F481756

General Info

Members Datasets Scaffolds Average Seq Length
809 259 1410 51

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101607027|Ga0075428_1016070272
Length 59
Sequence MIKRFLRDETGLELSEYAVAAALVALACVAAFQLLGENIGTKIDTLADTIESGAAPAAP

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
187 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
199 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
200 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
201 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
222 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
235 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
236 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.21
Metatranscriptomes 7.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.47
Rhizosphere 96.17
Stem 0
Stem Tuber 0
Unclassified 42.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_101607027 3300006844 Unclassified 680
2 MRS2a_Contig_5286 2124908027 Unclassified 532
3 SwRhRL2b_contig_1654826 2162886007 Eukaryota 1067
4 SwRhRL2b_contig_1832240 2162886007 Unclassified 989
5 JGI24749J21850_1004603 3300002076 Bacteria 1930
6 JGI24751J29686_10000016 3300002459 Bacteria 112162
7 JGI25406J46586_10024086 3300003203 Bacteria 2393
8 Ga0007416J51690_1058726 3300003577 Bacteria 868
9 Ga0007416J51690_1100015 3300003577 Bacteria 688
10 Ga0058859_10004319 3300004798 Unclassified 578
11 Ga0058859_10012182 3300004798 Bacteria 547
12 Ga0058859_10022403 3300004798 Unclassified 718
13 Ga0058859_10056669 3300004798 Bacteria 1058
14 Ga0058859_10056793 3300004798 Bacteria 954
15 Ga0058859_11790054 3300004798 Unclassified 926
16 Ga0058859_11821714 3300004798 Unclassified 595
17 Ga0058863_10012707 3300004799 Unclassified 551
18 Ga0058863_11473085 3300004799 Unclassified 695
19 Ga0058863_11774124 3300004799 Bacteria 821
20 Ga0058860_11748693 3300004801 Unclassified 523
21 Ga0058860_11798911 3300004801 Unclassified 540
22 Ga0058860_12107265 3300004801 Unclassified 774
23 Ga0058860_12177989 3300004801 Unclassified 522
24 Ga0058862_12137975 3300004803 Unclassified 760
25 Ga0058862_12770453 3300004803 Bacteria 624
26 Ga0058862_12868416 3300004803 Bacteria 735
27 Ga0065714_10064507 3300005288 Bacteria 46235
28 Ga0065704_10114662 3300005289 Bacteria 1887
29 Ga0065704_10148170 3300005289 Bacteria 1452
30 Ga0065704_10199263 3300005289 Bacteria 1154
31 Ga0065704_10212129 3300005289 Bacteria 1105
32 Ga0065712_10000138 3300005290 Bacteria 62583
33 Ga0065712_10009836 3300005290 Bacteria 2887
34 Ga0065712_10137765 3300005290 Bacteria 1480
35 Ga0065712_10360971 3300005290 Unclassified 775
36 Ga0065712_10732532 3300005290 Unclassified 535
37 Ga0065715_10001087 3300005293 Bacteria 12173
38 Ga0065715_10030631 3300005293 Bacteria 2211
39 Ga0065715_10089648 3300005293 Bacteria 9092
40 Ga0065715_10092194 3300005293 Bacteria 5269
41 Ga0065715_10153651 3300005293 Bacteria 1698
42 Ga0065715_10281266 3300005293 Unclassified 1086
43 Ga0065715_10420410 3300005293 Unclassified 859
44 Ga0065715_10624246 3300005293 Unclassified 693
45 Ga0065715_10716057 3300005293 Unclassified 614
46 Ga0065715_10888638 3300005293 Unclassified 578
47 Ga0065715_10989295 3300005293 Unclassified 548
48 Ga0065707_10001679 3300005295 Bacteria 5819
49 Ga0065707_10016458 3300005295 Bacteria 1867
50 Ga0065707_10024395 3300005295 Bacteria 1424
51 Ga0065707_10027396 3300005295 Bacteria 1090
52 Ga0065707_10106816 3300005295 Bacteria 2575
53 Ga0065707_10564542 3300005295 Unclassified 693
54 Ga0065707_10686074 3300005295 Unclassified 646
55 Ga0070676_10580356 3300005328 Unclassified 806
56 Ga0070683_100222668 3300005329 Unclassified 1793
57 Ga0070690_100215418 3300005330 Bacteria 1343
58 Ga0070690_100800055 3300005330 Unclassified 731
59 Ga0070670_100031206 3300005331 Unclassified 4588
60 Ga0070670_100081556 3300005331 Bacteria 2779
61 Ga0070670_100322955 3300005331 Unclassified 1353
62 Ga0070670_100335403 3300005331 Bacteria 1327
63 Ga0070670_100674329 3300005331 Unclassified 928
64 Ga0070670_101109589 3300005331 Unclassified 722
65 Ga0070670_102053547 3300005331 Unclassified 527
66 Ga0070677_10389284 3300005333 Unclassified 732
67 Ga0068869_100004585 3300005334 Bacteria 8610
68 Ga0068869_100017565 3300005334 Bacteria 4852
69 Ga0068869_100888047 3300005334 Unclassified 771
70 Ga0070680_100193871 3300005336 Bacteria 1712
71 Ga0070680_101571761 3300005336 Bacteria 570
72 Ga0070682_100015534 3300005337 Bacteria 4414
73 Ga0070682_100598490 3300005337 Unclassified 870
74 Ga0068868_100731663 3300005338 Unclassified 887
75 Ga0070660_100064931 3300005339 Unclassified 2840
76 Ga0070660_100448788 3300005339 Bacteria 1070
77 Ga0070689_100194748 3300005340 Bacteria 1652
78 Ga0070689_100447443 3300005340 Bacteria 1099
79 Ga0070689_101789300 3300005340 Unclassified 560
80 Ga0070689_101914678 3300005340 Bacteria 542
81 Ga0070689_101971678 3300005340 Bacteria 534
82 Ga0070689_102041606 3300005340 Bacteria 525
83 Ga0070689_102097241 3300005340 Unclassified 518
84 Ga0070687_100025153 3300005343 Bacteria 2852
85 Ga0070687_100039031 3300005343 Bacteria 2383
86 Ga0070687_101040394 3300005343 Unclassified 596
87 Ga0070661_100042830 3300005344 Bacteria 3306
88 Ga0070661_100748812 3300005344 Bacteria 799
89 Ga0070692_10319093 3300005345 Unclassified 955
90 Ga0070692_10322359 3300005345 Unclassified 950
91 Ga0070692_10605317 3300005345 Bacteria 726
92 Ga0070668_101122237 3300005347 Unclassified 710
93 Ga0070669_100031317 3300005353 Bacteria 3842
94 Ga0070675_101519650 3300005354 Bacteria 618
95 Ga0070671_100013825 3300005355 Bacteria 6513
96 Ga0070671_100277978 3300005355 Unclassified 1424
97 Ga0070671_100553799 3300005355 Bacteria 992
98 Ga0070674_100835694 3300005356 Unclassified 798
99 Ga0070673_101098696 3300005364 Unclassified 743
100 Ga0070673_101933490 3300005364 Unclassified 560
101 Ga0070688_100573188 3300005365 Unclassified 861
102 Ga0070659_100081773 3300005366 Bacteria 2580
103 Ga0070659_100244028 3300005366 Unclassified 1487
104 Ga0070659_100602553 3300005366 Unclassified 944
105 Ga0070659_101028902 3300005366 Unclassified 724
106 Ga0070667_100424959 3300005367 Bacteria 1212
107 Ga0070667_101132627 3300005367 Unclassified 732
108 Ga0070667_101304031 3300005367 Unclassified 680
109 Ga0070703_10002856 3300005406 Bacteria 4945
110 Ga0070701_10026826 3300005438 Bacteria 2814
111 Ga0070701_10159731 3300005438 Bacteria 1305
112 Ga0070701_10702258 3300005438 Unclassified 680
113 Ga0070705_100003994 3300005440 Bacteria 7208
114 Ga0070705_100414768 3300005440 Bacteria 1001
115 Ga0070705_100552881 3300005440 Unclassified 883
116 Ga0070705_100761279 3300005440 Unclassified 767
