F481684
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 807 | 321 | 1614 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300025916|Ga0207663_11567274|Ga0207663_115672741 |
| Length | 93 |
| Sequence | LLVLETGSADMSTRKQSQAAKRNVKQAQKTIKHLPKETRSALGRQGAAVAQRKRAGGSSPKTRAELYKMARQRDLPGRSKMGRDELARKLGEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 66 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 96 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 147 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 158 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 160 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 164 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 168 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 193 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 194 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 195 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 196 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 197 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 198 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 199 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 200 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 201 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 202 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 203 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 204 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.18 |
| Metatranscriptomes | 5.82 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.62 |
| Nodule | 0 |
| Rhizoplane | 5.08 |
| Rhizosphere | 92.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207663_11567274 | 3300025916 | Unclassified | 530 |
| 2 | JGI25407J50210_10018823 | 3300003373 | Bacteria | 1795 |
| 3 | JGI25407J50210_10040248 | 3300003373 | Bacteria | 1198 |
| 4 | JGI25407J50210_10128071 | 3300003373 | Bacteria | 625 |
| 5 | Ga0058863_11265689 | 3300004799 | Bacteria | 651 |
| 6 | Ga0070658_10089982 | 3300005327 | Bacteria | 2528 |
| 7 | Ga0070658_10099813 | 3300005327 | Bacteria | 2399 |
| 8 | Ga0070658_10268828 | 3300005327 | Bacteria | 1449 |
| 9 | Ga0068869_100656907 | 3300005334 | Unclassified | 891 |
| 10 | Ga0070680_100082601 | 3300005336 | Unclassified | 2652 |
| 11 | Ga0070680_100382014 | 3300005336 | Bacteria | 1199 |
| 12 | Ga0070680_101160501 | 3300005336 | Bacteria | 668 |
| 13 | Ga0070682_100483396 | 3300005337 | Bacteria | 956 |
| 14 | Ga0070682_100963143 | 3300005337 | Unclassified | 706 |
| 15 | Ga0068868_100453357 | 3300005338 | Bacteria | 1116 |
| 16 | Ga0068868_100841292 | 3300005338 | Unclassified | 831 |
| 17 | Ga0070660_100913108 | 3300005339 | Bacteria | 741 |
| 18 | Ga0070660_101723461 | 3300005339 | Bacteria | 534 |
| 19 | Ga0070689_102184248 | 3300005340 | Unclassified | 507 |
| 20 | Ga0070661_100084247 | 3300005344 | Unclassified | 2349 |
| 21 | Ga0070661_101380542 | 3300005344 | Bacteria | 592 |
| 22 | Ga0070692_10712082 | 3300005345 | Bacteria | 677 |
| 23 | Ga0070659_100052102 | 3300005366 | Bacteria | 3218 |
| 24 | Ga0070709_10171475 | 3300005434 | Unclassified | 1516 |
| 25 | Ga0070709_10183124 | 3300005434 | Unclassified | 1472 |
| 26 | Ga0070709_10584044 | 3300005434 | Bacteria | 858 |
| 27 | Ga0070709_11024649 | 3300005434 | Bacteria | 657 |
| 28 | Ga0070709_11409779 | 3300005434 | Unclassified | 564 |
| 29 | Ga0070714_100010662 | 3300005435 | Bacteria | 7271 |
| 30 | Ga0070714_100020292 | 3300005435 | Bacteria | 5425 |
| 31 | Ga0070714_100046929 | 3300005435 | Bacteria | 3666 |
| 32 | Ga0070714_100053413 | 3300005435 | Bacteria | 3449 |
| 33 | Ga0070714_100078924 | 3300005435 | Bacteria | 2862 |
| 34 | Ga0070714_100151958 | 3300005435 | Bacteria | 2087 |
| 35 | Ga0070714_100307051 | 3300005435 | Unclassified | 1480 |
| 36 | Ga0070714_100340074 | 3300005435 | Bacteria | 1407 |
| 37 | Ga0070714_101574358 | 3300005435 | Bacteria | 642 |
| 38 | Ga0070713_100009281 | 3300005436 | Bacteria | 7032 |
| 39 | Ga0070713_100030647 | 3300005436 | Bacteria | 4273 |
| 40 | Ga0070713_100050053 | 3300005436 | Bacteria | 3449 |
| 41 | Ga0070713_100207489 | 3300005436 | Unclassified | 1772 |
| 42 | Ga0070713_100299380 | 3300005436 | Unclassified | 1480 |
| 43 | Ga0070713_101027518 | 3300005436 | Unclassified | 795 |
| 44 | Ga0070713_101599634 | 3300005436 | Bacteria | 632 |
| 45 | Ga0070713_101617308 | 3300005436 | Bacteria | 629 |
| 46 | Ga0070710_10006389 | 3300005437 | Bacteria | 5661 |
| 47 | Ga0070710_10021709 | 3300005437 | Bacteria | 3351 |
| 48 | Ga0070710_10148380 | 3300005437 | Unclassified | 1444 |
| 49 | Ga0070710_10447984 | 3300005437 | Bacteria | 874 |
| 50 | Ga0070710_10959879 | 3300005437 | Bacteria | 620 |
| 51 | Ga0070711_100100227 | 3300005439 | Bacteria | 2106 |
| 52 | Ga0070711_100220026 | 3300005439 | Unclassified | 1475 |
| 53 | Ga0070711_100464120 | 3300005439 | Unclassified | 1038 |
| 54 | Ga0070711_100690986 | 3300005439 | Bacteria | 858 |
| 55 | Ga0070711_101191650 | 3300005439 | Bacteria | 658 |
| 56 | Ga0070705_100007045 | 3300005440 | Bacteria | 5526 |
| 57 | Ga0070708_100396595 | 3300005445 | Bacteria | 1301 |
| 58 | Ga0070708_100761990 | 3300005445 | Bacteria | 910 |
| 59 | Ga0070708_101316466 | 3300005445 | Bacteria | 675 |
| 60 | Ga0070708_101885844 | 3300005445 | Unclassified | 554 |
| 61 | Ga0070708_102084366 | 3300005445 | Unclassified | 525 |
| 62 | Ga0070663_100310057 | 3300005455 | Bacteria | 1266 |
| 63 | Ga0070663_100562027 | 3300005455 | Unclassified | 955 |
| 64 | Ga0070663_100578642 | 3300005455 | Unclassified | 942 |
| 65 | Ga0070678_100073819 | 3300005456 | Bacteria | 2561 |
| 66 | Ga0070678_101203656 | 3300005456 | Bacteria | 702 |
| 67 | Ga0070681_10010595 | 3300005458 | Bacteria | 9108 |
| 68 | Ga0070681_10621985 | 3300005458 | Unclassified | 994 |
| 69 | Ga0070706_100000939 | 3300005467 | Bacteria | 31876 |
| 70 | Ga0070706_100007212 | 3300005467 | Bacteria | 10446 |
| 71 | Ga0070706_100018337 | 3300005467 | Bacteria | 6457 |
| 72 | Ga0070706_100020451 | 3300005467 | Bacteria | 6101 |
| 73 | Ga0070707_100000166 | 3300005468 | Bacteria | 63590 |
| 74 | Ga0070707_100004101 | 3300005468 | Bacteria | 13683 |
| 75 | Ga0070707_100020974 | 3300005468 | Bacteria | 6170 |
| 76 | Ga0070707_100323204 | 3300005468 | Bacteria | 1499 |
| 77 | Ga0070707_100440272 | 3300005468 | Bacteria | 1264 |
| 78 | Ga0070698_100000006 | 3300005471 | Bacteria | 129236 |
| 79 | Ga0070698_100011358 | 3300005471 | Bacteria | 9453 |
| 80 | Ga0070698_100020214 | 3300005471 | Bacteria | 6981 |
| 81 | Ga0070698_100337701 | 3300005471 | Bacteria | 1438 |
| 82 | Ga0070698_100779910 | 3300005471 | Bacteria | 899 |
| 83 | Ga0070699_100396398 | 3300005518 | Bacteria | 1247 |
| 84 | Ga0070699_100620868 | 3300005518 | Unclassified | 986 |
| 85 | Ga0070679_100187194 | 3300005530 | Unclassified | 2040 |
| 86 | Ga0070679_100674063 | 3300005530 | Bacteria | 977 |
| 87 | Ga0070679_101523290 | 3300005530 | Bacteria | 616 |
| 88 | Ga0070684_100094120 | 3300005535 | Bacteria | 2668 |
| 89 | Ga0070684_100616459 | 3300005535 | Bacteria | 1009 |
| 90 | Ga0070684_100796859 | 3300005535 | Bacteria | 883 |
| 91 | Ga0070697_100170674 | 3300005536 | Bacteria | 1841 |
| 92 | Ga0070686_100191865 | 3300005544 | Bacteria | 1459 |
| 93 | Ga0070686_100392319 | 3300005544 | Unclassified | 1053 |
| 94 | Ga0070695_100542894 | 3300005545 | Unclassified | 905 |
| 95 | Ga0070695_101580510 | 3300005545 | Bacteria | 547 |
| 96 | Ga0070696_100146121 | 3300005546 | Bacteria | 1732 |
| 97 | Ga0070696_100248366 | 3300005546 | Bacteria | 1345 |
| 98 | Ga0070693_100165614 | 3300005547 | Bacteria | 1411 |
| 99 | Ga0070665_100101876 | 3300005548 | Unclassified | 2875 |
| 100 | Ga0070704_100071467 | 3300005549 | Unclassified | 2521 |
| 101 | Ga0068855_100686104 | 3300005563 | Bacteria | 1097 |
| 102 | Ga0068855_101229658 | 3300005563 | Bacteria | 778 |
| 103 | Ga0068855_101698651 | 3300005563 | Bacteria | 644 |
| 104 | Ga0070664_100971997 | 3300005564 | Archaea | 797 |
| 105 | Ga0070664_101176355 | 3300005564 | Unclassified | 723 |
| 106 | Ga0068857_100855787 | 3300005577 | Bacteria | 870 |
| 107 | Ga0068857_100868040 | 3300005577 | Bacteria | 864 |
| 108 | Ga0068857_100925787 | 3300005577 | Bacteria | 837 |
| 109 | Ga0068854_100736964 | 3300005578 | Bacteria | 854 |
| 110 | Ga0068856_100026347 | 3300005614 | Bacteria | 5669 |
| 111 | Ga0068856_100162308 | 3300005614 | Bacteria | 2245 |
| 112 | Ga0068856_100437340 | 3300005614 | Unclassified | 1328 |
| 113 | Ga0068856_100626947 | 3300005614 | Bacteria | 1096 |
| 114 | Ga0070702_100024635 | 3300005615 | Bacteria | 3213 |
| 115 | Ga0068852_100017352 | 3300005616 | Bacteria | 5646 |
| 116 | Ga0068852_102297328 | 3300005616 | Unclassified | 560 |
| 117 | Ga0068870_10239997 | 3300005840 | Bacteria | 1118 |
| 118 | Ga0068863_100448235 | 3300005841 | Unclassified | 1266 |
| 119 | Ga0068863_102348576 | 3300005841 | Unclassified | 543 |
| 120 | Ga0068858_100422153 | 3300005842 | Unclassified | 1282 |
| 121 | Ga0068860_100167390 | 3300005843 | Bacteria | 2122 |
| 122 | Ga0081455_10054105 | 3300005937 | Bacteria | 3423 |
| 123 | Ga0081455_10082617 | 3300005937 | Bacteria | 2627 |
| 124 | Ga0081455_10554349 | 3300005937 | Unclassified | 759 |
| 125 | Ga0081538_10000635 | 3300005981 | Bacteria | 38947 |
| 126 | Ga0081538_10003841 | 3300005981 | Bacteria | 14036 |
| 127 | Ga0081538_10004099 | 3300005981 | Bacteria | 13548 |
| 128 | Ga0081538_10005257 | 3300005981 | Bacteria | 11689 |
| 129 | Ga0081538_10008316 | 3300005981 | Bacteria | 8833 |
| 130 | Ga0081538_10073319 | 3300005981 | Bacteria | 1871 |
| 131 | Ga0081538_10110826 | 3300005981 | Bacteria | 1348 |
| 132 | Ga0081538_10116631 | 3300005981 | Bacteria | 1295 |
| 133 | Ga0081539_10024682 | 3300005985 | Bacteria | 3893 |
| 134 | Ga0081539_10138950 | 3300005985 | Bacteria | 1183 |
| 135 | Ga0070717_10062603 | 3300006028 | Bacteria | 3086 |
| 136 | Ga0070717_10098365 | 3300006028 | Bacteria | 2480 |
