F481684

General Info

Members Datasets Scaffolds Average Seq Length
807 321 1614 89

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_11567274|Ga0207663_115672741
Length 93
Sequence LLVLETGSADMSTRKQSQAAKRNVKQAQKTIKHLPKETRSALGRQGAAVAQRKRAGGSSPKTRAELYKMARQRDLPGRSKMGRDELARKLGEK

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
96 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
198 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
199 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
200 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
201 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
202 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.18
Metatranscriptomes 5.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 5.08
Rhizosphere 92.69
Stem 0
Stem Tuber 0
Unclassified 17.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_11567274 3300025916 Unclassified 530
2 JGI25407J50210_10018823 3300003373 Bacteria 1795
3 JGI25407J50210_10040248 3300003373 Bacteria 1198
4 JGI25407J50210_10128071 3300003373 Bacteria 625
5 Ga0058863_11265689 3300004799 Bacteria 651
6 Ga0070658_10089982 3300005327 Bacteria 2528
7 Ga0070658_10099813 3300005327 Bacteria 2399
8 Ga0070658_10268828 3300005327 Bacteria 1449
9 Ga0068869_100656907 3300005334 Unclassified 891
10 Ga0070680_100082601 3300005336 Unclassified 2652
11 Ga0070680_100382014 3300005336 Bacteria 1199
12 Ga0070680_101160501 3300005336 Bacteria 668
13 Ga0070682_100483396 3300005337 Bacteria 956
14 Ga0070682_100963143 3300005337 Unclassified 706
15 Ga0068868_100453357 3300005338 Bacteria 1116
16 Ga0068868_100841292 3300005338 Unclassified 831
17 Ga0070660_100913108 3300005339 Bacteria 741
18 Ga0070660_101723461 3300005339 Bacteria 534
19 Ga0070689_102184248 3300005340 Unclassified 507
20 Ga0070661_100084247 3300005344 Unclassified 2349
21 Ga0070661_101380542 3300005344 Bacteria 592
22 Ga0070692_10712082 3300005345 Bacteria 677
23 Ga0070659_100052102 3300005366 Bacteria 3218
24 Ga0070709_10171475 3300005434 Unclassified 1516
25 Ga0070709_10183124 3300005434 Unclassified 1472
26 Ga0070709_10584044 3300005434 Bacteria 858
27 Ga0070709_11024649 3300005434 Bacteria 657
28 Ga0070709_11409779 3300005434 Unclassified 564
29 Ga0070714_100010662 3300005435 Bacteria 7271
30 Ga0070714_100020292 3300005435 Bacteria 5425
31 Ga0070714_100046929 3300005435 Bacteria 3666
32 Ga0070714_100053413 3300005435 Bacteria 3449
33 Ga0070714_100078924 3300005435 Bacteria 2862
34 Ga0070714_100151958 3300005435 Bacteria 2087
35 Ga0070714_100307051 3300005435 Unclassified 1480
36 Ga0070714_100340074 3300005435 Bacteria 1407
37 Ga0070714_101574358 3300005435 Bacteria 642
38 Ga0070713_100009281 3300005436 Bacteria 7032
39 Ga0070713_100030647 3300005436 Bacteria 4273
40 Ga0070713_100050053 3300005436 Bacteria 3449
41 Ga0070713_100207489 3300005436 Unclassified 1772
42 Ga0070713_100299380 3300005436 Unclassified 1480
43 Ga0070713_101027518 3300005436 Unclassified 795
44 Ga0070713_101599634 3300005436 Bacteria 632
45 Ga0070713_101617308 3300005436 Bacteria 629
46 Ga0070710_10006389 3300005437 Bacteria 5661
47 Ga0070710_10021709 3300005437 Bacteria 3351
48 Ga0070710_10148380 3300005437 Unclassified 1444
49 Ga0070710_10447984 3300005437 Bacteria 874
50 Ga0070710_10959879 3300005437 Bacteria 620
51 Ga0070711_100100227 3300005439 Bacteria 2106
52 Ga0070711_100220026 3300005439 Unclassified 1475
53 Ga0070711_100464120 3300005439 Unclassified 1038
54 Ga0070711_100690986 3300005439 Bacteria 858
55 Ga0070711_101191650 3300005439 Bacteria 658
56 Ga0070705_100007045 3300005440 Bacteria 5526
57 Ga0070708_100396595 3300005445 Bacteria 1301
58 Ga0070708_100761990 3300005445 Bacteria 910
59 Ga0070708_101316466 3300005445 Bacteria 675
60 Ga0070708_101885844 3300005445 Unclassified 554
61 Ga0070708_102084366 3300005445 Unclassified 525
62 Ga0070663_100310057 3300005455 Bacteria 1266
63 Ga0070663_100562027 3300005455 Unclassified 955
64 Ga0070663_100578642 3300005455 Unclassified 942
65 Ga0070678_100073819 3300005456 Bacteria 2561
66 Ga0070678_101203656 3300005456 Bacteria 702
67 Ga0070681_10010595 3300005458 Bacteria 9108
68 Ga0070681_10621985 3300005458 Unclassified 994
69 Ga0070706_100000939 3300005467 Bacteria 31876
70 Ga0070706_100007212 3300005467 Bacteria 10446
71 Ga0070706_100018337 3300005467 Bacteria 6457
72 Ga0070706_100020451 3300005467 Bacteria 6101
73 Ga0070707_100000166 3300005468 Bacteria 63590
74 Ga0070707_100004101 3300005468 Bacteria 13683
75 Ga0070707_100020974 3300005468 Bacteria 6170
76 Ga0070707_100323204 3300005468 Bacteria 1499
77 Ga0070707_100440272 3300005468 Bacteria 1264
78 Ga0070698_100000006 3300005471 Bacteria 129236
79 Ga0070698_100011358 3300005471 Bacteria 9453
80 Ga0070698_100020214 3300005471 Bacteria 6981
81 Ga0070698_100337701 3300005471 Bacteria 1438
82 Ga0070698_100779910 3300005471 Bacteria 899
83 Ga0070699_100396398 3300005518 Bacteria 1247
84 Ga0070699_100620868 3300005518 Unclassified 986
85 Ga0070679_100187194 3300005530 Unclassified 2040
86 Ga0070679_100674063 3300005530 Bacteria 977
87 Ga0070679_101523290 3300005530 Bacteria 616
88 Ga0070684_100094120 3300005535 Bacteria 2668
89 Ga0070684_100616459 3300005535 Bacteria 1009
90 Ga0070684_100796859 3300005535 Bacteria 883
91 Ga0070697_100170674 3300005536 Bacteria 1841
92 Ga0070686_100191865 3300005544 Bacteria 1459
93 Ga0070686_100392319 3300005544 Unclassified 1053
94 Ga0070695_100542894 3300005545 Unclassified 905
95 Ga0070695_101580510 3300005545 Bacteria 547
96 Ga0070696_100146121 3300005546 Bacteria 1732
97 Ga0070696_100248366 3300005546 Bacteria 1345
98 Ga0070693_100165614 3300005547 Bacteria 1411
99 Ga0070665_100101876 3300005548 Unclassified 2875
100 Ga0070704_100071467 3300005549 Unclassified 2521
101 Ga0068855_100686104 3300005563 Bacteria 1097
102 Ga0068855_101229658 3300005563 Bacteria 778
103 Ga0068855_101698651 3300005563 Bacteria 644
104 Ga0070664_100971997 3300005564 Archaea 797
105 Ga0070664_101176355 3300005564 Unclassified 723
106 Ga0068857_100855787 3300005577 Bacteria 870
107 Ga0068857_100868040 3300005577 Bacteria 864
108 Ga0068857_100925787 3300005577 Bacteria 837
109 Ga0068854_100736964 3300005578 Bacteria 854
110 Ga0068856_100026347 3300005614 Bacteria 5669
111 Ga0068856_100162308 3300005614 Bacteria 2245
112 Ga0068856_100437340 3300005614 Unclassified 1328
113 Ga0068856_100626947 3300005614 Bacteria 1096
114 Ga0070702_100024635 3300005615 Bacteria 3213
115 Ga0068852_100017352 3300005616 Bacteria 5646
116 Ga0068852_102297328 3300005616 Unclassified 560
117 Ga0068870_10239997 3300005840 Bacteria 1118
118 Ga0068863_100448235 3300005841 Unclassified 1266
119 Ga0068863_102348576 3300005841 Unclassified 543
120 Ga0068858_100422153 3300005842 Unclassified 1282
121 Ga0068860_100167390 3300005843 Bacteria 2122
122 Ga0081455_10054105 3300005937 Bacteria 3423
123 Ga0081455_10082617 3300005937 Bacteria 2627
124 Ga0081455_10554349 3300005937 Unclassified 759
125 Ga0081538_10000635 3300005981 Bacteria 38947
126 Ga0081538_10003841 3300005981 Bacteria 14036
127 Ga0081538_10004099 3300005981 Bacteria 13548
128 Ga0081538_10005257 3300005981 Bacteria 11689
129 Ga0081538_10008316 3300005981 Bacteria 8833
130 Ga0081538_10073319 3300005981 Bacteria 1871
131 Ga0081538_10110826 3300005981 Bacteria 1348
132 Ga0081538_10116631 3300005981 Bacteria 1295
133 Ga0081539_10024682 3300005985 Bacteria 3893
134 Ga0081539_10138950 3300005985 Bacteria 1183
135 Ga0070717_10062603 3300006028 Bacteria 3086
136 Ga0070717_10098365 3300006028 Bacteria 2480
137 Ga0070717_10126499 3300006028 Bacteria 2194
