F481667

General Info

Members Datasets Scaffolds Average Seq Length
806 298 806 50

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_1255643_c1|nmdc:mga0qj67_1255643_c1_105_257
Length 45
Sequence MLDLMRELWAFMRERKKFWLLPILVGGLVVFTQGSALAPFIYTLF

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
207 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
208 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
209 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
210 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
211 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
212 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
229 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
230 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
231 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
232 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
233 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
234 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
235 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
257 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
258 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
259 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
260 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
261 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
262 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
263 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
264 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
265 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
266 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
267 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
272 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
273 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
274 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
275 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
276 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
277 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
278 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
279 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
280 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 0.5
Rhizosphere 98.88
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10247975 3300001990 Unclassified 526
2 JGI26145J50221_1001561 3300003371 Bacteria 1805
3 Ga0058859_10071813 3300004798 Bacteria 2097
4 Ga0058860_10944608 3300004801 Unclassified 1078
5 Ga0065704_10654044 3300005289 Unclassified 565
6 Ga0065712_10048009 3300005290 Unclassified 786
7 Ga0065715_10407420 3300005293 Unclassified 874
8 Ga0065707_10153166 3300005295 Bacteria 1636
9 Ga0070658_10932872 3300005327 Unclassified 755
10 Ga0070676_10757969 3300005328 Unclassified 713
11 Ga0070683_100112441 3300005329 Bacteria 2570
12 Ga0070690_100119199 3300005330 Bacteria 1770
13 Ga0070690_100411240 3300005330 Bacteria 995
14 Ga0070690_101189982 3300005330 Unclassified 607
15 Ga0070670_100735181 3300005331 Bacteria 889
16 Ga0070677_10536158 3300005333 Unclassified 639
17 Ga0068869_100131138 3300005334 Bacteria 1927
18 Ga0068869_100927541 3300005334 Bacteria 755
19 Ga0068869_101413723 3300005334 Bacteria 616
20 Ga0070666_10475435 3300005335 Unclassified 904
21 Ga0070680_100002059 3300005336 Bacteria 14833
22 Ga0070680_100275657 3300005336 Unclassified 1424
23 Ga0068868_100393531 3300005338 Bacteria 1194
24 Ga0068868_100752100 3300005338 Unclassified 876
25 Ga0070660_100240370 3300005339 Bacteria 1475
26 Ga0070660_100357290 3300005339 Bacteria 1204
27 Ga0070689_100043834 3300005340 Bacteria 3440
28 Ga0070689_100494724 3300005340 Unclassified 1047
29 Ga0070689_101077864 3300005340 Unclassified 717
30 Ga0070689_101476381 3300005340 Bacteria 615
31 Ga0070691_10019602 3300005341 Bacteria 3123
32 Ga0070691_10113955 3300005341 Bacteria 1355
33 Ga0070687_100100597 3300005343 Bacteria 1618
34 Ga0070687_100762567 3300005343 Bacteria 682
35 Ga0070687_101189531 3300005343 Bacteria 562
36 Ga0070661_100032523 3300005344 Bacteria 3776
37 Ga0070661_101771504 3300005344 Bacteria 524
38 Ga0070692_10880169 3300005345 Viruses 618
39 Ga0070668_100045278 3300005347 Bacteria 3377
40 Ga0070668_100075893 3300005347 Bacteria 2625
41 Ga0070669_100019680 3300005353 Bacteria 4822
42 Ga0070669_100079723 3300005353 Bacteria 2436
43 Ga0070669_100557903 3300005353 Bacteria 955
44 Ga0070675_100029088 3300005354 Bacteria 4453
45 Ga0070675_101158214 3300005354 Unclassified 711
46 Ga0070671_100130065 3300005355 Bacteria 2120
47 Ga0070671_101600420 3300005355 Bacteria 577
48 Ga0070674_100031408 3300005356 Bacteria 3519
49 Ga0070674_100199853 3300005356 Bacteria 1543
50 Ga0070674_101305307 3300005356 Bacteria 647
51 Ga0070673_100002666 3300005364 Bacteria 10920
52 Ga0070673_100069651 3300005364 Unclassified 2820
53 Ga0070673_100089306 3300005364 Bacteria 2515
54 Ga0070673_102145989 3300005364 Bacteria 531
55 Ga0070688_100024928 3300005365 Bacteria 3536
56 Ga0070688_100153245 3300005365 Bacteria 1577
57 Ga0070659_100041847 3300005366 Bacteria 3582
58 Ga0070659_101624143 3300005366 Bacteria 577
59 Ga0070667_100183584 3300005367 Bacteria 1851
60 Ga0070667_100957832 3300005367 Unclassified 798
61 Ga0070667_101176720 3300005367 Bacteria 717
62 Ga0070714_100254765 3300005435 Bacteria 1624
63 Ga0070701_10196160 3300005438 Bacteria 1191
64 Ga0070701_10964533 3300005438 Unclassified 593
65 Ga0070711_100082865 3300005439 Bacteria 2290
66 Ga0070705_100308159 3300005440 Bacteria 1138
67 Ga0070705_100545003 3300005440 Bacteria 888
68 Ga0070700_100025268 3300005441 Bacteria 3497
69 Ga0070700_100270531 3300005441 Bacteria 1227
70 Ga0070700_100865109 3300005441 Unclassified 733
71 Ga0070700_101253340 3300005441 Bacteria 621
72 Ga0070694_100031366 3300005444 Bacteria 3485
73 Ga0070694_101867326 3300005444 Unclassified 513
74 Ga0070708_100221606 3300005445 Bacteria 1774
75 Ga0070708_100238033 3300005445 Bacteria 1709
76 Ga0070708_100555300 3300005445 Bacteria 1083
77 Ga0070708_102218197 3300005445 Unclassified 507
78 Ga0070663_100074878 3300005455 Bacteria 2473
79 Ga0070663_101166080 3300005455 Bacteria 676
80 Ga0070678_100158794 3300005456 Bacteria 1829
81 Ga0070678_100801979 3300005456 Bacteria 855
82 Ga0070678_102093422 3300005456 Bacteria 536
83 Ga0070662_100245139 3300005457 Bacteria 1438
84 Ga0070662_100282808 3300005457 Bacteria 1343
85 Ga0070662_100662994 3300005457 Unclassified 881
86 Ga0070681_10000612 3300005458 Bacteria 29342
87 Ga0070681_10006622 3300005458 Bacteria 11281
88 Ga0070681_10044888 3300005458 Bacteria 4424
89 Ga0068867_100126336 3300005459 Bacteria 1982
90 Ga0068867_100300830 3300005459 Bacteria 1322
91 Ga0068867_100995593 3300005459 Bacteria 760
92 Ga0070685_11485602 3300005466 Unclassified 522
93 Ga0070706_100072236 3300005467 Bacteria 3193
94 Ga0070706_100078810 3300005467 Bacteria 3050
95 Ga0070706_100183798 3300005467 Bacteria 1952
96 Ga0070706_100387146 3300005467 Bacteria 1302
97 Ga0070706_101411583 3300005467 Unclassified 637
98 Ga0070706_101799410 3300005467 Unclassified 557
99 Ga0070707_100290937 3300005468 Bacteria 1587
100 Ga0070707_100632354 3300005468 Unclassified 1033
101 Ga0070707_101185904 3300005468 Bacteria 730
