 Ga0501084_0000612_15659_16093 144
516 3300054114 Ga0501084_1367790 Ga0501084_1367790_57_491 144
517 3300060353 Ga0501082_0001948 Ga0501082_0001948_8468_8902 144
518 3300061734 Ga0530510_0003941 Ga0530510_0003941_554_988 144
519 3300049665 Ga0501227_198553 Ga0501227_198553_23_466 145
520 3300049741 Ga0501079_0584631 Ga0501079_0584631_314_751 145
521 3300005293 Ga0065715_10864599 Ga0065715_108645991 146
522 3300005518 Ga0070699_100442480 Ga0070699_1004424802 146
523 3300005536 Ga0070697_100119900 Ga0070697_1001199004 146
524 3300005546 Ga0070696_100101723 Ga0070696_1001017235 146
525 3300046660 Ga0495625_0039775 Ga0495625_0039775_1031_1474 146
526 3300003322 rootL2_10251230 rootL2_102512303 147
527 3300003577 Ga0007416J51690_1014507 Ga0007416J51690_10145076 147
528 3300005290 Ga0065712_10087908 Ga0065712_100879082 147
529 3300005330 Ga0070690_100632833 Ga0070690_1006328332 147
530 3300005331 Ga0070670_100019552 Ga0070670_1000195526 147
531 3300005331 Ga0070670_100060675 Ga0070670_1000606754 147
532 3300005331 Ga0070670_101436273 Ga0070670_1014362731 147
533 3300005334 Ga0068869_100330816 Ga0068869_1003308163 147
534 3300005335 Ga0070666_10714375 Ga0070666_107143752 147
535 3300005335 Ga0070666_10833053 Ga0070666_108330532 147
536 3300005338 Ga0068868_100417539 Ga0068868_1004175392 147
537 3300005340 Ga0070689_100049952 Ga0070689_1000499522 147
538 3300005340 Ga0070689_100579805 Ga0070689_1005798051 147
539 3300005344 Ga0070661_100022563 Ga0070661_1000225635 147
540 3300005344 Ga0070661_101014259 Ga0070661_1010142591 147
541 3300005347 Ga0070668_100064495 Ga0070668_1000644953 147
542 3300005347 Ga0070668_100133764 Ga0070668_1001337642 147
543 3300005347 Ga0070668_100957650 Ga0070668_1009576501 147
544 3300005355 Ga0070671_100076924 Ga0070671_1000769243 147
545 3300005355 Ga0070671_100244360 Ga0070671_1002443604 147
546 3300005364 Ga0070673_101706394 Ga0070673_1017063941 147
547 3300005367 Ga0070667_100071012 Ga0070667_1000710123 147
548 3300005441 Ga0070700_100013206 Ga0070700_1000132063 147
549 3300005444 Ga0070694_100000051 Ga0070694_10000005119 147
550 3300005444 Ga0070694_100014694 Ga0070694_1000146947 147
551 3300005456 Ga0070678_100719089 Ga0070678_1007190891 147
552 3300005456 Ga0070678_100875195 Ga0070678_1008751952 147
553 3300005456 Ga0070678_101006416 Ga0070678_1010064161 147
554 3300005457 Ga0070662_100152761 Ga0070662_1001527613 147
555 3300005458 Ga0070681_10006958 Ga0070681_1000695811 147
556 3300005458 Ga0070681_10571501 Ga0070681_105715012 147
557 3300005459 Ga0068867_100063410 Ga0068867_1000634104 147
558 3300005468 Ga0070707_100026693 Ga0070707_1000266934 147
559 3300005471 Ga0070698_100020984 Ga0070698_1000209846 147
560 3300005471 Ga0070698_100143983 Ga0070698_1001439832 147
561 3300005518 Ga0070699_100003516 Ga0070699_1000035164 147
562 3300005535 Ga0070684_101674523 Ga0070684_1016745232 147
563 3300005536 Ga0070697_100138929 Ga0070697_1001389292 147
564 3300005536 Ga0070697_100456749 Ga0070697_1004567491 147
565 3300005539 Ga0068853_100160911 Ga0068853_1001609112 147
566 3300005539 Ga0068853_101111251 Ga0068853_1011112511 147
567 3300005543 Ga0070672_100011579 Ga0070672_1000115795 147
568 3300005543 Ga0070672_100076552 Ga0070672_1000765526 147