| 137 | Ga0070717_10126499 | 3300006028 | Bacteria | 2194 |
| 138 | Ga0070717_10189906 | 3300006028 | Bacteria | 1795 |
| 139 | Ga0070717_10281032 | 3300006028 | Unclassified | 1476 |
| 140 | Ga0070717_11116885 | 3300006028 | Bacteria | 718 |
| 141 | Ga0075365_10110665 | 3300006038 | Bacteria | 1887 |
| 142 | Ga0075365_10393309 | 3300006038 | Bacteria | 978 |
| 143 | Ga0070715_10003458 | 3300006163 | Bacteria | 5025 |
| 144 | Ga0070715_10009201 | 3300006163 | Bacteria | 3473 |
| 145 | Ga0070715_10013051 | 3300006163 | Bacteria | 3042 |
| 146 | Ga0070715_10042129 | 3300006163 | Unclassified | 1917 |
| 147 | Ga0070715_10156705 | 3300006163 | Bacteria | 1121 |
| 148 | Ga0070716_100001899 | 3300006173 | Bacteria | 9483 |
| 149 | Ga0070716_100026860 | 3300006173 | Bacteria | 3086 |
| 150 | Ga0070716_100140236 | 3300006173 | Unclassified | 1540 |
| 151 | Ga0070716_100236424 | 3300006173 | Bacteria | 1236 |
| 152 | Ga0070716_100425841 | 3300006173 | Bacteria | 961 |
| 153 | Ga0070716_100770281 | 3300006173 | Bacteria | 742 |
| 154 | Ga0070716_101012555 | 3300006173 | Bacteria | 657 |
| 155 | Ga0070716_101030017 | 3300006173 | Bacteria | 652 |
| 156 | Ga0070712_100016737 | 3300006175 | Bacteria | 4740 |
| 157 | Ga0070712_100031273 | 3300006175 | Bacteria | 3584 |
| 158 | Ga0070712_100167835 | 3300006175 | Unclassified | 1700 |
| 159 | Ga0070712_100203670 | 3300006175 | Unclassified | 1556 |
| 160 | Ga0070712_100873727 | 3300006175 | Bacteria | 774 |
| 161 | Ga0070712_101153564 | 3300006175 | Bacteria | 673 |
| 162 | Ga0097621_100584403 | 3300006237 | Bacteria | 1019 |
| 163 | Ga0068871_100534227 | 3300006358 | Bacteria | 1060 |
| 164 | Ga0068871_101946245 | 3300006358 | Unclassified | 559 |
| 165 | Ga0075428_100648274 | 3300006844 | Unclassified | 1126 |
| 166 | Ga0075428_100823437 | 3300006844 | Bacteria | 986 |
| 167 | Ga0075430_100739953 | 3300006846 | Bacteria | 811 |
| 168 | Ga0075430_101656038 | 3300006846 | Bacteria | 525 |
| 169 | Ga0075433_10091668 | 3300006852 | Bacteria | 2687 |
| 170 | Ga0075434_100052596 | 3300006871 | Bacteria | 4047 |
| 171 | Ga0075434_100460198 | 3300006871 | Bacteria | 1293 |
| 172 | Ga0075434_101116615 | 3300006871 | Unclassified | 801 |
| 173 | Ga0075429_100260889 | 3300006880 | Unclassified | 1517 |
| 174 | Ga0075436_100034851 | 3300006914 | Bacteria | 3472 |
| 175 | Ga0075436_100163174 | 3300006914 | Bacteria | 1571 |
| 176 | Ga0075436_100274973 | 3300006914 | Bacteria | 1203 |
| 177 | Ga0075436_100746234 | 3300006914 | Bacteria | 727 |
| 178 | Ga0075436_100765468 | 3300006914 | Bacteria | 718 |
| 179 | Ga0075435_100084390 | 3300007076 | Bacteria | 2613 |
| 180 | Ga0075435_100142665 | 3300007076 | Unclassified | 2010 |
| 181 | Ga0075435_100173424 | 3300007076 | Bacteria | 1820 |
| 182 | Ga0075435_100236315 | 3300007076 | Bacteria | 1553 |
| 183 | Ga0075435_101573308 | 3300007076 | Bacteria | 577 |
| 184 | Ga0099795_10461520 | 3300007788 | Unclassified | 586 |
| 185 | Ga0105251_10195194 | 3300009011 | Unclassified | 912 |
| 186 | Ga0105240_10761005 | 3300009093 | Bacteria | 1052 |
| 187 | Ga0111539_10083731 | 3300009094 | Bacteria | 3750 |
| 188 | Ga0111539_10278012 | 3300009094 | Bacteria | 1948 |
| 189 | Ga0105247_10375284 | 3300009101 | Bacteria | 1007 |
| 190 | Ga0114129_10009365 | 3300009147 | Bacteria | 13966 |
| 191 | Ga0114129_10967132 | 3300009147 | Unclassified | 1074 |
| 192 | Ga0114129_11852284 | 3300009147 | Bacteria | 733 |
| 193 | Ga0105243_12046420 | 3300009148 | Bacteria | 608 |
| 194 | Ga0105241_10244356 | 3300009174 | Bacteria | 1519 |
| 195 | Ga0105241_10934283 | 3300009174 | Bacteria | 807 |
| 196 | Ga0105242_10129411 | 3300009176 | Unclassified | 2177 |
| 197 | Ga0105237_10277930 | 3300009545 | Bacteria | 1677 |
| 198 | Ga0105237_10854221 | 3300009545 | Bacteria | 917 |
| 199 | Ga0105238_10130511 | 3300009551 | Unclassified | 2491 |
| 200 | Ga0105238_10339739 | 3300009551 | Bacteria | 1489 |
| 201 | Ga0105249_10456944 | 3300009553 | Unclassified | 1316 |
| 202 | Ga0105246_10166146 | 3300011119 | Bacteria | 1685 |
| 203 | Ga0154016_131472 | 3300013045 | Bacteria | 987 |
| 204 | Ga0157373_10084177 | 3300013100 | Unclassified | 2242 |
| 205 | Ga0157370_10090426 | 3300013104 | Bacteria | 2874 |
| 206 | Ga0157369_10002422 | 3300013105 | Bacteria | 22422 |
| 207 | Ga0157369_10016802 | 3300013105 | Bacteria | 8225 |
| 208 | Ga0157369_10217237 | 3300013105 | Bacteria | 2002 |
| 209 | Ga0157369_10229004 | 3300013105 | Bacteria | 1943 |
| 210 | Ga0157369_10496770 | 3300013105 | Unclassified | 1262 |
| 211 | Ga0157374_10107907 | 3300013296 | Bacteria | 2676 |
| 212 | Ga0157374_12062421 | 3300013296 | Bacteria | 597 |
| 213 | Ga0157378_10021358 | 3300013297 | Bacteria | 5692 |
| 214 | Ga0163162_10436036 | 3300013306 | Unclassified | 1442 |
| 215 | Ga0157372_10097103 | 3300013307 | Bacteria | 3359 |
| 216 | Ga0157372_11951715 | 3300013307 | Bacteria | 675 |
| 217 | Ga0157375_10423515 | 3300013308 | Bacteria | 1497 |
| 218 | Ga0157375_10761315 | 3300013308 | Bacteria | 1119 |
| 219 | Ga0163163_10410551 | 3300014325 | Unclassified | 1413 |
| 220 | Ga0163163_11113648 | 3300014325 | Bacteria | 852 |
| 221 | Ga0182008_10162088 | 3300014497 | Bacteria | 1126 |
| 222 | Ga0157379_11127867 | 3300014968 | Bacteria | 752 |
| 223 | Ga0157376_10503846 | 3300014969 | Unclassified | 1190 |
| 224 | Ga0157376_10762414 | 3300014969 | Bacteria | 978 |
| 225 | Ga0182005_1079799 | 3300015265 | Bacteria | 903 |
| 226 | Ga0197907_10101199 | 3300020069 | Bacteria | 544 |
| 227 | Ga0197907_10249360 | 3300020069 | Unclassified | 603 |
| 228 | Ga0197907_10503529 | 3300020069 | Bacteria | 3157 |
| 229 | Ga0197907_10946039 | 3300020069 | Bacteria | 823 |
| 230 | Ga0197907_11025201 | 3300020069 | Bacteria | 758 |
| 231 | Ga0197907_11250657 | 3300020069 | Bacteria | 5884 |
| 232 | Ga0206356_10829837 | 3300020070 | Bacteria | 1209 |
| 233 | Ga0206356_11058141 | 3300020070 | Bacteria | 978 |
| 234 | Ga0206356_11516356 | 3300020070 | Bacteria | 650 |
| 235 | Ga0206356_11739667 | 3300020070 | Bacteria | 2712 |
| 236 | Ga0206349_1452561 | 3300020075 | Bacteria | 1404 |
| 237 | Ga0206349_1457924 | 3300020075 | Bacteria | 1729 |
| 238 | Ga0206349_1943060 | 3300020075 | Bacteria | 963 |
| 239 | Ga0206355_1444598 | 3300020076 | Bacteria | 1572 |
| 240 | Ga0206355_1529971 | 3300020076 | Bacteria | 824 |
| 241 | Ga0206351_10332592 | 3300020077 | Bacteria | 1145 |
| 242 | Ga0206351_10354766 | 3300020077 | Unclassified | 584 |
| 243 | Ga0206351_10741260 | 3300020077 | Bacteria | 1812 |
| 244 | Ga0206351_10902751 | 3300020077 | Bacteria | 779 |
| 245 | Ga0206350_10270511 | 3300020080 | Bacteria | 663 |
| 246 | Ga0206350_11064801 | 3300020080 | Bacteria | 533 |
| 247 | Ga0206350_11240311 | 3300020080 | Bacteria | 666 |
| 248 | Ga0206350_11356179 | 3300020080 | Bacteria | 651 |
| 249 | Ga0206350_11420438 | 3300020080 | Bacteria | 1718 |
| 250 | Ga0206354_10519068 | 3300020081 | Bacteria | 774 |
| 251 | Ga0206354_10572110 | 3300020081 | Bacteria | 1429 |
| 252 | Ga0206354_10612338 | 3300020081 | Bacteria | 998 |
| 253 | Ga0206354_11485858 | 3300020081 | Bacteria | 1206 |
| 254 | Ga0206353_10714114 | 3300020082 | Bacteria | 2698 |
| 255 | Ga0206353_10840274 | 3300020082 | Bacteria | 502 |
| 256 | Ga0206353_10865515 | 3300020082 | Bacteria | 1247 |
| 257 | Ga0206353_11353822 | 3300020082 | Bacteria | 3171 |
| 258 | Ga0154015_1580273 | 3300020610 | Bacteria | 634 |
| 259 | Ga0154015_1661415 | 3300020610 | Bacteria | 782 |
| 260 | Ga0213875_10125934 | 3300021388 | Bacteria | 1197 |
| 261 | Ga0213875_10314853 | 3300021388 | Unclassified | 741 |
| 262 | Ga0213875_10489172 | 3300021388 | Unclassified | 591 |
| 263 | Ga0224712_10005170 | 3300022467 | Bacteria | 3605 |
| 264 | Ga0224712_10016014 | 3300022467 | Bacteria | 2453 |
| 265 | Ga0224712_10046345 | 3300022467 | Bacteria | 1668 |
| 266 | Ga0224712_10046507 | 3300022467 | Bacteria | 1666 |
| 267 | Ga0224712_10095591 | 3300022467 | Bacteria | 1251 |
| 268 | Ga0224712_10175039 | 3300022467 | Bacteria | 964 |
| 269 | Ga0224712_10229901 | 3300022467 | Unclassified | 851 |
| 270 | Ga0224712_10379496 | 3300022467 | Bacteria | 671 |
| 271 | Ga0224712_10384847 | 3300022467 | Unclassified | 667 |
| 272 | Ga0207692_10003841 | 3300025898 | Bacteria | 5903 |
| 273 | Ga0207692_10046482 | 3300025898 | Bacteria | 2176 |
| 274 | Ga0207692_10103755 | 3300025898 | Bacteria | 1566 |
| 275 | Ga0207692_10174777 | 3300025898 | Bacteria | 1247 |
| 276 | Ga0207692_10185222 | 3300025898 | Unclassified | 1215 |
| 277 | Ga0207688_10984093 | 3300025901 | Bacteria | 533 |
| 278 | Ga0207680_10474645 | 3300025903 | Bacteria | 889 |
| 279 | Ga0207647_10155324 | 3300025904 | Bacteria | 1336 |
| 280 | Ga0207685_10000749 | 3300025905 | Bacteria | 5928 |
| 281 | Ga0207685_10277700 | 3300025905 | Bacteria | 821 |
| 282 | Ga0207685_10283588 | 3300025905 | Bacteria | 814 |
| 283 | Ga0207699_10001111 | 3300025906 | Bacteria | 12725 |
| 284 | Ga0207699_10004397 | 3300025906 | Bacteria | 6740 |
| 285 | Ga0207699_10052772 | 3300025906 | Bacteria | 2408 |
| 286 | Ga0207699_10181150 | 3300025906 | Bacteria | 1416 |
| 287 | Ga0207699_10379288 | 3300025906 | Bacteria | 1003 |
| 288 | Ga0207699_10412320 | 3300025906 | Bacteria | 964 |
| 289 | Ga0207699_11185001 | 3300025906 | Unclassified | 566 |
| 290 | Ga0207705_10119042 | 3300025909 | Bacteria | 1958 |
| 291 | Ga0207705_10261881 | 3300025909 | Bacteria | 1320 |
| 292 | Ga0207684_10050186 | 3300025910 | Bacteria | 3539 |
| 293 | Ga0207684_10074627 | 3300025910 | Bacteria | 2881 |
| 294 | Ga0207684_10357140 | 3300025910 | Bacteria | 1257 |
| 295 | Ga0207654_10302508 | 3300025911 | Bacteria | 1088 |
| 296 | Ga0207654_10793509 | 3300025911 | Unclassified | 684 |
| 297 | Ga0207654_11102585 | 3300025911 | Unclassified | 578 |
| 298 | Ga0207707_10102195 | 3300025912 | Bacteria | 2505 |
| 299 | Ga0207707_10538047 | 3300025912 | Unclassified | 993 |