117 Ga0070705_101524246 3300005440 Unclassified 561
118 Ga0070705_101603799 3300005440 Unclassified 548
119 Ga0070700_100104765 3300005441 Bacteria 1869
120 Ga0070700_100253428 3300005441 Bacteria 1264
121 Ga0070700_100719019 3300005441 Unclassified 796
122 Ga0070700_100740272 3300005441 Bacteria 786
123 Ga0070694_100010935 3300005444 Bacteria 5615
124 Ga0070694_100021214 3300005444 Unclassified 4147
125 Ga0070694_100244181 3300005444 Bacteria 1355
126 Ga0070694_100891983 3300005444 Unclassified 734
127 Ga0070694_101865000 3300005444 Unclassified 513
128 Ga0070708_100075065 3300005445 Unclassified 3051
129 Ga0070678_100878596 3300005456 Unclassified 818
130 Ga0070662_100486075 3300005457 Unclassified 1028
131 Ga0070662_100592814 3300005457 Unclassified 932
132 Ga0070662_101833631 3300005457 Unclassified 524
133 Ga0070681_10049172 3300005458 Unclassified 4212
134 Ga0068867_100595425 3300005459 Unclassified 963
135 Ga0068867_101069505 3300005459 Unclassified 735
136 Ga0070685_11384939 3300005466 Bacteria 539
137 Ga0070685_11593484 3300005466 Bacteria 505
138 Ga0070706_100000085 3300005467 Bacteria 108868
139 Ga0070707_100141351 3300005468 Bacteria 2343
140 Ga0070707_101480138 3300005468 Bacteria 646
141 Ga0070698_100007491 3300005471 Bacteria 11810
142 Ga0070698_100076743 3300005471 Bacteria 3343
143 Ga0070698_101303131 3300005471 Bacteria 676
144 Ga0070699_100006028 3300005518 Bacteria 10597
145 Ga0070699_100015177 3300005518 Bacteria 6619
146 Ga0070699_100204446 3300005518 Bacteria 1757
147 Ga0070699_101361445 3300005518 Unclassified 651
148 Ga0070679_100006500 3300005530 Bacteria 10898
149 Ga0070679_100090286 3300005530 Bacteria 3052
150 Ga0070684_100223224 3300005535 Unclassified 1719
151 Ga0070697_100000205 3300005536 Bacteria 48600
152 Ga0070697_100056690 3300005536 Bacteria 3188
153 Ga0070697_100097972 3300005536 Bacteria 2434
154 Ga0070697_100374710 3300005536 Bacteria 1232
155 Ga0068853_100085215 3300005539 Unclassified 2769
156 Ga0068853_101156578 3300005539 Unclassified 747
157 Ga0068853_102462708 3300005539 Bacteria 504
158 Ga0070672_100307162 3300005543 Bacteria 1346
159 Ga0070672_100604223 3300005543 Unclassified 955
160 Ga0070672_100868375 3300005543 Unclassified 796
161 Ga0070672_101118074 3300005543 Unclassified 700
162 Ga0070686_100429776 3300005544 Unclassified 1011
163 Ga0070686_100508677 3300005544 Bacteria 936
164 Ga0070695_100105840 3300005545 Bacteria 1902
165 Ga0070695_100188652 3300005545 Bacteria 1466
166 Ga0070695_100194021 3300005545 Bacteria 1447
167 Ga0070695_100249943 3300005545 Unclassified 1290
168 Ga0070695_100259848 3300005545 Archaea 1268
169 Ga0070695_100351269 3300005545 Unclassified 1105
170 Ga0070695_100586022 3300005545 Unclassified 874
171 Ga0070695_100955274 3300005545 Unclassified 695
172 Ga0070695_101193192 3300005545 Unclassified 626
173 Ga0070696_100271190 3300005546 Viruses 1290
174 Ga0070696_100314974 3300005546 Unclassified 1202
175 Ga0070696_101143041 3300005546 Unclassified 656
176 Ga0070696_101171119 3300005546 Unclassified 648
177 Ga0070696_101205291 3300005546 Unclassified 640
178 Ga0070696_101367100 3300005546 Unclassified 603
179 Ga0070693_100001191 3300005547 Bacteria 11706
180 Ga0070693_100018937 3300005547 Bacteria 3602
181 Ga0070693_100046247 3300005547 Bacteria 2471
182 Ga0070693_100163506 3300005547 Bacteria 1420
183 Ga0070693_100194235 3300005547 Bacteria 1315
184 Ga0070693_100289000 3300005547 Bacteria 1101
185 Ga0070693_100618525 3300005547 Unclassified 784
186 Ga0070704_100046349 3300005549 Unclassified 3031
187 Ga0070704_100455243 3300005549 Unclassified 1103
188 Ga0070704_100603592 3300005549 Unclassified 965
189 Ga0070704_100653168 3300005549 Unclassified 929
190 Ga0070704_100946884 3300005549 Unclassified 777
191 Ga0070664_100153430 3300005564 Unclassified 2034
192 Ga0070664_100221388 3300005564 Bacteria 1693
193 Ga0070664_100225597 3300005564 Bacteria 1677
194 Ga0070664_100493695 3300005564 Bacteria 1128
195 Ga0070664_100960049 3300005564 Bacteria 803
196 Ga0070664_101410135 3300005564 Unclassified 659
197 Ga0068857_100047832 3300005577 Unclassified 3798
198 Ga0068857_100070370 3300005577 Bacteria 3116
199 Ga0068857_100505627 3300005577 Unclassified 1134
200 Ga0068857_100511823 3300005577 Bacteria 1127
201 Ga0068857_100882566 3300005577 Bacteria 857
202 Ga0068857_101409113 3300005577 Bacteria 678
203 Ga0068854_100118427 3300005578 Bacteria 2006
204 Ga0068854_100523042 3300005578 Bacteria 1002
205 Ga0068854_100745737 3300005578 Bacteria 849
206 Ga0068854_101904632 3300005578 Bacteria 547
207 Ga0070702_100002324 3300005615 Bacteria 8161
208 Ga0070702_100007796 3300005615 Bacteria 5148
209 Ga0070702_100514605 3300005615 Unclassified 881
210 Ga0070702_100558626 3300005615 Bacteria 851
211 Ga0070702_101215629 3300005615 Bacteria 608
212 Ga0068852_100810607 3300005616 Bacteria 950
213 Ga0068852_100886909 3300005616 Unclassified 909
214 Ga0068852_101516008 3300005616 Unclassified 693
215 Ga0068852_102072823 3300005616 Unclassified 591
216 Ga0068859_100016807 3300005617 Bacteria 7346
217 Ga0068859_100285080 3300005617 Bacteria 1745
218 Ga0068859_100420107 3300005617 Bacteria 1433
219 Ga0068859_100564248 3300005617 Unclassified 1232
220 Ga0068859_100574149 3300005617 Bacteria 1221
221 Ga0068859_100830737 3300005617 Bacteria 1010
222 Ga0068859_101406391 3300005617 Unclassified 769
223 Ga0068859_102086860 3300005617 Bacteria 626
224 Ga0068859_102656725 3300005617 Bacteria 550
225 Ga0068864_100069393 3300005618 Unclassified 3065
226 Ga0068864_100223427 3300005618 Bacteria 1738
227 Ga0068864_100339804 3300005618 Bacteria 1414
228 Ga0068864_100477918 3300005618 Bacteria 1196
229 Ga0068864_101137501 3300005618 Unclassified 778
230 Ga0068864_101853849 3300005618 Unclassified 608
231 Ga0068864_101974074 3300005618 Bacteria 589
232 Ga0068864_102402404 3300005618 Bacteria 533
233 Ga0068866_10225298 3300005718 Bacteria 1134
234 Ga0068866_11036697 3300005718 Bacteria 585
235 Ga0068861_100014688 3300005719 Bacteria 5499
236 Ga0068861_100174518 3300005719 Bacteria 1784
237 Ga0068861_100407567 3300005719 Unclassified 1208
238 Ga0068861_100834891 3300005719 Bacteria 867
239 Ga0068861_100853150 3300005719 Bacteria 859
240 Ga0068861_101959658 3300005719 Unclassified 584
241 Ga0068851_10000848 3300005834 Bacteria 13156
242 Ga0068851_10720943 3300005834 Bacteria 615
243 Ga0068851_10796651 3300005834 Unclassified 587
244 Ga0068870_10223609 3300005840 Unclassified 1153
245 Ga0068870_10430057 3300005840 Unclassified 866
246 Ga0068863_100031948 3300005841 Bacteria 5020