569 3300005543 Ga0070672_100644420 Ga0070672_1006444202 147
570 3300005544 Ga0070686_100154460 Ga0070686_1001544604 147
571 3300005545 Ga0070695_100000132 Ga0070695_1000001329 147
572 3300005545 Ga0070695_100100854 Ga0070695_1001008542 147
573 3300005545 Ga0070695_100345641 Ga0070695_1003456412 147
574 3300005545 Ga0070695_100723226 Ga0070695_1007232261 147
575 3300005546 Ga0070696_100814502 Ga0070696_1008145022 147
576 3300005546 Ga0070696_101654709 Ga0070696_1016547091 147
577 3300005547 Ga0070693_100000459 Ga0070693_10000045915 147
578 3300005547 Ga0070693_100043145 Ga0070693_1000431454 147
579 3300005547 Ga0070693_100634256 Ga0070693_1006342561 147
580 3300005549 Ga0070704_100325643 Ga0070704_1003256431 147
581 3300005564 Ga0070664_100000591 Ga0070664_10000059116 147
582 3300005564 Ga0070664_100024412 Ga0070664_1000244124 147
583 3300005564 Ga0070664_100267599 Ga0070664_1002675994 147
584 3300005564 Ga0070664_100526304 Ga0070664_1005263042 147
585 3300005564 Ga0070664_100734049 Ga0070664_1007340492 147
586 3300005617 Ga0068859_101349662 Ga0068859_1013496622 147
587 3300005618 Ga0068864_100011188 Ga0068864_1000111882 147
588 3300005618 Ga0068864_100037713 Ga0068864_1000377134 147
589 3300005618 Ga0068864_100062948 Ga0068864_1000629483 147
590 3300005618 Ga0068864_100147223 Ga0068864_1001472234 147
591 3300005719 Ga0068861_100004876 Ga0068861_1000048764 147
592 3300005719 Ga0068861_100009178 Ga0068861_1000091785 147
593 3300005719 Ga0068861_100582524 Ga0068861_1005825242 147
594 3300005840 Ga0068870_10379969 Ga0068870_103799692 147
595 3300005841 Ga0068863_100056704 Ga0068863_1000567047 147
596 3300005841 Ga0068863_100326465 Ga0068863_1003264652 147
597 3300005841 Ga0068863_100362118 Ga0068863_1003621183 147
598 3300005841 Ga0068863_100744549 Ga0068863_1007445492 147
599 3300005841 Ga0068863_101109021 Ga0068863_1011090212 147
600 3300005842 Ga0068858_100002332 Ga0068858_1000023325 147
601 3300005842 Ga0068858_100015004 Ga0068858_1000150046 147
602 3300005842 Ga0068858_100239525 Ga0068858_1002395253 147
603 3300005842 Ga0068858_100283307 Ga0068858_1002833072 147
604 3300005842 Ga0068858_101770097 Ga0068858_1017700971 147
605 3300005843 Ga0068860_100309218 Ga0068860_1003092181 147
606 3300005843 Ga0068860_101097493 Ga0068860_1010974932 147
607 3300006048 Ga0075363_100040425 Ga0075363_1000404255 147
608 3300006237 Ga0097621_100377811 Ga0097621_1003778112 147
609 3300006237 Ga0097621_100438755 Ga0097621_1004387552 147
610 3300006237 Ga0097621_100588800 Ga0097621_1005888002 147
611 3300006358 Ga0068871_100187407 Ga0068871_1001874072 147
612 3300006358 Ga0068871_101587963 Ga0068871_1015879632 147
613 3300006844 Ga0075428_100807302 Ga0075428_1008073022 147
614 3300006847 Ga0075431_100046677 Ga0075431_1000466774 147
615 3300006852 Ga0075433_10572262 Ga0075433_105722621 147
616 3300006871 Ga0075434_101632336 Ga0075434_1016323361 147
617 3300006880 Ga0075429_101535986 Ga0075429_1015359861 147
618 3300006931 Ga0097620_101349659 Ga0097620_1013496592 147
619 3300009094 Ga0111539_10028193 Ga0111539_100281934 147
620 3300009101 Ga0105247_10001576 Ga0105247_1000157613 147
621 3300009174 Ga0105241_10012734 Ga0105241_100127346 147
622 3300009174 Ga0105241_10070569 Ga0105241_100705692 147