| 300 | Ga0207707_11091966 | 3300025912 | Bacteria | 651 |
| 301 | Ga0207695_10684055 | 3300025913 | Bacteria | 906 |
| 302 | Ga0207671_11033363 | 3300025914 | Unclassified | 647 |
| 303 | Ga0207693_10013495 | 3300025915 | Bacteria | 6585 |
| 304 | Ga0207693_10019026 | 3300025915 | Bacteria | 5467 |
| 305 | Ga0207693_10026835 | 3300025915 | Bacteria | 4556 |
| 306 | Ga0207693_10359365 | 3300025915 | Unclassified | 1139 |
| 307 | Ga0207663_10000281 | 3300025916 | Bacteria | 22286 |
| 308 | Ga0207663_10022532 | 3300025916 | Bacteria | 3602 |
| 309 | Ga0207663_10069536 | 3300025916 | Bacteria | 2265 |
| 310 | Ga0207663_10206939 | 3300025916 | Bacteria | 1419 |
| 311 | Ga0207663_10349235 | 3300025916 | Bacteria | 1119 |
| 312 | Ga0207663_10435090 | 3300025916 | Bacteria | 1009 |
| 313 | Ga0207660_10527705 | 3300025917 | Unclassified | 959 |
| 314 | Ga0207649_10262970 | 3300025920 | Unclassified | 1247 |
| 315 | Ga0207652_10319223 | 3300025921 | Bacteria | 1402 |
| 316 | Ga0207652_10660530 | 3300025921 | Unclassified | 934 |
| 317 | Ga0207646_10000049 | 3300025922 | Bacteria | 171680 |
| 318 | Ga0207646_10008672 | 3300025922 | Bacteria | 10155 |
| 319 | Ga0207646_10010500 | 3300025922 | Bacteria | 9041 |
| 320 | Ga0207646_10244809 | 3300025922 | Bacteria | 1620 |
| 321 | Ga0207694_10588886 | 3300025924 | Unclassified | 935 |
| 322 | Ga0207687_10968963 | 3300025927 | Bacteria | 729 |
| 323 | Ga0207700_10000703 | 3300025928 | Bacteria | 19387 |
| 324 | Ga0207700_10003873 | 3300025928 | Bacteria | 8744 |
| 325 | Ga0207700_10004961 | 3300025928 | Bacteria | 7909 |
| 326 | Ga0207700_10036458 | 3300025928 | Bacteria | 3552 |
| 327 | Ga0207700_10047849 | 3300025928 | Bacteria | 3173 |
| 328 | Ga0207700_10406204 | 3300025928 | Bacteria | 1194 |
| 329 | Ga0207700_10723312 | 3300025928 | Bacteria | 889 |
| 330 | Ga0207700_11084340 | 3300025928 | Bacteria | 716 |
| 331 | Ga0207664_10001364 | 3300025929 | Bacteria | 16039 |
| 332 | Ga0207664_10016099 | 3300025929 | Bacteria | 5447 |
| 333 | Ga0207664_10035079 | 3300025929 | Unclassified | 3868 |
| 334 | Ga0207664_10036347 | 3300025929 | Bacteria | 3807 |
| 335 | Ga0207664_10051349 | 3300025929 | Bacteria | 3255 |
| 336 | Ga0207664_10058393 | 3300025929 | Bacteria | 3069 |
| 337 | Ga0207664_10074708 | 3300025929 | Bacteria | 2739 |
| 338 | Ga0207664_10093295 | 3300025929 | Bacteria | 2472 |
| 339 | Ga0207664_10180942 | 3300025929 | Bacteria | 1810 |
| 340 | Ga0207664_10312694 | 3300025929 | Bacteria | 1384 |
| 341 | Ga0207664_11489587 | 3300025929 | Bacteria | 598 |
| 342 | Ga0207644_10234209 | 3300025931 | Unclassified | 1460 |
| 343 | Ga0207709_11268446 | 3300025935 | Bacteria | 608 |
| 344 | Ga0207665_10034231 | 3300025939 | Bacteria | 3371 |
| 345 | Ga0207665_10072912 | 3300025939 | Bacteria | 2347 |
| 346 | Ga0207665_10115944 | 3300025939 | Bacteria | 1887 |
| 347 | Ga0207665_10435702 | 3300025939 | Bacteria | 1003 |
| 348 | Ga0207689_10008124 | 3300025942 | Bacteria | 9154 |
| 349 | Ga0207661_10915117 | 3300025944 | Unclassified | 808 |
| 350 | Ga0207661_12178361 | 3300025944 | Bacteria | 501 |
| 351 | Ga0207679_10503199 | 3300025945 | Archaea | 1081 |
| 352 | Ga0207679_11069673 | 3300025945 | Bacteria | 740 |
| 353 | Ga0207667_10928543 | 3300025949 | Bacteria | 861 |
| 354 | Ga0207712_10888107 | 3300025961 | Bacteria | 787 |
| 355 | Ga0207640_10980351 | 3300025981 | Bacteria | 742 |
| 356 | Ga0207677_11917027 | 3300026023 | Unclassified | 551 |
| 357 | Ga0207703_10785721 | 3300026035 | Unclassified | 908 |
| 358 | Ga0207703_11429856 | 3300026035 | Bacteria | 665 |
| 359 | Ga0207678_10080258 | 3300026067 | Bacteria | 2793 |
| 360 | Ga0207678_10451563 | 3300026067 | Bacteria | 1117 |
| 361 | Ga0207678_11094703 | 3300026067 | Archaea | 705 |
| 362 | Ga0207702_10194515 | 3300026078 | Bacteria | 1876 |
| 363 | Ga0207702_10407295 | 3300026078 | Bacteria | 1313 |
| 364 | Ga0207702_11048026 | 3300026078 | Unclassified | 809 |
| 365 | Ga0207641_11105116 | 3300026088 | Unclassified | 791 |
| 366 | Ga0207641_12079683 | 3300026088 | Unclassified | 569 |
| 367 | Ga0207674_10192519 | 3300026116 | Bacteria | 1989 |
| 368 | Ga0207683_10000951 | 3300026121 | Bacteria | 26526 |
| 369 | Ga0207683_10726630 | 3300026121 | Bacteria | 921 |
| 370 | Ga0207698_10040406 | 3300026142 | Bacteria | 3466 |
| 371 | Ga0207698_10128734 | 3300026142 | Bacteria | 2159 |
| 372 | Ga0268266_11232566 | 3300028379 | Bacteria | 723 |
| 373 | Ga0268264_10144008 | 3300028381 | Bacteria | 2129 |
| 374 | Ga0265760_10311854 | 3300031090 | Bacteria | 558 |
| 375 | Ga0307408_100022486 | 3300031548 | Bacteria | 4285 |
| 376 | Ga0307408_100282707 | 3300031548 | Bacteria | 1382 |
| 377 | Ga0307408_101711777 | 3300031548 | Unclassified | 599 |
| 378 | Ga0307405_10002359 | 3300031731 | Bacteria | 8311 |
| 379 | Ga0307405_10011741 | 3300031731 | Bacteria | 4608 |
| 380 | Ga0307405_10060317 | 3300031731 | Unclassified | 2393 |
| 381 | Ga0307405_10081447 | 3300031731 | Bacteria | 2116 |
| 382 | Ga0307405_10118520 | 3300031731 | Bacteria | 1807 |
| 383 | Ga0307405_10454452 | 3300031731 | Bacteria | 1016 |
| 384 | Ga0307413_10014145 | 3300031824 | Bacteria | 4041 |
| 385 | Ga0307413_10145315 | 3300031824 | Bacteria | 1645 |
| 386 | Ga0307413_10227966 | 3300031824 | Bacteria | 1366 |
| 387 | Ga0307413_10403648 | 3300031824 | Bacteria | 1071 |
| 388 | Ga0307410_10060923 | 3300031852 | Bacteria | 2581 |
| 389 | Ga0307410_10086661 | 3300031852 | Bacteria | 2212 |
| 390 | Ga0307410_10089763 | 3300031852 | Bacteria | 2178 |
| 391 | Ga0307410_10151815 | 3300031852 | Bacteria | 1725 |
| 392 | Ga0307410_10389185 | 3300031852 | Bacteria | 1124 |
| 393 | Ga0307406_10001669 | 3300031901 | Bacteria | 12200 |
| 394 | Ga0307406_10081715 | 3300031901 | Bacteria | 2149 |
| 395 | Ga0307406_10194615 | 3300031901 | Bacteria | 1487 |
| 396 | Ga0307406_10311880 | 3300031901 | Bacteria | 1213 |
| 397 | Ga0307407_10010245 | 3300031903 | Bacteria | 4411 |
| 398 | Ga0307407_10038898 | 3300031903 | Bacteria | 2640 |
| 399 | Ga0307407_10149900 | 3300031903 | Bacteria | 1514 |
| 400 | Ga0307412_10037179 | 3300031911 | Bacteria | 3126 |
| 401 | Ga0307412_10256650 | 3300031911 | Bacteria | 1360 |
| 402 | Ga0307412_10598957 | 3300031911 | Bacteria | 933 |
| 403 | Ga0307409_100000552 | 3300031995 | Bacteria | 16263 |
| 404 | Ga0307409_100072702 | 3300031995 | Bacteria | 2739 |
| 405 | Ga0307409_100101536 | 3300031995 | Bacteria | 2387 |
| 406 | Ga0307409_100174687 | 3300031995 | Bacteria | 1895 |
| 407 | Ga0307409_100304668 | 3300031995 | Bacteria | 1484 |
| 408 | Ga0307409_100486700 | 3300031995 | Bacteria | 1198 |
| 409 | Ga0307409_100530784 | 3300031995 | Bacteria | 1151 |
| 410 | Ga0307409_101203786 | 3300031995 | Bacteria | 781 |
| 411 | Ga0307409_101958328 | 3300031995 | Bacteria | 615 |
| 412 | Ga0307416_100000276 | 3300032002 | Bacteria | 27133 |
| 413 | Ga0307416_100002882 | 3300032002 | Bacteria | 10018 |
| 414 | Ga0307416_100005358 | 3300032002 | Bacteria | 7872 |
| 415 | Ga0307416_100063208 | 3300032002 | Bacteria | 3030 |
| 416 | Ga0307416_100135635 | 3300032002 | Bacteria | 2225 |
| 417 | Ga0307416_101079250 | 3300032002 | Bacteria | 907 |
| 418 | Ga0307416_101225975 | 3300032002 | Unclassified | 856 |
| 419 | Ga0307416_102330852 | 3300032002 | Bacteria | 635 |
| 420 | Ga0307414_10030923 | 3300032004 | Bacteria | 3504 |
| 421 | Ga0307414_10088661 | 3300032004 | Bacteria | 2290 |
| 422 | Ga0307414_10109088 | 3300032004 | Bacteria | 2102 |
| 423 | Ga0307414_10169452 | 3300032004 | Bacteria | 1744 |
| 424 | Ga0307411_10078848 | 3300032005 | Bacteria | 2259 |
| 425 | Ga0307411_10079129 | 3300032005 | Bacteria | 2256 |
| 426 | Ga0307411_10113845 | 3300032005 | Bacteria | 1942 |
| 427 | Ga0307411_10155968 | 3300032005 | Bacteria | 1703 |
| 428 | Ga0307411_10668870 | 3300032005 | Bacteria | 901 |
| 429 | Ga0307415_100000257 | 3300032126 | Bacteria | 22928 |
| 430 | Ga0307415_100001904 | 3300032126 | Bacteria | 10252 |
| 431 | Ga0307415_100005123 | 3300032126 | Bacteria | 6909 |
| 432 | Ga0307415_100010229 | 3300032126 | Bacteria | 5301 |
| 433 | Ga0307415_100040228 | 3300032126 | Bacteria | 3095 |
| 434 | Ga0307415_100167359 | 3300032126 | Bacteria | 1710 |
| 435 | Ga0307415_100275303 | 3300032126 | Bacteria | 1381 |
| 436 | Ga0307415_100402550 | 3300032126 | Bacteria | 1169 |
| 437 | Ga0373950_0104287 | 3300034818 | Bacteria | 614 |
| 438 | Ga0373926_0275543 | 3300035083 | Bacteria | 655 |
| 439 | Ga0373928_0083399 | 3300035084 | Bacteria | 809 |
| 440 | Ga0373929_0046228 | 3300035085 | Bacteria | 983 |
| 441 | Ga0373934_0215233 | 3300035086 | Unclassified | 792 |
| 442 | Ga0373934_0279377 | 3300035086 | Bacteria | 691 |
| 443 | Ga0373940_0058756 | 3300035088 | Archaea | 1095 |
| 444 | Ga0373949_0075300 | 3300035090 | Bacteria | 891 |
| 445 | Ga0373952_0243463 | 3300035092 | Bacteria | 542 |
| 446 | Ga0373923_0015461 | 3300035111 | Bacteria | 2881 |
| 447 | Ga0373923_0245970 | 3300035111 | Bacteria | 836 |
| 448 | Ga0373932_0200405 | 3300035112 | Bacteria | 709 |
| 449 | Ga0373936_0005545 | 3300035113 | Bacteria | 4762 |
| 450 | Ga0373936_0325361 | 3300035113 | Unclassified | 697 |
| 451 | Ga0373939_0075485 | 3300035114 | Unclassified | 1108 |
| 452 | Ga0373941_0082293 | 3300035115 | Bacteria | 1089 |
| 453 | Ga0373945_0066126 | 3300035116 | Bacteria | 1359 |
| 454 | Ga0373945_0426126 | 3300035116 | Unclassified | 584 |
| 455 | Ga0373953_0003936 | 3300035117 | Bacteria | 4679 |
| 456 | Ga0373953_0066075 | 3300035117 | Unclassified | 1485 |
| 457 | Ga0373954_0032161 | 3300035118 | Bacteria | 2424 |
| 458 | Ga0373954_0241534 | 3300035118 | Bacteria | 889 |
| 459 | Ga0373957_0000327 | 3300035120 | Bacteria | 12009 |
| 460 | Ga0373957_0308899 | 3300035120 | Unclassified | 671 |
| 461 | Ga0373955_0679685 | 3300035172 | Bacteria | 631 |
| 462 | Ga0373942_0023120 | 3300035207 | Bacteria | 1584 |
| 463 | Ga0373961_0028711 | 3300035241 | Bacteria | 1535 |