247 Ga0068863_100215435 3300005841 Unclassified 1849
248 Ga0068863_100497297 3300005841 Bacteria 1200
249 Ga0068863_100509549 3300005841 Bacteria 1185
250 Ga0068863_100752322 3300005841 Unclassified 970
251 Ga0068863_101909979 3300005841 Unclassified 604
252 Ga0068858_100018054 3300005842 Bacteria 6606
253 Ga0068858_100042392 3300005842 Bacteria 4220
254 Ga0068858_100133198 3300005842 Bacteria 2331
255 Ga0068858_100321714 3300005842 Bacteria 1478
256 Ga0068858_100518501 3300005842 Bacteria 1152
257 Ga0068858_101358998 3300005842 Bacteria 699
258 Ga0068858_102166749 3300005842 Unclassified 550
259 Ga0068860_100044221 3300005843 Bacteria 4245
260 Ga0068860_100078252 3300005843 Bacteria 3145
261 Ga0068860_100349608 3300005843 Bacteria 1455
262 Ga0068860_100434234 3300005843 Bacteria 1303
263 Ga0068860_100831785 3300005843 Bacteria 937
264 Ga0068860_100952417 3300005843 Unclassified 876
265 Ga0068860_101278315 3300005843 Bacteria 754
266 Ga0068860_101803649 3300005843 Bacteria 633
267 Ga0068862_100266106 3300005844 Bacteria 1566
268 Ga0068862_100361241 3300005844 Bacteria 1350
269 Ga0068862_100705968 3300005844 Unclassified 977
270 Ga0068862_100729124 3300005844 Unclassified 962
271 Ga0068862_102096275 3300005844 Unclassified 577
272 Ga0068862_102227036 3300005844 Unclassified 559
273 Ga0081455_10289527 3300005937 Bacteria 1180
274 Ga0081539_10000490 3300005985 Bacteria 83577
275 Ga0081539_10029862 3300005985 Bacteria 3397
276 Ga0081539_10370012 3300005985 Unclassified 599
277 Ga0097621_100144601 3300006237 Unclassified 2035
278 Ga0068871_100241804 3300006358 Unclassified 1569
279 Ga0075430_100021529 3300006846 Bacteria 5480
280 Ga0075430_101545250 3300006846 Unclassified 545
281 Ga0075431_100117513 3300006847 Unclassified 2744
282 Ga0075431_100635074 3300006847 Bacteria 1049
283 Ga0075433_10411102 3300006852 Bacteria 1194
284 Ga0075433_10613847 3300006852 Unclassified 954
285 Ga0075433_10981446 3300006852 Unclassified 736
286 Ga0075434_100037822 3300006871 Bacteria 4777
287 Ga0075429_100045122 3300006880 Unclassified 3834
288 Ga0075429_100525919 3300006880 Unclassified 1036
289 Ga0075429_101385107 3300006880 Unclassified 612
290 Ga0068865_100713272 3300006881 Unclassified 858
291 Ga0068865_101894812 3300006881 Unclassified 540
292 Ga0075436_100386699 3300006914 Bacteria 1012
293 Ga0097620_100016807 3300006931 Bacteria 7346
294 Ga0097620_100285070 3300006931 Bacteria 1745
295 Ga0097620_100420106 3300006931 Bacteria 1433
296 Ga0097620_100564283 3300006931 Unclassified 1232
297 Ga0097620_100574153 3300006931 Bacteria 1221
298 Ga0097620_100830757 3300006931 Bacteria 1010
299 Ga0097620_101406330 3300006931 Unclassified 769
300 Ga0097620_102086848 3300006931 Bacteria 626
301 Ga0097620_102656733 3300006931 Bacteria 550
302 Ga0105251_10160794 3300009011 Bacteria 1012
303 Ga0105251_10640493 3300009011 Bacteria 507
304 Ga0105244_10216551 3300009036 Unclassified 899
305 Ga0105250_10533719 3300009092 Unclassified 536
306 Ga0105250_10551424 3300009092 Unclassified 529
307 Ga0105240_11251541 3300009093 Unclassified 784
308 Ga0111539_12388586 3300009094 Unclassified 613
309 Ga0105245_10309114 3300009098 Bacteria 1554
310 Ga0105245_11218104 3300009098 Unclassified 801
311 Ga0105245_11754054 3300009098 Bacteria 673
312 Ga0105247_10124098 3300009101 Unclassified 1676
313 Ga0105247_10201510 3300009101 Bacteria 1338
314 Ga0105247_10317797 3300009101 Bacteria 1085
315 Ga0105247_10382811 3300009101 Bacteria 998
316 Ga0114129_10007188 3300009147 Bacteria 15845
317 Ga0114129_10066866 3300009147 Bacteria 5012
318 Ga0114129_10277212 3300009147 Bacteria 2241
319 Ga0114129_10288917 3300009147 Bacteria 2189
320 Ga0114129_11018961 3300009147 Bacteria 1041
321 Ga0114129_12474775 3300009147 Unclassified 621
322 Ga0114129_13522319 3300009147 Bacteria 500
323 Ga0105243_10269137 3300009148 Bacteria 1529
324 Ga0105243_10413434 3300009148 Bacteria 1256
325 Ga0105243_10805877 3300009148 Bacteria 926
326 Ga0105243_10825206 3300009148 Bacteria 916
327 Ga0105243_11549460 3300009148 Bacteria 688
328 Ga0105243_11559434 3300009148 Bacteria 686
329 Ga0105243_11891466 3300009148 Bacteria 629
330 Ga0105241_10044049 3300009174 Bacteria 3381
331 Ga0105241_10309365 3300009174 Bacteria 1359
332 Ga0105241_10392573 3300009174 Bacteria 1215
333 Ga0105241_11311472 3300009174 Unclassified 690
334 Ga0105241_11597558 3300009174 Unclassified 631
335 Ga0105241_12692813 3300009174 Unclassified 501
336 Ga0105242_10100665 3300009176 Bacteria 2448
337 Ga0105242_10583272 3300009176 Bacteria 1077
338 Ga0105242_11013438 3300009176 Bacteria 839
339 Ga0105248_10364345 3300009177 Bacteria 1627
340 Ga0105248_10833748 3300009177 Bacteria 1041
341 Ga0105248_10996577 3300009177 Bacteria 946
342 Ga0105237_10005294 3300009545 Bacteria 14589
343 Ga0105237_10599702 3300009545 Bacteria 1108
344 Ga0105237_10992068 3300009545 Unclassified 847
345 Ga0105238_10231192 3300009551 Bacteria 1826
346 Ga0105238_13061225 3300009551 Unclassified 502
347 Ga0105249_10000028 3300009553 Bacteria 230039
348 Ga0105249_10305239 3300009553 Bacteria 1598
349 Ga0105249_10759045 3300009553 Bacteria 1032
350 Ga0105239_10192876 3300010375 Bacteria 2281
351 Ga0105239_11553507 3300010375 Unclassified 765
352 Ga0105246_10278351 3300011119 Unclassified 1341
353 Ga0105246_10695883 3300011119 Bacteria 890
354 Ga0105246_11341850 3300011119 Bacteria 665
355 Ga0105246_12454030 3300011119 Unclassified 512
356 Ga0157373_10097815 3300013100 Bacteria 2066
357 Ga0157373_10347431 3300013100 Bacteria 1058
358 Ga0157373_10831642 3300013100 Unclassified 682
359 Ga0157371_10882374 3300013102 Unclassified 677
360 Ga0157371_10955441 3300013102 Unclassified 652
361 Ga0157371_11322040 3300013102 Bacteria 558
362 Ga0157374_10323192 3300013296 Unclassified 1529
363 Ga0157374_11702205 3300013296 Unclassified 655
364 Ga0157378_10099126 3300013297 Bacteria 2658
365 Ga0157378_10302406 3300013297 Bacteria 1548
366 Ga0157378_10851756 3300013297 Bacteria 940
367 Ga0157378_12685789 3300013297 Unclassified 550
368 Ga0163162_10000027 3300013306 Bacteria 178451
369 Ga0163162_10004493 3300013306 Bacteria 13436
370 Ga0163162_10013845 3300013306 Bacteria 7879
371 Ga0163162_10101936 3300013306 Bacteria 2963
372 Ga0163162_10258572 3300013306 Bacteria 1873
373 Ga0163162_11070767 3300013306 Bacteria 913
374 Ga0163162_12432720 3300013306 Unclassified 602
375 Ga0157372_10304284 3300013307 Bacteria 1855
376 Ga0157372_10318219 3300013307 Bacteria 1812
377 Ga0157372_11586271 3300013307 Unclassified 753
378 Ga0157372_12992482 3300013307 Bacteria 540
379 Ga0157375_10002762 3300013308 Bacteria 15184
380 Ga0157375_10340747 3300013308 Unclassified 1665