138 Ga0070717_10189906 3300006028 Bacteria 1795
139 Ga0070717_10281032 3300006028 Unclassified 1476
140 Ga0070717_11116885 3300006028 Bacteria 718
141 Ga0075365_10110665 3300006038 Bacteria 1887
142 Ga0075365_10393309 3300006038 Bacteria 978
143 Ga0070715_10003458 3300006163 Bacteria 5025
144 Ga0070715_10009201 3300006163 Bacteria 3473
145 Ga0070715_10013051 3300006163 Bacteria 3042
146 Ga0070715_10042129 3300006163 Unclassified 1917
147 Ga0070715_10156705 3300006163 Bacteria 1121
148 Ga0070716_100001899 3300006173 Bacteria 9483
149 Ga0070716_100026860 3300006173 Bacteria 3086
150 Ga0070716_100140236 3300006173 Unclassified 1540
151 Ga0070716_100236424 3300006173 Bacteria 1236
152 Ga0070716_100425841 3300006173 Bacteria 961
153 Ga0070716_100770281 3300006173 Bacteria 742
154 Ga0070716_101012555 3300006173 Bacteria 657
155 Ga0070716_101030017 3300006173 Bacteria 652
156 Ga0070712_100016737 3300006175 Bacteria 4740
157 Ga0070712_100031273 3300006175 Bacteria 3584
158 Ga0070712_100167835 3300006175 Unclassified 1700
159 Ga0070712_100203670 3300006175 Unclassified 1556
160 Ga0070712_100873727 3300006175 Bacteria 774
161 Ga0070712_101153564 3300006175 Bacteria 673
162 Ga0097621_100584403 3300006237 Bacteria 1019
163 Ga0068871_100534227 3300006358 Bacteria 1060
164 Ga0068871_101946245 3300006358 Unclassified 559
165 Ga0075428_100648274 3300006844 Unclassified 1126
166 Ga0075428_100823437 3300006844 Bacteria 986
167 Ga0075430_100739953 3300006846 Bacteria 811
168 Ga0075430_101656038 3300006846 Bacteria 525
169 Ga0075433_10091668 3300006852 Bacteria 2687
170 Ga0075434_100052596 3300006871 Bacteria 4047
171 Ga0075434_100460198 3300006871 Bacteria 1293
172 Ga0075434_101116615 3300006871 Unclassified 801
173 Ga0075429_100260889 3300006880 Unclassified 1517
174 Ga0075436_100034851 3300006914 Bacteria 3472
175 Ga0075436_100163174 3300006914 Bacteria 1571
176 Ga0075436_100274973 3300006914 Bacteria 1203
177 Ga0075436_100746234 3300006914 Bacteria 727
178 Ga0075436_100765468 3300006914 Bacteria 718
179 Ga0075435_100084390 3300007076 Bacteria 2613
180 Ga0075435_100142665 3300007076 Unclassified 2010
181 Ga0075435_100173424 3300007076 Bacteria 1820
182 Ga0075435_100236315 3300007076 Bacteria 1553
183 Ga0075435_101573308 3300007076 Bacteria 577
184 Ga0099795_10461520 3300007788 Unclassified 586
185 Ga0105251_10195194 3300009011 Unclassified 912
186 Ga0105240_10761005 3300009093 Bacteria 1052
187 Ga0111539_10083731 3300009094 Bacteria 3750
188 Ga0111539_10278012 3300009094 Bacteria 1948
189 Ga0105247_10375284 3300009101 Bacteria 1007
190 Ga0114129_10009365 3300009147 Bacteria 13966
191 Ga0114129_10967132 3300009147 Unclassified 1074
192 Ga0114129_11852284 3300009147 Bacteria 733
193 Ga0105243_12046420 3300009148 Bacteria 608
194 Ga0105241_10244356 3300009174 Bacteria 1519
195 Ga0105241_10934283 3300009174 Bacteria 807
196 Ga0105242_10129411 3300009176 Unclassified 2177
197 Ga0105237_10277930 3300009545 Bacteria 1677
198 Ga0105237_10854221 3300009545 Bacteria 917
199 Ga0105238_10130511 3300009551 Unclassified 2491
200 Ga0105238_10339739 3300009551 Bacteria 1489
201 Ga0105249_10456944 3300009553 Unclassified 1316
202 Ga0105246_10166146 3300011119 Bacteria 1685
203 Ga0154016_131472 3300013045 Bacteria 987
204 Ga0157373_10084177 3300013100 Unclassified 2242
205 Ga0157370_10090426 3300013104 Bacteria 2874
206 Ga0157369_10002422 3300013105 Bacteria 22422
207 Ga0157369_10016802 3300013105 Bacteria 8225
208 Ga0157369_10217237 3300013105 Bacteria 2002
209 Ga0157369_10229004 3300013105 Bacteria 1943
210 Ga0157369_10496770 3300013105 Unclassified 1262
211 Ga0157374_10107907 3300013296 Bacteria 2676
212 Ga0157374_12062421 3300013296 Bacteria 597
213 Ga0157378_10021358 3300013297 Bacteria 5692
214 Ga0163162_10436036 3300013306 Unclassified 1442
215 Ga0157372_10097103 3300013307 Bacteria 3359
216 Ga0157372_11951715 3300013307 Bacteria 675
217 Ga0157375_10423515 3300013308 Bacteria 1497
218 Ga0157375_10761315 3300013308 Bacteria 1119
219 Ga0163163_10410551 3300014325 Unclassified 1413
220 Ga0163163_11113648 3300014325 Bacteria 852
221 Ga0182008_10162088 3300014497 Bacteria 1126
222 Ga0157379_11127867 3300014968 Bacteria 752
223 Ga0157376_10503846 3300014969 Unclassified 1190
224 Ga0157376_10762414 3300014969 Bacteria 978
225 Ga0182005_1079799 3300015265 Bacteria 903
226 Ga0197907_10101199 3300020069 Bacteria 544
227 Ga0197907_10249360 3300020069 Unclassified 603
228 Ga0197907_10503529 3300020069 Bacteria 3157
229 Ga0197907_10946039 3300020069 Bacteria 823
230 Ga0197907_11025201 3300020069 Bacteria 758
231 Ga0197907_11250657 3300020069 Bacteria 5884
232 Ga0206356_10829837 3300020070 Bacteria 1209
233 Ga0206356_11058141 3300020070 Bacteria 978
234 Ga0206356_11516356 3300020070 Bacteria 650
235 Ga0206356_11739667 3300020070 Bacteria 2712
236 Ga0206349_1452561 3300020075 Bacteria 1404
237 Ga0206349_1457924 3300020075 Bacteria 1729
238 Ga0206349_1943060 3300020075 Bacteria 963
239 Ga0206355_1444598 3300020076 Bacteria 1572
240 Ga0206355_1529971 3300020076 Bacteria 824
241 Ga0206351_10332592 3300020077 Bacteria 1145
242 Ga0206351_10354766 3300020077 Unclassified 584
243 Ga0206351_10741260 3300020077 Bacteria 1812
244 Ga0206351_10902751 3300020077 Bacteria 779
245 Ga0206350_10270511 3300020080 Bacteria 663
246 Ga0206350_11064801 3300020080 Bacteria 533
247 Ga0206350_11240311 3300020080 Bacteria 666
248 Ga0206350_11356179 3300020080 Bacteria 651
249 Ga0206350_11420438 3300020080 Bacteria 1718
250 Ga0206354_10519068 3300020081 Bacteria 774
251 Ga0206354_10572110 3300020081 Bacteria 1429
252 Ga0206354_10612338 3300020081 Bacteria 998
253 Ga0206354_11485858 3300020081 Bacteria 1206
254 Ga0206353_10714114 3300020082 Bacteria 2698
255 Ga0206353_10840274 3300020082 Bacteria 502
256 Ga0206353_10865515 3300020082 Bacteria 1247
257 Ga0206353_11353822 3300020082 Bacteria 3171
258 Ga0154015_1580273 3300020610 Bacteria 634
259 Ga0154015_1661415 3300020610 Bacteria 782
260 Ga0213875_10125934 3300021388 Bacteria 1197
261 Ga0213875_10314853 3300021388 Unclassified 741
262 Ga0213875_10489172 3300021388 Unclassified 591
263 Ga0224712_10005170 3300022467 Bacteria 3605
264 Ga0224712_10016014 3300022467 Bacteria 2453
265 Ga0224712_10046345 3300022467 Bacteria 1668
266 Ga0224712_10046507 3300022467 Bacteria 1666
267 Ga0224712_10095591 3300022467 Bacteria 1251
268 Ga0224712_10175039 3300022467 Bacteria 964
269 Ga0224712_10229901 3300022467 Unclassified 851
270 Ga0224712_10379496 3300022467 Bacteria 671
271 Ga0224712_10384847 3300022467 Unclassified 667
272 Ga0207692_10003841 3300025898 Bacteria 5903
273 Ga0207692_10046482 3300025898 Bacteria 2176
274 Ga0207692_10103755 3300025898 Bacteria 1566
275 Ga0207692_10174777 3300025898 Bacteria 1247
276 Ga0207692_10185222 3300025898 Unclassified 1215
277 Ga0207688_10984093 3300025901 Bacteria 533
278 Ga0207680_10474645 3300025903 Bacteria 889
279 Ga0207647_10155324 3300025904 Bacteria 1336
280 Ga0207685_10000749 3300025905 Bacteria 5928
281 Ga0207685_10277700 3300025905 Bacteria 821
282 Ga0207685_10283588 3300025905 Bacteria 814
283 Ga0207699_10001111 3300025906 Bacteria 12725
284 Ga0207699_10004397 3300025906 Bacteria 6740
285 Ga0207699_10052772 3300025906 Bacteria 2408
286 Ga0207699_10181150 3300025906 Bacteria 1416
287 Ga0207699_10379288 3300025906 Bacteria 1003
288 Ga0207699_10412320 3300025906 Bacteria 964
289 Ga0207699_11185001 3300025906 Unclassified 566
290 Ga0207705_10119042 3300025909 Bacteria 1958
291 Ga0207705_10261881 3300025909 Bacteria 1320
292 Ga0207684_10050186 3300025910 Bacteria 3539
293 Ga0207684_10074627 3300025910 Bacteria 2881