102 Ga0070698_100003892 3300005471 Bacteria 16413
103 Ga0070698_100012841 3300005471 Bacteria 8871
104 Ga0070698_100436686 3300005471 Bacteria 1244
105 Ga0070698_100882090 3300005471 Unclassified 840
106 Ga0070698_101148894 3300005471 Unclassified 725
107 Ga0070698_101725027 3300005471 Bacteria 579
108 Ga0070698_102169158 3300005471 Bacteria 509
109 Ga0070699_100017618 3300005518 Bacteria 6132
110 Ga0070699_100023190 3300005518 Bacteria 5347
111 Ga0070699_100697937 3300005518 Unclassified 927
112 Ga0070699_101161936 3300005518 Bacteria 708
113 Ga0070679_100009667 3300005530 Bacteria 9122
114 Ga0070679_100839969 3300005530 Unclassified 862
115 Ga0070679_101916275 3300005530 Bacteria 541
116 Ga0070684_101016488 3300005535 Bacteria 778
117 Ga0070684_101218166 3300005535 Unclassified 708
118 Ga0070697_100008497 3300005536 Bacteria 8014
119 Ga0070697_100236257 3300005536 Bacteria 1560
120 Ga0070697_100257254 3300005536 Bacteria 1494
121 Ga0070697_100700473 3300005536 Bacteria 894
122 Ga0070697_100855014 3300005536 Bacteria 806
123 Ga0070697_101134556 3300005536 Bacteria 696
124 Ga0070697_101414429 3300005536 Unclassified 621
125 Ga0070697_102130660 3300005536 Bacteria 502
126 Ga0068853_101272002 3300005539 Bacteria 711
127 Ga0070672_100029041 3300005543 Bacteria 4143
128 Ga0070672_100112126 3300005543 Bacteria 2224
129 Ga0070672_100184921 3300005543 Bacteria 1737
130 Ga0070672_100191034 3300005543 Bacteria 1710
131 Ga0070686_100276543 3300005544 Bacteria 1236
132 Ga0070686_100308426 3300005544 Bacteria 1176
133 Ga0070686_101372519 3300005544 Bacteria 592
134 Ga0070686_101791432 3300005544 Unclassified 522
135 Ga0070695_100195923 3300005545 Bacteria 1441
136 Ga0070696_100002400 3300005546 Bacteria 12401
137 Ga0070696_100273636 3300005546 Bacteria 1285
138 Ga0070696_100523096 3300005546 Bacteria 947
139 Ga0070696_100661996 3300005546 Bacteria 848
140 Ga0070696_101157297 3300005546 Unclassified 652
141 Ga0070693_100105159 3300005547 Bacteria 1727
142 Ga0070693_100706294 3300005547 Bacteria 739
143 Ga0070665_100162554 3300005548 Bacteria 2235
144 Ga0070704_100032657 3300005549 Bacteria 3513
145 Ga0070704_100434320 3300005549 Bacteria 1127
146 Ga0070704_101422199 3300005549 Unclassified 636
147 Ga0070704_101856848 3300005549 Unclassified 558
148 Ga0068855_100033978 3300005563 Bacteria 6083
149 Ga0068857_101057545 3300005577 Unclassified 783
150 Ga0068857_101712705 3300005577 Unclassified 615
151 Ga0068857_101945163 3300005577 Unclassified 576
152 Ga0068854_100116537 3300005578 Bacteria 2022
153 Ga0068854_101063181 3300005578 Unclassified 719
154 Ga0068854_101348843 3300005578 Bacteria 643
155 Ga0068854_102010834 3300005578 Bacteria 533
156 Ga0068856_100109899 3300005614 Bacteria 2754
157 Ga0070702_100086826 3300005615 Bacteria 1888
158 Ga0070702_100176040 3300005615 Bacteria 1396
159 Ga0070702_100655211 3300005615 Unclassified 794
160 Ga0070702_101168025 3300005615 Bacteria 619
161 Ga0068852_100629655 3300005616 Bacteria 1079
162 Ga0068859_100117315 3300005617 Bacteria 2727
163 Ga0068859_100139669 3300005617 Bacteria 2496
164 Ga0068859_100178063 3300005617 Bacteria 2209
165 Ga0068859_100416127 3300005617 Bacteria 1440
166 Ga0068859_101884178 3300005617 Unclassified 660
167 Ga0068864_100808080 3300005618 Unclassified 922
168 Ga0068864_102346092 3300005618 Unclassified 540
169 Ga0068866_10165297 3300005718 Bacteria 1294
170 Ga0068866_10477348 3300005718 Unclassified 821
171 Ga0068861_100052875 3300005719 Bacteria 3089
172 Ga0068861_100244284 3300005719 Bacteria 1528
173 Ga0068861_100626979 3300005719 Bacteria 990
174 Ga0068861_102346235 3300005719 Bacteria 536
175 Ga0068870_10173702 3300005840 Bacteria 1288
176 Ga0068863_100230024 3300005841 Unclassified 1788
177 Ga0068858_100164009 3300005842 Bacteria 2093
178 Ga0068858_100487806 3300005842 Bacteria 1190
179 Ga0068858_100850576 3300005842 Bacteria 891
180 Ga0068858_101206012 3300005842 Unclassified 744
181 Ga0068858_101373868 3300005842 Bacteria 696
182 Ga0068858_102491653 3300005842 Unclassified 511
183 Ga0068860_100137552 3300005843 Bacteria 2346
184 Ga0068860_100235307 3300005843 Bacteria 1780
185 Ga0068860_100894598 3300005843 Bacteria 904
186 Ga0068860_101298612 3300005843 Unclassified 748
187 Ga0068860_102236194 3300005843 Bacteria 568
188 Ga0068862_100104397 3300005844 Bacteria 2482
189 Ga0068862_100121605 3300005844 Bacteria 2302
190 Ga0068862_101250191 3300005844 Unclassified 742
191 Ga0068862_101544002 3300005844 Bacteria 670
192 Ga0081455_10003374 3300005937 Bacteria 18420
193 Ga0081455_10005104 3300005937 Bacteria 14479
194 Ga0081455_10005732 3300005937 Bacteria 13538
195 Ga0081455_10165463 3300005937 Bacteria 1690
196 Ga0081538_10003359 3300005981 Bacteria 15149
197 Ga0081538_10007871 3300005981 Bacteria 9136
198 Ga0081538_10025886 3300005981 Plasmid 4122
199 Ga0081540_1004479 3300005983 Bacteria 10632
200 Ga0075432_10032086 3300006058 Bacteria 1820
201 Ga0075432_10101768 3300006058 Bacteria 1062
202 Ga0075432_10572467 3300006058 Unclassified 513
203 Ga0075427_10071128 3300006194 Unclassified 620
204 Ga0097621_100100525 3300006237 Bacteria 2433
205 Ga0097621_100501085 3300006237 Unclassified 1100
206 Ga0068871_100124807 3300006358 Bacteria 2178
207 Ga0075428_100002796 3300006844 Bacteria 18986
208 Ga0075428_100016284 3300006844 Bacteria 8217
209 Ga0075428_100078772 3300006844 Bacteria 3597
210 Ga0075428_100091223 3300006844 Bacteria 3323
211 Ga0075428_100109417 3300006844 Bacteria 3011
212 Ga0075428_100221432 3300006844 Bacteria 2043
213 Ga0075428_100264965 3300006844 Bacteria 1850
214 Ga0075428_100401352 3300006844 Bacteria 1469
215 Ga0075428_100465279 3300006844 Unclassified 1354
216 Ga0075428_100566354 3300006844 Bacteria 1214
217 Ga0075428_100746288 3300006844 Bacteria 1041
218 Ga0075428_100780685 3300006844 Unclassified 1016
219 Ga0075428_101092869 3300006844 Unclassified 842
220 Ga0075428_101729396 3300006844 Bacteria 652
221 Ga0075430_100003745 3300006846 Bacteria 12777
222 Ga0075430_100008951 3300006846 Bacteria 8455
223 Ga0075430_100036044 3300006846 Unclassified 4194
224 Ga0075430_100062272 3300006846 Bacteria 3134
225 Ga0075430_100079885 3300006846 Bacteria 2740
226 Ga0075430_100150682 3300006846 Bacteria 1937
227 Ga0075430_100170153 3300006846 Bacteria 1812
228 Ga0075430_100285943 3300006846 Bacteria 1364
229 Ga0075430_100804333 3300006846 Bacteria 775
230 Ga0075431_100005537 3300006847 Bacteria 12465
231 Ga0075431_100034193 3300006847 Bacteria 5238
232 Ga0075431_100042249 3300006847 Unclassified 4701
233 Ga0075431_100239719 3300006847 Bacteria 1845
234 Ga0075431_100245256 3300006847 Unclassified 1821
235 Ga0075431_100332254 3300006847 Bacteria 1531
236 Ga0075431_100435569 3300006847 Bacteria 1308
237 Ga0075431_100789070 3300006847 Bacteria 923
238 Ga0075431_100897437 3300006847 Bacteria 856
239 Ga0075431_100976500 3300006847 Unclassified 814
240 Ga0075431_101344869 3300006847 Bacteria 675
241 Ga0075431_101656039 3300006847 Bacteria 597
242 Ga0075433_10001398 3300006852 Bacteria 17801
243 Ga0075433_10069168 3300006852 Bacteria 3100
244 Ga0075433_10113828 3300006852 Unclassified 2400
245 Ga0075433_10278156 3300006852 Bacteria 1483
246 Ga0075433_10307026 3300006852 Bacteria 1404