| 464 | Ga0373962_0268397 | 3300035242 | Unclassified | 597 |
| 465 | Ga0373924_0040498 | 3300035410 | Bacteria | 1907 |
| 466 | Ga0373931_0134710 | 3300035691 | Bacteria | 1425 |
| 467 | Ga0373931_0499455 | 3300035691 | Bacteria | 784 |
| 468 | Ga0373935_0086824 | 3300035692 | Bacteria | 2042 |
| 469 | Ga0373935_0510501 | 3300035692 | Bacteria | 873 |
| 470 | Ga0373935_1397561 | 3300035692 | Unclassified | 523 |
| 471 | Ga0373927_0167885 | 3300035695 | Bacteria | 1438 |
| 472 | Ga0373927_0193473 | 3300035695 | Bacteria | 1335 |
| 473 | Ga0373933_0423624 | 3300035724 | Bacteria | 869 |
| 474 | Ga0373947_0020987 | 3300035725 | Bacteria | 3779 |
| 475 | Ga0373947_0268892 | 3300035725 | Bacteria | 1131 |
| 476 | Ga0373937_0093183 | 3300036401 | Bacteria | 2792 |
| 477 | Ga0373937_0282545 | 3300036401 | Bacteria | 1567 |
| 478 | Ga0373937_0299118 | 3300036401 | Bacteria | 1521 |
| 479 | Ga0373937_0787415 | 3300036401 | Bacteria | 899 |
| 480 | Ga0373925_0013905 | 3300037068 | Bacteria | 5826 |
| 481 | Ga0373925_0275236 | 3300037068 | Bacteria | 1355 |
| 482 | Ga0373925_0796456 | 3300037068 | Bacteria | 779 |
| 483 | Ga0373925_0891259 | 3300037068 | Bacteria | 733 |
| 484 | Ga0373925_1334662 | 3300037068 | Bacteria | 588 |
| 485 | Ga0395899_0671654 | 3300037312 | Bacteria | 653 |
| 486 | Ga0395899_0753493 | 3300037312 | Bacteria | 606 |
| 487 | Ga0395900_0188116 | 3300037418 | Bacteria | 2095 |
| 488 | Ga0395898_0817843 | 3300037466 | Bacteria | 872 |
| 489 | Ga0395905_0274107 | 3300037471 | Bacteria | 1573 |
| 490 | Ga0395905_0833109 | 3300037471 | Bacteria | 825 |
| 491 | Ga0436364_0603707 | 3300037853 | Unclassified | 1799 |
| 492 | Ga0436364_0719141 | 3300037853 | Bacteria | 1207 |
| 493 | Ga0436364_1059409 | 3300037853 | Bacteria | 1059 |
| 494 | Ga0436364_1356142 | 3300037853 | Bacteria | 1840 |
| 495 | Ga0436364_1503601 | 3300037853 | Bacteria | 5087 |
| 496 | Ga0436364_1552435 | 3300037853 | Bacteria | 596 |
| 497 | Ga0395901_0007564 | 3300038443 | Bacteria | 10973 |
| 498 | Ga0436365_1556469 | 3300039437 | Bacteria | 729 |
| 499 | Ga0436361_0423855 | 3300039447 | Bacteria | 567 |
| 500 | Ga0436361_0537557 | 3300039447 | Bacteria | 503 |
| 501 | Ga0436363_1070021 | 3300039450 | Bacteria | 1498 |
| 502 | Ga0436363_1337738 | 3300039450 | Unclassified | 1966 |
| 503 | Ga0436362_0013593 | 3300039453 | Unclassified | 616 |
| 504 | Ga0439443_029103 | 3300042003 | Bacteria | 904 |
| 505 | Ga0439448_0039352 | 3300042005 | Unclassified | 1524 |
| 506 | Ga0439448_0110017 | 3300042005 | Bacteria | 941 |
| 507 | Ga0439450_079968 | 3300042008 | Bacteria | 812 |
| 508 | Ga0439454_108943 | 3300042011 | Unclassified | 527 |
| 509 | Ga0439455_0007482 | 3300042012 | Bacteria | 2311 |
| 510 | Ga0439463_050466 | 3300042016 | Bacteria | 1061 |
| 511 | Ga0450893_0096004 | 3300042532 | Bacteria | 600 |
| 512 | Ga0439440_0008234 | 3300042993 | Bacteria | 2136 |
| 513 | Ga0439440_0161769 | 3300042993 | Unclassified | 646 |
| 514 | Ga0466972_0291340 | 3300044658 | Bacteria | 763 |
| 515 | Ga0466965_0688893 | 3300044683 | Bacteria | 586 |
| 516 | Ga0466966_0360443 | 3300044684 | Bacteria | 873 |
| 517 | Ga0466961_0023841 | 3300044693 | Bacteria | 3937 |
| 518 | Ga0466961_0024151 | 3300044693 | Bacteria | 3910 |
| 519 | Ga0466963_0002387 | 3300044694 | Bacteria | 10500 |
| 520 | Ga0466963_0010864 | 3300044694 | Bacteria | 5528 |
| 521 | Ga0466963_0036278 | 3300044694 | Bacteria | 3214 |
| 522 | Ga0466963_0053750 | 3300044694 | Bacteria | 2675 |
| 523 | Ga0466963_0084456 | 3300044694 | Bacteria | 2154 |
| 524 | Ga0466963_0113809 | 3300044694 | Bacteria | 1858 |
| 525 | Ga0466963_0154566 | 3300044694 | Bacteria | 1594 |
| 526 | Ga0466963_0331349 | 3300044694 | Bacteria | 1072 |
| 527 | Ga0466963_0680891 | 3300044694 | Bacteria | 726 |
| 528 | Ga0466964_0033161 | 3300044706 | Bacteria | 2056 |
| 529 | Ga0466964_0063299 | 3300044706 | Bacteria | 1545 |
| 530 | Ga0466964_0154397 | 3300044706 | Bacteria | 1067 |
| 531 | Ga0466964_0192690 | 3300044706 | Unclassified | 974 |
| 532 | Ga0466964_0525205 | 3300044706 | Bacteria | 639 |
| 533 | Ga0466964_0665298 | 3300044706 | Unclassified | 577 |
| 534 | Ga0466971_0012120 | 3300044719 | Bacteria | 3778 |
| 535 | Ga0466971_0018073 | 3300044719 | Bacteria | 3123 |
| 536 | Ga0466971_0330045 | 3300044719 | Bacteria | 736 |
| 537 | Ga0466971_0468688 | 3300044719 | Bacteria | 619 |
| 538 | Ga0466970_0434332 | 3300044765 | Bacteria | 751 |
| 539 | Ga0466957_0001981 | 3300044842 | Bacteria | 10904 |
| 540 | Ga0466957_0006686 | 3300044842 | Bacteria | 6520 |
| 541 | Ga0466957_0728263 | 3300044842 | Bacteria | 701 |
| 542 | Ga0466960_1026255 | 3300044901 | Bacteria | 507 |
| 543 | Ga0466959_0025048 | 3300045049 | Bacteria | 4420 |
| 544 | Ga0466959_0093798 | 3300045049 | Bacteria | 2154 |
| 545 | Ga0466958_0014965 | 3300045836 | Bacteria | 4437 |
| 546 | Ga0466958_0023628 | 3300045836 | Bacteria | 3611 |
| 547 | Ga0466958_0025815 | 3300045836 | Bacteria | 3467 |
| 548 | Ga0466958_0148997 | 3300045836 | Bacteria | 1475 |
| 549 | Ga0466958_0155758 | 3300045836 | Bacteria | 1442 |
| 550 | Ga0466958_0225454 | 3300045836 | Bacteria | 1196 |
| 551 | Ga0466958_0630420 | 3300045836 | Bacteria | 698 |
| 552 | Ga0466967_0001825 | 3300045976 | Bacteria | 12808 |
| 553 | Ga0466967_0013890 | 3300045976 | Bacteria | 6245 |
| 554 | Ga0466967_0018355 | 3300045976 | Bacteria | 5587 |
| 555 | Ga0466967_0027537 | 3300045976 | Bacteria | 4730 |
| 556 | Ga0466967_0036220 | 3300045976 | Bacteria | 4210 |
| 557 | Ga0466967_0123546 | 3300045976 | Bacteria | 2395 |
| 558 | Ga0466967_0153709 | 3300045976 | Bacteria | 2153 |
| 559 | Ga0466967_0185149 | 3300045976 | Bacteria | 1966 |
| 560 | Ga0466967_0204525 | 3300045976 | Bacteria | 1871 |
| 561 | Ga0466967_0342803 | 3300045976 | Bacteria | 1445 |
| 562 | Ga0466967_0649068 | 3300045976 | Bacteria | 1043 |
| 563 | Ga0466967_0810153 | 3300045976 | Bacteria | 930 |
| 564 | Ga0495592_0211894 | 3300046454 | Bacteria | 1300 |
| 565 | Ga0495592_0634561 | 3300046454 | Unclassified | 648 |
| 566 | Ga0495603_0281019 | 3300046455 | Bacteria | 957 |
| 567 | Ga0495629_0018817 | 3300046459 | Bacteria | 4937 |
| 568 | Ga0495629_0034472 | 3300046459 | Bacteria | 3578 |
| 569 | Ga0495651_0239127 | 3300046462 | Bacteria | 1246 |
| 570 | Ga0495651_0729937 | 3300046462 | Unclassified | 615 |
| 571 | Ga0495653_0193110 | 3300046463 | Unclassified | 1387 |
| 572 | Ga0495653_0209892 | 3300046463 | Bacteria | 1316 |
| 573 | Ga0495653_0470057 | 3300046463 | Bacteria | 788 |
| 574 | Ga0495580_0922794 | 3300046472 | Unclassified | 560 |
| 575 | Ga0495582_0237881 | 3300046473 | Bacteria | 1043 |
| 576 | Ga0495582_0273813 | 3300046473 | Bacteria | 969 |
| 577 | Ga0495639_0110234 | 3300046475 | Bacteria | 1306 |
| 578 | Ga0495662_0004245 | 3300046476 | Bacteria | 7213 |
| 579 | Ga0495662_0067720 | 3300046476 | Bacteria | 1728 |
| 580 | Ga0495662_0110247 | 3300046476 | Bacteria | 1349 |
| 581 | Ga0495664_0029260 | 3300046477 | Bacteria | 3220 |
| 582 | Ga0495664_0039968 | 3300046477 | Bacteria | 2772 |
| 583 | Ga0495618_0065365 | 3300046514 | Bacteria | 2311 |
| 584 | Ga0495618_0155440 | 3300046514 | Bacteria | 1460 |
| 585 | Ga0495628_0122187 | 3300046516 | Bacteria | 1997 |
| 586 | Ga0495628_0236245 | 3300046516 | Unclassified | 1368 |
| 587 | Ga0495630_0196477 | 3300046517 | Bacteria | 1539 |
| 588 | Ga0495630_0240379 | 3300046517 | Bacteria | 1384 |
| 589 | Ga0495630_0565164 | 3300046517 | Bacteria | 872 |
| 590 | Ga0495630_0864116 | 3300046517 | Bacteria | 689 |
| 591 | Ga0495630_1527429 | 3300046517 | Bacteria | 501 |
| 592 | Ga0495666_0382833 | 3300046526 | Bacteria | 633 |
| 593 | Ga0495652_1148836 | 3300046529 | Bacteria | 502 |
| 594 | Ga0495640_0057150 | 3300046533 | Bacteria | 2663 |
| 595 | Ga0495640_0674966 | 3300046533 | Unclassified | 621 |
| 596 | Ga0495586_0066738 | 3300046535 | Bacteria | 1961 |
| 597 | Ga0495587_0138873 | 3300046536 | Unclassified | 1387 |
| 598 | Ga0495587_0201724 | 3300046536 | Bacteria | 1125 |
| 599 | Ga0495598_0223433 | 3300046537 | Bacteria | 688 |
| 600 | Ga0495645_0058459 | 3300046543 | Bacteria | 2797 |
| 601 | Ga0495645_0153526 | 3300046543 | Bacteria | 1597 |
| 602 | Ga0495645_0174504 | 3300046543 | Bacteria | 1477 |
| 603 | Ga0495667_0450584 | 3300046559 | Bacteria | 808 |
| 604 | Ga0495656_0478944 | 3300046615 | Bacteria | 658 |
| 605 | Ga0495634_0079112 | 3300046642 | Bacteria | 2153 |
| 606 | Ga0495634_0222593 | 3300046642 | Bacteria | 1164 |
| 607 | Ga0495634_0891870 | 3300046642 | Bacteria | 503 |
| 608 | Ga0495635_0038374 | 3300046663 | Bacteria | 3316 |
| 609 | Ga0495635_0223104 | 3300046663 | Unclassified | 1274 |
| 610 | Ga0495635_0381693 | 3300046663 | Bacteria | 937 |
| 611 | Ga0495657_0032165 | 3300046675 | Bacteria | 3663 |
| 612 | Ga0495599_0013505 | 3300046678 | Bacteria | 5045 |
| 613 | Ga0495599_0170643 | 3300046678 | Bacteria | 1342 |
| 614 | Ga0495623_0011455 | 3300046679 | Bacteria | 5739 |
| 615 | Ga0495658_0020070 | 3300046683 | Bacteria | 3500 |
| 616 | Ga0495613_0015364 | 3300046689 | Bacteria | 5692 |
| 617 | Ga0495613_0452917 | 3300046689 | Bacteria | 869 |
| 618 | Ga0495613_0519838 | 3300046689 | Bacteria | 800 |
| 619 | Ga0495624_0004062 | 3300046690 | Bacteria | 10771 |
| 620 | Ga0495624_0238521 | 3300046690 | Bacteria | 1101 |
| 621 | Ga0495670_0538242 | 3300046691 | Bacteria | 635 |
| 622 | Ga0495600_0890766 | 3300046809 | Bacteria | 525 |
| 623 | Ga0495581_0013565 | 3300047315 | Bacteria | 4726 |
| 624 | Ga0495581_0266116 | 3300047315 | Unclassified | 1002 |
| 625 | Ga0495604_0087827 | 3300047317 | Bacteria | 2314 |
| 626 | Ga0495604_0887725 | 3300047317 | Bacteria | 557 |
| 627 | Ga0495636_0365387 | 3300047318 | Bacteria | 683 |
| 628 | Ga0495636_0637282 | 3300047318 | Unclassified | 523 |
| 629 | Ga0495674_0006249 | 3300047319 | Bacteria | 11431 |
| 630 | Ga0495674_1373001 | 3300047319 | Bacteria | 527 |