294 Ga0207684_10357140 3300025910 Bacteria 1257
295 Ga0207654_10302508 3300025911 Bacteria 1088
296 Ga0207654_10793509 3300025911 Unclassified 684
297 Ga0207654_11102585 3300025911 Unclassified 578
298 Ga0207707_10102195 3300025912 Bacteria 2505
299 Ga0207707_10538047 3300025912 Unclassified 993
300 Ga0207707_11091966 3300025912 Bacteria 651
301 Ga0207695_10684055 3300025913 Bacteria 906
302 Ga0207671_11033363 3300025914 Unclassified 647
303 Ga0207693_10013495 3300025915 Bacteria 6585
304 Ga0207693_10019026 3300025915 Bacteria 5467
305 Ga0207693_10026835 3300025915 Bacteria 4556
306 Ga0207693_10359365 3300025915 Unclassified 1139
307 Ga0207663_10000281 3300025916 Bacteria 22286
308 Ga0207663_10022532 3300025916 Bacteria 3602
309 Ga0207663_10069536 3300025916 Bacteria 2265
310 Ga0207663_10206939 3300025916 Bacteria 1419
311 Ga0207663_10349235 3300025916 Bacteria 1119
312 Ga0207663_10435090 3300025916 Bacteria 1009
313 Ga0207660_10527705 3300025917 Unclassified 959
314 Ga0207649_10262970 3300025920 Unclassified 1247
315 Ga0207652_10319223 3300025921 Bacteria 1402
316 Ga0207652_10660530 3300025921 Unclassified 934
317 Ga0207646_10000049 3300025922 Bacteria 171680
318 Ga0207646_10008672 3300025922 Bacteria 10155
319 Ga0207646_10010500 3300025922 Bacteria 9041
320 Ga0207646_10244809 3300025922 Bacteria 1620
321 Ga0207694_10588886 3300025924 Unclassified 935
322 Ga0207687_10968963 3300025927 Bacteria 729
323 Ga0207700_10000703 3300025928 Bacteria 19387
324 Ga0207700_10003873 3300025928 Bacteria 8744
325 Ga0207700_10004961 3300025928 Bacteria 7909
326 Ga0207700_10036458 3300025928 Bacteria 3552
327 Ga0207700_10047849 3300025928 Bacteria 3173
328 Ga0207700_10406204 3300025928 Bacteria 1194
329 Ga0207700_10723312 3300025928 Bacteria 889
330 Ga0207700_11084340 3300025928 Bacteria 716
331 Ga0207664_10001364 3300025929 Bacteria 16039
332 Ga0207664_10016099 3300025929 Bacteria 5447
333 Ga0207664_10035079 3300025929 Unclassified 3868
334 Ga0207664_10036347 3300025929 Bacteria 3807
335 Ga0207664_10051349 3300025929 Bacteria 3255
336 Ga0207664_10058393 3300025929 Bacteria 3069
337 Ga0207664_10074708 3300025929 Bacteria 2739
338 Ga0207664_10093295 3300025929 Bacteria 2472
339 Ga0207664_10180942 3300025929 Bacteria 1810
340 Ga0207664_10312694 3300025929 Bacteria 1384
341 Ga0207664_11489587 3300025929 Bacteria 598
342 Ga0207644_10234209 3300025931 Unclassified 1460
343 Ga0207709_11268446 3300025935 Bacteria 608
344 Ga0207665_10034231 3300025939 Bacteria 3371
345 Ga0207665_10072912 3300025939 Bacteria 2347
346 Ga0207665_10115944 3300025939 Bacteria 1887
347 Ga0207665_10435702 3300025939 Bacteria 1003
348 Ga0207689_10008124 3300025942 Bacteria 9154
349 Ga0207661_10915117 3300025944 Unclassified 808
350 Ga0207661_12178361 3300025944 Bacteria 501
351 Ga0207679_10503199 3300025945 Archaea 1081
352 Ga0207679_11069673 3300025945 Bacteria 740
353 Ga0207667_10928543 3300025949 Bacteria 861
354 Ga0207712_10888107 3300025961 Bacteria 787
355 Ga0207640_10980351 3300025981 Bacteria 742
356 Ga0207677_11917027 3300026023 Unclassified 551
357 Ga0207703_10785721 3300026035 Unclassified 908
358 Ga0207703_11429856 3300026035 Bacteria 665
359 Ga0207678_10080258 3300026067 Bacteria 2793
360 Ga0207678_10451563 3300026067 Bacteria 1117
361 Ga0207678_11094703 3300026067 Archaea 705
362 Ga0207702_10194515 3300026078 Bacteria 1876
363 Ga0207702_10407295 3300026078 Bacteria 1313
364 Ga0207702_11048026 3300026078 Unclassified 809
365 Ga0207641_11105116 3300026088 Unclassified 791
366 Ga0207641_12079683 3300026088 Unclassified 569
367 Ga0207674_10192519 3300026116 Bacteria 1989
368 Ga0207683_10000951 3300026121 Bacteria 26526
369 Ga0207683_10726630 3300026121 Bacteria 921
370 Ga0207698_10040406 3300026142 Bacteria 3466
371 Ga0207698_10128734 3300026142 Bacteria 2159
372 Ga0268266_11232566 3300028379 Bacteria 723
373 Ga0268264_10144008 3300028381 Bacteria 2129
374 Ga0265760_10311854 3300031090 Bacteria 558
375 Ga0307408_100022486 3300031548 Bacteria 4285
376 Ga0307408_100282707 3300031548 Bacteria 1382
377 Ga0307408_101711777 3300031548 Unclassified 599
378 Ga0307405_10002359 3300031731 Bacteria 8311
379 Ga0307405_10011741 3300031731 Bacteria 4608
380 Ga0307405_10060317 3300031731 Unclassified 2393
381 Ga0307405_10081447 3300031731 Bacteria 2116
382 Ga0307405_10118520 3300031731 Bacteria 1807
383 Ga0307405_10454452 3300031731 Bacteria 1016
384 Ga0307413_10014145 3300031824 Bacteria 4041
385 Ga0307413_10145315 3300031824 Bacteria 1645
386 Ga0307413_10227966 3300031824 Bacteria 1366
387 Ga0307413_10403648 3300031824 Bacteria 1071
388 Ga0307410_10060923 3300031852 Bacteria 2581
389 Ga0307410_10086661 3300031852 Bacteria 2212
390 Ga0307410_10089763 3300031852 Bacteria 2178
391 Ga0307410_10151815 3300031852 Bacteria 1725
392 Ga0307410_10389185 3300031852 Bacteria 1124
393 Ga0307406_10001669 3300031901 Bacteria 12200
394 Ga0307406_10081715 3300031901 Bacteria 2149
395 Ga0307406_10194615 3300031901 Bacteria 1487
396 Ga0307406_10311880 3300031901 Bacteria 1213
397 Ga0307407_10010245 3300031903 Bacteria 4411
398 Ga0307407_10038898 3300031903 Bacteria 2640
399 Ga0307407_10149900 3300031903 Bacteria 1514
400 Ga0307412_10037179 3300031911 Bacteria 3126
401 Ga0307412_10256650 3300031911 Bacteria 1360
402 Ga0307412_10598957 3300031911 Bacteria 933
403 Ga0307409_100000552 3300031995 Bacteria 16263
404 Ga0307409_100072702 3300031995 Bacteria 2739
405 Ga0307409_100101536 3300031995 Bacteria 2387
406 Ga0307409_100174687 3300031995 Bacteria 1895
407 Ga0307409_100304668 3300031995 Bacteria 1484
408 Ga0307409_100486700 3300031995 Bacteria 1198
409 Ga0307409_100530784 3300031995 Bacteria 1151
410 Ga0307409_101203786 3300031995 Bacteria 781
411 Ga0307409_101958328 3300031995 Bacteria 615
412 Ga0307416_100000276 3300032002 Bacteria 27133
413 Ga0307416_100002882 3300032002 Bacteria 10018
414 Ga0307416_100005358 3300032002 Bacteria 7872
415 Ga0307416_100063208 3300032002 Bacteria 3030
416 Ga0307416_100135635 3300032002 Bacteria 2225
417 Ga0307416_101079250 3300032002 Bacteria 907
418 Ga0307416_101225975 3300032002 Unclassified 856
419 Ga0307416_102330852 3300032002 Bacteria 635
420 Ga0307414_10030923 3300032004 Bacteria 3504
421 Ga0307414_10088661 3300032004 Bacteria 2290
422 Ga0307414_10109088 3300032004 Bacteria 2102
423 Ga0307414_10169452 3300032004 Bacteria 1744
424 Ga0307411_10078848 3300032005 Bacteria 2259
425 Ga0307411_10079129 3300032005 Bacteria 2256
426 Ga0307411_10113845 3300032005 Bacteria 1942
427 Ga0307411_10155968 3300032005 Bacteria 1703
428 Ga0307411_10668870 3300032005 Bacteria 901
429 Ga0307415_100000257 3300032126 Bacteria 22928
430 Ga0307415_100001904 3300032126 Bacteria 10252
431 Ga0307415_100005123 3300032126 Bacteria 6909
432 Ga0307415_100010229 3300032126 Bacteria 5301
433 Ga0307415_100040228 3300032126 Bacteria 3095
434 Ga0307415_100167359 3300032126 Bacteria 1710
435 Ga0307415_100275303 3300032126 Bacteria 1381
436 Ga0307415_100402550 3300032126 Bacteria 1169
437 Ga0373950_0104287 3300034818 Bacteria 614
438 Ga0373926_0275543 3300035083 Bacteria 655
439 Ga0373928_0083399 3300035084 Bacteria 809
440 Ga0373929_0046228 3300035085 Bacteria 983
441 Ga0373934_0215233 3300035086 Unclassified 792
442 Ga0373934_0279377 3300035086 Bacteria 691
443 Ga0373940_0058756 3300035088 Archaea 1095
444 Ga0373949_0075300 3300035090 Bacteria 891
445 Ga0373952_0243463 3300035092 Bacteria 542
446 Ga0373923_0015461 3300035111 Bacteria 2881
447 Ga0373923_0245970 3300035111 Bacteria 836
448 Ga0373932_0200405 3300035112 Bacteria 709
449 Ga0373936_0005545 3300035113 Bacteria 4762