247 Ga0075433_10615978 3300006852 Bacteria 953
248 Ga0075433_11289663 3300006852 Bacteria 633
249 Ga0075433_11596206 3300006852 Unclassified 563
250 Ga0075433_11612485 3300006852 Bacteria 560
251 Ga0075434_100037785 3300006871 Bacteria 4780
252 Ga0075434_100051110 3300006871 Bacteria 4106
253 Ga0075434_100094512 3300006871 Bacteria 2994
254 Ga0075434_100126059 3300006871 Bacteria 2577
255 Ga0075434_100394669 3300006871 Bacteria 1404
256 Ga0075434_100506720 3300006871 Unclassified 1228
257 Ga0075434_100537724 3300006871 Bacteria 1188
258 Ga0075434_100981995 3300006871 Unclassified 858
259 Ga0075434_101852546 3300006871 Bacteria 610
260 Ga0075429_100015697 3300006880 Bacteria 6562
261 Ga0075429_100029066 3300006880 Unclassified 4800
262 Ga0075429_100057299 3300006880 Bacteria 3392
263 Ga0075429_100100865 3300006880 Bacteria 2520
264 Ga0075429_100115496 3300006880 Bacteria 2346
265 Ga0075429_100316672 3300006880 Bacteria 1365
266 Ga0075429_100334401 3300006880 Bacteria 1326
267 Ga0075429_100340108 3300006880 Bacteria 1314
268 Ga0075429_100438749 3300006880 Unclassified 1144
269 Ga0075429_100572330 3300006880 Bacteria 990
270 Ga0075429_100853910 3300006880 Viruses 797
271 Ga0075429_100930617 3300006880 Bacteria 760
272 Ga0075429_100952181 3300006880 Unclassified 751
273 Ga0068865_100006629 3300006881 Bacteria 7082
274 Ga0068865_100284233 3300006881 Bacteria 1318
275 Ga0068865_101043006 3300006881 Unclassified 718
276 Ga0075436_100046776 3300006914 Unclassified 2984
277 Ga0075436_100048127 3300006914 Bacteria 2942
278 Ga0097620_100117317 3300006931 Bacteria 2727
279 Ga0097620_100139667 3300006931 Bacteria 2496
280 Ga0097620_100178053 3300006931 Bacteria 2209
281 Ga0097620_100416110 3300006931 Bacteria 1440
282 Ga0097620_101883779 3300006931 Unclassified 660
283 Ga0075435_100027752 3300007076 Bacteria 4432
284 Ga0075435_100270730 3300007076 Bacteria 1449
285 Ga0075435_100293944 3300007076 Bacteria 1388
286 Ga0075435_100395860 3300007076 Bacteria 1187
287 Ga0075435_100484658 3300007076 Unclassified 1068
288 Ga0075435_101094569 3300007076 Bacteria 697
289 Ga0075435_101124038 3300007076 Bacteria 687
290 Ga0099794_10301156 3300007265 Bacteria 830
291 Ga0099794_10441169 3300007265 Unclassified 682
292 Ga0105240_10041272 3300009093 Bacteria 5891
293 Ga0105240_10162322 3300009093 Bacteria 2653
294 Ga0105240_10674163 3300009093 Bacteria 1131
295 Ga0111539_10020928 3300009094 Bacteria 8054
296 Ga0111539_10060788 3300009094 Bacteria 4477
297 Ga0111539_10178995 3300009094 Bacteria 2477
298 Ga0111539_10290129 3300009094 Bacteria 1904
299 Ga0111539_10702989 3300009094 Unclassified 1177
300 Ga0111539_10888374 3300009094 Bacteria 1037
301 Ga0111539_11189737 3300009094 Unclassified 885
302 Ga0111539_11473899 3300009094 Unclassified 789
303 Ga0105245_12441907 3300009098 Bacteria 576
304 Ga0105247_10454737 3300009101 Bacteria 924
305 Ga0114129_10005952 3300009147 Bacteria 17264
306 Ga0114129_10018701 3300009147 Bacteria 9868
307 Ga0114129_10059350 3300009147 Bacteria 5349
308 Ga0114129_10069903 3300009147 Bacteria 4895
309 Ga0114129_10085812 3300009147 Unclassified 4367
310 Ga0114129_10090670 3300009147 Unclassified 4237
311 Ga0114129_10111773 3300009147 Bacteria 3769
312 Ga0114129_10120706 3300009147 Bacteria 3609
313 Ga0114129_10145165 3300009147 Bacteria 3251
314 Ga0114129_10168844 3300009147 Unclassified 2984
315 Ga0114129_10315401 3300009147 Bacteria 2080
316 Ga0114129_10447922 3300009147 Bacteria 1694
317 Ga0114129_10489429 3300009147 Unclassified 1608
318 Ga0114129_10647811 3300009147 Bacteria 1364
319 Ga0114129_10737160 3300009147 Bacteria 1263
320 Ga0114129_10986572 3300009147 Bacteria 1062
321 Ga0114129_11031046 3300009147 Bacteria 1034
322 Ga0114129_11039326 3300009147 Bacteria 1029
323 Ga0114129_11058995 3300009147 Unclassified 1018
324 Ga0114129_11069671 3300009147 Bacteria 1012
325 Ga0114129_11123895 3300009147 Bacteria 982
326 Ga0114129_11206821 3300009147 Bacteria 942
327 Ga0114129_11253583 3300009147 Bacteria 921
328 Ga0114129_11262640 3300009147 Archaea 917
329 Ga0114129_11362653 3300009147 Bacteria 877
330 Ga0114129_11955566 3300009147 Viruses 710
331 Ga0114129_12269091 3300009147 Unclassified 652
332 Ga0114129_13470155 3300009147 Unclassified 505
333 Ga0105243_10027900 3300009148 Bacteria 4330
334 Ga0105243_10073463 3300009148 Bacteria 2771
335 Ga0105243_11501844 3300009148 Unclassified 697
336 Ga0105242_10077507 3300009176 Bacteria 2773
337 Ga0105242_10303063 3300009176 Bacteria 1459
338 Ga0105242_10591692 3300009176 Unclassified 1070
339 Ga0105248_10020631 3300009177 Bacteria 7303
340 Ga0105248_10223054 3300009177 Bacteria 2122
341 Ga0105248_10364733 3300009177 Bacteria 1626
342 Ga0105248_11164825 3300009177 Unclassified 871
343 Ga0105248_11456340 3300009177 Bacteria 775
344 Ga0105237_11025416 3300009545 Unclassified 832
345 Ga0105238_10081375 3300009551 Bacteria 3228
346 Ga0105249_10414861 3300009553 Bacteria 1379
347 Ga0105249_10596642 3300009553 Bacteria 1159
348 Ga0105249_11329871 3300009553 Bacteria 790
349 Ga0105249_13273966 3300009553 Unclassified 521
350 Ga0105239_10091409 3300010375 Bacteria 3358
351 Ga0105246_11304842 3300011119 Unclassified 673
352 Ga0157373_10139082 3300013100 Bacteria 1707
353 Ga0157373_10347100 3300013100 Bacteria 1058
354 Ga0157373_11448723 3300013100 Bacteria 523
355 Ga0157371_10839428 3300013102 Unclassified 694
356 Ga0157370_10266267 3300013104 Bacteria 1583
357 Ga0157369_12308179 3300013105 Bacteria 545
358 Ga0157374_10031675 3300013296 Bacteria 4809
359 Ga0157374_10101351 3300013296 Unclassified 2761
360 Ga0157378_10009886 3300013297 Bacteria 8314
361 Ga0157378_10073226 3300013297 Bacteria 3079
362 Ga0157378_10224203 3300013297 Unclassified 1788
363 Ga0157378_10280874 3300013297 Unclassified 1605
364 Ga0157378_11995504 3300013297 Bacteria 630
365 Ga0163162_10036544 3300013306 Bacteria 4897
366 Ga0163162_10391041 3300013306 Bacteria 1523
367 Ga0163162_10468141 3300013306 Bacteria 1392
368 Ga0163162_13451638 3300013306 Unclassified 503
369 Ga0157372_10150816 3300013307 Bacteria 2683
370 Ga0157375_10247727 3300013308 Bacteria 1942
371 Ga0157375_11342646 3300013308 Bacteria 841
372 Ga0157375_12360614 3300013308 Unclassified 634
373 Ga0157375_12712092 3300013308 Unclassified 592
374 Ga0163163_12316982 3300014325 Unclassified 596
375 Ga0157380_10028062 3300014326 Bacteria 4288
376 Ga0157380_10161018 3300014326 Bacteria 1950
377 Ga0157380_10463527 3300014326 Bacteria 1220
378 Ga0157380_10597012 3300014326 Bacteria 1091
379 Ga0157377_10014033 3300014745 Bacteria 4070
380 Ga0157377_10185475 3300014745 Bacteria 1311
381 Ga0157377_10383043 3300014745 Unclassified 953
382 Ga0157379_10507094 3300014968 Bacteria 1119
383 Ga0157379_11377274 3300014968 Unclassified 683
384 Ga0157379_11882101 3300014968 Bacteria 589
385 Ga0157376_10024323 3300014969 Bacteria 4753
386 Ga0157376_10959620 3300014969 Bacteria 876
387 Ga0163161_10230912 3300017792 Bacteria 1436
388 Ga0163161_11464390 3300017792 Bacteria 598
389 Ga0207653_10274061 3300025885 Bacteria 650
390 Ga0207642_10200791 3300025899 Unclassified 1101
391 Ga0207710_10196771 3300025900 Bacteria 994
392 Ga0207680_10262129 3300025903 Bacteria 1196