623 3300009176 Ga0105242_10771581 Ga0105242_107715812 147
624 3300009177 Ga0105248_10002695 Ga0105248_100026953 147
625 3300009177 Ga0105248_10051180 Ga0105248_100511805 147
626 3300009177 Ga0105248_10197661 Ga0105248_101976613 147
627 3300009551 Ga0105238_10383913 Ga0105238_103839131 147
628 3300009551 Ga0105238_11063457 Ga0105238_110634572 147
629 3300009553 Ga0105249_10384130 Ga0105249_103841302 147
630 3300010375 Ga0105239_12295932 Ga0105239_122959321 147
631 3300011119 Ga0105246_10040583 Ga0105246_100405833 147
632 3300013100 Ga0157373_10575733 Ga0157373_105757332 147
633 3300013296 Ga0157374_10670394 Ga0157374_106703942 147
634 3300013297 Ga0157378_10000039 Ga0157378_1000003981 147
635 3300013297 Ga0157378_10000400 Ga0157378_1000040034 147
636 3300013297 Ga0157378_10521209 Ga0157378_105212092 147
637 3300013297 Ga0157378_11067393 Ga0157378_110673932 147
638 3300013297 Ga0157378_11228526 Ga0157378_112285261 147
639 3300013306 Ga0163162_10013174 Ga0163162_100131745 147
640 3300013306 Ga0163162_10130263 Ga0163162_101302633 147
641 3300013307 Ga0157372_10954050 Ga0157372_109540502 147
642 3300013307 Ga0157372_11626707 Ga0157372_116267072 147
643 3300013308 Ga0157375_10000009 Ga0157375_10000009216 147
644 3300013308 Ga0157375_10021084 Ga0157375_100210843 147
645 3300013308 Ga0157375_10620782 Ga0157375_106207824 147
646 3300013308 Ga0157375_11595069 Ga0157375_115950692 147
647 3300014325 Ga0163163_10007673 Ga0163163_100076734 147
648 3300014325 Ga0163163_10077127 Ga0163163_100771273 147
649 3300014325 Ga0163163_10388414 Ga0163163_103884142 147
650 3300014326 Ga0157380_10136922 Ga0157380_101369223 147
651 3300014326 Ga0157380_10226764 Ga0157380_102267642 147
652 3300014968 Ga0157379_10015503 Ga0157379_100155033 147
653 3300014969 Ga0157376_10136744 Ga0157376_101367445 147
654 3300014969 Ga0157376_10656542 Ga0157376_106565421 147
655 3300017792 Ga0163161_10186038 Ga0163161_101860382 147
656 3300017792 Ga0163161_10194286 Ga0163161_101942862 147
657 3300017792 Ga0163161_11449893 Ga0163161_114498931 147
658 3300025900 Ga0207710_10017024 Ga0207710_100170244 147
659 3300025903 Ga0207680_10333845 Ga0207680_103338452 147
660 3300025903 Ga0207680_10591076 Ga0207680_105910762 147
661 3300025908 Ga0207643_10884818 Ga0207643_108848181 147
662 3300025911 Ga0207654_10094646 Ga0207654_100946462 147
663 3300025911 Ga0207654_10242720 Ga0207654_102427202 147
664 3300025912 Ga0207707_10510635 Ga0207707_105106352 147
665 3300025912 Ga0207707_11193069 Ga0207707_111930692 147
666 3300025913 Ga0207695_10195015 Ga0207695_101950152 147
667 3300025917 Ga0207660_10252802 Ga0207660_102528024 147
668 3300025920 Ga0207649_10247675 Ga0207649_102476752 147
669 3300025921 Ga0207652_10410414 Ga0207652_104104142 147
670 3300025922 Ga0207646_10033887 Ga0207646_100338871 147
671 3300025925 Ga0207650_10019210 Ga0207650_100192103 147
672 3300025925 Ga0207650_10053843 Ga0207650_100538432 147
673 3300025925 Ga0207650_10144700 Ga0207650_101447002 147
674 3300025925 Ga0207650_10792948 Ga0207650_107929482 147
675 3300025925 Ga0207650_11476129 Ga0207650_114761291 147
676 3300025926 Ga0207659_10049027 Ga0207659_100490275 147
677 3300025927 Ga0207687_10012665 Ga0207687_100126656 147
678 3300025931 Ga0207644_10035812 Ga0207644_100358124 147