450 Ga0373936_0325361 3300035113 Unclassified 697
451 Ga0373939_0075485 3300035114 Unclassified 1108
452 Ga0373941_0082293 3300035115 Bacteria 1089
453 Ga0373945_0066126 3300035116 Bacteria 1359
454 Ga0373945_0426126 3300035116 Unclassified 584
455 Ga0373953_0003936 3300035117 Bacteria 4679
456 Ga0373953_0066075 3300035117 Unclassified 1485
457 Ga0373954_0032161 3300035118 Bacteria 2424
458 Ga0373954_0241534 3300035118 Bacteria 889
459 Ga0373957_0000327 3300035120 Bacteria 12009
460 Ga0373957_0308899 3300035120 Unclassified 671
461 Ga0373955_0679685 3300035172 Bacteria 631
462 Ga0373942_0023120 3300035207 Bacteria 1584
463 Ga0373961_0028711 3300035241 Bacteria 1535
464 Ga0373962_0268397 3300035242 Unclassified 597
465 Ga0373924_0040498 3300035410 Bacteria 1907
466 Ga0373931_0134710 3300035691 Bacteria 1425
467 Ga0373931_0499455 3300035691 Bacteria 784
468 Ga0373935_0086824 3300035692 Bacteria 2042
469 Ga0373935_0510501 3300035692 Bacteria 873
470 Ga0373935_1397561 3300035692 Unclassified 523
471 Ga0373927_0167885 3300035695 Bacteria 1438
472 Ga0373927_0193473 3300035695 Bacteria 1335
473 Ga0373933_0423624 3300035724 Bacteria 869
474 Ga0373947_0020987 3300035725 Bacteria 3779
475 Ga0373947_0268892 3300035725 Bacteria 1131
476 Ga0373937_0093183 3300036401 Bacteria 2792
477 Ga0373937_0282545 3300036401 Bacteria 1567
478 Ga0373937_0299118 3300036401 Bacteria 1521
479 Ga0373937_0787415 3300036401 Bacteria 899
480 Ga0373925_0013905 3300037068 Bacteria 5826
481 Ga0373925_0275236 3300037068 Bacteria 1355
482 Ga0373925_0796456 3300037068 Bacteria 779
483 Ga0373925_0891259 3300037068 Bacteria 733
484 Ga0373925_1334662 3300037068 Bacteria 588
485 Ga0395899_0671654 3300037312 Bacteria 653
486 Ga0395899_0753493 3300037312 Bacteria 606
487 Ga0395900_0188116 3300037418 Bacteria 2095
488 Ga0395898_0817843 3300037466 Bacteria 872
489 Ga0395905_0274107 3300037471 Bacteria 1573
490 Ga0395905_0833109 3300037471 Bacteria 825
491 Ga0436364_0603707 3300037853 Unclassified 1799
492 Ga0436364_0719141 3300037853 Bacteria 1207
493 Ga0436364_1059409 3300037853 Bacteria 1059
494 Ga0436364_1356142 3300037853 Bacteria 1840
495 Ga0436364_1503601 3300037853 Bacteria 5087
496 Ga0436364_1552435 3300037853 Bacteria 596
497 Ga0395901_0007564 3300038443 Bacteria 10973
498 Ga0436365_1556469 3300039437 Bacteria 729
499 Ga0436361_0423855 3300039447 Bacteria 567
500 Ga0436361_0537557 3300039447 Bacteria 503
501 Ga0436363_1070021 3300039450 Bacteria 1498
502 Ga0436363_1337738 3300039450 Unclassified 1966
503 Ga0436362_0013593 3300039453 Unclassified 616
504 Ga0439443_029103 3300042003 Bacteria 904
505 Ga0439448_0039352 3300042005 Unclassified 1524
506 Ga0439448_0110017 3300042005 Bacteria 941
507 Ga0439450_079968 3300042008 Bacteria 812
508 Ga0439454_108943 3300042011 Unclassified 527
509 Ga0439455_0007482 3300042012 Bacteria 2311
510 Ga0439463_050466 3300042016 Bacteria 1061
511 Ga0450893_0096004 3300042532 Bacteria 600
512 Ga0439440_0008234 3300042993 Bacteria 2136
513 Ga0439440_0161769 3300042993 Unclassified 646
514 Ga0466972_0291340 3300044658 Bacteria 763
515 Ga0466965_0688893 3300044683 Bacteria 586
516 Ga0466966_0360443 3300044684 Bacteria 873
517 Ga0466961_0023841 3300044693 Bacteria 3937
518 Ga0466961_0024151 3300044693 Bacteria 3910
519 Ga0466963_0002387 3300044694 Bacteria 10500
520 Ga0466963_0010864 3300044694 Bacteria 5528
521 Ga0466963_0036278 3300044694 Bacteria 3214
522 Ga0466963_0053750 3300044694 Bacteria 2675
523 Ga0466963_0084456 3300044694 Bacteria 2154
524 Ga0466963_0113809 3300044694 Bacteria 1858
525 Ga0466963_0154566 3300044694 Bacteria 1594
526 Ga0466963_0331349 3300044694 Bacteria 1072
527 Ga0466963_0680891 3300044694 Bacteria 726
528 Ga0466964_0033161 3300044706 Bacteria 2056
529 Ga0466964_0063299 3300044706 Bacteria 1545
530 Ga0466964_0154397 3300044706 Bacteria 1067
531 Ga0466964_0192690 3300044706 Unclassified 974
532 Ga0466964_0525205 3300044706 Bacteria 639
533 Ga0466964_0665298 3300044706 Unclassified 577
534 Ga0466971_0012120 3300044719 Bacteria 3778
535 Ga0466971_0018073 3300044719 Bacteria 3123
536 Ga0466971_0330045 3300044719 Bacteria 736
537 Ga0466971_0468688 3300044719 Bacteria 619
538 Ga0466970_0434332 3300044765 Bacteria 751
539 Ga0466957_0001981 3300044842 Bacteria 10904
540 Ga0466957_0006686 3300044842 Bacteria 6520
541 Ga0466957_0728263 3300044842 Bacteria 701
542 Ga0466960_1026255 3300044901 Bacteria 507
543 Ga0466959_0025048 3300045049 Bacteria 4420
544 Ga0466959_0093798 3300045049 Bacteria 2154
545 Ga0466958_0014965 3300045836 Bacteria 4437
546 Ga0466958_0023628 3300045836 Bacteria 3611
547 Ga0466958_0025815 3300045836 Bacteria 3467
548 Ga0466958_0148997 3300045836 Bacteria 1475
549 Ga0466958_0155758 3300045836 Bacteria 1442
550 Ga0466958_0225454 3300045836 Bacteria 1196
551 Ga0466958_0630420 3300045836 Bacteria 698
552 Ga0466967_0001825 3300045976 Bacteria 12808
553 Ga0466967_0013890 3300045976 Bacteria 6245
554 Ga0466967_0018355 3300045976 Bacteria 5587
555 Ga0466967_0027537 3300045976 Bacteria 4730
556 Ga0466967_0036220 3300045976 Bacteria 4210
557 Ga0466967_0123546 3300045976 Bacteria 2395
558 Ga0466967_0153709 3300045976 Bacteria 2153
559 Ga0466967_0185149 3300045976 Bacteria 1966
560 Ga0466967_0204525 3300045976 Bacteria 1871
561 Ga0466967_0342803 3300045976 Bacteria 1445
562 Ga0466967_0649068 3300045976 Bacteria 1043
563 Ga0466967_0810153 3300045976 Bacteria 930
564 Ga0495592_0211894 3300046454 Bacteria 1300
565 Ga0495592_0634561 3300046454 Unclassified 648
566 Ga0495603_0281019 3300046455 Bacteria 957
567 Ga0495629_0018817 3300046459 Bacteria 4937
568 Ga0495629_0034472 3300046459 Bacteria 3578
569 Ga0495651_0239127 3300046462 Bacteria 1246
570 Ga0495651_0729937 3300046462 Unclassified 615
571 Ga0495653_0193110 3300046463 Unclassified 1387
572 Ga0495653_0209892 3300046463 Bacteria 1316
573 Ga0495653_0470057 3300046463 Bacteria 788
574 Ga0495580_0922794 3300046472 Unclassified 560
575 Ga0495582_0237881 3300046473 Bacteria 1043
576 Ga0495582_0273813 3300046473 Bacteria 969
577 Ga0495639_0110234 3300046475 Bacteria 1306
578 Ga0495662_0004245 3300046476 Bacteria 7213
579 Ga0495662_0067720 3300046476 Bacteria 1728
580 Ga0495662_0110247 3300046476 Bacteria 1349
581 Ga0495664_0029260 3300046477 Bacteria 3220
582 Ga0495664_0039968 3300046477 Bacteria 2772
583 Ga0495618_0065365 3300046514 Bacteria 2311
584 Ga0495618_0155440 3300046514 Bacteria 1460
585 Ga0495628_0122187 3300046516 Bacteria 1997
586 Ga0495628_0236245 3300046516 Unclassified 1368
587 Ga0495630_0196477 3300046517 Bacteria 1539
588 Ga0495630_0240379 3300046517 Bacteria 1384
589 Ga0495630_0565164 3300046517 Bacteria 872
590 Ga0495630_0864116 3300046517 Bacteria 689
591 Ga0495630_1527429 3300046517 Bacteria 501
592 Ga0495666_0382833 3300046526 Bacteria 633
593 Ga0495652_1148836 3300046529 Bacteria 502
594 Ga0495640_0057150 3300046533 Bacteria 2663
595 Ga0495640_0674966 3300046533 Unclassified 621
596 Ga0495586_0066738 3300046535 Bacteria 1961
597 Ga0495587_0138873 3300046536 Unclassified 1387
598 Ga0495587_0201724 3300046536 Bacteria 1125
599 Ga0495598_0223433 3300046537 Bacteria 688
600 Ga0495645_0058459 3300046543 Bacteria 2797
601 Ga0495645_0153526 3300046543 Bacteria 1597
602 Ga0495645_0174504 3300046543 Bacteria 1477
603 Ga0495667_0450584 3300046559 Bacteria 808
604 Ga0495656_0478944 3300046615 Bacteria 658
605 Ga0495634_0079112 3300046642 Bacteria 2153
606 Ga0495634_0222593 3300046642 Bacteria 1164
607 Ga0495634_0891870 3300046642 Bacteria 503
608 Ga0495635_0038374 3300046663 Bacteria 3316
609 Ga0495635_0223104 3300046663 Unclassified 1274