| 631 | Ga0495676_0199460 | 3300047321 | Bacteria | 1391 |
| 632 | Ga0495676_0291372 | 3300047321 | Bacteria | 1103 |
| 633 | Ga0495676_0870590 | 3300047321 | Unclassified | 578 |
| 634 | Ga0495680_0260489 | 3300047322 | Bacteria | 1226 |
| 635 | Ga0495680_0602023 | 3300047322 | Bacteria | 735 |
| 636 | Ga0495675_0311108 | 3300047444 | Bacteria | 933 |
| 637 | Ga0495684_0009909 | 3300047471 | Bacteria | 7358 |
| 638 | Ga0495684_0192526 | 3300047471 | Bacteria | 1507 |
| 639 | Ga0495684_0236698 | 3300047471 | Bacteria | 1333 |
| 640 | Ga0495593_0013682 | 3300047673 | Bacteria | 4623 |
| 641 | Ga0495593_0304953 | 3300047673 | Bacteria | 796 |
| 642 | Ga0495602_0039422 | 3300048088 | Bacteria | 4350 |
| 643 | Ga0496100_0118260 | 3300048903 | Bacteria | 1851 |
| 644 | Ga0496100_0290582 | 3300048903 | Unclassified | 1221 |
| 645 | Ga0496101_0033133 | 3300048904 | Bacteria | 3642 |
| 646 | Ga0496101_0930275 | 3300048904 | Unclassified | 684 |
| 647 | Ga0496102_0162432 | 3300048905 | Unclassified | 2101 |
| 648 | Ga0496102_0861692 | 3300048905 | Bacteria | 828 |
| 649 | Ga0496103_0136593 | 3300048906 | Unclassified | 1567 |
| 650 | Ga0496103_0317208 | 3300048906 | Unclassified | 1003 |
| 651 | Ga0496104_0050826 | 3300048907 | Bacteria | 3911 |
| 652 | Ga0496104_0429476 | 3300048907 | Unclassified | 1233 |
| 653 | Ga0496104_0716888 | 3300048907 | Bacteria | 908 |
| 654 | Ga0496104_0723814 | 3300048907 | Bacteria | 902 |
| 655 | Ga0496104_1052205 | 3300048907 | Bacteria | 718 |
| 656 | Ga0496105_0051266 | 3300048908 | Bacteria | 3409 |
| 657 | Ga0496105_0266234 | 3300048908 | Bacteria | 1385 |
| 658 | Ga0496106_0044266 | 3300048909 | Unclassified | 3341 |
| 659 | Ga0496106_0317969 | 3300048909 | Unclassified | 1249 |
| 660 | Ga0496107_0043324 | 3300048910 | Bacteria | 3233 |
| 661 | Ga0496107_0127278 | 3300048910 | Bacteria | 1879 |
| 662 | Ga0496108_0679810 | 3300048911 | Bacteria | 893 |
| 663 | Ga0496108_1414077 | 3300048911 | Unclassified | 581 |
| 664 | Ga0496109_0100497 | 3300048912 | Unclassified | 2683 |
| 665 | Ga0496109_0227026 | 3300048912 | Bacteria | 1756 |
| 666 | Ga0496109_0897365 | 3300048912 | Bacteria | 824 |
| 667 | Ga0496109_1045693 | 3300048912 | Bacteria | 754 |
| 668 | Ga0496110_0633578 | 3300048913 | Unclassified | 968 |
| 669 | Ga0496110_1037720 | 3300048913 | Unclassified | 728 |
| 670 | Ga0496110_1132766 | 3300048913 | Bacteria | 691 |
| 671 | Ga0496111_0215308 | 3300048914 | Bacteria | 1427 |
| 672 | Ga0496112_0012785 | 3300048915 | Bacteria | 7726 |
| 673 | Ga0496112_0091523 | 3300048915 | Bacteria | 3010 |
| 674 | Ga0496112_0242859 | 3300048915 | Bacteria | 1753 |
| 675 | Ga0496112_0554160 | 3300048915 | Bacteria | 1083 |
| 676 | Ga0496113_0446166 | 3300048916 | Bacteria | 1039 |
| 677 | Ga0496113_0459778 | 3300048916 | Bacteria | 1023 |
| 678 | Ga0496113_0603996 | 3300048916 | Bacteria | 878 |
| 679 | Ga0496114_0024707 | 3300048917 | Bacteria | 4905 |
| 680 | Ga0496114_0439925 | 3300048917 | Bacteria | 1155 |
| 681 | Ga0496114_0642225 | 3300048917 | Unclassified | 934 |
| 682 | Ga0496115_0079282 | 3300048918 | Bacteria | 2672 |
| 683 | Ga0496115_0300363 | 3300048918 | Bacteria | 1316 |
| 684 | Ga0496126_0086703 | 3300048929 | Bacteria | 2759 |
| 685 | Ga0501031_0012809 | 3300049568 | Bacteria | 5479 |
| 686 | Ga0501031_0059641 | 3300049568 | Bacteria | 2486 |
| 687 | Ga0501031_0091326 | 3300049568 | Bacteria | 1986 |
| 688 | Ga0501031_0179533 | 3300049568 | Bacteria | 1383 |
| 689 | Ga0501032_0052550 | 3300049569 | Bacteria | 2745 |
| 690 | Ga0501032_0079759 | 3300049569 | Bacteria | 2179 |
| 691 | Ga0501032_0733553 | 3300049569 | Bacteria | 625 |
| 692 | Ga0501033_0211144 | 3300049570 | Bacteria | 1384 |
| 693 | Ga0501033_0389993 | 3300049570 | Bacteria | 972 |
| 694 | Ga0501034_1329170 | 3300049571 | Archaea | 595 |
| 695 | Ga0501036_0098664 | 3300049572 | Bacteria | 2470 |
| 696 | Ga0501036_0645463 | 3300049572 | Unclassified | 876 |
| 697 | Ga0501037_0074429 | 3300049573 | Bacteria | 2468 |
| 698 | Ga0501037_0498109 | 3300049573 | Unclassified | 827 |
| 699 | Ga0501038_0004237 | 3300049574 | Bacteria | 13331 |
| 700 | Ga0501038_0155989 | 3300049574 | Bacteria | 1858 |
| 701 | Ga0501038_0305296 | 3300049574 | Bacteria | 1248 |
| 702 | Ga0501038_0856392 | 3300049574 | Bacteria | 673 |
| 703 | Ga0501039_0031252 | 3300049575 | Bacteria | 4104 |
| 704 | Ga0501039_0528533 | 3300049575 | Bacteria | 926 |
| 705 | Ga0501040_0180575 | 3300049576 | Bacteria | 1496 |
| 706 | Ga0501042_0020798 | 3300049578 | Bacteria | 4569 |
| 707 | Ga0501042_0087374 | 3300049578 | Bacteria | 2237 |
| 708 | Ga0501042_0173252 | 3300049578 | Bacteria | 1557 |
| 709 | Ga0501043_0011612 | 3300049579 | Bacteria | 6895 |
| 710 | Ga0501043_1051427 | 3300049579 | Bacteria | 577 |
| 711 | Ga0501046_0072261 | 3300049580 | Bacteria | 2679 |
| 712 | Ga0501047_0479027 | 3300049581 | Archaea | 1072 |
| 713 | Ga0501047_0841808 | 3300049581 | Bacteria | 731 |
| 714 | Ga0501047_1296012 | 3300049581 | Unclassified | 542 |
| 715 | Ga0501048_0008453 | 3300049582 | Bacteria | 7787 |
| 716 | Ga0501048_0047877 | 3300049582 | Bacteria | 3050 |
| 717 | Ga0501048_0691146 | 3300049582 | Bacteria | 732 |
| 718 | Ga0501068_0466938 | 3300049584 | Bacteria | 817 |
| 719 | Ga0501069_0001126 | 3300049585 | Bacteria | 12892 |
| 720 | Ga0501069_0187644 | 3300049585 | Bacteria | 1196 |
| 721 | Ga0501069_0553535 | 3300049585 | Unclassified | 688 |
| 722 | Ga0501069_0646381 | 3300049585 | Unclassified | 636 |
| 723 | Ga0501069_0965395 | 3300049585 | Bacteria | 520 |
| 724 | Ga0501070_0003286 | 3300049586 | Bacteria | 14033 |
| 725 | Ga0501070_0027511 | 3300049586 | Bacteria | 4770 |
| 726 | Ga0501070_0068088 | 3300049586 | Bacteria | 2947 |
| 727 | Ga0501070_0931185 | 3300049586 | Bacteria | 677 |
| 728 | Ga0501070_1121583 | 3300049586 | Bacteria | 606 |
| 729 | Ga0501071_0003879 | 3300049587 | Bacteria | 9421 |
| 730 | Ga0501071_0169115 | 3300049587 | Bacteria | 1636 |
| 731 | Ga0501072_0182035 | 3300049588 | Bacteria | 1676 |
| 732 | Ga0501072_1135241 | 3300049588 | Bacteria | 608 |
| 733 | Ga0501073_0032818 | 3300049589 | Bacteria | 3700 |
| 734 | Ga0501073_0497780 | 3300049589 | Bacteria | 843 |
| 735 | Ga0501073_1221734 | 3300049589 | Bacteria | 516 |
| 736 | Ga0501074_0106190 | 3300049590 | Bacteria | 2010 |
| 737 | Ga0501074_0122346 | 3300049590 | Bacteria | 1861 |
| 738 | Ga0501074_1172598 | 3300049590 | Unclassified | 539 |
| 739 | Ga0501075_0034676 | 3300049591 | Bacteria | 3759 |
| 740 | Ga0501075_0603515 | 3300049591 | Unclassified | 837 |
| 741 | Ga0501076_0331080 | 3300049592 | Bacteria | 1249 |
| 742 | Ga0501076_1101100 | 3300049592 | Unclassified | 654 |
| 743 | Ga0501076_1125753 | 3300049592 | Bacteria | 646 |
| 744 | Ga0501077_0304889 | 3300049593 | Bacteria | 1015 |
| 745 | Ga0501077_0487385 | 3300049593 | Unclassified | 790 |
| 746 | Ga0501077_0541274 | 3300049593 | Unclassified | 747 |
| 747 | Ga0501079_0179240 | 3300049741 | Bacteria | 1653 |
| 748 | Ga0501079_1584329 | 3300049741 | Bacteria | 515 |
| 749 | Ga0501080_0047141 | 3300049742 | Bacteria | 4011 |
| 750 | Ga0501080_0061621 | 3300049742 | Bacteria | 3492 |
| 751 | Ga0501080_0594908 | 3300049742 | Bacteria | 982 |
| 752 | Ga0501080_1050609 | 3300049742 | Unclassified | 705 |
| 753 | Ga0501080_1579136 | 3300049742 | Unclassified | 556 |
| 754 | Ga0501080_1780266 | 3300049742 | Bacteria | 518 |
| 755 | Ga0501083_0009512 | 3300049744 | Bacteria | 6864 |
| 756 | Ga0501083_0278781 | 3300049744 | Bacteria | 1087 |
| 757 | Ga0501035_0127896 | 3300049822 | Bacteria | 2217 |
| 758 | Ga0501035_0285513 | 3300049822 | Bacteria | 1394 |
| 759 | Ga0501035_0649790 | 3300049822 | Archaea | 855 |
| 760 | Ga0501035_0833540 | 3300049822 | Bacteria | 735 |
| 761 | Ga0501044_0012429 | 3300049823 | Bacteria | 9220 |
| 762 | Ga0501045_0030609 | 3300049824 | Bacteria | 3896 |
| 763 | Ga0501045_0132064 | 3300049824 | Bacteria | 1856 |
| 764 | Ga0501045_0277662 | 3300049824 | Bacteria | 1247 |
| 765 | nmdc:mga0yw44_684495_c1 | 3300050492 | Bacteria | 697 |
| 766 | nmdc:mga0yw44_859028_c1 | 3300050492 | Bacteria | 616 |
| 767 | nmdc:mga0yw44_870840_c1 | 3300050492 | Bacteria | 611 |
| 768 | nmdc:mga05p37_12819_c1 | 3300050507 | Bacteria | 10023 |
| 769 | nmdc:mga05p37_728898_c1 | 3300050507 | Unclassified | 1096 |
| 770 | nmdc:mga0qj67_355455_c1 | 3300050509 | Bacteria | 1184 |
| 771 | nmdc:mga06r32_91522_c1 | 3300050510 | Bacteria | 2973 |
| 772 | nmdc:mga08y16_519964_c1 | 3300050511 | Unclassified | 1207 |
| 773 | nmdc:mga08y16_620300_c2 | 3300050511 | Unclassified | 622 |
| 774 | nmdc:mga0n895_327308_c1 | 3300050512 | Unclassified | 1553 |
| 775 | nmdc:mga0n895_440003_c1 | 3300050512 | Bacteria | 1317 |
| 776 | nmdc:mga0n895_595259_c1 | 3300050512 | Unclassified | 1109 |
| 777 | nmdc:mga0n895_70459_c1 | 3300050512 | Bacteria | 3465 |
| 778 | nmdc:mga0rr50_1034996_c1 | 3300050513 | Bacteria | 699 |
| 779 | nmdc:mga0rr50_123495_c1 | 3300050513 | Bacteria | 2064 |
| 780 | nmdc:mga0rr50_246798_c1 | 3300050513 | Bacteria | 1481 |
| 781 | nmdc:mga0rr50_253032_c1 | 3300050513 | Bacteria | 1464 |
| 782 | nmdc:mga08x19_443414_c1 | 3300050514 | Unclassified | 913 |
| 783 | nmdc:mga08x19_684720_c1 | 3300050514 | Bacteria | 728 |
| 784 | nmdc:mga08x19_909018_c1 | 3300050514 | Bacteria | 625 |
| 785 | nmdc:mga0a205_1113821_c1 | 3300050515 | Bacteria | 637 |
| 786 | nmdc:mga0a205_285557_c1 | 3300050515 | Bacteria | 1525 |
| 787 | nmdc:mga0a205_347254_c1 | 3300050515 | Unclassified | 1352 |
| 788 | Ga0495601_0027869 | 3300053077 | Bacteria | 3495 |
| 789 | Ga0495601_0102315 | 3300053077 | Bacteria | 1851 |
| 790 | Ga0495612_0012775 | 3300053078 | Bacteria | 3385 |
| 791 | Ga0495612_0053218 | 3300053078 | Bacteria | 1667 |
| 792 | Ga0495612_0123581 | 3300053078 | Bacteria | 1115 |
| 793 | Ga0495595_0011142 | 3300053084 | Bacteria | 3755 |
| 794 | Ga0495595_0532268 | 3300053084 | Bacteria | 600 |