393 Ga0207645_10005980 3300025907 Bacteria 8758
394 Ga0207645_10577425 3300025907 Bacteria 763
395 Ga0207643_10153493 3300025908 Bacteria 1382
396 Ga0207705_10013097 3300025909 Bacteria 5985
397 Ga0207684_10035507 3300025910 Bacteria 4234
398 Ga0207684_10093628 3300025910 Bacteria 2562
399 Ga0207684_10100163 3300025910 Bacteria 2476
400 Ga0207684_10218856 3300025910 Bacteria 1643
401 Ga0207684_10245754 3300025910 Bacteria 1544
402 Ga0207654_10446534 3300025911 Bacteria 906
403 Ga0207707_10001853 3300025912 Bacteria 19332
404 Ga0207707_10094936 3300025912 Bacteria 2606
405 Ga0207707_10138781 3300025912 Bacteria 2126
406 Ga0207695_10192545 3300025913 Bacteria 1956
407 Ga0207663_10059039 3300025916 Bacteria 2425
408 Ga0207660_10007560 3300025917 Bacteria 7032
409 Ga0207660_10192201 3300025917 Bacteria 1590
410 Ga0207660_10247965 3300025917 Bacteria 1405
411 Ga0207660_10770483 3300025917 Unclassified 785
412 Ga0207662_10105303 3300025918 Bacteria 1753
413 Ga0207662_10213519 3300025918 Bacteria 1253
414 Ga0207657_10001811 3300025919 Bacteria 23057
415 Ga0207657_10129247 3300025919 Bacteria 2072
416 Ga0207657_10170326 3300025919 Bacteria 1764
417 Ga0207649_10608382 3300025920 Unclassified 841
418 Ga0207652_10007191 3300025921 Bacteria 8983
419 Ga0207652_10318627 3300025921 Bacteria 1404
420 Ga0207652_10588075 3300025921 Bacteria 999
421 Ga0207646_10253254 3300025922 Bacteria 1591
422 Ga0207646_11175456 3300025922 Unclassified 673
423 Ga0207681_10027143 3300025923 Bacteria 3700
424 Ga0207681_10267618 3300025923 Bacteria 1340
425 Ga0207681_10307967 3300025923 Bacteria 1255
426 Ga0207694_10071363 3300025924 Bacteria 2714
427 Ga0207650_10031403 3300025925 Bacteria 3835
428 Ga0207650_10583585 3300025925 Unclassified 939
429 Ga0207659_10069896 3300025926 Bacteria 2559
430 Ga0207664_11057657 3300025929 Bacteria 726
431 Ga0207644_10030659 3300025931 Bacteria 3742
432 Ga0207644_10342694 3300025931 Bacteria 1212
433 Ga0207644_10911170 3300025931 Unclassified 737
434 Ga0207644_11705092 3300025931 Unclassified 528
435 Ga0207690_10592929 3300025932 Bacteria 904
436 Ga0207690_11255031 3300025932 Bacteria 619
437 Ga0207706_10004396 3300025933 Bacteria 13245
438 Ga0207706_10006287 3300025933 Bacteria 11036
439 Ga0207706_10135695 3300025933 Bacteria 2165
440 Ga0207686_10127937 3300025934 Bacteria 1738
441 Ga0207709_10077069 3300025935 Bacteria 2136
442 Ga0207709_11279589 3300025935 Bacteria 606
443 Ga0207709_11788895 3300025935 Bacteria 511
444 Ga0207669_10740531 3300025937 Unclassified 811
445 Ga0207669_11696220 3300025937 Bacteria 540
446 Ga0207704_10003039 3300025938 Bacteria 7581
447 Ga0207704_11367407 3300025938 Unclassified 606
448 Ga0207691_10008091 3300025940 Bacteria 10098
449 Ga0207691_10016009 3300025940 Bacteria 7122
450 Ga0207691_10203055 3300025940 Bacteria 1724
451 Ga0207691_10255908 3300025940 Bacteria 1510
452 Ga0207691_11584994 3300025940 Bacteria 533
453 Ga0207711_10251537 3300025941 Bacteria 1623
454 Ga0207711_10474898 3300025941 Unclassified 1165
455 Ga0207711_10741307 3300025941 Unclassified 916
456 Ga0207711_11553490 3300025941 Unclassified 605
457 Ga0207711_11975395 3300025941 Bacteria 526
458 Ga0207689_10007800 3300025942 Bacteria 9367
459 Ga0207689_11221738 3300025942 Unclassified 632
460 Ga0207689_11317704 3300025942 Bacteria 606
461 Ga0207689_11709149 3300025942 Unclassified 521
462 Ga0207661_10105383 3300025944 Bacteria 2376
463 Ga0207661_11118754 3300025944 Bacteria 725
464 Ga0207679_10066283 3300025945 Bacteria 2705
465 Ga0207679_10533558 3300025945 Bacteria 1051
466 Ga0207667_10028912 3300025949 Bacteria 6017
467 Ga0207651_10033306 3300025960 Bacteria 3322
468 Ga0207651_10052560 3300025960 Unclassified 2779
469 Ga0207651_10217962 3300025960 Unclassified 1541
470 Ga0207651_10349858 3300025960 Unclassified 1244
471 Ga0207651_10473454 3300025960 Bacteria 1078
472 Ga0207651_11342025 3300025960 Unclassified 643
473 Ga0207712_10019630 3300025961 Bacteria 4417
474 Ga0207712_10382695 3300025961 Bacteria 1178
475 Ga0207668_10145186 3300025972 Bacteria 1830
476 Ga0207668_10145661 3300025972 Bacteria 1827
477 Ga0207640_10015236 3300025981 Bacteria 4447
478 Ga0207640_10055844 3300025981 Bacteria 2589
479 Ga0207640_10525755 3300025981 Bacteria 989
480 Ga0207658_11810880 3300025986 Unclassified 557
481 Ga0207677_10199772 3300026023 Bacteria 1588
482 Ga0207677_10280493 3300026023 Bacteria 1367
483 Ga0207703_10356353 3300026035 Unclassified 1348
484 Ga0207703_10896009 3300026035 Bacteria 849
485 Ga0207703_11459870 3300026035 Bacteria 658
486 Ga0207708_10002116 3300026075 Bacteria 14637
487 Ga0207708_10316947 3300026075 Bacteria 1271
488 Ga0207702_10334611 3300026078 Bacteria 1445
489 Ga0207641_10159670 3300026088 Bacteria 2049
490 Ga0207641_10929371 3300026088 Bacteria 865
491 Ga0207641_11252878 3300026088 Bacteria 742
492 Ga0207648_10000971 3300026089 Bacteria 32341
493 Ga0207648_10396934 3300026089 Bacteria 1249
494 Ga0207648_11150676 3300026089 Bacteria 728
495 Ga0207676_11033927 3300026095 Unclassified 810
496 Ga0207676_11977322 3300026095 Bacteria 582
497 Ga0207674_10340583 3300026116 Bacteria 1450
498 Ga0207674_11455612 3300026116 Bacteria 654
499 Ga0207675_100029601 3300026118 Bacteria 5100
500 Ga0207675_100211591 3300026118 Bacteria 1865
501 Ga0207675_100364633 3300026118 Bacteria 1418
502 Ga0207675_101012175 3300026118 Unclassified 849
503 Ga0207683_10002617 3300026121 Bacteria 15711
504 Ga0207683_10169630 3300026121 Bacteria 1976
505 Ga0207698_10849701 3300026142 Bacteria 918
506 Ga0209969_1000761 3300027360 Bacteria 4316
507 Ga0209967_1001515 3300027364 Bacteria 2979
508 Ga0209981_1000933 3300027378 Bacteria 3663
509 Ga0209996_1000443 3300027395 Bacteria 4990
510 Ga0209996_1053866 3300027395 Unclassified 612
511 Ga0209984_1000288 3300027424 Bacteria 5713
512 Ga0210000_1000168 3300027462 Bacteria 9449
513 Ga0209995_1024174 3300027471 Bacteria 1011
514 Ga0209968_1000142 3300027526 Bacteria 12474
515 Ga0209968_1015903 3300027526 Bacteria 1193
516 Ga0209999_1003539 3300027543 Bacteria 2798
517 Ga0209982_1000124 3300027552 Bacteria 8417
518 Ga0209970_1001779 3300027614 Bacteria 3734
519 Ga0210002_1000032 3300027617 Bacteria 21467
520 Ga0209971_1003221 3300027682 Bacteria 3890
521 Ga0209966_1000451 3300027695 Bacteria 11482
522 Ga0209974_10000674 3300027876 Bacteria 11586
523 Ga0209974_10101986 3300027876 Unclassified 1004
524 Ga0209974_10216048 3300027876 Bacteria 712
525 Ga0207428_10121154 3300027907 Bacteria 2006
526 Ga0207428_10534782 3300027907 Bacteria 849
527 Ga0207428_10665786 3300027907 Bacteria 746
528 Ga0268265_10066606 3300028380 Bacteria 2785
529 Ga0268265_11024627 3300028380 Unclassified 816
530 Ga0268265_11124903 3300028380 Unclassified 780
531 Ga0268265_11565388 3300028380 Bacteria 664
532 Ga0268264_10113987 3300028381 Bacteria 2373
533 Ga0268264_10525700 3300028381 Bacteria 1157
534 Ga0268264_10593189 3300028381 Bacteria 1091
535 Ga0268264_11380669 3300028381 Unclassified 715
536 Ga0307513_10478142 3300031456 Bacteria 966
537 Ga0307408_101179431 3300031548 Unclassified 713
538 Ga0307408_102320362 3300031548 Unclassified 520
539 Ga0307413_10532301 3300031824 Bacteria 950
540 Ga0307413_11215390 3300031824 Unclassified 656