610 Ga0495635_0381693 3300046663 Bacteria 937
611 Ga0495657_0032165 3300046675 Bacteria 3663
612 Ga0495599_0013505 3300046678 Bacteria 5045
613 Ga0495599_0170643 3300046678 Bacteria 1342
614 Ga0495623_0011455 3300046679 Bacteria 5739
615 Ga0495658_0020070 3300046683 Bacteria 3500
616 Ga0495613_0015364 3300046689 Bacteria 5692
617 Ga0495613_0452917 3300046689 Bacteria 869
618 Ga0495613_0519838 3300046689 Bacteria 800
619 Ga0495624_0004062 3300046690 Bacteria 10771
620 Ga0495624_0238521 3300046690 Bacteria 1101
621 Ga0495670_0538242 3300046691 Bacteria 635
622 Ga0495600_0890766 3300046809 Bacteria 525
623 Ga0495581_0013565 3300047315 Bacteria 4726
624 Ga0495581_0266116 3300047315 Unclassified 1002
625 Ga0495604_0087827 3300047317 Bacteria 2314
626 Ga0495604_0887725 3300047317 Bacteria 557
627 Ga0495636_0365387 3300047318 Bacteria 683
628 Ga0495636_0637282 3300047318 Unclassified 523
629 Ga0495674_0006249 3300047319 Bacteria 11431
630 Ga0495674_1373001 3300047319 Bacteria 527
631 Ga0495676_0199460 3300047321 Bacteria 1391
632 Ga0495676_0291372 3300047321 Bacteria 1103
633 Ga0495676_0870590 3300047321 Unclassified 578
634 Ga0495680_0260489 3300047322 Bacteria 1226
635 Ga0495680_0602023 3300047322 Bacteria 735
636 Ga0495675_0311108 3300047444 Bacteria 933
637 Ga0495684_0009909 3300047471 Bacteria 7358
638 Ga0495684_0192526 3300047471 Bacteria 1507
639 Ga0495684_0236698 3300047471 Bacteria 1333
640 Ga0495593_0013682 3300047673 Bacteria 4623
641 Ga0495593_0304953 3300047673 Bacteria 796
642 Ga0495602_0039422 3300048088 Bacteria 4350
643 Ga0496100_0118260 3300048903 Bacteria 1851
644 Ga0496100_0290582 3300048903 Unclassified 1221
645 Ga0496101_0033133 3300048904 Bacteria 3642
646 Ga0496101_0930275 3300048904 Unclassified 684
647 Ga0496102_0162432 3300048905 Unclassified 2101
648 Ga0496102_0861692 3300048905 Bacteria 828
649 Ga0496103_0136593 3300048906 Unclassified 1567
650 Ga0496103_0317208 3300048906 Unclassified 1003
651 Ga0496104_0050826 3300048907 Bacteria 3911
652 Ga0496104_0429476 3300048907 Unclassified 1233
653 Ga0496104_0716888 3300048907 Bacteria 908
654 Ga0496104_0723814 3300048907 Bacteria 902
655 Ga0496104_1052205 3300048907 Bacteria 718
656 Ga0496105_0051266 3300048908 Bacteria 3409
657 Ga0496105_0266234 3300048908 Bacteria 1385
658 Ga0496106_0044266 3300048909 Unclassified 3341
659 Ga0496106_0317969 3300048909 Unclassified 1249
660 Ga0496107_0043324 3300048910 Bacteria 3233
661 Ga0496107_0127278 3300048910 Bacteria 1879
662 Ga0496108_0679810 3300048911 Bacteria 893
663 Ga0496108_1414077 3300048911 Unclassified 581
664 Ga0496109_0100497 3300048912 Unclassified 2683
665 Ga0496109_0227026 3300048912 Bacteria 1756
666 Ga0496109_0897365 3300048912 Bacteria 824
667 Ga0496109_1045693 3300048912 Bacteria 754
668 Ga0496110_0633578 3300048913 Unclassified 968
669 Ga0496110_1037720 3300048913 Unclassified 728
670 Ga0496110_1132766 3300048913 Bacteria 691
671 Ga0496111_0215308 3300048914 Bacteria 1427
672 Ga0496112_0012785 3300048915 Bacteria 7726
673 Ga0496112_0091523 3300048915 Bacteria 3010
674 Ga0496112_0242859 3300048915 Bacteria 1753
675 Ga0496112_0554160 3300048915 Bacteria 1083
676 Ga0496113_0446166 3300048916 Bacteria 1039
677 Ga0496113_0459778 3300048916 Bacteria 1023
678 Ga0496113_0603996 3300048916 Bacteria 878
679 Ga0496114_0024707 3300048917 Bacteria 4905
680 Ga0496114_0439925 3300048917 Bacteria 1155
681 Ga0496114_0642225 3300048917 Unclassified 934
682 Ga0496115_0079282 3300048918 Bacteria 2672
683 Ga0496115_0300363 3300048918 Bacteria 1316
684 Ga0496126_0086703 3300048929 Bacteria 2759
685 Ga0501031_0012809 3300049568 Bacteria 5479
686 Ga0501031_0059641 3300049568 Bacteria 2486
687 Ga0501031_0091326 3300049568 Bacteria 1986
688 Ga0501031_0179533 3300049568 Bacteria 1383
689 Ga0501032_0052550 3300049569 Bacteria 2745
690 Ga0501032_0079759 3300049569 Bacteria 2179
691 Ga0501032_0733553 3300049569 Bacteria 625
692 Ga0501033_0211144 3300049570 Bacteria 1384
693 Ga0501033_0389993 3300049570 Bacteria 972
694 Ga0501034_1329170 3300049571 Archaea 595
695 Ga0501036_0098664 3300049572 Bacteria 2470
696 Ga0501036_0645463 3300049572 Unclassified 876
697 Ga0501037_0074429 3300049573 Bacteria 2468
698 Ga0501037_0498109 3300049573 Unclassified 827
699 Ga0501038_0004237 3300049574 Bacteria 13331
700 Ga0501038_0155989 3300049574 Bacteria 1858
701 Ga0501038_0305296 3300049574 Bacteria 1248
702 Ga0501038_0856392 3300049574 Bacteria 673
703 Ga0501039_0031252 3300049575 Bacteria 4104
704 Ga0501039_0528533 3300049575 Bacteria 926
705 Ga0501040_0180575 3300049576 Bacteria 1496
706 Ga0501042_0020798 3300049578 Bacteria 4569
707 Ga0501042_0087374 3300049578 Bacteria 2237
708 Ga0501042_0173252 3300049578 Bacteria 1557
709 Ga0501043_0011612 3300049579 Bacteria 6895
710 Ga0501043_1051427 3300049579 Bacteria 577
711 Ga0501046_0072261 3300049580 Bacteria 2679
712 Ga0501047_0479027 3300049581 Archaea 1072
713 Ga0501047_0841808 3300049581 Bacteria 731
714 Ga0501047_1296012 3300049581 Unclassified 542
715 Ga0501048_0008453 3300049582 Bacteria 7787
716 Ga0501048_0047877 3300049582 Bacteria 3050
717 Ga0501048_0691146 3300049582 Bacteria 732
718 Ga0501068_0466938 3300049584 Bacteria 817
719 Ga0501069_0001126 3300049585 Bacteria 12892
720 Ga0501069_0187644 3300049585 Bacteria 1196
721 Ga0501069_0553535 3300049585 Unclassified 688
722 Ga0501069_0646381 3300049585 Unclassified 636
723 Ga0501069_0965395 3300049585 Bacteria 520
724 Ga0501070_0003286 3300049586 Bacteria 14033
725 Ga0501070_0027511 3300049586 Bacteria 4770
726 Ga0501070_0068088 3300049586 Bacteria 2947
727 Ga0501070_0931185 3300049586 Bacteria 677
728 Ga0501070_1121583 3300049586 Bacteria 606
729 Ga0501071_0003879 3300049587 Bacteria 9421
730 Ga0501071_0169115 3300049587 Bacteria 1636
731 Ga0501072_0182035 3300049588 Bacteria 1676
732 Ga0501072_1135241 3300049588 Bacteria 608
733 Ga0501073_0032818 3300049589 Bacteria 3700
734 Ga0501073_0497780 3300049589 Bacteria 843
735 Ga0501073_1221734 3300049589 Bacteria 516
736 Ga0501074_0106190 3300049590 Bacteria 2010
737 Ga0501074_0122346 3300049590 Bacteria 1861
738 Ga0501074_1172598 3300049590 Unclassified 539
739 Ga0501075_0034676 3300049591 Bacteria 3759
740 Ga0501075_0603515 3300049591 Unclassified 837
741 Ga0501076_0331080 3300049592 Bacteria 1249
742 Ga0501076_1101100 3300049592 Unclassified 654
743 Ga0501076_1125753 3300049592 Bacteria 646
744 Ga0501077_0304889 3300049593 Bacteria 1015
745 Ga0501077_0487385 3300049593 Unclassified 790
746 Ga0501077_0541274 3300049593 Unclassified 747
747 Ga0501079_0179240 3300049741 Bacteria 1653
748 Ga0501079_1584329 3300049741 Bacteria 515
749 Ga0501080_0047141 3300049742 Bacteria 4011
750 Ga0501080_0061621 3300049742 Bacteria 3492
751 Ga0501080_0594908 3300049742 Bacteria 982
752 Ga0501080_1050609 3300049742 Unclassified 705
753 Ga0501080_1579136 3300049742 Unclassified 556
754 Ga0501080_1780266 3300049742 Bacteria 518
755 Ga0501083_0009512 3300049744 Bacteria 6864
756 Ga0501083_0278781 3300049744 Bacteria 1087
757 Ga0501035_0127896 3300049822 Bacteria 2217
758 Ga0501035_0285513 3300049822 Bacteria 1394
759 Ga0501035_0649790 3300049822 Archaea 855
760 Ga0501035_0833540 3300049822 Bacteria 735
761 Ga0501044_0012429 3300049823 Bacteria 9220
762 Ga0501045_0030609 3300049824 Bacteria 3896
763 Ga0501045_0132064 3300049824 Bacteria 1856
764 Ga0501045_0277662 3300049824 Bacteria 1247
765 nmdc:mga0yw44_684495_c1 3300050492 Bacteria 697
766 nmdc:mga0yw44_859028_c1 3300050492 Bacteria 616
767 nmdc:mga0yw44_870840_c1 3300050492 Bacteria 611
768 nmdc:mga05p37_12819_c1 3300050507 Bacteria 10023