381 Ga0157375_10722615 3300013308 Bacteria 1149
382 Ga0157375_12696920 3300013308 Unclassified 594
383 Ga0157375_13169695 3300013308 Bacteria 549
384 Ga0163163_10001393 3300014325 Bacteria 20428
385 Ga0163163_10009368 3300014325 Bacteria 8739
386 Ga0163163_10099364 3300014325 Unclassified 2931
387 Ga0163163_10160106 3300014325 Unclassified 2296
388 Ga0163163_10788702 3300014325 Bacteria 1013
389 Ga0163163_10922498 3300014325 Unclassified 937
390 Ga0157380_11526641 3300014326 Bacteria 722
391 Ga0157380_12091273 3300014326 Unclassified 629
392 Ga0157380_12781057 3300014326 Unclassified 556
393 Ga0157377_10094410 3300014745 Unclassified 1772
394 Ga0157377_10198088 3300014745 Bacteria 1273
395 Ga0157377_10825916 3300014745 Unclassified 686
396 Ga0157377_11313204 3300014745 Bacteria 566
397 Ga0157379_10026575 3300014968 Bacteria 5152
398 Ga0157379_10162034 3300014968 Bacteria 2019
399 Ga0157379_10432173 3300014968 Bacteria 1213
400 Ga0157376_11647191 3300014969 Unclassified 676
401 Ga0182007_10079208 3300015262 Bacteria 1077
402 Ga0163161_10040407 3300017792 Unclassified 3350
403 Ga0207697_10098235 3300025315 Bacteria 1246
404 Ga0207656_10004963 3300025321 Bacteria 4673
405 Ga0207653_10003558 3300025885 Bacteria 4903
406 Ga0207653_10169486 3300025885 Unclassified 812
407 Ga0207642_10452048 3300025899 Unclassified 778
408 Ga0207642_11131331 3300025899 Bacteria 507
409 Ga0207710_10008492 3300025900 Bacteria 4330
410 Ga0207710_10205829 3300025900 Bacteria 973
411 Ga0207710_10283924 3300025900 Unclassified 833
412 Ga0207710_10773271 3300025900 Unclassified 505
413 Ga0207688_10318439 3300025901 Bacteria 954
414 Ga0207688_10717587 3300025901 Bacteria 632
415 Ga0207647_10079153 3300025904 Bacteria 1973
416 Ga0207647_10629160 3300025904 Unclassified 590
417 Ga0207645_10090573 3300025907 Bacteria 1967
418 Ga0207645_10227501 3300025907 Bacteria 1230
419 Ga0207645_10688949 3300025907 Unclassified 694
420 Ga0207643_10137278 3300025908 Bacteria 1458
421 Ga0207643_10188376 3300025908 Bacteria 1251
422 Ga0207643_10520696 3300025908 Unclassified 761
423 Ga0207684_10000091 3300025910 Bacteria 170468
424 Ga0207654_10006752 3300025911 Bacteria 5770
425 Ga0207654_10273609 3300025911 Bacteria 1140
426 Ga0207654_10776957 3300025911 Unclassified 691
427 Ga0207654_11111803 3300025911 Unclassified 576
428 Ga0207654_11280543 3300025911 Unclassified 534
429 Ga0207707_10008032 3300025912 Bacteria 9165
430 Ga0207707_10045093 3300025912 Unclassified 3842
431 Ga0207671_10003947 3300025914 Bacteria 14441
432 Ga0207671_11266894 3300025914 Bacteria 575
433 Ga0207660_10303744 3300025917 Bacteria 1271
434 Ga0207660_10410251 3300025917 Bacteria 1092
435 Ga0207660_11273852 3300025917 Bacteria 597
436 Ga0207660_11477042 3300025917 Unclassified 550
437 Ga0207662_10122000 3300025918 Bacteria 1635
438 Ga0207662_10131656 3300025918 Unclassified 1577
439 Ga0207662_10167634 3300025918 Unclassified 1407
440 Ga0207662_11303556 3300025918 Unclassified 516
441 Ga0207657_10163242 3300025919 Bacteria 1808
442 Ga0207657_10195246 3300025919 Unclassified 1631
443 Ga0207649_10032690 3300025920 Unclassified 3103
444 Ga0207652_10006447 3300025921 Bacteria 9465
445 Ga0207652_10146103 3300025921 Bacteria 2117
446 Ga0207646_10203644 3300025922 Bacteria 1788
447 Ga0207646_10686172 3300025922 Unclassified 916
448 Ga0207681_10015730 3300025923 Bacteria 4723
449 Ga0207650_10000009 3300025925 Bacteria 483583
450 Ga0207650_10110117 3300025925 Bacteria 2131
451 Ga0207650_10141796 3300025925 Unclassified 1890
452 Ga0207650_10161047 3300025925 Bacteria 1778
453 Ga0207650_11502086 3300025925 Unclassified 573
454 Ga0207650_11762968 3300025925 Unclassified 524
455 Ga0207659_10867283 3300025926 Unclassified 776
456 Ga0207659_11539618 3300025926 Unclassified 568
457 Ga0207687_10365061 3300025927 Bacteria 1179
458 Ga0207687_10557124 3300025927 Bacteria 962
459 Ga0207687_11457728 3300025927 Bacteria 588
460 Ga0207644_10011332 3300025931 Bacteria 5898
461 Ga0207644_11322089 3300025931 Unclassified 606
462 Ga0207690_10003883 3300025932 Bacteria 8834
463 Ga0207690_10065757 3300025932 Bacteria 2481
464 Ga0207690_11049613 3300025932 Unclassified 678
465 Ga0207690_11066882 3300025932 Unclassified 673
466 Ga0207706_10237889 3300025933 Unclassified 1592
467 Ga0207706_10467949 3300025933 Bacteria 1090
468 Ga0207686_10562935 3300025934 Bacteria 892
469 Ga0207709_10617950 3300025935 Unclassified 860
470 Ga0207709_11463854 3300025935 Unclassified 566
471 Ga0207670_10611742 3300025936 Bacteria 895
472 Ga0207670_10867419 3300025936 Bacteria 755
473 Ga0207670_10872773 3300025936 Bacteria 752
474 Ga0207670_11296653 3300025936 Unclassified 617
475 Ga0207670_11335806 3300025936 Bacteria 608
476 Ga0207670_11445406 3300025936 Unclassified 584
477 Ga0207704_10229136 3300025938 Bacteria 1380
478 Ga0207704_11432052 3300025938 Unclassified 592
479 Ga0207665_10110571 3300025939 Bacteria 1930
480 Ga0207691_10924414 3300025940 Bacteria 730
481 Ga0207691_10961492 3300025940 Unclassified 713
482 Ga0207691_11034737 3300025940 Bacteria 685
483 Ga0207711_10043908 3300025941 Bacteria 3814
484 Ga0207711_10331010 3300025941 Bacteria 1408
485 Ga0207711_10878940 3300025941 Bacteria 834
486 Ga0207711_10885227 3300025941 Unclassified 830
487 Ga0207689_10011031 3300025942 Bacteria 7767
488 Ga0207689_10015777 3300025942 Bacteria 6395
489 Ga0207689_10041179 3300025942 Bacteria 3822
490 Ga0207689_10216808 3300025942 Bacteria 1581
491 Ga0207689_10342603 3300025942 Bacteria 1242
492 Ga0207689_10380093 3300025942 Bacteria 1176
493 Ga0207689_10442958 3300025942 Unclassified 1085
494 Ga0207661_10203346 3300025944 Unclassified 1742
495 Ga0207679_10011417 3300025945 Bacteria 5753
496 Ga0207679_10471156 3300025945 Bacteria 1117
497 Ga0207679_10537018 3300025945 Bacteria 1048
498 Ga0207667_11518200 3300025949 Unclassified 640
499 Ga0207651_10153669 3300025960 Bacteria 1795
500 Ga0207651_10158826 3300025960 Unclassified 1770
501 Ga0207651_10857905 3300025960 Unclassified 807
502 Ga0207651_11379338 3300025960 Unclassified 634
503 Ga0207712_10001718 3300025961 Bacteria 14698
504 Ga0207712_10016423 3300025961 Unclassified 4793
505 Ga0207712_10407367 3300025961 Unclassified 1144
506 Ga0207712_11370832 3300025961 Bacteria 632
507 Ga0207668_10007028 3300025972 Bacteria 6677
508 Ga0207640_10397910 3300025981 Bacteria 1121
509 Ga0207640_10499666 3300025981 Bacteria 1012
510 Ga0207640_10907806 3300025981 Unclassified 770
511 Ga0207658_11449629 3300025986 Unclassified 628
512 Ga0207677_11373038 3300026023 Unclassified 650
513 Ga0207703_10015882 3300026035 Bacteria 5873