679 3300025931 Ga0207644_10219381 Ga0207644_102193812 147
680 3300025933 Ga0207706_10087051 Ga0207706_100870513 147
681 3300025936 Ga0207670_10017537 Ga0207670_100175373 147
682 3300025936 Ga0207670_10059695 Ga0207670_100596952 147
683 3300025937 Ga0207669_11004598 Ga0207669_110045981 147
684 3300025940 Ga0207691_10021460 Ga0207691_100214607 147
685 3300025940 Ga0207691_10290018 Ga0207691_102900184 147
686 3300025940 Ga0207691_10579027 Ga0207691_105790272 147
687 3300025941 Ga0207711_10004193 Ga0207711_100041938 147
688 3300025941 Ga0207711_10076160 Ga0207711_100761603 147
689 3300025942 Ga0207689_10354938 Ga0207689_103549381 147
690 3300025945 Ga0207679_10018522 Ga0207679_100185228 147
691 3300025945 Ga0207679_10146993 Ga0207679_101469932 147
692 3300025945 Ga0207679_10187472 Ga0207679_101874721 147
693 3300025960 Ga0207651_10069277 Ga0207651_100692774 147
694 3300025960 Ga0207651_10672841 Ga0207651_106728411 147
695 3300025960 Ga0207651_10992845 Ga0207651_109928451 147
696 3300025961 Ga0207712_10155016 Ga0207712_101550162 147
697 3300025972 Ga0207668_10119569 Ga0207668_101195692 147
698 3300025986 Ga0207658_10111846 Ga0207658_101118462 147
699 3300026023 Ga0207677_10396175 Ga0207677_103961753 147
700 3300026035 Ga0207703_10000601 Ga0207703_100006015 147
701 3300026035 Ga0207703_10007165 Ga0207703_1000716510 147
702 3300026035 Ga0207703_10080875 Ga0207703_100808752 147
703 3300026035 Ga0207703_10526108 Ga0207703_105261081 147
704 3300026041 Ga0207639_10242095 Ga0207639_102420954 147
705 3300026041 Ga0207639_11018091 Ga0207639_110180911 147
706 3300026067 Ga0207678_10654099 Ga0207678_106540992 147
707 3300026088 Ga0207641_10044187 Ga0207641_100441872 147
708 3300026088 Ga0207641_10097202 Ga0207641_100972022 147
709 3300026088 Ga0207641_10674581 Ga0207641_106745811 147
710 3300026088 Ga0207641_10970012 Ga0207641_109700121 147
711 3300026089 Ga0207648_10079721 Ga0207648_100797215 147
712 3300026095 Ga0207676_10034819 Ga0207676_100348195 147
713 3300026095 Ga0207676_10083064 Ga0207676_100830643 147
714 3300026095 Ga0207676_11826696 Ga0207676_118266961 147
715 3300026118 Ga0207675_100027018 Ga0207675_1000270184 147
716 3300026118 Ga0207675_100027936 Ga0207675_1000279365 147
717 3300026118 Ga0207675_100879073 Ga0207675_1008790731 147
718 3300026121 Ga0207683_10378909 Ga0207683_103789092 147
719 3300026121 Ga0207683_11453795 Ga0207683_114537952 147
720 3300027907 Ga0207428_10568409 Ga0207428_105684091 147
721 3300028381 Ga0268264_10995914 Ga0268264_109959142 147
722 3300028786 Ga0307517_10221631 Ga0307517_102216313 147
723 3300030522 Ga0307512_10244797 Ga0307512_102447972 147
724 3300031456 Ga0307513_10698862 Ga0307513_106988621 147
725 3300031616 Ga0307508_10235936 Ga0307508_102359362 147
726 3300031903 Ga0307407_10226502 Ga0307407_102265023 147
727 3300032002 Ga0307416_102363145 Ga0307416_1023631452 147
728 3300032005 Ga0307411_10095974 Ga0307411_100959742 147
729 3300035172 Ga0373955_0267385 Ga0373955_0267385_88_531 147
730 3300037471 Ga0395905_0119273 Ga0395905_0119273_456_899 147
731 3300042007 Ga0439449_0007120 Ga0439449_0007120_497_940 147
732 3300046457 Ga0495590_0000646 Ga0495590_0000646_2094_2537 147
733 3300046460 Ga0495638_0026825 Ga0495638_0026825_1831_2274 147