769 nmdc:mga05p37_728898_c1 3300050507 Unclassified 1096
770 nmdc:mga0qj67_355455_c1 3300050509 Bacteria 1184
771 nmdc:mga06r32_91522_c1 3300050510 Bacteria 2973
772 nmdc:mga08y16_519964_c1 3300050511 Unclassified 1207
773 nmdc:mga08y16_620300_c2 3300050511 Unclassified 622
774 nmdc:mga0n895_327308_c1 3300050512 Unclassified 1553
775 nmdc:mga0n895_440003_c1 3300050512 Bacteria 1317
776 nmdc:mga0n895_595259_c1 3300050512 Unclassified 1109
777 nmdc:mga0n895_70459_c1 3300050512 Bacteria 3465
778 nmdc:mga0rr50_1034996_c1 3300050513 Bacteria 699
779 nmdc:mga0rr50_123495_c1 3300050513 Bacteria 2064
780 nmdc:mga0rr50_246798_c1 3300050513 Bacteria 1481
781 nmdc:mga0rr50_253032_c1 3300050513 Bacteria 1464
782 nmdc:mga08x19_443414_c1 3300050514 Unclassified 913
783 nmdc:mga08x19_684720_c1 3300050514 Bacteria 728
784 nmdc:mga08x19_909018_c1 3300050514 Bacteria 625
785 nmdc:mga0a205_1113821_c1 3300050515 Bacteria 637
786 nmdc:mga0a205_285557_c1 3300050515 Bacteria 1525
787 nmdc:mga0a205_347254_c1 3300050515 Unclassified 1352
788 Ga0495601_0027869 3300053077 Bacteria 3495
789 Ga0495601_0102315 3300053077 Bacteria 1851
790 Ga0495612_0012775 3300053078 Bacteria 3385
791 Ga0495612_0053218 3300053078 Bacteria 1667
792 Ga0495612_0123581 3300053078 Bacteria 1115
793 Ga0495595_0011142 3300053084 Bacteria 3755
794 Ga0495595_0532268 3300053084 Bacteria 600
795 Ga0495619_0018476 3300053085 Bacteria 4422
796 Ga0495619_0675834 3300053085 Bacteria 703
797 Ga0501084_0014587 3300054114 Bacteria 6514
798 Ga0501084_0044612 3300054114 Bacteria 3712
799 Ga0501084_0046244 3300054114 Bacteria 3645
800 Ga0501084_0083148 3300054114 Bacteria 2687
801 Ga0501084_0292538 3300054114 Bacteria 1375
802 Ga0587122_000265 3300059628 Bacteria 2535
803 Ga0501082_0039996 3300060353 Bacteria 4046
804 Ga0466962_0139064 3300061719 Bacteria 1176
805 Ga0466962_0248819 3300061719 Bacteria 873
806 Ga0466962_0397527 3300061719 Bacteria 690
807 Ga0466962_0547080 3300061719 Bacteria 588
808 Ga0207663_11567274
809 JGI25407J50210_10018823
810 JGI25407J50210_10040248
811 JGI25407J50210_10128071
812 Ga0058863_11265689
813 Ga0070658_10089982
814 Ga0070658_10099813
815 Ga0070658_10268828
816 Ga0068869_100656907
817 Ga0070680_100082601
818 Ga0070680_100382014
819 Ga0070680_101160501
820 Ga0070682_100483396
821 Ga0070682_100963143
822 Ga0068868_100453357
823 Ga0068868_100841292
824 Ga0070660_100913108
825 Ga0070660_101723461
826 Ga0070689_102184248
827 Ga0070661_100084247
828 Ga0070661_101380542
829 Ga0070692_10712082
830 Ga0070659_100052102
831 Ga0070709_10171475
832 Ga0070709_10183124
833 Ga0070709_10584044
834 Ga0070709_11024649
835 Ga0070709_11409779
836 Ga0070714_100010662
837 Ga0070714_100020292
838 Ga0070714_100046929
839 Ga0070714_100053413
840 Ga0070714_100078924
841 Ga0070714_100151958
842 Ga0070714_100307051
843 Ga0070714_100340074
844 Ga0070714_101574358
845 Ga0070713_100009281
846 Ga0070713_100030647
847 Ga0070713_100050053
848 Ga0070713_100207489
849 Ga0070713_100299380
850 Ga0070713_101027518
851 Ga0070713_101599634
852 Ga0070713_101617308
853 Ga0070710_10006389
854 Ga0070710_10021709
855 Ga0070710_10148380
856 Ga0070710_10447984
857 Ga0070710_10959879
858 Ga0070711_100100227
859 Ga0070711_100220026
860 Ga0070711_100464120
861 Ga0070711_100690986
862 Ga0070711_101191650
863 Ga0070705_100007045
864 Ga0070708_100396595
865 Ga0070708_100761990
866 Ga0070708_101316466
867 Ga0070708_101885844
868 Ga0070708_102084366
869 Ga0070663_100310057
870 Ga0070663_100562027
871 Ga0070663_100578642
872 Ga0070678_100073819
873 Ga0070678_101203656
874 Ga0070681_10010595
875 Ga0070681_10621985
876 Ga0070706_100000939
877 Ga0070706_100007212
878 Ga0070706_100018337
879 Ga0070706_100020451
880 Ga0070707_100000166
881 Ga0070707_100004101
882 Ga0070707_100020974
883 Ga0070707_100323204
884 Ga0070707_100440272
885 Ga0070698_100000006
886 Ga0070698_100011358
887 Ga0070698_100020214
888 Ga0070698_100337701
889 Ga0070698_100779910
890 Ga0070699_100396398
891 Ga0070699_100620868
892 Ga0070679_100187194
893 Ga0070679_100674063
894 Ga0070679_101523290
895 Ga0070684_100094120
896 Ga0070684_100616459
897 Ga0070684_100796859
898 Ga0070697_100170674
899 Ga0070686_100191865
900 Ga0070686_100392319
901 Ga0070695_100542894
902 Ga0070695_101580510
903 Ga0070696_100146121
904 Ga0070696_100248366
905 Ga0070693_100165614
906 Ga0070665_100101876
907 Ga0070704_100071467
908 Ga0068855_100686104
909 Ga0068855_101229658
910 Ga0068855_101698651
911 Ga0070664_100971997
912 Ga0070664_101176355
913 Ga0068857_100855787
914 Ga0068857_100868040
915 Ga0068857_100925787
916 Ga0068854_100736964
917 Ga0068856_100026347
918 Ga0068856_100162308
919 Ga0068856_100437340
920 Ga0068856_100626947
921 Ga0070702_100024635
922 Ga0068852_100017352
923 Ga0068852_102297328
924 Ga0068870_10239997
925 Ga0068863_100448235
926 Ga0068863_102348576
927 Ga0068858_100422153
928 Ga0068860_100167390
929 Ga0081455_10054105
930 Ga0081455_10082617
931 Ga0081455_10554349
932 Ga0081538_10000635
933 Ga0081538_10003841
934 Ga0081538_10004099
935 Ga0081538_10005257
936 Ga0081538_10008316
937 Ga0081538_10073319
938 Ga0081538_10110826
939 Ga0081538_10116631
940 Ga0081539_10024682
941 Ga0081539_10138950
942 Ga0070717_10062603
943 Ga0070717_10098365
944 Ga0070717_10126499
945 Ga0070717_10189906
946 Ga0070717_10281032
947 Ga0070717_11116885
948 Ga0075365_10110665
949 Ga0075365_10393309
950 Ga0070715_10003458
951 Ga0070715_10009201
952 Ga0070715_10013051
953 Ga0070715_10042129
954 Ga0070715_10156705
955 Ga0070716_100001899
956 Ga0070716_100026860
957 Ga0070716_100140236
958 Ga0070716_100236424
959 Ga0070716_100425841
960 Ga0070716_100770281
961 Ga0070716_101012555
962 Ga0070716_101030017
963 Ga0070712_100016737
964 Ga0070712_100031273
965 Ga0070712_100167835
966 Ga0070712_100203670
967 Ga0070712_100873727
968 Ga0070712_101153564
969 Ga0097621_100584403
970 Ga0068871_100534227
971 Ga0068871_101946245
972 Ga0075428_100648274
973 Ga0075428_100823437
974 Ga0075430_100739953
975 Ga0075430_101656038
976 Ga0075433_10091668
977 Ga0075434_100052596
978 Ga0075434_100460198
979 Ga0075434_101116615
980 Ga0075429_100260889
981 Ga0075436_100034851
982 Ga0075436_100163174
983 Ga0075436_100274973
984 Ga0075436_100746234
985 Ga0075436_100765468
986 Ga0075435_100084390
987 Ga0075435_100142665
988 Ga0075435_100173424
989 Ga0075435_100236315
990 Ga0075435_101573308
991 Ga0099795_10461520
992 Ga0105251_10195194
993 Ga0105240_10761005
994 Ga0111539_10083731
995 Ga0111539_10278012
996 Ga0105247_10375284
997 Ga0114129_10009365
998 Ga0114129_10967132
999 Ga0114129_11852284
1000 Ga0105243_12046420
1001 Ga0105241_10244356
1002 Ga0105241_10934283
1003 Ga0105242_10129411
1004 Ga0105237_10277930
1005 Ga0105237_10854221
1006 Ga0105238_10130511
1007 Ga0105238_10339739
1008 Ga0105249_10456944
1009 Ga0105246_10166146
1010 Ga0154016_131472
1011 Ga0157373_10084177
1012 Ga0157370_10090426
1013 Ga0157369_10002422
1014 Ga0157369_10016802
1015 Ga0157369_10217237
1016 Ga0157369_10229004
1017 Ga0157369_10496770
1018 Ga0157374_10107907
1019 Ga0157374_12062421
1020 Ga0157378_10021358
1021 Ga0163162_10436036
1022 Ga0157372_10097103
1023 Ga0157372_11951715
1024 Ga0157375_10423515
1025 Ga0157375_10761315
1026 Ga0163163_10410551
1027 Ga0163163_11113648
1028 Ga0182008_10162088
1029 Ga0157379_11127867
1030 Ga0157376_10503846
1031 Ga0157376_10762414
1032 Ga0182005_1079799
1033 Ga0197907_10101199
1034 Ga0197907_10249360
1035 Ga0197907_10503529
1036 Ga0197907_10946039
1037 Ga0197907_11025201
1038 Ga0197907_11250657
1039 Ga0206356_10829837
1040 Ga0206356_11058141
1041 Ga0206356_11516356