514 Ga0207703_10120978 3300026035 Bacteria 2247
515 Ga0207703_10296923 3300026035 Bacteria 1472
516 Ga0207703_10689131 3300026035 Bacteria 971
517 Ga0207703_10725025 3300026035 Bacteria 946
518 Ga0207703_10729238 3300026035 Unclassified 943
519 Ga0207703_11803244 3300026035 Unclassified 588
520 Ga0207639_10028669 3300026041 Bacteria 4067
521 Ga0207639_11358013 3300026041 Unclassified 667
522 Ga0207639_12085120 3300026041 Bacteria 528
523 Ga0207639_12114338 3300026041 Unclassified 524
524 Ga0207639_12214691 3300026041 Unclassified 511
525 Ga0207678_10698280 3300026067 Unclassified 893
526 Ga0207708_10037033 3300026075 Unclassified 3716
527 Ga0207708_10175740 3300026075 Bacteria 1698
528 Ga0207708_10826821 3300026075 Bacteria 798
529 Ga0207708_10842291 3300026075 Unclassified 791
530 Ga0207708_11137010 3300026075 Unclassified 681
531 Ga0207708_11561186 3300026075 Unclassified 580
532 Ga0207641_10129484 3300026088 Bacteria 2264
533 Ga0207641_10204259 3300026088 Bacteria 1824
534 Ga0207641_10470863 3300026088 Bacteria 1216
535 Ga0207641_10513853 3300026088 Bacteria 1164
536 Ga0207641_11095820 3300026088 Bacteria 795
537 Ga0207648_10151302 3300026089 Bacteria 2048
538 Ga0207676_10043894 3300026095 Unclassified 3445
539 Ga0207676_10241597 3300026095 Bacteria 1620
540 Ga0207676_10292071 3300026095 Bacteria 1485
541 Ga0207676_10332229 3300026095 Bacteria 1399
542 Ga0207676_10399902 3300026095 Unclassified 1283
543 Ga0207676_10417538 3300026095 Unclassified 1257
544 Ga0207676_11289478 3300026095 Bacteria 725
545 Ga0207676_11399363 3300026095 Bacteria 695
546 Ga0207674_10000036 3300026116 Bacteria 135434
547 Ga0207674_10066891 3300026116 Bacteria 3619
548 Ga0207674_10673254 3300026116 Bacteria 999
549 Ga0207674_10834006 3300026116 Unclassified 889
550 Ga0207674_10861772 3300026116 Bacteria 873
551 Ga0207674_11038202 3300026116 Bacteria 789
552 Ga0207674_11725105 3300026116 Unclassified 594
553 Ga0207674_12113227 3300026116 Unclassified 527
554 Ga0207675_100067134 3300026118 Bacteria 3352
555 Ga0207675_100181842 3300026118 Bacteria 2014
556 Ga0207675_100195871 3300026118 Unclassified 1939
557 Ga0207675_101016447 3300026118 Bacteria 848
558 Ga0207675_101182502 3300026118 Unclassified 785
559 Ga0207675_102196984 3300026118 Unclassified 567
560 Ga0207683_10624720 3300026121 Bacteria 998
561 Ga0207683_10759699 3300026121 Unclassified 899
562 Ga0207698_10512463 3300026142 Bacteria 1169
563 Ga0207698_11567264 3300026142 Bacteria 674
564 Ga0268265_10885298 3300028380 Unclassified 876
565 Ga0268265_10918358 3300028380 Unclassified 860
566 Ga0268265_11822723 3300028380 Bacteria 615
567 Ga0268265_12353814 3300028380 Unclassified 539
568 Ga0268265_12684010 3300028380 Bacteria 503
569 Ga0268264_10075352 3300028381 Bacteria 2869
570 Ga0268264_10078781 3300028381 Bacteria 2810
571 Ga0268264_10643993 3300028381 Bacteria 1048
572 Ga0268264_10821398 3300028381 Bacteria 930
573 Ga0268264_11059423 3300028381 Unclassified 819
574 Ga0268264_11863752 3300028381 Unclassified 611
575 Ga0307408_100426068 3300031548 Bacteria 1145
576 Ga0307408_100556521 3300031548 Unclassified 1013
577 Ga0307408_100685228 3300031548 Bacteria 920
578 Ga0307408_100856105 3300031548 Unclassified 829
579 Ga0307408_101133587 3300031548 Unclassified 727
580 Ga0307405_11247536 3300031731 Unclassified 645
581 Ga0307405_11631395 3300031731 Unclassified 570
582 Ga0307413_10754196 3300031824 Unclassified 814
583 Ga0307416_100132052 3300032002 Bacteria 2250
584 Ga0307416_100143694 3300032002 Bacteria 2174
585 Ga0307416_101491034 3300032002 Bacteria 782
586 Ga0307416_101556258 3300032002 Bacteria 767
587 Ga0307414_10856802 3300032004 Bacteria 831
588 Ga0307411_10676698 3300032005 Bacteria 896
589 Ga0307415_100023989 3300032126 Bacteria 3800
590 Ga0373948_0105202 3300034817 Unclassified 669
591 Ga0373950_0078090 3300034818 Unclassified 688
592 Ga0373951_0001688 3300035091 Bacteria 5766
593 Ga0373951_0124713 3300035091 Unclassified 704
594 Ga0373960_0138548 3300035121 Bacteria 822
595 Ga0373961_0259836 3300035241 Unclassified 631
596 Ga0373961_0295853 3300035241 Unclassified 598
597 Ga0373962_0251361 3300035242 Unclassified 614
598 Ga0373931_0751801 3300035691 Unclassified 647
599 Ga0373931_0943186 3300035691 Unclassified 582
600 Ga0395899_0764866 3300037312 Bacteria 600
601 Ga0395900_0290185 3300037418 Unclassified 1625
602 Ga0395900_1901571 3300037418 Bacteria 506
603 Ga0395898_0674436 3300037466 Unclassified 976
604 Ga0395898_1642299 3300037466 Unclassified 566
605 Ga0395905_0223705 3300037471 Unclassified 1761
606 Ga0395905_1464829 3300037471 Unclassified 587
607 Ga0395905_1510135 3300037471 Unclassified 576
608 Ga0395901_0170337 3300038443 Unclassified 2285
609 Ga0242419_000455 3300038698 Bacteria 2215
610 Ga0242422_00080 3300038699 Bacteria 4316
611 Ga0242420_005371 3300038996 Bacteria 1983
612 Ga0439453_0080511 3300041408 Unclassified 702
613 Ga0439449_0230508 3300042007 Unclassified 695
614 Ga0439455_0234306 3300042012 Unclassified 536
615 Ga0439464_0183318 3300042439 Bacteria 664
616 Ga0451576_0520303 3300045051 Unclassified 1250
617 Ga0451576_0939079 3300045051 Bacteria 907
618 Ga0496100_0444505 3300048903 Unclassified 993
619 Ga0496102_0723540 3300048905 Bacteria 918
620 Ga0496102_1458864 3300048905 Unclassified 603
621 Ga0496103_0907719 3300048906 Unclassified 552
622 Ga0496106_0001964 3300048909 Bacteria 15456
623 Ga0496106_0367154 3300048909 Bacteria 1156
624 Ga0496107_0191841 3300048910 Unclassified 1518
625 Ga0496107_0195981 3300048910 Bacteria 1501
626 Ga0496108_0095863 3300048911 Bacteria 2527
627 Ga0496109_1485888 3300048912 Bacteria 613
628 Ga0496109_1986136 3300048912 Unclassified 514
629 Ga0496112_0131984 3300048915 Bacteria 2469
630 Ga0496112_0395415 3300048915 Bacteria 1322
631 Ga0496112_0423212 3300048915 Bacteria 1270
632 Ga0496112_0915106 3300048915 Bacteria 799
633 Ga0496113_0179483 3300048916 Unclassified 1678
634 Ga0496113_0575438 3300048916 Bacteria 903
635 Ga0496113_0764746 3300048916 Bacteria 769
636 Ga0496113_1172119 3300048916 Unclassified 601
637 Ga0501306_019546 3300049127 Bacteria 935
638 Ga0501308_009513 3300049128 Bacteria 1063
639 Ga0501308_046915 3300049128 Unclassified 623
640 Ga0501308_073064 3300049128 Unclassified 535
641 Ga0501309_014838 3300049129 Unclassified 1049
642 Ga0501309_070228 3300049129 Unclassified 575
643 Ga0501309_077684 3300049129 Unclassified 553
644 Ga0501310_011900 3300049130 Bacteria 990
645 Ga0501310_014984 3300049130 Bacteria 916
646 Ga0501310_049239 3300049130 Unclassified 606
647 Ga0501305_012241 3300049161 Bacteria 1171
648 Ga0501307_014759 3300049162 Bacteria 958