734 3300046463 Ga0495653_0014403 Ga0495653_0014403_4687_5133 147
735 3300046472 Ga0495580_0082119 Ga0495580_0082119_885_1328 147
736 3300046491 Ga0495584_0000095 Ga0495584_0000095_42243_42686 147
737 3300046492 Ga0495585_0000428 Ga0495585_0000428_22535_22978 147
738 3300046492 Ga0495585_0007809 Ga0495585_0007809_924_1370 147
739 3300046500 Ga0495596_0003769 Ga0495596_0003769_1959_2402 147
740 3300046501 Ga0495607_0163268 Ga0495607_0163268_553_999 147
741 3300046506 Ga0495583_0007506 Ga0495583_0007506_1038_1481 147
742 3300046513 Ga0495616_0000052 Ga0495616_0000052_66143_66586 147
743 3300046513 Ga0495616_0000447 Ga0495616_0000447_9822_10265 147
744 3300046513 Ga0495616_0001194 Ga0495616_0001194_12754_13197 147
745 3300046519 Ga0495632_0000082 Ga0495632_0000082_91574_92020 147
746 3300046519 Ga0495632_0132721 Ga0495632_0132721_656_1099 147
747 3300046519 Ga0495632_0165107 Ga0495632_0165107_476_919 147
748 3300046528 Ga0495642_0122561 Ga0495642_0122561_471_914 147
749 3300046530 Ga0495654_0142333 Ga0495654_0142333_271_714 147
750 3300046538 Ga0495609_0024437 Ga0495609_0024437_1791_2234 147
751 3300046538 Ga0495609_0294846 Ga0495609_0294846_184_627 147
752 3300046542 Ga0495597_0068321 Ga0495597_0068321_131_574 147
753 3300046558 Ga0495633_0000640 Ga0495633_0000640_9781_10224 147
754 3300046616 Ga0495668_0006667 Ga0495668_0006667_1437_1883 147
755 3300046660 Ga0495625_0026470 Ga0495625_0026470_2119_2568 147
756 3300046660 Ga0495625_0084504 Ga0495625_0084504_887_1330 147
757 3300046660 Ga0495625_0457777 Ga0495625_0457777_162_605 147
758 3300046665 Ga0495661_0034421 Ga0495661_0034421_1253_1696 147
759 3300046691 Ga0495670_0023487 Ga0495670_0023487_1422_1865 147
760 3300046794 Ga0495589_0526790 Ga0495589_0526790_85_528 147
761 3300046810 Ga0495660_0006120 Ga0495660_0006120_2565_3011 147
762 3300047322 Ga0495680_0315989 Ga0495680_0315989_380_823 147
763 3300047323 Ga0495683_0000157 Ga0495683_0000157_47148_47591 147
764 3300047443 Ga0495687_000187 Ga0495687_000187_62350_62793 147
765 3300047446 Ga0495679_008567 Ga0495679_008567_2420_2863 147
766 3300047673 Ga0495593_0117580 Ga0495593_0117580_395_841 147
767 3300048088 Ga0495602_0008918 Ga0495602_0008918_8462_8908 147
768 3300048091 Ga0495626_0047699 Ga0495626_0047699_1376_1822 147
769 3300048091 Ga0495626_0163821 Ga0495626_0163821_305_751 147
770 3300048903 Ga0496100_0076667 Ga0496100_0076667_148_591 147
771 3300048904 Ga0496101_0034270 Ga0496101_0034270_328_771 147
772 3300048905 Ga0496102_0004345 Ga0496102_0004345_4880_5323 147
773 3300048907 Ga0496104_0006833 Ga0496104_0006833_736_1179 147
774 3300048907 Ga0496104_0019564 Ga0496104_0019564_761_1204 147
775 3300048907 Ga0496104_0114200 Ga0496104_0114200_1130_1573 147
776 3300048909 Ga0496106_0010643 Ga0496106_0010643_4535_4978 147
777 3300048909 Ga0496106_0012662 Ga0496106_0012662_3968_4411 147
778 3300048910 Ga0496107_0508336 Ga0496107_0508336_347_790 147
779 3300048911 Ga0496108_0002232 Ga0496108_0002232_8843_9286 147
780 3300048911 Ga0496108_0006449 Ga0496108_0006449_1608_2051 147
781 3300048912 Ga0496109_0015121 Ga0496109_0015121_3171_3614 147
782 3300048912 Ga0496109_0104250 Ga0496109_0104250_1007_1450 147
783 3300048913 Ga0496110_0005940 Ga0496110_0005940_6023_6466 147