541 Ga0307410_10507054 3300031852 Unclassified 993
542 Ga0307407_10438252 3300031903 Bacteria 946
543 Ga0307407_10551922 3300031903 Unclassified 852
544 Ga0307412_11643733 3300031911 Unclassified 587
545 Ga0307412_11926529 3300031911 Unclassified 546
546 Ga0307409_100479462 3300031995 Bacteria 1207
547 Ga0307409_100561028 3300031995 Bacteria 1123
548 Ga0307409_100969066 3300031995 Bacteria 867
549 Ga0307416_100562758 3300032002 Bacteria 1215
550 Ga0307416_101751564 3300032002 Bacteria 726
551 Ga0307414_10870171 3300032004 Unclassified 825
552 Ga0307411_10125104 3300032005 Bacteria 1868
553 Ga0307411_11667166 3300032005 Unclassified 589
554 Ga0373952_0126114 3300035092 Bacteria 699
555 Ga0373961_0217632 3300035241 Unclassified 680
556 Ga0373931_0223976 3300035691 Bacteria 1134
557 Ga0451804_0682386 3300041463 Bacteria 620
558 Ga0451839_1028224 3300041496 Bacteria 1643
559 Ga0439443_122779 3300042003 Unclassified 511
560 Ga0439452_036385 3300042010 Unclassified 1180
561 Ga0439455_0208547 3300042012 Unclassified 567
562 Ga0439435_0116623 3300042436 Bacteria 833
563 Ga0439460_0013298 3300042461 Bacteria 2152
564 Ga0453683_0368198 3300044673 Bacteria 924
565 Ga0451576_0141115 3300045051 Bacteria 2512
566 Ga0451576_1218775 3300045051 Bacteria 786
567 Ga0451576_1814643 3300045051 Unclassified 630
568 Ga0451576_2213190 3300045051 Unclassified 564
569 Ga0466967_0248470 3300045976 Bacteria 1699
570 Ga0466967_0602113 3300045976 Unclassified 1085
571 Ga0495651_0773283 3300046462 Bacteria 594
572 Ga0495580_0277214 3300046472 Bacteria 1144
573 Ga0495594_0109102 3300046499 Bacteria 1560
574 Ga0495622_0290316 3300046557 Bacteria 714
575 Ga0495635_0273624 3300046663 Bacteria 1135
576 Ga0495669_0097567 3300046684 Bacteria 1363
577 Ga0495669_0149782 3300046684 Bacteria 1104
578 Ga0495636_0153379 3300047318 Bacteria 1035
579 Ga0495636_0251204 3300047318 Unclassified 818
580 Ga0495636_0488785 3300047318 Unclassified 594
581 Ga0496107_1185333 3300048910 Bacteria 549
582 Ga0496108_0363127 3300048911 Bacteria 1264
583 Ga0496109_2063592 3300048912 Unclassified 502
584 Ga0501308_042964 3300049128 Unclassified 642
585 Ga0501309_030012 3300049129 Unclassified 799
586 Ga0501291_027180 3300049514 Unclassified 946
587 Ga0501291_150631 3300049514 Unclassified 525
588 Ga0501292_012798 3300049515 Bacteria 1284
589 Ga0501297_007146 3300049520 Bacteria 1205
590 Ga0501298_007475 3300049521 Bacteria 1812
591 Ga0501299_046582 3300049522 Bacteria 885
592 Ga0501299_054238 3300049522 Unclassified 835
593 Ga0501300_010301 3300049523 Bacteria 1363
594 Ga0501301_046108 3300049524 Bacteria 508
595 Ga0501312_054022 3300049528 Unclassified 683
596 Ga0501316_057555 3300049532 Unclassified 570
597 Ga0501325_045027 3300049541 Unclassified 547
598 Ga0501033_0711916 3300049570 Unclassified 683
599 Ga0501036_0298082 3300049572 Bacteria 1349
600 Ga0501036_1112489 3300049572 Bacteria 645
601 Ga0501036_1391954 3300049572 Unclassified 569
602 Ga0501037_0672638 3300049573 Bacteria 691
603 Ga0501038_0544123 3300049574 Bacteria 884
604 Ga0501038_0800968 3300049574 Bacteria 700
605 Ga0501039_0266690 3300049575 Bacteria 1346
606 Ga0501039_0288264 3300049575 Bacteria 1291
607 Ga0501039_0446086 3300049575 Bacteria 1016
608 Ga0501039_0872042 3300049575 Unclassified 701
609 Ga0501040_0316662 3300049576 Bacteria 1116
610 Ga0501040_0473941 3300049576 Unclassified 902
611 Ga0501041_0485039 3300049577 Unclassified 786
612 Ga0501041_0501239 3300049577 Unclassified 772
613 Ga0501041_1010942 3300049577 Unclassified 535
614 Ga0501042_0216155 3300049578 Unclassified 1383
615 Ga0501042_0258918 3300049578 Bacteria 1256
616 Ga0501042_0398607 3300049578 Bacteria 997
617 Ga0501042_0768036 3300049578 Bacteria 701
618 Ga0501042_1403916 3300049578 Unclassified 509
619 Ga0501046_0788146 3300049580 Unclassified 666
620 Ga0501067_0131716 3300049583 Unclassified 1392
621 Ga0501068_0060454 3300049584 Unclassified 2301
622 Ga0501068_1145828 3300049584 Bacteria 515
623 Ga0501069_0166196 3300049585 Unclassified 1272
624 Ga0501071_0076663 3300049587 Bacteria 2442
625 Ga0501071_1614489 3300049587 Bacteria 501
626 Ga0501072_0192406 3300049588 Unclassified 1627
627 Ga0501072_0290973 3300049588 Bacteria 1299
628 Ga0501072_1113735 3300049588 Unclassified 614
629 Ga0501074_1284421 3300049590 Unclassified 513
630 Ga0501075_0040870 3300049591 Bacteria 3475
631 Ga0501075_0047523 3300049591 Bacteria 3225
632 Ga0501075_0068688 3300049591 Bacteria 2678
633 Ga0501075_0274771 3300049591 Bacteria 1284
634 Ga0501075_0336075 3300049591 Bacteria 1151
635 Ga0501076_0275666 3300049592 Bacteria 1378
636 Ga0501076_0281350 3300049592 Bacteria 1363
637 Ga0501076_0447731 3300049592 Bacteria 1063
638 Ga0501076_0469402 3300049592 Unclassified 1036
639 Ga0501077_0082459 3300049593 Bacteria 2038
640 Ga0501077_0089549 3300049593 Bacteria 1950
641 Ga0501077_0216671 3300049593 Bacteria 1217
642 Ga0501077_0729289 3300049593 Unclassified 637
643 Ga0501206_020076 3300049653 Bacteria 948
644 Ga0501209_131927 3300049656 Unclassified 746
645 Ga0501217_156755 3300049661 Unclassified 684
646 Ga0501217_331337 3300049661 Unclassified 509
647 Ga0501230_021571 3300049667 Bacteria 1130
648 Ga0501233_003818 3300049668 Bacteria 2731
649 Ga0501235_020905 3300049669 Bacteria 1453
650 Ga0501249_091286 3300049679 Unclassified 723
651 Ga0501253_032144 3300049683 Bacteria 1008
652 Ga0501260_003362 3300049689 Bacteria 1433
653 Ga0501261_026218 3300049690 Unclassified 861
654 Ga0501219_005770 3300049703 Unclassified 883
655 Ga0501229_014462 3300049706 Unclassified 1017
656 Ga0501079_0045000 3300049741 Bacteria 3407
657 Ga0501079_1014712 3300049741 Unclassified 654
658 Ga0501079_1402425 3300049741 Bacteria 550
659 Ga0501079_1647540 3300049741 Unclassified 505
660 Ga0501080_1003199 3300049742 Bacteria 724
661 Ga0501080_1358112 3300049742 Unclassified 607
662 Ga0501080_1664427 3300049742 Unclassified 539
663 Ga0501081_0234706 3300049743 Bacteria 1337
664 Ga0501081_0425208 3300049743 Bacteria 985
665 Ga0501081_1040655 3300049743 Bacteria 619
666 Ga0501265_072078 3300049762 Unclassified 585
667 Ga0501266_026730 3300049763 Unclassified 809
668 Ga0501271_043819 3300049768 Unclassified 590
669 Ga0501272_032630 3300049769 Bacteria 668
670 Ga0501273_092545 3300049770 Unclassified 516
671 Ga0501276_006317 3300049773 Unclassified 930
672 Ga0501279_043427 3300049775 Unclassified 696
673 Ga0501280_053797 3300049776 Unclassified 684
674 Ga0501281_08569 3300049777 Unclassified 716
675 Ga0501283_004428 3300049779 Bacteria 1899
676 Ga0501283_004543 3300049779 Bacteria 1881
677 Ga0501035_0809918 3300049822 Bacteria 748
678 Ga0501035_0841069 3300049822 Bacteria 731
679 Ga0501045_0519574 3300049824 Bacteria 884
680 Ga0501045_0803480 3300049824 Bacteria 693
681 Ga0501045_1319687 3300049824 Bacteria 525
682 Ga0501212_081802 3300049851 Unclassified 585
683 nmdc:mga05p37_134729_c1 3300050507 Bacteria 3030
684 nmdc:mga05p37_135081_c2 3300050507 Bacteria 2725
685 nmdc:mga05p37_136481_c1 3300050507 Unclassified 3008
686 nmdc:mga05p37_1387628_c1 3300050507 Unclassified 709
687 nmdc:mga05p37_145658_c1 3300050507 Bacteria 2901
688 nmdc:mga05p37_179730_c1 3300050507 Bacteria 2575