649 Ga0501291_117324 3300049514 Bacteria 573
650 Ga0501311_011142 3300049527 Bacteria 1103
651 Ga0501311_056905 3300049527 Unclassified 624
652 Ga0501312_015522 3300049528 Bacteria 1081
653 Ga0501314_026585 3300049530 Unclassified 627
654 Ga0501316_009472 3300049532 Bacteria 1093
655 Ga0501317_020759 3300049533 Bacteria 887
656 Ga0501321_029939 3300049537 Unclassified 723
657 Ga0501323_073463 3300049539 Unclassified 550
658 Ga0501324_006140 3300049540 Bacteria 1004
659 Ga0501325_015498 3300049541 Unclassified 753
660 Ga0501330_013268 3300049546 Unclassified 610
661 Ga0501339_01140 3300049555 Unclassified 641
662 Ga0501217_302767 3300049661 Bacteria 528
663 Ga0501250_028656 3300049680 Unclassified 762
664 Ga0501259_030391 3300049688 Bacteria 1016
665 Ga0501260_012529 3300049689 Unclassified 868
666 Ga0501225_0052753 3300049705 Bacteria 1134
667 Ga0501226_014670 3300049853 Bacteria 865
668 nmdc:mga05p37_2058550_c1 3300050507 Unclassified 537
669 nmdc:mga05p37_259373_c1 3300050507 Bacteria 2081
670 nmdc:mga05p37_32950_c1 3300050507 Bacteria 6343
671 nmdc:mga05p37_492638_c1 3300050507 Unclassified 1409
672 nmdc:mga05p37_492939_c1 3300050507 Unclassified 1408
673 nmdc:mga09592_1079486_c1 3300050508 Bacteria 668
674 nmdc:mga09592_20950_c1 3300050508 Bacteria 5383
675 nmdc:mga09592_758869_c1 3300050508 Unclassified 823
676 nmdc:mga0qj67_54870_c1 3300050509 Unclassified 3156
677 nmdc:mga0qj67_739185_c1 3300050509 Unclassified 781
678 nmdc:mga06r32_415707_c1 3300050510 Bacteria 1326
679 nmdc:mga06r32_78102_c1 3300050510 Unclassified 3217
680 nmdc:mga0n895_18579_c1 3300050512 Bacteria 6437
681 nmdc:mga0rr50_67904_c1 3300050513 Bacteria 2710
682 nmdc:mga08x19_687075_c1 3300050514 Unclassified 726
683 nmdc:mga0a205_1061890_c1 3300050515 Unclassified 657
684 nmdc:mga0a205_1460829_c1 3300050515 Unclassified 532
685 nmdc:mga0a205_764375_c1 3300050515 Unclassified 815
686 nmdc:mga0a205_850680_c1 3300050515 Unclassified 759
687 Ga0587093_032826 3300059478 Bacteria 755
688 Ga0587093_044801 3300059478 Unclassified 682
689 Ga0587070_067724 3300059491 Bacteria 754
690 Ga0587070_125743 3300059491 Bacteria 618
691 Ga0587077_093894 3300059493 Unclassified 710
692 Ga0587077_234696 3300059493 Unclassified 523
693 Ga0587077_236569 3300059493 Unclassified 522
694 Ga0587085_035205 3300059506 Bacteria 845
695 Ga0587085_104132 3300059506 Unclassified 603
696 Ga0587101_043404 3300059623 Bacteria 750
697 Ga0587109_204333 3300059624 Bacteria 516
698 Ga0587117_038010 3300059627 Bacteria 755
699 Ga0587062_042817 3300059639 Bacteria 741
700 Ga0587068_087431 3300059641 Unclassified 638
701 Ga0587072_145688 3300059643 Unclassified 568
702 Ga0587124_035602 3300059660 Unclassified 566
703 Ga0587071_150140 3300060344 Unclassified 579
704 Ga0587111_0052161 3300060346 Bacteria 906
705 Ga0587111_0087802 3300060346 Bacteria 754
706 Ga0075428_101607027
707 MRS2a_Contig_5286
708 SwRhRL2b_contig_1654826
709 SwRhRL2b_contig_1832240
710 JGI24749J21850_1004603
711 JGI24751J29686_10000016
712 JGI25406J46586_10024086
713 Ga0007416J51690_1058726
714 Ga0007416J51690_1100015
715 Ga0058859_10004319
716 Ga0058859_10012182
717 Ga0058859_10022403
718 Ga0058859_10056669
719 Ga0058859_10056793
720 Ga0058859_11790054
721 Ga0058859_11821714
722 Ga0058863_10012707
723 Ga0058863_11473085
724 Ga0058863_11774124
725 Ga0058860_11748693
726 Ga0058860_11798911
727 Ga0058860_12107265
728 Ga0058860_12177989
729 Ga0058862_12137975
730 Ga0058862_12770453
731 Ga0058862_12868416
732 Ga0065714_10064507
733 Ga0065704_10114662
734 Ga0065704_10148170
735 Ga0065704_10199263
736 Ga0065704_10212129
737 Ga0065712_10000138
738 Ga0065712_10009836
739 Ga0065712_10137765
740 Ga0065712_10360971
741 Ga0065712_10732532
742 Ga0065715_10001087
743 Ga0065715_10030631
744 Ga0065715_10089648
745 Ga0065715_10092194
746 Ga0065715_10153651
747 Ga0065715_10281266
748 Ga0065715_10420410
749 Ga0065715_10624246
750 Ga0065715_10716057
751 Ga0065715_10888638
752 Ga0065715_10989295
753 Ga0065707_10001679
754 Ga0065707_10016458
755 Ga0065707_10024395
756 Ga0065707_10027396
757 Ga0065707_10106816
758 Ga0065707_10564542
759 Ga0065707_10686074
760 Ga0070676_10580356
761 Ga0070683_100222668
762 Ga0070690_100215418
763 Ga0070690_100800055
764 Ga0070670_100031206
765 Ga0070670_100081556
766 Ga0070670_100322955
767 Ga0070670_100335403
768 Ga0070670_100674329
769 Ga0070670_101109589
770 Ga0070670_102053547
771 Ga0070677_10389284
772 Ga0068869_100004585
773 Ga0068869_100017565
774 Ga0068869_100888047
775 Ga0070680_100193871
776 Ga0070680_101571761
777 Ga0070682_100015534
778 Ga0070682_100598490
779 Ga0068868_100731663
780 Ga0070660_100064931
781 Ga0070660_100448788
782 Ga0070689_100194748
783 Ga0070689_100447443
784 Ga0070689_101789300
785 Ga0070689_101914678
786 Ga0070689_101971678
787 Ga0070689_102041606
788 Ga0070689_102097241
789 Ga0070687_100025153
790 Ga0070687_100039031
791 Ga0070687_101040394
792 Ga0070661_100042830
793 Ga0070661_100748812
794 Ga0070692_10319093
795 Ga0070692_10322359
796 Ga0070692_10605317
797 Ga0070668_101122237
798 Ga0070669_100031317
799 Ga0070675_101519650
800 Ga0070671_100013825
801 Ga0070671_100277978
802 Ga0070671_100553799
803 Ga0070674_100835694
804 Ga0070673_101098696
805 Ga0070673_101933490
806 Ga0070688_100573188
807 Ga0070659_100081773
808 Ga0070659_100244028
809 Ga0070659_100602553
810 Ga0070659_101028902
811 Ga0070667_100424959
812 Ga0070667_101132627
813 Ga0070667_101304031
814 Ga0070703_10002856
815 Ga0070701_10026826
816 Ga0070701_10159731
817 Ga0070701_10702258
818 Ga0070705_100003994
819 Ga0070705_100414768
820 Ga0070705_100552881
821 Ga0070705_100761279
822 Ga0070705_101524246
823 Ga0070705_101603799
824 Ga0070700_100104765
825 Ga0070700_100253428
826 Ga0070700_100719019
827 Ga0070700_100740272
828 Ga0070694_100010935
829 Ga0070694_100021214
830 Ga0070694_100244181
831 Ga0070694_100891983
832 Ga0070694_101865000
833 Ga0070708_100075065
834 Ga0070678_100878596
835 Ga0070662_100486075
836 Ga0070662_100592814
837 Ga0070662_101833631
838 Ga0070681_10049172
839 Ga0068867_100595425
840 Ga0068867_101069505
841 Ga0070685_11384939
842 Ga0070685_11593484
843 Ga0070706_100000085
844 Ga0070707_100141351
845 Ga0070707_101480138
846 Ga0070698_100007491
847 Ga0070698_100076743
848 Ga0070698_101303131
849 Ga0070699_100006028
850 Ga0070699_100015177
851 Ga0070699_100204446
852 Ga0070699_101361445
853 Ga0070679_100006500
854 Ga0070679_100090286
855 Ga0070684_100223224
856 Ga0070697_100000205
857 Ga0070697_100056690
858 Ga0070697_100097972
859 Ga0070697_100374710
860 Ga0068853_100085215
861 Ga0068853_101156578
862 Ga0068853_102462708