| 795 | Ga0495619_0018476 | 3300053085 | Bacteria | 4422 |
| 796 | Ga0495619_0675834 | 3300053085 | Bacteria | 703 |
| 797 | Ga0501084_0014587 | 3300054114 | Bacteria | 6514 |
| 798 | Ga0501084_0044612 | 3300054114 | Bacteria | 3712 |
| 799 | Ga0501084_0046244 | 3300054114 | Bacteria | 3645 |
| 800 | Ga0501084_0083148 | 3300054114 | Bacteria | 2687 |
| 801 | Ga0501084_0292538 | 3300054114 | Bacteria | 1375 |
| 802 | Ga0587122_000265 | 3300059628 | Bacteria | 2535 |
| 803 | Ga0501082_0039996 | 3300060353 | Bacteria | 4046 |
| 804 | Ga0466962_0139064 | 3300061719 | Bacteria | 1176 |
| 805 | Ga0466962_0248819 | 3300061719 | Bacteria | 873 |
| 806 | Ga0466962_0397527 | 3300061719 | Bacteria | 690 |
| 807 | Ga0466962_0547080 | 3300061719 | Bacteria | 588 |
| 808 | Ga0207663_11567274 | |||
| 809 | JGI25407J50210_10018823 | |||
| 810 | JGI25407J50210_10040248 | |||
| 811 | JGI25407J50210_10128071 | |||
| 812 | Ga0058863_11265689 | |||
| 813 | Ga0070658_10089982 | |||
| 814 | Ga0070658_10099813 | |||
| 815 | Ga0070658_10268828 | |||
| 816 | Ga0068869_100656907 | |||
| 817 | Ga0070680_100082601 | |||
| 818 | Ga0070680_100382014 | |||
| 819 | Ga0070680_101160501 | |||
| 820 | Ga0070682_100483396 | |||
| 821 | Ga0070682_100963143 | |||
| 822 | Ga0068868_100453357 | |||
| 823 | Ga0068868_100841292 | |||
| 824 | Ga0070660_100913108 | |||
| 825 | Ga0070660_101723461 | |||
| 826 | Ga0070689_102184248 | |||
| 827 | Ga0070661_100084247 | |||
| 828 | Ga0070661_101380542 | |||
| 829 | Ga0070692_10712082 | |||
| 830 | Ga0070659_100052102 | |||
| 831 | Ga0070709_10171475 | |||
| 832 | Ga0070709_10183124 | |||
| 833 | Ga0070709_10584044 | |||
| 834 | Ga0070709_11024649 | |||
| 835 | Ga0070709_11409779 | |||
| 836 | Ga0070714_100010662 | |||
| 837 | Ga0070714_100020292 | |||
| 838 | Ga0070714_100046929 | |||
| 839 | Ga0070714_100053413 | |||
| 840 | Ga0070714_100078924 | |||
| 841 | Ga0070714_100151958 | |||
| 842 | Ga0070714_100307051 | |||
| 843 | Ga0070714_100340074 | |||
| 844 | Ga0070714_101574358 | |||
| 845 | Ga0070713_100009281 | |||
| 846 | Ga0070713_100030647 | |||
| 847 | Ga0070713_100050053 | |||
| 848 | Ga0070713_100207489 | |||
| 849 | Ga0070713_100299380 | |||
| 850 | Ga0070713_101027518 | |||
| 851 | Ga0070713_101599634 | |||
| 852 | Ga0070713_101617308 | |||
| 853 | Ga0070710_10006389 | |||
| 854 | Ga0070710_10021709 | |||
| 855 | Ga0070710_10148380 | |||
| 856 | Ga0070710_10447984 | |||
| 857 | Ga0070710_10959879 | |||
| 858 | Ga0070711_100100227 | |||
| 859 | Ga0070711_100220026 | |||
| 860 | Ga0070711_100464120 | |||
| 861 | Ga0070711_100690986 | |||
| 862 | Ga0070711_101191650 | |||
| 863 | Ga0070705_100007045 | |||
| 864 | Ga0070708_100396595 | |||
| 865 | Ga0070708_100761990 | |||
| 866 | Ga0070708_101316466 | |||
| 867 | Ga0070708_101885844 | |||
| 868 | Ga0070708_102084366 | |||
| 869 | Ga0070663_100310057 | |||
| 870 | Ga0070663_100562027 | |||
| 871 | Ga0070663_100578642 | |||
| 872 | Ga0070678_100073819 | |||
| 873 | Ga0070678_101203656 | |||
| 874 | Ga0070681_10010595 | |||
| 875 | Ga0070681_10621985 | |||
| 876 | Ga0070706_100000939 | |||
| 877 | Ga0070706_100007212 | |||
| 878 | Ga0070706_100018337 | |||
| 879 | Ga0070706_100020451 | |||
| 880 | Ga0070707_100000166 | |||
| 881 | Ga0070707_100004101 | |||
| 882 | Ga0070707_100020974 | |||
| 883 | Ga0070707_100323204 | |||
| 884 | Ga0070707_100440272 | |||
| 885 | Ga0070698_100000006 | |||
| 886 | Ga0070698_100011358 | |||
| 887 | Ga0070698_100020214 | |||
| 888 | Ga0070698_100337701 | |||
| 889 | Ga0070698_100779910 | |||
| 890 | Ga0070699_100396398 | |||
| 891 | Ga0070699_100620868 | |||
| 892 | Ga0070679_100187194 | |||
| 893 | Ga0070679_100674063 | |||
| 894 | Ga0070679_101523290 | |||
| 895 | Ga0070684_100094120 | |||
| 896 | Ga0070684_100616459 | |||
| 897 | Ga0070684_100796859 | |||
| 898 | Ga0070697_100170674 | |||
| 899 | Ga0070686_100191865 | |||
| 900 | Ga0070686_100392319 | |||
| 901 | Ga0070695_100542894 | |||
| 902 | Ga0070695_101580510 | |||
| 903 | Ga0070696_100146121 | |||
| 904 | Ga0070696_100248366 | |||
| 905 | Ga0070693_100165614 | |||
| 906 | Ga0070665_100101876 | |||
| 907 | Ga0070704_100071467 | |||
| 908 | Ga0068855_100686104 | |||
| 909 | Ga0068855_101229658 | |||
| 910 | Ga0068855_101698651 | |||
| 911 | Ga0070664_100971997 | |||
| 912 | Ga0070664_101176355 | |||
| 913 | Ga0068857_100855787 | |||
| 914 | Ga0068857_100868040 | |||
| 915 | Ga0068857_100925787 | |||
| 916 | Ga0068854_100736964 | |||
| 917 | Ga0068856_100026347 | |||
| 918 | Ga0068856_100162308 | |||
| 919 | Ga0068856_100437340 | |||
| 920 | Ga0068856_100626947 | |||
| 921 | Ga0070702_100024635 | |||
| 922 | Ga0068852_100017352 | |||
| 923 | Ga0068852_102297328 | |||
| 924 | Ga0068870_10239997 | |||
| 925 | Ga0068863_100448235 | |||
| 926 | Ga0068863_102348576 | |||
| 927 | Ga0068858_100422153 | |||
| 928 | Ga0068860_100167390 | |||
| 929 | Ga0081455_10054105 | |||
| 930 | Ga0081455_10082617 | |||
| 931 | Ga0081455_10554349 | |||
| 932 | Ga0081538_10000635 | |||
| 933 | Ga0081538_10003841 | |||
| 934 | Ga0081538_10004099 | |||
| 935 | Ga0081538_10005257 | |||
| 936 | Ga0081538_10008316 | |||
| 937 | Ga0081538_10073319 | |||
| 938 | Ga0081538_10110826 | |||
| 939 | Ga0081538_10116631 | |||
| 940 | Ga0081539_10024682 | |||
| 941 | Ga0081539_10138950 | |||
| 942 | Ga0070717_10062603 | |||
| 943 | Ga0070717_10098365 | |||
| 944 | Ga0070717_10126499 | |||
| 945 | Ga0070717_10189906 | |||
| 946 | Ga0070717_10281032 | |||
| 947 | Ga0070717_11116885 | |||
| 948 | Ga0075365_10110665 | |||
| 949 | Ga0075365_10393309 | |||
| 950 | Ga0070715_10003458 | |||
| 951 | Ga0070715_10009201 | |||
| 952 | Ga0070715_10013051 | |||
| 953 | Ga0070715_10042129 | |||
| 954 | Ga0070715_10156705 | |||
| 955 | Ga0070716_100001899 | |||
| 956 | Ga0070716_100026860 | |||
| 957 | Ga0070716_100140236 | |||
| 958 | Ga0070716_100236424 | |||
| 959 | Ga0070716_100425841 | |||
| 960 | Ga0070716_100770281 | |||
| 961 | Ga0070716_101012555 | |||
| 962 | Ga0070716_101030017 | |||
| 963 | Ga0070712_100016737 | |||
| 964 | Ga0070712_100031273 | |||
| 965 | Ga0070712_100167835 | |||
| 966 | Ga0070712_100203670 | |||
| 967 | Ga0070712_100873727 | |||
| 968 | Ga0070712_101153564 | |||
| 969 | Ga0097621_100584403 | |||
| 970 | Ga0068871_100534227 | |||
| 971 | Ga0068871_101946245 | |||
| 972 | Ga0075428_100648274 | |||
| 973 | Ga0075428_100823437 | |||
| 974 | Ga0075430_100739953 | |||
| 975 | Ga0075430_101656038 | |||
| 976 | Ga0075433_10091668 | |||
| 977 | Ga0075434_100052596 | |||
| 978 | Ga0075434_100460198 | |||
| 979 | Ga0075434_101116615 | |||
| 980 | Ga0075429_100260889 | |||
| 981 | Ga0075436_100034851 | |||
| 982 | Ga0075436_100163174 | |||
| 983 | Ga0075436_100274973 | |||
| 984 | Ga0075436_100746234 | |||
| 985 | Ga0075436_100765468 | |||
| 986 | Ga0075435_100084390 | |||
| 987 | Ga0075435_100142665 | |||
| 988 | Ga0075435_100173424 | |||
| 989 | Ga0075435_100236315 | |||
| 990 | Ga0075435_101573308 | |||
| 991 | Ga0099795_10461520 | |||
| 992 | Ga0105251_10195194 | |||
| 993 | Ga0105240_10761005 | |||
| 994 | Ga0111539_10083731 | |||
| 995 | Ga0111539_10278012 | |||
| 996 | Ga0105247_10375284 | |||
| 997 | Ga0114129_10009365 | |||
| 998 | Ga0114129_10967132 | |||
| 999 | Ga0114129_11852284 | |||
| 1000 | Ga0105243_12046420 | |||
| 1001 | Ga0105241_10244356 | |||
| 1002 | Ga0105241_10934283 | |||
| 1003 | Ga0105242_10129411 | |||
| 1004 | Ga0105237_10277930 | |||
| 1005 | Ga0105237_10854221 | |||
| 1006 | Ga0105238_10130511 | |||
| 1007 | Ga0105238_10339739 | |||
| 1008 | Ga0105249_10456944 | |||
| 1009 | Ga0105246_10166146 | |||
| 1010 | Ga0154016_131472 | |||
| 1011 | Ga0157373_10084177 | |||
| 1012 | Ga0157370_10090426 | |||
| 1013 | Ga0157369_10002422 | |||
| 1014 | Ga0157369_10016802 | |||
| 1015 | Ga0157369_10217237 | |||
| 1016 | Ga0157369_10229004 | |||
| 1017 | Ga0157369_10496770 | |||
| 1018 | Ga0157374_10107907 | |||
| 1019 | Ga0157374_12062421 | |||
| 1020 | Ga0157378_10021358 | |||
| 1021 | Ga0163162_10436036 | |||
| 1022 | Ga0157372_10097103 | |||
| 1023 | Ga0157372_11951715 | |||
| 1024 | Ga0157375_10423515 | |||
| 1025 | Ga0157375_10761315 | |||
| 1026 | Ga0163163_10410551 | |||
| 1027 | Ga0163163_11113648 | |||
| 1028 | Ga0182008_10162088 | |||
| 1029 | Ga0157379_11127867 | |||
| 1030 | Ga0157376_10503846 | |||
| 1031 | Ga0157376_10762414 | |||
| 1032 | Ga0182005_1079799 | |||
| 1033 | Ga0197907_10101199 | |||
| 1034 | Ga0197907_10249360 | |||
| 1035 | Ga0197907_10503529 | |||
| 1036 | Ga0197907_10946039 | |||
| 1037 | Ga0197907_11025201 | |||
| 1038 | Ga0197907_11250657 | |||
| 1039 | Ga0206356_10829837 | |||
| 1040 | Ga0206356_11058141 | |||
| 1041 | Ga0206356_11516356 | |||
| 1042 | Ga0206356_11739667 | |||
| 1043 | Ga0206349_1452561 | |||
| 1044 | Ga0206349_1457924 | |||
| 1045 | Ga0206349_1943060 | |||
| 1046 | Ga0206355_1444598 | |||
| 1047 | Ga0206355_1529971 | |||
| 1048 | Ga0206351_10332592 | |||
| 1049 | Ga0206351_10354766 | |||
| 1050 | Ga0206351_10741260 | |||
| 1051 | Ga0206351_10902751 | |||
| 1052 | Ga0206350_10270511 | |||
| 1053 | Ga0206350_11064801 | |||
| 1054 | Ga0206350_11240311 | |||
| 1055 | Ga0206350_11356179 | |||
| 1056 | Ga0206350_11420438 | |||
| 1057 | Ga0206354_10519068 | |||
| 1058 | Ga0206354_10572110 | |||
| 1059 | Ga0206354_10612338 | |||
| 1060 | Ga0206354_11485858 | |||
| 1061 | Ga0206353_10714114 | |||
| 1062 | Ga0206353_10840274 | |||
| 1063 | Ga0206353_10865515 | |||
| 1064 | Ga0206353_11353822 | |||
| 1065 | Ga0154015_1580273 | |||
| 1066 | Ga0154015_1661415 | |||
| 1067 | Ga0213875_10125934 | |||
| 1068 | Ga0213875_10314853 | |||
| 1069 | Ga0213875_10489172 | |||
| 1070 | Ga0224712_10005170 | |||
| 1071 | Ga0224712_10016014 | |||
| 1072 | Ga0224712_10046345 | |||
| 1073 | Ga0224712_10046507 | |||
| 1074 | Ga0224712_10095591 | |||
| 1075 | Ga0224712_10175039 | |||
| 1076 | Ga0224712_10229901 | |||
| 1077 | Ga0224712_10379496 | |||