689 nmdc:mga05p37_201724_c1 3300050507 Bacteria 2408
690 nmdc:mga05p37_202684_c1 3300050507 Bacteria 2402
691 nmdc:mga05p37_2093548_c1 3300050507 Bacteria 531
692 nmdc:mga05p37_231660_c1 3300050507 Bacteria 2225
693 nmdc:mga05p37_314714_c1 3300050507 Bacteria 1854
694 nmdc:mga05p37_323056_c1 3300050507 Bacteria 1826
695 nmdc:mga05p37_32779_c1 3300050507 Bacteria 6356
696 nmdc:mga05p37_393924_c1 3300050507 Bacteria 1619
697 nmdc:mga05p37_405769_c1 3300050507 Unclassified 1590
698 nmdc:mga05p37_49008_c1 3300050507 Bacteria 5194
699 nmdc:mga05p37_50844_c1 3300050507 Bacteria 5097
700 nmdc:mga05p37_52220_c1 3300050507 Bacteria 5027
701 nmdc:mga05p37_545809_c1 3300050507 Bacteria 1321
702 nmdc:mga05p37_550686_c1 3300050507 Bacteria 1313
703 nmdc:mga05p37_609079_c1 3300050507 Bacteria 1231
704 nmdc:mga05p37_912703_c1 3300050507 Unclassified 945
705 nmdc:mga05p37_92103_c1 3300050507 Bacteria 3735
706 nmdc:mga05p37_993881_c1 3300050507 Unclassified 892
707 nmdc:mga09592_1113313_c1 3300050508 Unclassified 656
708 nmdc:mga09592_1164313_c1 3300050508 Unclassified 639
709 nmdc:mga09592_1193799_c1 3300050508 Unclassified 629
710 nmdc:mga09592_1353381_c1 3300050508 Bacteria 584
711 nmdc:mga09592_137997_c1 3300050508 Bacteria 2101
712 nmdc:mga09592_1555585_c1 3300050508 Unclassified 537
713 nmdc:mga09592_186148_c1 3300050508 Bacteria 1797
714 nmdc:mga09592_18945_c1 3300050508 Bacteria 5647
715 nmdc:mga09592_290521_c2 3300050508 Bacteria 621
716 nmdc:mga09592_322593_c1 3300050508 Unclassified 1338
717 nmdc:mga09592_331019_c1 3300050508 Unclassified 1319
718 nmdc:mga09592_556788_c1 3300050508 Bacteria 985
719 nmdc:mga09592_590815_c1 3300050508 Unclassified 952
720 nmdc:mga09592_639_c1 3300050508 Bacteria 26621
721 nmdc:mga09592_745033_c1 3300050508 Unclassified 832
722 nmdc:mga09592_82197_c1 3300050508 Bacteria 2745
723 nmdc:mga0qj67_1051448_c1 3300050509 Unclassified 637
724 nmdc:mga0qj67_1055249_c1 3300050509 Unclassified 636
725 nmdc:mga0qj67_1255643_c1 3300050509 Bacteria 575
726 nmdc:mga0qj67_1434475_c1 3300050509 Bacteria 532
727 nmdc:mga0qj67_159861_c1 3300050509 Bacteria 1829
728 nmdc:mga0qj67_2718_c1 3300050509 Bacteria 12680
729 nmdc:mga0qj67_4545_c1 3300050509 Bacteria 10054
730 nmdc:mga0qj67_624736_c1 3300050509 Unclassified 861
731 nmdc:mga0qj67_90121_c1 3300050509 Unclassified 2463
732 nmdc:mga0qj67_96471_c1 3300050509 Bacteria 2380
733 nmdc:mga06r32_1116398_c1 3300050510 Viruses 737
734 nmdc:mga06r32_1274011_c1 3300050510 Bacteria 680
735 nmdc:mga06r32_130201_c1 3300050510 Unclassified 2062
736 nmdc:mga06r32_1428985_c1 3300050510 Bacteria 633
737 nmdc:mga06r32_1467434_c1 3300050510 Bacteria 623
738 nmdc:mga06r32_29065_c1 3300050510 Bacteria 5177
739 nmdc:mga06r32_5095_c1 3300050510 Bacteria 11818
740 nmdc:mga06r32_543806_c1 3300050510 Bacteria 1136
741 nmdc:mga06r32_581912_c1 3300050510 Bacteria 1092
742 nmdc:mga06r32_604142_c1 3300050510 Bacteria 1068
743 nmdc:mga06r32_650721_c1 3300050510 Bacteria 1022
744 nmdc:mga06r32_698615_c1 3300050510 Bacteria 980
745 nmdc:mga06r32_742176_c1 3300050510 Unclassified 945
746 nmdc:mga06r32_771229_c1 3300050510 Unclassified 924
747 nmdc:mga06r32_925195_c1 3300050510 Unclassified 827
748 nmdc:mga08y16_1057315_c1 3300050511 Bacteria 789
749 nmdc:mga08y16_160828_c1 3300050511 Bacteria 2333
750 nmdc:mga08y16_1748466_c1 3300050511 Unclassified 576
751 nmdc:mga08y16_1916788_c1 3300050511 Unclassified 543
752 nmdc:mga08y16_23063_c1 3300050511 Bacteria 6571
753 nmdc:mga08y16_253154_c1 3300050511 Bacteria 1820
754 nmdc:mga08y16_253658_c1 3300050511 Bacteria 1818
755 nmdc:mga08y16_590497_c1 3300050511 Bacteria 1120
756 nmdc:mga0n895_1244982_c1 3300050512 Bacteria 717
757 nmdc:mga0n895_2032327_c1 3300050512 Unclassified 532
758 nmdc:mga0n895_226986_c1 3300050512 Bacteria 1896
759 nmdc:mga0n895_239822_c1 3300050512 Bacteria 1840
760 nmdc:mga0n895_358965_c1 3300050512 Bacteria 1476
761 nmdc:mga0n895_482369_c1 3300050512 Bacteria 1250
762 nmdc:mga0n895_611736_c1 3300050512 Bacteria 1091
763 nmdc:mga0n895_673787_c1 3300050512 Bacteria 1032
764 nmdc:mga0n895_726099_c1 3300050512 Bacteria 988
765 nmdc:mga0n895_7975_c1 3300050512 Bacteria 9132
766 nmdc:mga0n895_972033_c1 3300050512 Bacteria 831
767 nmdc:mga0n895_989502_c1 3300050512 Unclassified 823
768 nmdc:mga0n895_99107_c1 3300050512 Bacteria 2922
769 nmdc:mga0rr50_1731616_c1 3300050513 Bacteria 526
770 nmdc:mga0rr50_195324_c1 3300050513 Bacteria 1660
771 nmdc:mga0rr50_234067_c1 3300050513 Bacteria 1521
772 nmdc:mga0rr50_309030_c1 3300050513 Bacteria 1324
773 nmdc:mga0rr50_659_c1 3300050513 Bacteria 18530
774 nmdc:mga0rr50_935784_c1 3300050513 Bacteria 739
775 nmdc:mga08x19_187928_c1 3300050514 Bacteria 1412
776 nmdc:mga08x19_311529_c1 3300050514 Bacteria 1094
777 nmdc:mga08x19_45516_c1 3300050514 Bacteria 2804
778 nmdc:mga08x19_483799_c1 3300050514 Unclassified 873
779 nmdc:mga0a205_1038677_c1 3300050515 Unclassified 666
780 nmdc:mga0a205_123268_c1 3300050515 Bacteria 2491
781 nmdc:mga0a205_1233287_c1 3300050515 Unclassified 596
782 nmdc:mga0a205_140160_c1 3300050515 Bacteria 2319
783 nmdc:mga0a205_338398_c1 3300050515 Bacteria 1374
784 nmdc:mga0a205_35291_c1 3300050515 Bacteria 4801
785 nmdc:mga0a205_361_c1 3300050515 Bacteria 34318
786 nmdc:mga0a205_454776_c1 3300050515 Unclassified 1140
787 nmdc:mga0a205_46142_c2 3300050515 Bacteria 1052
788 nmdc:mga0a205_469668_c1 3300050515 Bacteria 1117
789 nmdc:mga0a205_541447_c1 3300050515 Bacteria 1020
790 nmdc:mga0a205_635039_c1 3300050515 Bacteria 919
791 nmdc:mga0a205_7044_c1 3300050515 Bacteria 10157
792 nmdc:mga0a205_92973_c1 3300050515 Bacteria 2914
793 Ga0500647_0337980 3300053091 Bacteria 631
794 Ga0501084_0349202 3300054114 Bacteria 1250
795 Ga0501084_0912633 3300054114 Unclassified 739
796 Ga0501084_1080816 3300054114 Unclassified 674
797 Ga0501084_1237462 3300054114 Bacteria 626
798 Ga0590075_035851 3300059424 Bacteria 1264
799 Ga0590075_177103 3300059424 Unclassified 564
800 Ga0587084_147291 3300059477 Bacteria 515
801 Ga0501082_0156966 3300060353 Unclassified 1977
802 Ga0501082_0400572 3300060353 Bacteria 1198
803 Ga0501082_1510686 3300060353 Unclassified 586
804 Ga0530510_0124959 3300061734 Bacteria 1891
805 Ga0530510_0575062 3300061734 Bacteria 856
806 Ga0530510_0741731 3300061734 Bacteria 749

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006846 Ga0075430_100804333 Ga0075430_1008043331 45
2 3300031548 Ga0307408_102320362 Ga0307408_1023203621 45
3 3300031911 Ga0307412_11926529 Ga0307412_119265292 45
4 3300050509 nmdc:mga0qj67_1255643_c1 nmdc:mga0qj67_1255643_c1_105_257 45
5 3300005444 Ga0070694_101867326 Ga0070694_1018673261 46
6 3300050512 nmdc:mga0n895_2032327_c1 nmdc:mga0n895_2032327_c1_35_175 46
7 3300013100 Ga0157373_11448723 Ga0157373_114487231 47
8 3300026088 Ga0207641_10159670 Ga0207641_101596702 47
9 3300005327 Ga0070658_10932872 Ga0070658_109328722 49
10 3300005328 Ga0070676_10757969 Ga0070676_107579692 49
11 3300005330 Ga0070690_100411240 Ga0070690_1004112402 49
12 3300005334 Ga0068869_100927541 Ga0068869_1009275411 49
13 3300005335 Ga0070666_10475435 Ga0070666_104754352 49
14 3300005340 Ga0070689_100494724 Ga0070689_1004947242 49
15 3300005340 Ga0070689_101476381 Ga0070689_1014763812 49