863 Ga0070672_100307162
864 Ga0070672_100604223
865 Ga0070672_100868375
866 Ga0070672_101118074
867 Ga0070686_100429776
868 Ga0070686_100508677
869 Ga0070695_100105840
870 Ga0070695_100188652
871 Ga0070695_100194021
872 Ga0070695_100249943
873 Ga0070695_100259848
874 Ga0070695_100351269
875 Ga0070695_100586022
876 Ga0070695_100955274
877 Ga0070695_101193192
878 Ga0070696_100271190
879 Ga0070696_100314974
880 Ga0070696_101143041
881 Ga0070696_101171119
882 Ga0070696_101205291
883 Ga0070696_101367100
884 Ga0070693_100001191
885 Ga0070693_100018937
886 Ga0070693_100046247
887 Ga0070693_100163506
888 Ga0070693_100194235
889 Ga0070693_100289000
890 Ga0070693_100618525
891 Ga0070704_100046349
892 Ga0070704_100455243
893 Ga0070704_100603592
894 Ga0070704_100653168
895 Ga0070704_100946884
896 Ga0070664_100153430
897 Ga0070664_100221388
898 Ga0070664_100225597
899 Ga0070664_100493695
900 Ga0070664_100960049
901 Ga0070664_101410135
902 Ga0068857_100047832
903 Ga0068857_100070370
904 Ga0068857_100505627
905 Ga0068857_100511823
906 Ga0068857_100882566
907 Ga0068857_101409113
908 Ga0068854_100118427
909 Ga0068854_100523042
910 Ga0068854_100745737
911 Ga0068854_101904632
912 Ga0070702_100002324
913 Ga0070702_100007796
914 Ga0070702_100514605
915 Ga0070702_100558626
916 Ga0070702_101215629
917 Ga0068852_100810607
918 Ga0068852_100886909
919 Ga0068852_101516008
920 Ga0068852_102072823
921 Ga0068859_100016807
922 Ga0068859_100285080
923 Ga0068859_100420107
924 Ga0068859_100564248
925 Ga0068859_100574149
926 Ga0068859_100830737
927 Ga0068859_101406391
928 Ga0068859_102086860
929 Ga0068859_102656725
930 Ga0068864_100069393
931 Ga0068864_100223427
932 Ga0068864_100339804
933 Ga0068864_100477918
934 Ga0068864_101137501
935 Ga0068864_101853849
936 Ga0068864_101974074
937 Ga0068864_102402404
938 Ga0068866_10225298
939 Ga0068866_11036697
940 Ga0068861_100014688
941 Ga0068861_100174518
942 Ga0068861_100407567
943 Ga0068861_100834891
944 Ga0068861_100853150
945 Ga0068861_101959658
946 Ga0068851_10000848
947 Ga0068851_10720943
948 Ga0068851_10796651
949 Ga0068870_10223609
950 Ga0068870_10430057
951 Ga0068863_100031948
952 Ga0068863_100215435
953 Ga0068863_100497297
954 Ga0068863_100509549
955 Ga0068863_100752322
956 Ga0068863_101909979
957 Ga0068858_100018054
958 Ga0068858_100042392
959 Ga0068858_100133198
960 Ga0068858_100321714
961 Ga0068858_100518501
962 Ga0068858_101358998
963 Ga0068858_102166749
964 Ga0068860_100044221
965 Ga0068860_100078252
966 Ga0068860_100349608
967 Ga0068860_100434234
968 Ga0068860_100831785
969 Ga0068860_100952417
970 Ga0068860_101278315
971 Ga0068860_101803649
972 Ga0068862_100266106
973 Ga0068862_100361241
974 Ga0068862_100705968
975 Ga0068862_100729124
976 Ga0068862_102096275
977 Ga0068862_102227036
978 Ga0081455_10289527
979 Ga0081539_10000490
980 Ga0081539_10029862
981 Ga0081539_10370012
982 Ga0097621_100144601
983 Ga0068871_100241804
984 Ga0075430_100021529
985 Ga0075430_101545250
986 Ga0075431_100117513
987 Ga0075431_100635074
988 Ga0075433_10411102
989 Ga0075433_10613847
990 Ga0075433_10981446
991 Ga0075434_100037822
992 Ga0075429_100045122
993 Ga0075429_100525919
994 Ga0075429_101385107
995 Ga0068865_100713272
996 Ga0068865_101894812
997 Ga0075436_100386699
998 Ga0097620_100016807
999 Ga0097620_100285070
1000 Ga0097620_100420106
1001 Ga0097620_100564283
1002 Ga0097620_100574153
1003 Ga0097620_100830757
1004 Ga0097620_101406330
1005 Ga0097620_102086848
1006 Ga0097620_102656733
1007 Ga0105251_10160794
1008 Ga0105251_10640493
1009 Ga0105244_10216551
1010 Ga0105250_10533719
1011 Ga0105250_10551424
1012 Ga0105240_11251541
1013 Ga0111539_12388586
1014 Ga0105245_10309114
1015 Ga0105245_11218104
1016 Ga0105245_11754054
1017 Ga0105247_10124098
1018 Ga0105247_10201510
1019 Ga0105247_10317797
1020 Ga0105247_10382811
1021 Ga0114129_10007188
1022 Ga0114129_10066866
1023 Ga0114129_10277212
1024 Ga0114129_10288917
1025 Ga0114129_11018961
1026 Ga0114129_12474775
1027 Ga0114129_13522319
1028 Ga0105243_10269137
1029 Ga0105243_10413434
1030 Ga0105243_10805877
1031 Ga0105243_10825206
1032 Ga0105243_11549460
1033 Ga0105243_11559434
1034 Ga0105243_11891466
1035 Ga0105241_10044049
1036 Ga0105241_10309365
1037 Ga0105241_10392573
1038 Ga0105241_11311472
1039 Ga0105241_11597558
1040 Ga0105241_12692813
1041 Ga0105242_10100665
1042 Ga0105242_10583272
1043 Ga0105242_11013438
1044 Ga0105248_10364345
1045 Ga0105248_10833748
1046 Ga0105248_10996577
1047 Ga0105237_10005294
1048 Ga0105237_10599702
1049 Ga0105237_10992068
1050 Ga0105238_10231192
1051 Ga0105238_13061225
1052 Ga0105249_10000028
1053 Ga0105249_10305239
1054 Ga0105249_10759045
1055 Ga0105239_10192876
1056 Ga0105239_11553507
1057 Ga0105246_10278351
1058 Ga0105246_10695883
1059 Ga0105246_11341850
1060 Ga0105246_12454030
1061 Ga0157373_10097815
1062 Ga0157373_10347431
1063 Ga0157373_10831642
1064 Ga0157371_10882374
1065 Ga0157371_10955441
1066 Ga0157371_11322040
1067 Ga0157374_10323192
1068 Ga0157374_11702205
1069 Ga0157378_10099126
1070 Ga0157378_10302406
1071 Ga0157378_10851756
1072 Ga0157378_12685789
1073 Ga0163162_10000027
1074 Ga0163162_10004493
1075 Ga0163162_10013845
1076 Ga0163162_10101936
1077 Ga0163162_10258572
1078 Ga0163162_11070767
1079 Ga0163162_12432720
1080 Ga0157372_10304284
1081 Ga0157372_10318219
1082 Ga0157372_11586271
1083 Ga0157372_12992482
1084 Ga0157375_10002762
1085 Ga0157375_10340747
1086 Ga0157375_10722615
1087 Ga0157375_12696920
1088 Ga0157375_13169695
1089 Ga0163163_10001393
1090 Ga0163163_10009368
1091 Ga0163163_10099364
1092 Ga0163163_10160106
1093 Ga0163163_10788702
1094 Ga0163163_10922498
1095 Ga0157380_11526641
1096 Ga0157380_12091273
1097 Ga0157380_12781057
1098 Ga0157377_10094410
1099 Ga0157377_10198088
1100 Ga0157377_10825916
1101 Ga0157377_11313204
1102 Ga0157379_10026575
1103 Ga0157379_10162034
1104 Ga0157379_10432173
1105 Ga0157376_11647191
1106 Ga0182007_10079208
1107 Ga0163161_10040407
1108 Ga0207697_10098235
1109 Ga0207656_10004963
1110 Ga0207653_10003558
1111 Ga0207653_10169486
1112 Ga0207642_10452048
1113 Ga0207642_11131331
1114 Ga0207710_10008492
1115 Ga0207710_10205829
1116 Ga0207710_10283924
1117 Ga0207710_10773271
1118 Ga0207688_10318439
1119 Ga0207688_10717587
1120 Ga0207647_10079153
1121 Ga0207647_10629160
1122 Ga0207645_10090573
1123 Ga0207645_10227501
1124 Ga0207645_10688949
1125 Ga0207643_10137278
1126 Ga0207643_10188376
1127 Ga0207643_10520696
1128 Ga0207684_10000091
1129 Ga0207654_10006752
1130 Ga0207654_10273609
1131 Ga0207654_10776957
1132 Ga0207654_11111803
1133 Ga0207654_11280543
1134 Ga0207707_10008032
1135 Ga0207707_10045093
1136 Ga0207671_10003947
1137 Ga0207671_11266894