1042 Ga0206356_11739667
1043 Ga0206349_1452561
1044 Ga0206349_1457924
1045 Ga0206349_1943060
1046 Ga0206355_1444598
1047 Ga0206355_1529971
1048 Ga0206351_10332592
1049 Ga0206351_10354766
1050 Ga0206351_10741260
1051 Ga0206351_10902751
1052 Ga0206350_10270511
1053 Ga0206350_11064801
1054 Ga0206350_11240311
1055 Ga0206350_11356179
1056 Ga0206350_11420438
1057 Ga0206354_10519068
1058 Ga0206354_10572110
1059 Ga0206354_10612338
1060 Ga0206354_11485858
1061 Ga0206353_10714114
1062 Ga0206353_10840274
1063 Ga0206353_10865515
1064 Ga0206353_11353822
1065 Ga0154015_1580273
1066 Ga0154015_1661415
1067 Ga0213875_10125934
1068 Ga0213875_10314853
1069 Ga0213875_10489172
1070 Ga0224712_10005170
1071 Ga0224712_10016014
1072 Ga0224712_10046345
1073 Ga0224712_10046507
1074 Ga0224712_10095591
1075 Ga0224712_10175039
1076 Ga0224712_10229901
1077 Ga0224712_10379496
1078 Ga0224712_10384847
1079 Ga0207692_10003841
1080 Ga0207692_10046482
1081 Ga0207692_10103755
1082 Ga0207692_10174777
1083 Ga0207692_10185222
1084 Ga0207688_10984093
1085 Ga0207680_10474645
1086 Ga0207647_10155324
1087 Ga0207685_10000749
1088 Ga0207685_10277700
1089 Ga0207685_10283588
1090 Ga0207699_10001111
1091 Ga0207699_10004397
1092 Ga0207699_10052772
1093 Ga0207699_10181150
1094 Ga0207699_10379288
1095 Ga0207699_10412320
1096 Ga0207699_11185001
1097 Ga0207705_10119042
1098 Ga0207705_10261881
1099 Ga0207684_10050186
1100 Ga0207684_10074627
1101 Ga0207684_10357140
1102 Ga0207654_10302508
1103 Ga0207654_10793509
1104 Ga0207654_11102585
1105 Ga0207707_10102195
1106 Ga0207707_10538047
1107 Ga0207707_11091966
1108 Ga0207695_10684055
1109 Ga0207671_11033363
1110 Ga0207693_10013495
1111 Ga0207693_10019026
1112 Ga0207693_10026835
1113 Ga0207693_10359365
1114 Ga0207663_10000281
1115 Ga0207663_10022532
1116 Ga0207663_10069536
1117 Ga0207663_10206939
1118 Ga0207663_10349235
1119 Ga0207663_10435090
1120 Ga0207660_10527705
1121 Ga0207649_10262970
1122 Ga0207652_10319223
1123 Ga0207652_10660530
1124 Ga0207646_10000049
1125 Ga0207646_10008672
1126 Ga0207646_10010500
1127 Ga0207646_10244809
1128 Ga0207694_10588886
1129 Ga0207687_10968963
1130 Ga0207700_10000703
1131 Ga0207700_10003873
1132 Ga0207700_10004961
1133 Ga0207700_10036458
1134 Ga0207700_10047849
1135 Ga0207700_10406204
1136 Ga0207700_10723312
1137 Ga0207700_11084340
1138 Ga0207664_10001364
1139 Ga0207664_10016099
1140 Ga0207664_10035079
1141 Ga0207664_10036347
1142 Ga0207664_10051349
1143 Ga0207664_10058393
1144 Ga0207664_10074708
1145 Ga0207664_10093295
1146 Ga0207664_10180942
1147 Ga0207664_10312694
1148 Ga0207664_11489587
1149 Ga0207644_10234209
1150 Ga0207709_11268446
1151 Ga0207665_10034231
1152 Ga0207665_10072912
1153 Ga0207665_10115944
1154 Ga0207665_10435702
1155 Ga0207689_10008124
1156 Ga0207661_10915117
1157 Ga0207661_12178361
1158 Ga0207679_10503199
1159 Ga0207679_11069673
1160 Ga0207667_10928543
1161 Ga0207712_10888107
1162 Ga0207640_10980351
1163 Ga0207677_11917027
1164 Ga0207703_10785721
1165 Ga0207703_11429856
1166 Ga0207678_10080258
1167 Ga0207678_10451563
1168 Ga0207678_11094703
1169 Ga0207702_10194515
1170 Ga0207702_10407295
1171 Ga0207702_11048026
1172 Ga0207641_11105116
1173 Ga0207641_12079683
1174 Ga0207674_10192519
1175 Ga0207683_10000951
1176 Ga0207683_10726630
1177 Ga0207698_10040406
1178 Ga0207698_10128734
1179 Ga0268266_11232566
1180 Ga0268264_10144008
1181 Ga0265760_10311854
1182 Ga0307408_100022486
1183 Ga0307408_100282707
1184 Ga0307408_101711777
1185 Ga0307405_10002359
1186 Ga0307405_10011741
1187 Ga0307405_10060317
1188 Ga0307405_10081447
1189 Ga0307405_10118520
1190 Ga0307405_10454452
1191 Ga0307413_10014145
1192 Ga0307413_10145315
1193 Ga0307413_10227966
1194 Ga0307413_10403648
1195 Ga0307410_10060923
1196 Ga0307410_10086661
1197 Ga0307410_10089763
1198 Ga0307410_10151815
1199 Ga0307410_10389185
1200 Ga0307406_10001669
1201 Ga0307406_10081715
1202 Ga0307406_10194615
1203 Ga0307406_10311880
1204 Ga0307407_10010245
1205 Ga0307407_10038898
1206 Ga0307407_10149900
1207 Ga0307412_10037179
1208 Ga0307412_10256650
1209 Ga0307412_10598957
1210 Ga0307409_100000552
1211 Ga0307409_100072702
1212 Ga0307409_100101536
1213 Ga0307409_100174687
1214 Ga0307409_100304668
1215 Ga0307409_100486700
1216 Ga0307409_100530784
1217 Ga0307409_101203786
1218 Ga0307409_101958328
1219 Ga0307416_100000276
1220 Ga0307416_100002882
1221 Ga0307416_100005358
1222 Ga0307416_100063208
1223 Ga0307416_100135635
1224 Ga0307416_101079250
1225 Ga0307416_101225975
1226 Ga0307416_102330852
1227 Ga0307414_10030923
1228 Ga0307414_10088661
1229 Ga0307414_10109088
1230 Ga0307414_10169452
1231 Ga0307411_10078848
1232 Ga0307411_10079129
1233 Ga0307411_10113845
1234 Ga0307411_10155968
1235 Ga0307411_10668870
1236 Ga0307415_100000257
1237 Ga0307415_100001904
1238 Ga0307415_100005123
1239 Ga0307415_100010229
1240 Ga0307415_100040228
1241 Ga0307415_100167359
1242 Ga0307415_100275303
1243 Ga0307415_100402550
1244 Ga0373950_0104287
1245 Ga0373926_0275543
1246 Ga0373928_0083399
1247 Ga0373929_0046228
1248 Ga0373934_0215233
1249 Ga0373934_0279377
1250 Ga0373940_0058756
1251 Ga0373949_0075300
1252 Ga0373952_0243463
1253 Ga0373923_0015461
1254 Ga0373923_0245970
1255 Ga0373932_0200405
1256 Ga0373936_0005545
1257 Ga0373936_0325361
1258 Ga0373939_0075485
1259 Ga0373941_0082293
1260 Ga0373945_0066126
1261 Ga0373945_0426126
1262 Ga0373953_0003936
1263 Ga0373953_0066075
1264 Ga0373954_0032161
1265 Ga0373954_0241534
1266 Ga0373957_0000327
1267 Ga0373957_0308899
1268 Ga0373955_0679685
1269 Ga0373942_0023120
1270 Ga0373961_0028711
1271 Ga0373962_0268397
1272 Ga0373924_0040498
1273 Ga0373931_0134710
1274 Ga0373931_0499455
1275 Ga0373935_0086824
1276 Ga0373935_0510501
1277 Ga0373935_1397561
1278 Ga0373927_0167885
1279 Ga0373927_0193473
1280 Ga0373933_0423624
1281 Ga0373947_0020987
1282 Ga0373947_0268892
1283 Ga0373937_0093183
1284 Ga0373937_0282545
1285 Ga0373937_0299118
1286 Ga0373937_0787415
1287 Ga0373925_0013905
1288 Ga0373925_0275236
1289 Ga0373925_0796456
1290 Ga0373925_0891259
1291 Ga0373925_1334662
1292 Ga0395899_0671654
1293 Ga0395899_0753493
1294 Ga0395900_0188116
1295 Ga0395898_0817843
1296 Ga0395905_0274107
1297 Ga0395905_0833109
1298 Ga0436364_0603707
1299 Ga0436364_0719141
1300 Ga0436364_1059409
1301 Ga0436364_1356142
1302 Ga0436364_1503601
1303 Ga0436364_1552435
1304 Ga0395901_0007564
1305 Ga0436365_1556469
1306 Ga0436361_0423855
1307 Ga0436361_0537557
1308 Ga0436363_1070021
1309 Ga0436363_1337738
1310 Ga0436362_0013593
1311 Ga0439443_029103
1312 Ga0439448_0039352
1313 Ga0439448_0110017
1314 Ga0439450_079968
1315 Ga0439454_108943
1316 Ga0439455_0007482
1317 Ga0439463_050466
1318 Ga0450893_0096004
1319 Ga0439440_0008234
1320 Ga0439440_0161769
1321 Ga0466972_0291340
1322 Ga0466965_0688893
1323 Ga0466966_0360443
1324 Ga0466961_0023841
1325 Ga0466961_0024151
1326 Ga0466963_0002387
1327 Ga0466963_0010864
1328 Ga0466963_0036278
1329 Ga0466963_0053750
1330 Ga0466963_0084456
1331 Ga0466963_0113809
1332 Ga0466963_0154566
1333 Ga0466963_0331349
1334 Ga0466963_0680891
1335 Ga0466964_0033161
1336 Ga0466964_0063299
1337 Ga0466964_0154397
1338 Ga0466964_0192690
1339 Ga0466964_0525205
1340 Ga0466964_0665298
1341 Ga0466971_0012120
1342 Ga0466971_0018073
1343 Ga0466971_0330045
1344 Ga0466971_0468688
1345 Ga0466970_0434332
1346 Ga0466957_0001981
1347 Ga0466957_0006686
1348 Ga0466957_0728263
1349 Ga0466960_1026255
1350 Ga0466959_0025048
1351 Ga0466959_0093798
1352 Ga0466958_0014965
1353 Ga0466958_0023628
1354 Ga0466958_0025815
1355 Ga0466958_0148997
1356 Ga0466958_0155758
1357 Ga0466958_0225454
1358 Ga0466958_0630420
1359 Ga0466967_0001825