16 3300005343 Ga0070687_100762567 Ga0070687_1007625671 49
17 3300005344 Ga0070661_101771504 Ga0070661_1017715042 49
18 3300005353 Ga0070669_100019680 Ga0070669_1000196804 49
19 3300005354 Ga0070675_100029088 Ga0070675_1000290885 49
20 3300005355 Ga0070671_100130065 Ga0070671_1001300652 49
21 3300005355 Ga0070671_101600420 Ga0070671_1016004202 49
22 3300005356 Ga0070674_100199853 Ga0070674_1001998532 49
23 3300005364 Ga0070673_100002666 Ga0070673_10000266610 49
24 3300005364 Ga0070673_100069651 Ga0070673_1000696512 49
25 3300005364 Ga0070673_100089306 Ga0070673_1000893062 49
26 3300005365 Ga0070688_100153245 Ga0070688_1001532451 49
27 3300005366 Ga0070659_101624143 Ga0070659_1016241431 49
28 3300005367 Ga0070667_100183584 Ga0070667_1001835843 49
29 3300005367 Ga0070667_101176720 Ga0070667_1011767202 49
30 3300005441 Ga0070700_101253340 Ga0070700_1012533402 49
31 3300005456 Ga0070678_100801979 Ga0070678_1008019792 49
32 3300005456 Ga0070678_102093422 Ga0070678_1020934221 49
33 3300005457 Ga0070662_100662994 Ga0070662_1006629941 49
34 3300005468 Ga0070707_100632354 Ga0070707_1006323543 49
35 3300005468 Ga0070707_101185904 Ga0070707_1011859042 49
36 3300005471 Ga0070698_101148894 Ga0070698_1011488942 49
37 3300005518 Ga0070699_101161936 Ga0070699_1011619362 49
38 3300005535 Ga0070684_101016488 Ga0070684_1010164881 49
39 3300005535 Ga0070684_101218166 Ga0070684_1012181662 49
40 3300005543 Ga0070672_100029041 Ga0070672_1000290413 49
41 3300005543 Ga0070672_100184921 Ga0070672_1001849213 49
42 3300005544 Ga0070686_101372519 Ga0070686_1013725192 49
43 3300005547 Ga0070693_100706294 Ga0070693_1007062942 49
44 3300005615 Ga0070702_100086826 Ga0070702_1000868263 49
45 3300005617 Ga0068859_100117315 Ga0068859_1001173153 49
46 3300005617 Ga0068859_100178063 Ga0068859_1001780632 49
47 3300005618 Ga0068864_100808080 Ga0068864_1008080803 49
48 3300005618 Ga0068864_102346092 Ga0068864_1023460922 49
49 3300005719 Ga0068861_100052875 Ga0068861_1000528752 49
50 3300005842 Ga0068858_101206012 Ga0068858_1012060122 49
51 3300005844 Ga0068862_101544002 Ga0068862_1015440022 49
52 3300006881 Ga0068865_101043006 Ga0068865_1010430061 49
53 3300006931 Ga0097620_100117317 Ga0097620_1001173172 49
54 3300006931 Ga0097620_100178053 Ga0097620_1001780532 49
55 3300009094 Ga0111539_11473899 Ga0111539_114738992 49
56 3300009177 Ga0105248_10223054 Ga0105248_102230541 49
57 3300009177 Ga0105248_10364733 Ga0105248_103647332 49
58 3300009177 Ga0105248_11456340 Ga0105248_114563402 49
59 3300013308 Ga0157375_10247727 Ga0157375_102477273 49
60 3300014326 Ga0157380_10028062 Ga0157380_100280624 49
61 3300014326 Ga0157380_10597012 Ga0157380_105970122 49
62 3300014745 Ga0157377_10014033 Ga0157377_100140333 49
63 3300014969 Ga0157376_10959620 Ga0157376_109596201 49
64 3300025907 Ga0207645_10577425 Ga0207645_105774253 49
65 3300025917 Ga0207660_10770483 Ga0207660_107704832 49
66 3300025922 Ga0207646_11175456 Ga0207646_111754562 49
67 3300025923 Ga0207681_10267618 Ga0207681_102676182 49
68 3300025925 Ga0207650_10583585 Ga0207650_105835852 49
69 3300025926 Ga0207659_10069896 Ga0207659_100698963 49
70 3300025931 Ga0207644_10030659 Ga0207644_100306592 49
71 3300025932 Ga0207690_11255031 Ga0207690_112550312 49
72 3300025933 Ga0207706_10135695 Ga0207706_101356952 49
73 3300025938 Ga0207704_11367407 Ga0207704_113674071 49
74 3300025940 Ga0207691_10016009 Ga0207691_100160095 49
75 3300025940 Ga0207691_10255908 Ga0207691_102559083 49
76 3300025941 Ga0207711_10251537 Ga0207711_102515372 49
77 3300025941 Ga0207711_10474898 Ga0207711_104748983 49
78 3300025941 Ga0207711_11975395 Ga0207711_119753951 49
79 3300025942 Ga0207689_11221738 Ga0207689_112217381 49
80 3300025942 Ga0207689_11317704 Ga0207689_113177042 49
81 3300025960 Ga0207651_10033306 Ga0207651_100333063 49
82 3300025960 Ga0207651_10052560 Ga0207651_100525604 49
83 3300025960 Ga0207651_11342025 Ga0207651_113420251 49
84 3300025986 Ga0207658_11810880 Ga0207658_118108801 49
85 3300026023 Ga0207677_10280493 Ga0207677_102804933 49
86 3300026035 Ga0207703_10356353 Ga0207703_103563532 49
87 3300026075 Ga0207708_10316947 Ga0207708_103169473 49
88 3300026088 Ga0207641_11252878 Ga0207641_112528782 49
89 3300026089 Ga0207648_11150676 Ga0207648_111506762 49
90 3300026095 Ga0207676_11033927 Ga0207676_110339272 49
91 3300026118 Ga0207675_100364633 Ga0207675_1003646332 49
92 3300026121 Ga0207683_10169630 Ga0207683_101696303 49
93 3300028380 Ga0268265_11565388 Ga0268265_115653882 49
94 3300031824 Ga0307413_11215390 Ga0307413_112153901 49
95 3300031852 Ga0307410_10507054 Ga0307410_105070542 49
96 3300031903 Ga0307407_10438252 Ga0307407_104382522 49
97 3300031903 Ga0307407_10551922 Ga0307407_105519222 49
98 3300031995 Ga0307409_100561028 Ga0307409_1005610282 49
99 3300031995 Ga0307409_100969066 Ga0307409_1009690663 49
100 3300032002 Ga0307416_100562758 Ga0307416_1005627583 49
101 3300046684 Ga0495669_0149782 Ga0495669_0149782_202_366 49
102 3300047318 Ga0495636_0488785 Ga0495636_0488785_55_219 49
103 3300001990 JGI24737J22298_10247975 JGI24737J22298_102479751 50
104 3300003371 JGI26145J50221_1001561 JGI26145J50221_10015613 50
105 3300004798 Ga0058859_10071813 Ga0058859_100718133 50
106 3300004801 Ga0058860_10944608 Ga0058860_109446083 50
107 3300005289 Ga0065704_10654044 Ga0065704_106540441 50
108 3300005290 Ga0065712_10048009 Ga0065712_100480091 50
109 3300005293 Ga0065715_10407420 Ga0065715_104074201 50
110 3300005295 Ga0065707_10153166 Ga0065707_101531663 50
111 3300005329 Ga0070683_100112441 Ga0070683_1001124412 50
112 3300005330 Ga0070690_100119199 Ga0070690_1001191993 50
113 3300005330 Ga0070690_101189982 Ga0070690_1011899822 50
114 3300005331 Ga0070670_100735181 Ga0070670_1007351813 50
115 3300005333 Ga0070677_10536158 Ga0070677_105361582 50
116 3300005334 Ga0068869_100131138 Ga0068869_1001311383 50
117 3300005334 Ga0068869_101413723 Ga0068869_1014137232 50
118 3300005336 Ga0070680_100002059 Ga0070680_10000205914 50
119 3300005336 Ga0070680_100275657 Ga0070680_1002756572 50
120 3300005338 Ga0068868_100393531 Ga0068868_1003935311 50
121 3300005338 Ga0068868_100752100 Ga0068868_1007521002 50
122 3300005339 Ga0070660_100240370 Ga0070660_1002403702 50
123 3300005339 Ga0070660_100357290 Ga0070660_1003572902 50
124 3300005340 Ga0070689_100043834 Ga0070689_1000438343 50
125 3300005340 Ga0070689_101077864 Ga0070689_1010778642 50
126 3300005341 Ga0070691_10019602 Ga0070691_100196023 50
127 3300005341 Ga0070691_10113955 Ga0070691_101139552 50
128 3300005343 Ga0070687_100100597 Ga0070687_1001005973 50
129 3300005343 Ga0070687_101189531 Ga0070687_1011895312 50
130 3300005344 Ga0070661_100032523 Ga0070661_1000325234 50
131 3300005345 Ga0070692_10880169 Ga0070692_108801691 50
132 3300005347 Ga0070668_100045278 Ga0070668_1000452783 50
133 3300005347 Ga0070668_100075893 Ga0070668_1000758933 50
134 3300005353 Ga0070669_100079723 Ga0070669_1000797232 50
135 3300005353 Ga0070669_100557903 Ga0070669_1005579033 50
136 3300005354 Ga0070675_101158214 Ga0070675_1011582142 50
137 3300005356 Ga0070674_100031408 Ga0070674_1000314085 50
138 3300005356 Ga0070674_101305307 Ga0070674_1013053071 50
139 3300005364 Ga0070673_102145989 Ga0070673_1021459892 50