784 3300048913 Ga0496110_0014596 Ga0496110_0014596_4836_5279 147
785 3300048913 Ga0496110_0798857 Ga0496110_0798857_353_796 147
786 3300048913 Ga0496110_1117781 Ga0496110_1117781_129_572 147
787 3300048915 Ga0496112_0000842 Ga0496112_0000842_12606_13049 147
788 3300048915 Ga0496112_0011469 Ga0496112_0011469_451_894 147
789 3300048916 Ga0496113_0022989 Ga0496113_0022989_1227_1670 147
790 3300048917 Ga0496114_0282651 Ga0496114_0282651_724_1167 147
791 3300048918 Ga0496115_0011104 Ga0496115_0011104_1961_2404 147
792 3300048925 Ga0496122_0290019 Ga0496122_0290019_79_525 147
793 3300048926 Ga0496123_0145087 Ga0496123_0145087_102_548 147
794 3300048927 Ga0496124_0143649 Ga0496124_0143649_804_1250 147
795 3300049459 Ga0495678_000102 Ga0495678_000102_97955_98401 147
796 3300049575 Ga0501039_0687517 Ga0501039_0687517_309_752 147
797 3300049578 Ga0501042_0883087 Ga0501042_0883087_190_633 147
798 3300049824 Ga0501045_0544803 Ga0501045_0544803_155_598 147
799 3300050490 nmdc:mga03n38_1501_c1 nmdc:mga03n38_1501_c1_1840_2283 147
800 3300050510 nmdc:mga06r32_39519_c1 nmdc:mga06r32_39519_c1_3176_3619 147
801 3300050511 nmdc:mga08y16_236228_c1 nmdc:mga08y16_236228_c1_1366_1809 147
802 3300050512 nmdc:mga0n895_1398660_c1 nmdc:mga0n895_1398660_c1_159_602 147
803 3300053083 Ga0495655_0000033 Ga0495655_0000033_27886_28329 147
804 3300053139 Ga0500568_0003238 Ga0500568_0003238_7226_7669 147
805 3300053139 Ga0500568_0033636 Ga0500568_0033636_901_1344 147
806 3300054114 Ga0501084_0008906 Ga0501084_0008906_1031_1474 147
807 2162886006 SwRhRL3b_contig_1143410 SwRhRL3b_0090.00000980 148
808 3300005289 Ga0065704_10299499 Ga0065704_102994992 148
809 3300005295 Ga0065707_10215133 Ga0065707_102151332 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

16

152

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0b-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath-tube complex in extended state 0.6503 10 148
6j0f-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state 0.6401 10 148
1xf8-assembly1.cif.gz_A crystal structure of weissella viridescens femx (y254f) mutant 0.6289 88 125
6bdc-assembly1.cif.gz_A structure of hcp1 from flavobacterium johnsoniae 0.6173 10 147
6j0f-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state 0.6054 10 148
ID Description Score Start End Superfamily
af_O06136_158_460_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.78 90 113 3.40.630.30
af_Q2FWJ9_318_422_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7676 115 142 3.30.70.260
af_Q5SZD4_150_264_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6696 94 114 3.40.630.30
af_Q2FYR1_1_132_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.65 81 113 3.40.630.30
af_Q54YS7_422_509_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6452 116 138 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A426U0G8-F1-model_v4 Phage tail protein 0.8146 1 147 GO:0005198
AF-A0A426U0G8-F1-model_v4 Phage tail protein 0.7948 1 147 GO:0005198
AF-A0A6B3HRY7-F1-model_v4 Phage tail protein 0.7706 75 146 GO:0005198
AF-A0A3C0E4N7-F1-model_v4 Phage tail protein 0.766 9 148 GO:0005198
AF-A0A6H9LDH8-F1-model_v4 deleted 0.7636 9 148

Feature Viewer

pLDDT pTM Quality
86.22 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map