1360 Ga0466967_0013890
1361 Ga0466967_0018355
1362 Ga0466967_0027537
1363 Ga0466967_0036220
1364 Ga0466967_0123546
1365 Ga0466967_0153709
1366 Ga0466967_0185149
1367 Ga0466967_0204525
1368 Ga0466967_0342803
1369 Ga0466967_0649068
1370 Ga0466967_0810153
1371 Ga0495592_0211894
1372 Ga0495592_0634561
1373 Ga0495603_0281019
1374 Ga0495629_0018817
1375 Ga0495629_0034472
1376 Ga0495651_0239127
1377 Ga0495651_0729937
1378 Ga0495653_0193110
1379 Ga0495653_0209892
1380 Ga0495653_0470057
1381 Ga0495580_0922794
1382 Ga0495582_0237881
1383 Ga0495582_0273813
1384 Ga0495639_0110234
1385 Ga0495662_0004245
1386 Ga0495662_0067720
1387 Ga0495662_0110247
1388 Ga0495664_0029260
1389 Ga0495664_0039968
1390 Ga0495618_0065365
1391 Ga0495618_0155440
1392 Ga0495628_0122187
1393 Ga0495628_0236245
1394 Ga0495630_0196477
1395 Ga0495630_0240379
1396 Ga0495630_0565164
1397 Ga0495630_0864116
1398 Ga0495630_1527429
1399 Ga0495666_0382833
1400 Ga0495652_1148836
1401 Ga0495640_0057150
1402 Ga0495640_0674966
1403 Ga0495586_0066738
1404 Ga0495587_0138873
1405 Ga0495587_0201724
1406 Ga0495598_0223433
1407 Ga0495645_0058459
1408 Ga0495645_0153526
1409 Ga0495645_0174504
1410 Ga0495667_0450584
1411 Ga0495656_0478944
1412 Ga0495634_0079112
1413 Ga0495634_0222593
1414 Ga0495634_0891870
1415 Ga0495635_0038374
1416 Ga0495635_0223104
1417 Ga0495635_0381693
1418 Ga0495657_0032165
1419 Ga0495599_0013505
1420 Ga0495599_0170643
1421 Ga0495623_0011455
1422 Ga0495658_0020070
1423 Ga0495613_0015364
1424 Ga0495613_0452917
1425 Ga0495613_0519838
1426 Ga0495624_0004062
1427 Ga0495624_0238521
1428 Ga0495670_0538242
1429 Ga0495600_0890766
1430 Ga0495581_0013565
1431 Ga0495581_0266116
1432 Ga0495604_0087827
1433 Ga0495604_0887725
1434 Ga0495636_0365387
1435 Ga0495636_0637282
1436 Ga0495674_0006249
1437 Ga0495674_1373001
1438 Ga0495676_0199460
1439 Ga0495676_0291372
1440 Ga0495676_0870590
1441 Ga0495680_0260489
1442 Ga0495680_0602023
1443 Ga0495675_0311108
1444 Ga0495684_0009909
1445 Ga0495684_0192526
1446 Ga0495684_0236698
1447 Ga0495593_0013682
1448 Ga0495593_0304953
1449 Ga0495602_0039422
1450 Ga0496100_0118260
1451 Ga0496100_0290582
1452 Ga0496101_0033133
1453 Ga0496101_0930275
1454 Ga0496102_0162432
1455 Ga0496102_0861692
1456 Ga0496103_0136593
1457 Ga0496103_0317208
1458 Ga0496104_0050826
1459 Ga0496104_0429476
1460 Ga0496104_0716888
1461 Ga0496104_0723814
1462 Ga0496104_1052205
1463 Ga0496105_0051266
1464 Ga0496105_0266234
1465 Ga0496106_0044266
1466 Ga0496106_0317969
1467 Ga0496107_0043324
1468 Ga0496107_0127278
1469 Ga0496108_0679810
1470 Ga0496108_1414077
1471 Ga0496109_0100497
1472 Ga0496109_0227026
1473 Ga0496109_0897365
1474 Ga0496109_1045693
1475 Ga0496110_0633578
1476 Ga0496110_1037720
1477 Ga0496110_1132766
1478 Ga0496111_0215308
1479 Ga0496112_0012785
1480 Ga0496112_0091523
1481 Ga0496112_0242859
1482 Ga0496112_0554160
1483 Ga0496113_0446166
1484 Ga0496113_0459778
1485 Ga0496113_0603996
1486 Ga0496114_0024707
1487 Ga0496114_0439925
1488 Ga0496114_0642225
1489 Ga0496115_0079282
1490 Ga0496115_0300363
1491 Ga0496126_0086703
1492 Ga0501031_0012809
1493 Ga0501031_0059641
1494 Ga0501031_0091326
1495 Ga0501031_0179533
1496 Ga0501032_0052550
1497 Ga0501032_0079759
1498 Ga0501032_0733553
1499 Ga0501033_0211144
1500 Ga0501033_0389993
1501 Ga0501034_1329170
1502 Ga0501036_0098664
1503 Ga0501036_0645463
1504 Ga0501037_0074429
1505 Ga0501037_0498109
1506 Ga0501038_0004237
1507 Ga0501038_0155989
1508 Ga0501038_0305296
1509 Ga0501038_0856392
1510 Ga0501039_0031252
1511 Ga0501039_0528533
1512 Ga0501040_0180575
1513 Ga0501042_0020798
1514 Ga0501042_0087374
1515 Ga0501042_0173252
1516 Ga0501043_0011612
1517 Ga0501043_1051427
1518 Ga0501046_0072261
1519 Ga0501047_0479027
1520 Ga0501047_0841808
1521 Ga0501047_1296012
1522 Ga0501048_0008453
1523 Ga0501048_0047877
1524 Ga0501048_0691146
1525 Ga0501068_0466938
1526 Ga0501069_0001126
1527 Ga0501069_0187644
1528 Ga0501069_0553535
1529 Ga0501069_0646381
1530 Ga0501069_0965395
1531 Ga0501070_0003286
1532 Ga0501070_0027511
1533 Ga0501070_0068088
1534 Ga0501070_0931185
1535 Ga0501070_1121583
1536 Ga0501071_0003879
1537 Ga0501071_0169115
1538 Ga0501072_0182035
1539 Ga0501072_1135241
1540 Ga0501073_0032818
1541 Ga0501073_0497780
1542 Ga0501073_1221734
1543 Ga0501074_0106190
1544 Ga0501074_0122346
1545 Ga0501074_1172598
1546 Ga0501075_0034676
1547 Ga0501075_0603515
1548 Ga0501076_0331080
1549 Ga0501076_1101100
1550 Ga0501076_1125753
1551 Ga0501077_0304889
1552 Ga0501077_0487385
1553 Ga0501077_0541274
1554 Ga0501079_0179240
1555 Ga0501079_1584329
1556 Ga0501080_0047141
1557 Ga0501080_0061621
1558 Ga0501080_0594908
1559 Ga0501080_1050609
1560 Ga0501080_1579136
1561 Ga0501080_1780266
1562 Ga0501083_0009512
1563 Ga0501083_0278781
1564 Ga0501035_0127896
1565 Ga0501035_0285513
1566 Ga0501035_0649790
1567 Ga0501035_0833540
1568 Ga0501044_0012429
1569 Ga0501045_0030609
1570 Ga0501045_0132064
1571 Ga0501045_0277662
1572 nmdc:mga0yw44_684495_c1
1573 nmdc:mga0yw44_859028_c1
1574 nmdc:mga0yw44_870840_c1
1575 nmdc:mga05p37_12819_c1
1576 nmdc:mga05p37_728898_c1
1577 nmdc:mga0qj67_355455_c1
1578 nmdc:mga06r32_91522_c1
1579 nmdc:mga08y16_519964_c1
1580 nmdc:mga08y16_620300_c2
1581 nmdc:mga0n895_327308_c1
1582 nmdc:mga0n895_440003_c1
1583 nmdc:mga0n895_595259_c1
1584 nmdc:mga0n895_70459_c1
1585 nmdc:mga0rr50_1034996_c1
1586 nmdc:mga0rr50_123495_c1
1587 nmdc:mga0rr50_246798_c1
1588 nmdc:mga0rr50_253032_c1
1589 nmdc:mga08x19_443414_c1
1590 nmdc:mga08x19_684720_c1
1591 nmdc:mga08x19_909018_c1
1592 nmdc:mga0a205_1113821_c1
1593 nmdc:mga0a205_285557_c1
1594 nmdc:mga0a205_347254_c1
1595 Ga0495601_0027869
1596 Ga0495601_0102315
1597 Ga0495612_0012775
1598 Ga0495612_0053218
1599 Ga0495612_0123581
1600 Ga0495595_0011142
1601 Ga0495595_0532268
1602 Ga0495619_0018476
1603 Ga0495619_0675834
1604 Ga0501084_0014587
1605 Ga0501084_0044612
1606 Ga0501084_0046244
1607 Ga0501084_0083148
1608 Ga0501084_0292538
1609 Ga0587122_000265
1610 Ga0501082_0039996
1611 Ga0466962_0139064
1612 Ga0466962_0248819
1613 Ga0466962_0397527
1614 Ga0466962_0547080

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a8v-assembly2.cif.gz_B structure of the rna-binding domain of the rho transcription terminator 0.8184 56 85
5wod-assembly1.cif.gz_A de novo design of covalently constrained meso-size protein scaffolds with unique tertiary structures 0.3423 54 86
1a8v-assembly2.cif.gz_B structure of the rna-binding domain of the rho transcription terminator 0.3195 56 85
5wod-assembly1.cif.gz_A de novo design of covalently constrained meso-size protein scaffolds with unique tertiary structures 0.3033 54 86
4oay-assembly6.cif.gz_J bldd ctd-c-di-gmp complex 0.3003 27 85
ID Description Score Start End Superfamily
af_Q2FWD7_13_140_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.919 56 81 2.40.50.140
1a8vB01 Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; 0.8184 56 85 1.10.720.10
2a8vC01 Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; 0.8023 56 85 1.10.720.10
2a8vC01 Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; 0.5586 56 85 1.10.720.10
1a8vB01 Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; 0.5447 56 85 1.10.720.10
ID Description Score Start End GO Terms
AF-A0A356KKC6-F1-model_v4 Rho termination factor N-terminal domain-containing protein 1.012 56 85
AF-A0A2D4SEZ1-F1-model_v4 Rho termination factor 1.009 56 85 GO:0006353
AF-A0A4Y3QRD2-F1-model_v4 Plasmid stabilization protein 1.006 56 87
AF-I4ANH7-F1-model_v4 Rho termination factor 1.004 56 86 GO:0006353
AF-L9VQR6-F1-model_v4 Rho termination factor-like N-terminal domain-containing protein 0.9911 56 86 GO:0006353

Map