| 1078 | Ga0224712_10384847 | |||
| 1079 | Ga0207692_10003841 | |||
| 1080 | Ga0207692_10046482 | |||
| 1081 | Ga0207692_10103755 | |||
| 1082 | Ga0207692_10174777 | |||
| 1083 | Ga0207692_10185222 | |||
| 1084 | Ga0207688_10984093 | |||
| 1085 | Ga0207680_10474645 | |||
| 1086 | Ga0207647_10155324 | |||
| 1087 | Ga0207685_10000749 | |||
| 1088 | Ga0207685_10277700 | |||
| 1089 | Ga0207685_10283588 | |||
| 1090 | Ga0207699_10001111 | |||
| 1091 | Ga0207699_10004397 | |||
| 1092 | Ga0207699_10052772 | |||
| 1093 | Ga0207699_10181150 | |||
| 1094 | Ga0207699_10379288 | |||
| 1095 | Ga0207699_10412320 | |||
| 1096 | Ga0207699_11185001 | |||
| 1097 | Ga0207705_10119042 | |||
| 1098 | Ga0207705_10261881 | |||
| 1099 | Ga0207684_10050186 | |||
| 1100 | Ga0207684_10074627 | |||
| 1101 | Ga0207684_10357140 | |||
| 1102 | Ga0207654_10302508 | |||
| 1103 | Ga0207654_10793509 | |||
| 1104 | Ga0207654_11102585 | |||
| 1105 | Ga0207707_10102195 | |||
| 1106 | Ga0207707_10538047 | |||
| 1107 | Ga0207707_11091966 | |||
| 1108 | Ga0207695_10684055 | |||
| 1109 | Ga0207671_11033363 | |||
| 1110 | Ga0207693_10013495 | |||
| 1111 | Ga0207693_10019026 | |||
| 1112 | Ga0207693_10026835 | |||
| 1113 | Ga0207693_10359365 | |||
| 1114 | Ga0207663_10000281 | |||
| 1115 | Ga0207663_10022532 | |||
| 1116 | Ga0207663_10069536 | |||
| 1117 | Ga0207663_10206939 | |||
| 1118 | Ga0207663_10349235 | |||
| 1119 | Ga0207663_10435090 | |||
| 1120 | Ga0207660_10527705 | |||
| 1121 | Ga0207649_10262970 | |||
| 1122 | Ga0207652_10319223 | |||
| 1123 | Ga0207652_10660530 | |||
| 1124 | Ga0207646_10000049 | |||
| 1125 | Ga0207646_10008672 | |||
| 1126 | Ga0207646_10010500 | |||
| 1127 | Ga0207646_10244809 | |||
| 1128 | Ga0207694_10588886 | |||
| 1129 | Ga0207687_10968963 | |||
| 1130 | Ga0207700_10000703 | |||
| 1131 | Ga0207700_10003873 | |||
| 1132 | Ga0207700_10004961 | |||
| 1133 | Ga0207700_10036458 | |||
| 1134 | Ga0207700_10047849 | |||
| 1135 | Ga0207700_10406204 | |||
| 1136 | Ga0207700_10723312 | |||
| 1137 | Ga0207700_11084340 | |||
| 1138 | Ga0207664_10001364 | |||
| 1139 | Ga0207664_10016099 | |||
| 1140 | Ga0207664_10035079 | |||
| 1141 | Ga0207664_10036347 | |||
| 1142 | Ga0207664_10051349 | |||
| 1143 | Ga0207664_10058393 | |||
| 1144 | Ga0207664_10074708 | |||
| 1145 | Ga0207664_10093295 | |||
| 1146 | Ga0207664_10180942 | |||
| 1147 | Ga0207664_10312694 | |||
| 1148 | Ga0207664_11489587 | |||
| 1149 | Ga0207644_10234209 | |||
| 1150 | Ga0207709_11268446 | |||
| 1151 | Ga0207665_10034231 | |||
| 1152 | Ga0207665_10072912 | |||
| 1153 | Ga0207665_10115944 | |||
| 1154 | Ga0207665_10435702 | |||
| 1155 | Ga0207689_10008124 | |||
| 1156 | Ga0207661_10915117 | |||
| 1157 | Ga0207661_12178361 | |||
| 1158 | Ga0207679_10503199 | |||
| 1159 | Ga0207679_11069673 | |||
| 1160 | Ga0207667_10928543 | |||
| 1161 | Ga0207712_10888107 | |||
| 1162 | Ga0207640_10980351 | |||
| 1163 | Ga0207677_11917027 | |||
| 1164 | Ga0207703_10785721 | |||
| 1165 | Ga0207703_11429856 | |||
| 1166 | Ga0207678_10080258 | |||
| 1167 | Ga0207678_10451563 | |||
| 1168 | Ga0207678_11094703 | |||
| 1169 | Ga0207702_10194515 | |||
| 1170 | Ga0207702_10407295 | |||
| 1171 | Ga0207702_11048026 | |||
| 1172 | Ga0207641_11105116 | |||
| 1173 | Ga0207641_12079683 | |||
| 1174 | Ga0207674_10192519 | |||
| 1175 | Ga0207683_10000951 | |||
| 1176 | Ga0207683_10726630 | |||
| 1177 | Ga0207698_10040406 | |||
| 1178 | Ga0207698_10128734 | |||
| 1179 | Ga0268266_11232566 | |||
| 1180 | Ga0268264_10144008 | |||
| 1181 | Ga0265760_10311854 | |||
| 1182 | Ga0307408_100022486 | |||
| 1183 | Ga0307408_100282707 | |||
| 1184 | Ga0307408_101711777 | |||
| 1185 | Ga0307405_10002359 | |||
| 1186 | Ga0307405_10011741 | |||
| 1187 | Ga0307405_10060317 | |||
| 1188 | Ga0307405_10081447 | |||
| 1189 | Ga0307405_10118520 | |||
| 1190 | Ga0307405_10454452 | |||
| 1191 | Ga0307413_10014145 | |||
| 1192 | Ga0307413_10145315 | |||
| 1193 | Ga0307413_10227966 | |||
| 1194 | Ga0307413_10403648 | |||
| 1195 | Ga0307410_10060923 | |||
| 1196 | Ga0307410_10086661 | |||
| 1197 | Ga0307410_10089763 | |||
| 1198 | Ga0307410_10151815 | |||
| 1199 | Ga0307410_10389185 | |||
| 1200 | Ga0307406_10001669 | |||
| 1201 | Ga0307406_10081715 | |||
| 1202 | Ga0307406_10194615 | |||
| 1203 | Ga0307406_10311880 | |||
| 1204 | Ga0307407_10010245 | |||
| 1205 | Ga0307407_10038898 | |||
| 1206 | Ga0307407_10149900 | |||
| 1207 | Ga0307412_10037179 | |||
| 1208 | Ga0307412_10256650 | |||
| 1209 | Ga0307412_10598957 | |||
| 1210 | Ga0307409_100000552 | |||
| 1211 | Ga0307409_100072702 | |||
| 1212 | Ga0307409_100101536 | |||
| 1213 | Ga0307409_100174687 | |||
| 1214 | Ga0307409_100304668 | |||
| 1215 | Ga0307409_100486700 | |||
| 1216 | Ga0307409_100530784 | |||
| 1217 | Ga0307409_101203786 | |||
| 1218 | Ga0307409_101958328 | |||
| 1219 | Ga0307416_100000276 | |||
| 1220 | Ga0307416_100002882 | |||
| 1221 | Ga0307416_100005358 | |||
| 1222 | Ga0307416_100063208 | |||
| 1223 | Ga0307416_100135635 | |||
| 1224 | Ga0307416_101079250 | |||
| 1225 | Ga0307416_101225975 | |||
| 1226 | Ga0307416_102330852 | |||
| 1227 | Ga0307414_10030923 | |||
| 1228 | Ga0307414_10088661 | |||
| 1229 | Ga0307414_10109088 | |||
| 1230 | Ga0307414_10169452 | |||
| 1231 | Ga0307411_10078848 | |||
| 1232 | Ga0307411_10079129 | |||
| 1233 | Ga0307411_10113845 | |||
| 1234 | Ga0307411_10155968 | |||
| 1235 | Ga0307411_10668870 | |||
| 1236 | Ga0307415_100000257 | |||
| 1237 | Ga0307415_100001904 | |||
| 1238 | Ga0307415_100005123 | |||
| 1239 | Ga0307415_100010229 | |||
| 1240 | Ga0307415_100040228 | |||
| 1241 | Ga0307415_100167359 | |||
| 1242 | Ga0307415_100275303 | |||
| 1243 | Ga0307415_100402550 | |||
| 1244 | Ga0373950_0104287 | |||
| 1245 | Ga0373926_0275543 | |||
| 1246 | Ga0373928_0083399 | |||
| 1247 | Ga0373929_0046228 | |||
| 1248 | Ga0373934_0215233 | |||
| 1249 | Ga0373934_0279377 | |||
| 1250 | Ga0373940_0058756 | |||
| 1251 | Ga0373949_0075300 | |||
| 1252 | Ga0373952_0243463 | |||
| 1253 | Ga0373923_0015461 | |||
| 1254 | Ga0373923_0245970 | |||
| 1255 | Ga0373932_0200405 | |||
| 1256 | Ga0373936_0005545 | |||
| 1257 | Ga0373936_0325361 | |||
| 1258 | Ga0373939_0075485 | |||
| 1259 | Ga0373941_0082293 | |||
| 1260 | Ga0373945_0066126 | |||
| 1261 | Ga0373945_0426126 | |||
| 1262 | Ga0373953_0003936 | |||
| 1263 | Ga0373953_0066075 | |||
| 1264 | Ga0373954_0032161 | |||
| 1265 | Ga0373954_0241534 | |||
| 1266 | Ga0373957_0000327 | |||
| 1267 | Ga0373957_0308899 | |||
| 1268 | Ga0373955_0679685 | |||
| 1269 | Ga0373942_0023120 | |||
| 1270 | Ga0373961_0028711 | |||
| 1271 | Ga0373962_0268397 | |||
| 1272 | Ga0373924_0040498 | |||
| 1273 | Ga0373931_0134710 | |||
| 1274 | Ga0373931_0499455 | |||
| 1275 | Ga0373935_0086824 | |||
| 1276 | Ga0373935_0510501 | |||
| 1277 | Ga0373935_1397561 | |||
| 1278 | Ga0373927_0167885 | |||
| 1279 | Ga0373927_0193473 | |||
| 1280 | Ga0373933_0423624 | |||
| 1281 | Ga0373947_0020987 | |||
| 1282 | Ga0373947_0268892 | |||
| 1283 | Ga0373937_0093183 | |||
| 1284 | Ga0373937_0282545 | |||
| 1285 | Ga0373937_0299118 | |||
| 1286 | Ga0373937_0787415 | |||
| 1287 | Ga0373925_0013905 | |||
| 1288 | Ga0373925_0275236 | |||
| 1289 | Ga0373925_0796456 | |||
| 1290 | Ga0373925_0891259 | |||
| 1291 | Ga0373925_1334662 | |||
| 1292 | Ga0395899_0671654 | |||
| 1293 | Ga0395899_0753493 | |||
| 1294 | Ga0395900_0188116 | |||
| 1295 | Ga0395898_0817843 | |||
| 1296 | Ga0395905_0274107 | |||
| 1297 | Ga0395905_0833109 | |||
| 1298 | Ga0436364_0603707 | |||
| 1299 | Ga0436364_0719141 | |||
| 1300 | Ga0436364_1059409 | |||
| 1301 | Ga0436364_1356142 | |||
| 1302 | Ga0436364_1503601 | |||
| 1303 | Ga0436364_1552435 | |||
| 1304 | Ga0395901_0007564 | |||
| 1305 | Ga0436365_1556469 | |||
| 1306 | Ga0436361_0423855 | |||
| 1307 | Ga0436361_0537557 | |||
| 1308 | Ga0436363_1070021 | |||
| 1309 | Ga0436363_1337738 | |||
| 1310 | Ga0436362_0013593 | |||
| 1311 | Ga0439443_029103 | |||
| 1312 | Ga0439448_0039352 | |||
| 1313 | Ga0439448_0110017 | |||
| 1314 | Ga0439450_079968 | |||
| 1315 | Ga0439454_108943 | |||
| 1316 | Ga0439455_0007482 | |||
| 1317 | Ga0439463_050466 | |||
| 1318 | Ga0450893_0096004 | |||
| 1319 | Ga0439440_0008234 | |||
| 1320 | Ga0439440_0161769 | |||
| 1321 | Ga0466972_0291340 | |||
| 1322 | Ga0466965_0688893 | |||
| 1323 | Ga0466966_0360443 | |||
| 1324 | Ga0466961_0023841 | |||
| 1325 | Ga0466961_0024151 | |||
| 1326 | Ga0466963_0002387 | |||
| 1327 | Ga0466963_0010864 | |||
| 1328 | Ga0466963_0036278 | |||
| 1329 | Ga0466963_0053750 | |||
| 1330 | Ga0466963_0084456 | |||
| 1331 | Ga0466963_0113809 | |||
| 1332 | Ga0466963_0154566 | |||
| 1333 | Ga0466963_0331349 | |||
| 1334 | Ga0466963_0680891 | |||
| 1335 | Ga0466964_0033161 | |||
| 1336 | Ga0466964_0063299 | |||
| 1337 | Ga0466964_0154397 | |||
| 1338 | Ga0466964_0192690 | |||
| 1339 | Ga0466964_0525205 | |||
| 1340 | Ga0466964_0665298 | |||
| 1341 | Ga0466971_0012120 | |||
| 1342 | Ga0466971_0018073 | |||
| 1343 | Ga0466971_0330045 | |||
| 1344 | Ga0466971_0468688 | |||
| 1345 | Ga0466970_0434332 | |||
| 1346 | Ga0466957_0001981 | |||
| 1347 | Ga0466957_0006686 | |||
| 1348 | Ga0466957_0728263 | |||
| 1349 | Ga0466960_1026255 | |||
| 1350 | Ga0466959_0025048 | |||
| 1351 | Ga0466959_0093798 | |||
| 1352 | Ga0466958_0014965 | |||
| 1353 | Ga0466958_0023628 | |||
| 1354 | Ga0466958_0025815 | |||
| 1355 | Ga0466958_0148997 | |||
| 1356 | Ga0466958_0155758 | |||
| 1357 | Ga0466958_0225454 | |||
| 1358 | Ga0466958_0630420 | |||
| 1359 | Ga0466967_0001825 | |||
| 1360 | Ga0466967_0013890 | |||
| 1361 | Ga0466967_0018355 | |||
| 1362 | Ga0466967_0027537 | |||
| 1363 | Ga0466967_0036220 | |||
| 1364 | Ga0466967_0123546 | |||
| 1365 | Ga0466967_0153709 | |||
| 1366 | Ga0466967_0185149 | |||
| 1367 | Ga0466967_0204525 | |||
| 1368 | Ga0466967_0342803 | |||
| 1369 | Ga0466967_0649068 | |||
| 1370 | Ga0466967_0810153 | |||
| 1371 | Ga0495592_0211894 | |||