1138 Ga0207660_10303744
1139 Ga0207660_10410251
1140 Ga0207660_11273852
1141 Ga0207660_11477042
1142 Ga0207662_10122000
1143 Ga0207662_10131656
1144 Ga0207662_10167634
1145 Ga0207662_11303556
1146 Ga0207657_10163242
1147 Ga0207657_10195246
1148 Ga0207649_10032690
1149 Ga0207652_10006447
1150 Ga0207652_10146103
1151 Ga0207646_10203644
1152 Ga0207646_10686172
1153 Ga0207681_10015730
1154 Ga0207650_10000009
1155 Ga0207650_10110117
1156 Ga0207650_10141796
1157 Ga0207650_10161047
1158 Ga0207650_11502086
1159 Ga0207650_11762968
1160 Ga0207659_10867283
1161 Ga0207659_11539618
1162 Ga0207687_10365061
1163 Ga0207687_10557124
1164 Ga0207687_11457728
1165 Ga0207644_10011332
1166 Ga0207644_11322089
1167 Ga0207690_10003883
1168 Ga0207690_10065757
1169 Ga0207690_11049613
1170 Ga0207690_11066882
1171 Ga0207706_10237889
1172 Ga0207706_10467949
1173 Ga0207686_10562935
1174 Ga0207709_10617950
1175 Ga0207709_11463854
1176 Ga0207670_10611742
1177 Ga0207670_10867419
1178 Ga0207670_10872773
1179 Ga0207670_11296653
1180 Ga0207670_11335806
1181 Ga0207670_11445406
1182 Ga0207704_10229136
1183 Ga0207704_11432052
1184 Ga0207665_10110571
1185 Ga0207691_10924414
1186 Ga0207691_10961492
1187 Ga0207691_11034737
1188 Ga0207711_10043908
1189 Ga0207711_10331010
1190 Ga0207711_10878940
1191 Ga0207711_10885227
1192 Ga0207689_10011031
1193 Ga0207689_10015777
1194 Ga0207689_10041179
1195 Ga0207689_10216808
1196 Ga0207689_10342603
1197 Ga0207689_10380093
1198 Ga0207689_10442958
1199 Ga0207661_10203346
1200 Ga0207679_10011417
1201 Ga0207679_10471156
1202 Ga0207679_10537018
1203 Ga0207667_11518200
1204 Ga0207651_10153669
1205 Ga0207651_10158826
1206 Ga0207651_10857905
1207 Ga0207651_11379338
1208 Ga0207712_10001718
1209 Ga0207712_10016423
1210 Ga0207712_10407367
1211 Ga0207712_11370832
1212 Ga0207668_10007028
1213 Ga0207640_10397910
1214 Ga0207640_10499666
1215 Ga0207640_10907806
1216 Ga0207658_11449629
1217 Ga0207677_11373038
1218 Ga0207703_10015882
1219 Ga0207703_10120978
1220 Ga0207703_10296923
1221 Ga0207703_10689131
1222 Ga0207703_10725025
1223 Ga0207703_10729238
1224 Ga0207703_11803244
1225 Ga0207639_10028669
1226 Ga0207639_11358013
1227 Ga0207639_12085120
1228 Ga0207639_12114338
1229 Ga0207639_12214691
1230 Ga0207678_10698280
1231 Ga0207708_10037033
1232 Ga0207708_10175740
1233 Ga0207708_10826821
1234 Ga0207708_10842291
1235 Ga0207708_11137010
1236 Ga0207708_11561186
1237 Ga0207641_10129484
1238 Ga0207641_10204259
1239 Ga0207641_10470863
1240 Ga0207641_10513853
1241 Ga0207641_11095820
1242 Ga0207648_10151302
1243 Ga0207676_10043894
1244 Ga0207676_10241597
1245 Ga0207676_10292071
1246 Ga0207676_10332229
1247 Ga0207676_10399902
1248 Ga0207676_10417538
1249 Ga0207676_11289478
1250 Ga0207676_11399363
1251 Ga0207674_10000036
1252 Ga0207674_10066891
1253 Ga0207674_10673254
1254 Ga0207674_10834006
1255 Ga0207674_10861772
1256 Ga0207674_11038202
1257 Ga0207674_11725105
1258 Ga0207674_12113227
1259 Ga0207675_100067134
1260 Ga0207675_100181842
1261 Ga0207675_100195871
1262 Ga0207675_101016447
1263 Ga0207675_101182502
1264 Ga0207675_102196984
1265 Ga0207683_10624720
1266 Ga0207683_10759699
1267 Ga0207698_10512463
1268 Ga0207698_11567264
1269 Ga0268265_10885298
1270 Ga0268265_10918358
1271 Ga0268265_11822723
1272 Ga0268265_12353814
1273 Ga0268265_12684010
1274 Ga0268264_10075352
1275 Ga0268264_10078781
1276 Ga0268264_10643993
1277 Ga0268264_10821398
1278 Ga0268264_11059423
1279 Ga0268264_11863752
1280 Ga0307408_100426068
1281 Ga0307408_100556521
1282 Ga0307408_100685228
1283 Ga0307408_100856105
1284 Ga0307408_101133587
1285 Ga0307405_11247536
1286 Ga0307405_11631395
1287 Ga0307413_10754196
1288 Ga0307416_100132052
1289 Ga0307416_100143694
1290 Ga0307416_101491034
1291 Ga0307416_101556258
1292 Ga0307414_10856802
1293 Ga0307411_10676698
1294 Ga0307415_100023989
1295 Ga0373948_0105202
1296 Ga0373950_0078090
1297 Ga0373951_0001688
1298 Ga0373951_0124713
1299 Ga0373960_0138548
1300 Ga0373961_0259836
1301 Ga0373961_0295853
1302 Ga0373962_0251361
1303 Ga0373931_0751801
1304 Ga0373931_0943186
1305 Ga0395899_0764866
1306 Ga0395900_0290185
1307 Ga0395900_1901571
1308 Ga0395898_0674436
1309 Ga0395898_1642299
1310 Ga0395905_0223705
1311 Ga0395905_1464829
1312 Ga0395905_1510135
1313 Ga0395901_0170337
1314 Ga0242419_000455
1315 Ga0242422_00080
1316 Ga0242420_005371
1317 Ga0439453_0080511
1318 Ga0439449_0230508
1319 Ga0439455_0234306
1320 Ga0439464_0183318
1321 Ga0451576_0520303
1322 Ga0451576_0939079
1323 Ga0496100_0444505
1324 Ga0496102_0723540
1325 Ga0496102_1458864
1326 Ga0496103_0907719
1327 Ga0496106_0001964
1328 Ga0496106_0367154
1329 Ga0496107_0191841
1330 Ga0496107_0195981
1331 Ga0496108_0095863
1332 Ga0496109_1485888
1333 Ga0496109_1986136
1334 Ga0496112_0131984
1335 Ga0496112_0395415
1336 Ga0496112_0423212
1337 Ga0496112_0915106
1338 Ga0496113_0179483
1339 Ga0496113_0575438
1340 Ga0496113_0764746
1341 Ga0496113_1172119
1342 Ga0501306_019546
1343 Ga0501308_009513
1344 Ga0501308_046915
1345 Ga0501308_073064
1346 Ga0501309_014838
1347 Ga0501309_070228
1348 Ga0501309_077684
1349 Ga0501310_011900
1350 Ga0501310_014984
1351 Ga0501310_049239
1352 Ga0501305_012241
1353 Ga0501307_014759
1354 Ga0501291_117324
1355 Ga0501311_011142
1356 Ga0501311_056905
1357 Ga0501312_015522
1358 Ga0501314_026585
1359 Ga0501316_009472
1360 Ga0501317_020759
1361 Ga0501321_029939
1362 Ga0501323_073463
1363 Ga0501324_006140
1364 Ga0501325_015498
1365 Ga0501330_013268
1366 Ga0501339_01140
1367 Ga0501217_302767
1368 Ga0501250_028656
1369 Ga0501259_030391
1370 Ga0501260_012529
1371 Ga0501225_0052753
1372 Ga0501226_014670
1373 nmdc:mga05p37_2058550_c1
1374 nmdc:mga05p37_259373_c1
1375 nmdc:mga05p37_32950_c1
1376 nmdc:mga05p37_492638_c1
1377 nmdc:mga05p37_492939_c1
1378 nmdc:mga09592_1079486_c1
1379 nmdc:mga09592_20950_c1
1380 nmdc:mga09592_758869_c1
1381 nmdc:mga0qj67_54870_c1
1382 nmdc:mga0qj67_739185_c1
1383 nmdc:mga06r32_415707_c1
1384 nmdc:mga06r32_78102_c1
1385 nmdc:mga0n895_18579_c1
1386 nmdc:mga0rr50_67904_c1
1387 nmdc:mga08x19_687075_c1
1388 nmdc:mga0a205_1061890_c1
1389 nmdc:mga0a205_1460829_c1
1390 nmdc:mga0a205_764375_c1
1391 nmdc:mga0a205_850680_c1
1392 Ga0587093_032826
1393 Ga0587093_044801
1394 Ga0587070_067724
1395 Ga0587070_125743
1396 Ga0587077_093894
1397 Ga0587077_234696
1398 Ga0587077_236569
1399 Ga0587085_035205
1400 Ga0587085_104132
1401 Ga0587101_043404
1402 Ga0587109_204333
1403 Ga0587117_038010
1404 Ga0587062_042817
1405 Ga0587068_087431
1406 Ga0587072_145688
1407 Ga0587124_035602
1408 Ga0587071_150140
1409 Ga0587111_0052161
1410 Ga0587111_0087802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map