| 1372 | Ga0495592_0634561 | |||
| 1373 | Ga0495603_0281019 | |||
| 1374 | Ga0495629_0018817 | |||
| 1375 | Ga0495629_0034472 | |||
| 1376 | Ga0495651_0239127 | |||
| 1377 | Ga0495651_0729937 | |||
| 1378 | Ga0495653_0193110 | |||
| 1379 | Ga0495653_0209892 | |||
| 1380 | Ga0495653_0470057 | |||
| 1381 | Ga0495580_0922794 | |||
| 1382 | Ga0495582_0237881 | |||
| 1383 | Ga0495582_0273813 | |||
| 1384 | Ga0495639_0110234 | |||
| 1385 | Ga0495662_0004245 | |||
| 1386 | Ga0495662_0067720 | |||
| 1387 | Ga0495662_0110247 | |||
| 1388 | Ga0495664_0029260 | |||
| 1389 | Ga0495664_0039968 | |||
| 1390 | Ga0495618_0065365 | |||
| 1391 | Ga0495618_0155440 | |||
| 1392 | Ga0495628_0122187 | |||
| 1393 | Ga0495628_0236245 | |||
| 1394 | Ga0495630_0196477 | |||
| 1395 | Ga0495630_0240379 | |||
| 1396 | Ga0495630_0565164 | |||
| 1397 | Ga0495630_0864116 | |||
| 1398 | Ga0495630_1527429 | |||
| 1399 | Ga0495666_0382833 | |||
| 1400 | Ga0495652_1148836 | |||
| 1401 | Ga0495640_0057150 | |||
| 1402 | Ga0495640_0674966 | |||
| 1403 | Ga0495586_0066738 | |||
| 1404 | Ga0495587_0138873 | |||
| 1405 | Ga0495587_0201724 | |||
| 1406 | Ga0495598_0223433 | |||
| 1407 | Ga0495645_0058459 | |||
| 1408 | Ga0495645_0153526 | |||
| 1409 | Ga0495645_0174504 | |||
| 1410 | Ga0495667_0450584 | |||
| 1411 | Ga0495656_0478944 | |||
| 1412 | Ga0495634_0079112 | |||
| 1413 | Ga0495634_0222593 | |||
| 1414 | Ga0495634_0891870 | |||
| 1415 | Ga0495635_0038374 | |||
| 1416 | Ga0495635_0223104 | |||
| 1417 | Ga0495635_0381693 | |||
| 1418 | Ga0495657_0032165 | |||
| 1419 | Ga0495599_0013505 | |||
| 1420 | Ga0495599_0170643 | |||
| 1421 | Ga0495623_0011455 | |||
| 1422 | Ga0495658_0020070 | |||
| 1423 | Ga0495613_0015364 | |||
| 1424 | Ga0495613_0452917 | |||
| 1425 | Ga0495613_0519838 | |||
| 1426 | Ga0495624_0004062 | |||
| 1427 | Ga0495624_0238521 | |||
| 1428 | Ga0495670_0538242 | |||
| 1429 | Ga0495600_0890766 | |||
| 1430 | Ga0495581_0013565 | |||
| 1431 | Ga0495581_0266116 | |||
| 1432 | Ga0495604_0087827 | |||
| 1433 | Ga0495604_0887725 | |||
| 1434 | Ga0495636_0365387 | |||
| 1435 | Ga0495636_0637282 | |||
| 1436 | Ga0495674_0006249 | |||
| 1437 | Ga0495674_1373001 | |||
| 1438 | Ga0495676_0199460 | |||
| 1439 | Ga0495676_0291372 | |||
| 1440 | Ga0495676_0870590 | |||
| 1441 | Ga0495680_0260489 | |||
| 1442 | Ga0495680_0602023 | |||
| 1443 | Ga0495675_0311108 | |||
| 1444 | Ga0495684_0009909 | |||
| 1445 | Ga0495684_0192526 | |||
| 1446 | Ga0495684_0236698 | |||
| 1447 | Ga0495593_0013682 | |||
| 1448 | Ga0495593_0304953 | |||
| 1449 | Ga0495602_0039422 | |||
| 1450 | Ga0496100_0118260 | |||
| 1451 | Ga0496100_0290582 | |||
| 1452 | Ga0496101_0033133 | |||
| 1453 | Ga0496101_0930275 | |||
| 1454 | Ga0496102_0162432 | |||
| 1455 | Ga0496102_0861692 | |||
| 1456 | Ga0496103_0136593 | |||
| 1457 | Ga0496103_0317208 | |||
| 1458 | Ga0496104_0050826 | |||
| 1459 | Ga0496104_0429476 | |||
| 1460 | Ga0496104_0716888 | |||
| 1461 | Ga0496104_0723814 | |||
| 1462 | Ga0496104_1052205 | |||
| 1463 | Ga0496105_0051266 | |||
| 1464 | Ga0496105_0266234 | |||
| 1465 | Ga0496106_0044266 | |||
| 1466 | Ga0496106_0317969 | |||
| 1467 | Ga0496107_0043324 | |||
| 1468 | Ga0496107_0127278 | |||
| 1469 | Ga0496108_0679810 | |||
| 1470 | Ga0496108_1414077 | |||
| 1471 | Ga0496109_0100497 | |||
| 1472 | Ga0496109_0227026 | |||
| 1473 | Ga0496109_0897365 | |||
| 1474 | Ga0496109_1045693 | |||
| 1475 | Ga0496110_0633578 | |||
| 1476 | Ga0496110_1037720 | |||
| 1477 | Ga0496110_1132766 | |||
| 1478 | Ga0496111_0215308 | |||
| 1479 | Ga0496112_0012785 | |||
| 1480 | Ga0496112_0091523 | |||
| 1481 | Ga0496112_0242859 | |||
| 1482 | Ga0496112_0554160 | |||
| 1483 | Ga0496113_0446166 | |||
| 1484 | Ga0496113_0459778 | |||
| 1485 | Ga0496113_0603996 | |||
| 1486 | Ga0496114_0024707 | |||
| 1487 | Ga0496114_0439925 | |||
| 1488 | Ga0496114_0642225 | |||
| 1489 | Ga0496115_0079282 | |||
| 1490 | Ga0496115_0300363 | |||
| 1491 | Ga0496126_0086703 | |||
| 1492 | Ga0501031_0012809 | |||
| 1493 | Ga0501031_0059641 | |||
| 1494 | Ga0501031_0091326 | |||
| 1495 | Ga0501031_0179533 | |||
| 1496 | Ga0501032_0052550 | |||
| 1497 | Ga0501032_0079759 | |||
| 1498 | Ga0501032_0733553 | |||
| 1499 | Ga0501033_0211144 | |||
| 1500 | Ga0501033_0389993 | |||
| 1501 | Ga0501034_1329170 | |||
| 1502 | Ga0501036_0098664 | |||
| 1503 | Ga0501036_0645463 | |||
| 1504 | Ga0501037_0074429 | |||
| 1505 | Ga0501037_0498109 | |||
| 1506 | Ga0501038_0004237 | |||
| 1507 | Ga0501038_0155989 | |||
| 1508 | Ga0501038_0305296 | |||
| 1509 | Ga0501038_0856392 | |||
| 1510 | Ga0501039_0031252 | |||
| 1511 | Ga0501039_0528533 | |||
| 1512 | Ga0501040_0180575 | |||
| 1513 | Ga0501042_0020798 | |||
| 1514 | Ga0501042_0087374 | |||
| 1515 | Ga0501042_0173252 | |||
| 1516 | Ga0501043_0011612 | |||
| 1517 | Ga0501043_1051427 | |||
| 1518 | Ga0501046_0072261 | |||
| 1519 | Ga0501047_0479027 | |||
| 1520 | Ga0501047_0841808 | |||
| 1521 | Ga0501047_1296012 | |||
| 1522 | Ga0501048_0008453 | |||
| 1523 | Ga0501048_0047877 | |||
| 1524 | Ga0501048_0691146 | |||
| 1525 | Ga0501068_0466938 | |||
| 1526 | Ga0501069_0001126 | |||
| 1527 | Ga0501069_0187644 | |||
| 1528 | Ga0501069_0553535 | |||
| 1529 | Ga0501069_0646381 | |||
| 1530 | Ga0501069_0965395 | |||
| 1531 | Ga0501070_0003286 | |||
| 1532 | Ga0501070_0027511 | |||
| 1533 | Ga0501070_0068088 | |||
| 1534 | Ga0501070_0931185 | |||
| 1535 | Ga0501070_1121583 | |||
| 1536 | Ga0501071_0003879 | |||
| 1537 | Ga0501071_0169115 | |||
| 1538 | Ga0501072_0182035 | |||
| 1539 | Ga0501072_1135241 | |||
| 1540 | Ga0501073_0032818 | |||
| 1541 | Ga0501073_0497780 | |||
| 1542 | Ga0501073_1221734 | |||
| 1543 | Ga0501074_0106190 | |||
| 1544 | Ga0501074_0122346 | |||
| 1545 | Ga0501074_1172598 | |||
| 1546 | Ga0501075_0034676 | |||
| 1547 | Ga0501075_0603515 | |||
| 1548 | Ga0501076_0331080 | |||
| 1549 | Ga0501076_1101100 | |||
| 1550 | Ga0501076_1125753 | |||
| 1551 | Ga0501077_0304889 | |||
| 1552 | Ga0501077_0487385 | |||
| 1553 | Ga0501077_0541274 | |||
| 1554 | Ga0501079_0179240 | |||
| 1555 | Ga0501079_1584329 | |||
| 1556 | Ga0501080_0047141 | |||
| 1557 | Ga0501080_0061621 | |||
| 1558 | Ga0501080_0594908 | |||
| 1559 | Ga0501080_1050609 | |||
| 1560 | Ga0501080_1579136 | |||
| 1561 | Ga0501080_1780266 | |||
| 1562 | Ga0501083_0009512 | |||
| 1563 | Ga0501083_0278781 | |||
| 1564 | Ga0501035_0127896 | |||
| 1565 | Ga0501035_0285513 | |||
| 1566 | Ga0501035_0649790 | |||
| 1567 | Ga0501035_0833540 | |||
| 1568 | Ga0501044_0012429 | |||
| 1569 | Ga0501045_0030609 | |||
| 1570 | Ga0501045_0132064 | |||
| 1571 | Ga0501045_0277662 | |||
| 1572 | nmdc:mga0yw44_684495_c1 | |||
| 1573 | nmdc:mga0yw44_859028_c1 | |||
| 1574 | nmdc:mga0yw44_870840_c1 | |||
| 1575 | nmdc:mga05p37_12819_c1 | |||
| 1576 | nmdc:mga05p37_728898_c1 | |||
| 1577 | nmdc:mga0qj67_355455_c1 | |||
| 1578 | nmdc:mga06r32_91522_c1 | |||
| 1579 | nmdc:mga08y16_519964_c1 | |||
| 1580 | nmdc:mga08y16_620300_c2 | |||
| 1581 | nmdc:mga0n895_327308_c1 | |||
| 1582 | nmdc:mga0n895_440003_c1 | |||
| 1583 | nmdc:mga0n895_595259_c1 | |||
| 1584 | nmdc:mga0n895_70459_c1 | |||
| 1585 | nmdc:mga0rr50_1034996_c1 | |||
| 1586 | nmdc:mga0rr50_123495_c1 | |||
| 1587 | nmdc:mga0rr50_246798_c1 | |||
| 1588 | nmdc:mga0rr50_253032_c1 | |||
| 1589 | nmdc:mga08x19_443414_c1 | |||
| 1590 | nmdc:mga08x19_684720_c1 | |||
| 1591 | nmdc:mga08x19_909018_c1 | |||
| 1592 | nmdc:mga0a205_1113821_c1 | |||
| 1593 | nmdc:mga0a205_285557_c1 | |||
| 1594 | nmdc:mga0a205_347254_c1 | |||
| 1595 | Ga0495601_0027869 | |||
| 1596 | Ga0495601_0102315 | |||
| 1597 | Ga0495612_0012775 | |||
| 1598 | Ga0495612_0053218 | |||
| 1599 | Ga0495612_0123581 | |||
| 1600 | Ga0495595_0011142 | |||
| 1601 | Ga0495595_0532268 | |||
| 1602 | Ga0495619_0018476 | |||
| 1603 | Ga0495619_0675834 | |||
| 1604 | Ga0501084_0014587 | |||
| 1605 | Ga0501084_0044612 | |||
| 1606 | Ga0501084_0046244 | |||
| 1607 | Ga0501084_0083148 | |||
| 1608 | Ga0501084_0292538 | |||
| 1609 | Ga0587122_000265 | |||
| 1610 | Ga0501082_0039996 | |||
| 1611 | Ga0466962_0139064 | |||
| 1612 | Ga0466962_0248819 | |||
| 1613 | Ga0466962_0397527 | |||
| 1614 | Ga0466962_0547080 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1a8v-assembly2.cif.gz_B | structure of the rna-binding domain of the rho transcription terminator | 0.8184 | 56 | 85 |
| 5wod-assembly1.cif.gz_A | de novo design of covalently constrained meso-size protein scaffolds with unique tertiary structures | 0.3423 | 54 | 86 |
| 1a8v-assembly2.cif.gz_B | structure of the rna-binding domain of the rho transcription terminator | 0.3195 | 56 | 85 |
| 5wod-assembly1.cif.gz_A | de novo design of covalently constrained meso-size protein scaffolds with unique tertiary structures | 0.3033 | 54 | 86 |
| 4oay-assembly6.cif.gz_J | bldd ctd-c-di-gmp complex | 0.3003 | 27 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWD7_13_140_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.919 | 56 | 81 | 2.40.50.140 |
| 1a8vB01 | Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; | 0.8184 | 56 | 85 | 1.10.720.10 |
| 2a8vC01 | Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; | 0.8023 | 56 | 85 | 1.10.720.10 |
| 2a8vC01 | Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; | 0.5586 | 56 | 85 | 1.10.720.10 |
| 1a8vB01 | Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; | 0.5447 | 56 | 85 | 1.10.720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356KKC6-F1-model_v4 | Rho termination factor N-terminal domain-containing protein | 1.012 | 56 | 85 |
|
| AF-A0A2D4SEZ1-F1-model_v4 | Rho termination factor | 1.009 | 56 | 85 |
GO:0006353
|
| AF-A0A4Y3QRD2-F1-model_v4 | Plasmid stabilization protein | 1.006 | 56 | 87 |
|
| AF-I4ANH7-F1-model_v4 | Rho termination factor | 1.004 | 56 | 86 |
GO:0006353
|
| AF-L9VQR6-F1-model_v4 | Rho termination factor-like N-terminal domain-containing protein | 0.9911 | 56 | 86 |
GO:0006353
|