140 3300005365 Ga0070688_100024928 Ga0070688_1000249284 50
141 3300005366 Ga0070659_100041847 Ga0070659_1000418472 50
142 3300005367 Ga0070667_100957832 Ga0070667_1009578322 50
143 3300005435 Ga0070714_100254765 Ga0070714_1002547653 50
144 3300005438 Ga0070701_10196160 Ga0070701_101961602 50
145 3300005438 Ga0070701_10964533 Ga0070701_109645331 50
146 3300005439 Ga0070711_100082865 Ga0070711_1000828653 50
147 3300005440 Ga0070705_100308159 Ga0070705_1003081592 50
148 3300005440 Ga0070705_100545003 Ga0070705_1005450033 50
149 3300005441 Ga0070700_100025268 Ga0070700_1000252682 50
150 3300005441 Ga0070700_100270531 Ga0070700_1002705312 50
151 3300005441 Ga0070700_100865109 Ga0070700_1008651091 50
152 3300005444 Ga0070694_100031366 Ga0070694_1000313664 50
153 3300005445 Ga0070708_100221606 Ga0070708_1002216061 50
154 3300005445 Ga0070708_100238033 Ga0070708_1002380332 50
155 3300005445 Ga0070708_100555300 Ga0070708_1005553002 50
156 3300005445 Ga0070708_102218197 Ga0070708_1022181971 50
157 3300005455 Ga0070663_100074878 Ga0070663_1000748782 50
158 3300005455 Ga0070663_101166080 Ga0070663_1011660802 50
159 3300005456 Ga0070678_100158794 Ga0070678_1001587943 50
160 3300005457 Ga0070662_100245139 Ga0070662_1002451393 50
161 3300005457 Ga0070662_100282808 Ga0070662_1002828082 50
162 3300005458 Ga0070681_10000612 Ga0070681_1000061219 50
163 3300005458 Ga0070681_10006622 Ga0070681_1000662210 50
164 3300005458 Ga0070681_10044888 Ga0070681_100448884 50
165 3300005459 Ga0068867_100126336 Ga0068867_1001263362 50
166 3300005459 Ga0068867_100300830 Ga0068867_1003008302 50
167 3300005459 Ga0068867_100995593 Ga0068867_1009955933 50
168 3300005466 Ga0070685_11485602 Ga0070685_114856021 50
169 3300005467 Ga0070706_100072236 Ga0070706_1000722363 50
170 3300005467 Ga0070706_100078810 Ga0070706_1000788103 50
171 3300005467 Ga0070706_100183798 Ga0070706_1001837984 50
172 3300005467 Ga0070706_100387146 Ga0070706_1003871463 50
173 3300005467 Ga0070706_101411583 Ga0070706_1014115831 50
174 3300005467 Ga0070706_101799410 Ga0070706_1017994101 50
175 3300005468 Ga0070707_100290937 Ga0070707_1002909371 50
176 3300005471 Ga0070698_100003892 Ga0070698_10000389215 50
177 3300005471 Ga0070698_100012841 Ga0070698_1000128415 50
178 3300005471 Ga0070698_100436686 Ga0070698_1004366862 50
179 3300005471 Ga0070698_100882090 Ga0070698_1008820901 50
180 3300005471 Ga0070698_101725027 Ga0070698_1017250272 50
181 3300005471 Ga0070698_102169158 Ga0070698_1021691581 50
182 3300005518 Ga0070699_100017618 Ga0070699_1000176187 50
183 3300005518 Ga0070699_100023190 Ga0070699_1000231905 50
184 3300005518 Ga0070699_100697937 Ga0070699_1006979371 50
185 3300005530 Ga0070679_100009667 Ga0070679_10000966710 50
186 3300005530 Ga0070679_100839969 Ga0070679_1008399693 50
187 3300005530 Ga0070679_101916275 Ga0070679_1019162752 50
188 3300005536 Ga0070697_100008497 Ga0070697_1000084977 50
189 3300005536 Ga0070697_100236257 Ga0070697_1002362572 50
190 3300005536 Ga0070697_100257254 Ga0070697_1002572541 50
191 3300005536 Ga0070697_100700473 Ga0070697_1007004733 50
192 3300005536 Ga0070697_100855014 Ga0070697_1008550142 50
193 3300005536 Ga0070697_101134556 Ga0070697_1011345562 50
194 3300005536 Ga0070697_101414429 Ga0070697_1014144292 50
195 3300005536 Ga0070697_102130660 Ga0070697_1021306601 50
196 3300005539 Ga0068853_101272002 Ga0068853_1012720022 50
197 3300005543 Ga0070672_100112126 Ga0070672_1001121263 50
198 3300005543 Ga0070672_100191034 Ga0070672_1001910343 50
199 3300005544 Ga0070686_100276543 Ga0070686_1002765433 50
200 3300005544 Ga0070686_100308426 Ga0070686_1003084263 50
201 3300005544 Ga0070686_101791432 Ga0070686_1017914322 50
202 3300005545 Ga0070695_100195923 Ga0070695_1001959232 50
203 3300005546 Ga0070696_100002400 Ga0070696_1000024007 50
204 3300005546 Ga0070696_100273636 Ga0070696_1002736363 50
205 3300005546 Ga0070696_100523096 Ga0070696_1005230962 50
206 3300005546 Ga0070696_100661996 Ga0070696_1006619962 50
207 3300005546 Ga0070696_101157297 Ga0070696_1011572971 50
208 3300005547 Ga0070693_100105159 Ga0070693_1001051593 50
209 3300005548 Ga0070665_100162554 Ga0070665_1001625543 50
210 3300005549 Ga0070704_100032657 Ga0070704_1000326571 50
211 3300005549 Ga0070704_100434320 Ga0070704_1004343201 50
212 3300005549 Ga0070704_101422199 Ga0070704_1014221992 50
213 3300005549 Ga0070704_101856848 Ga0070704_1018568481 50
214 3300005563 Ga0068855_100033978 Ga0068855_1000339784 50
215 3300005577 Ga0068857_101057545 Ga0068857_1010575452 50
216 3300005577 Ga0068857_101712705 Ga0068857_1017127052 50
217 3300005577 Ga0068857_101945163 Ga0068857_1019451632 50
218 3300005578 Ga0068854_100116537 Ga0068854_1001165372 50
219 3300005578 Ga0068854_101063181 Ga0068854_1010631811 50
220 3300005578 Ga0068854_101348843 Ga0068854_1013488432 50
221 3300005578 Ga0068854_102010834 Ga0068854_1020108341 50
222 3300005614 Ga0068856_100109899 Ga0068856_1001098992 50
223 3300005615 Ga0070702_100176040 Ga0070702_1001760401 50
224 3300005615 Ga0070702_100655211 Ga0070702_1006552112 50
225 3300005615 Ga0070702_101168025 Ga0070702_1011680251 50
226 3300005616 Ga0068852_100629655 Ga0068852_1006296553 50
227 3300005617 Ga0068859_100139669 Ga0068859_1001396693 50
228 3300005617 Ga0068859_100416127 Ga0068859_1004161272 50
229 3300005617 Ga0068859_101884178 Ga0068859_1018841781 50
230 3300005718 Ga0068866_10165297 Ga0068866_101652972 50
231 3300005718 Ga0068866_10477348 Ga0068866_104773481 50
232 3300005719 Ga0068861_100244284 Ga0068861_1002442843 50
233 3300005719 Ga0068861_100626979 Ga0068861_1006269793 50
234 3300005719 Ga0068861_102346235 Ga0068861_1023462351 50
235 3300005840 Ga0068870_10173702 Ga0068870_101737021 50
236 3300005841 Ga0068863_100230024 Ga0068863_1002300242 50
237 3300005842 Ga0068858_100164009 Ga0068858_1001640092 50
238 3300005842 Ga0068858_100487806 Ga0068858_1004878062 50
239 3300005842 Ga0068858_100850576 Ga0068858_1008505763 50
240 3300005842 Ga0068858_101373868 Ga0068858_1013738682 50
241 3300005842 Ga0068858_102491653 Ga0068858_1024916532 50
242 3300005843 Ga0068860_100137552 Ga0068860_1001375523 50
243 3300005843 Ga0068860_100235307 Ga0068860_1002353073 50
244 3300005843 Ga0068860_100894598 Ga0068860_1008945983 50
245 3300005843 Ga0068860_101298612 Ga0068860_1012986122 50
246 3300005843 Ga0068860_102236194 Ga0068860_1022361941 50
247 3300005844 Ga0068862_100104397 Ga0068862_1001043972 50
248 3300005844 Ga0068862_100121605 Ga0068862_1001216053 50
249 3300005844 Ga0068862_101250191 Ga0068862_1012501912 50
250 3300005937 Ga0081455_10003374 Ga0081455_1000337410 50
251 3300005937 Ga0081455_10005104 Ga0081455_1000510416 50
252 3300005937 Ga0081455_10005732 Ga0081455_100057325 50
253 3300005937 Ga0081455_10165463 Ga0081455_101654632 50
254 3300005981 Ga0081538_10003359 Ga0081538_1000335912 50
255 3300005981 Ga0081538_10007871 Ga0081538_100078711 50
256 3300005981 Ga0081538_10025886 Ga0081538_100258865 50
257 3300005983 Ga0081540_1004479 Ga0081540_100447911 50
258 3300006058 Ga0075432_10032086 Ga0075432_100320862 50
259 3300006058 Ga0075432_10101768 Ga0075432_101017682 50
260 3300006058 Ga0075432_10572467 Ga0075432_105724672 50
261 3300006194 Ga0075427_10071128 Ga0075427_100711282 50
262 3300006237 Ga0097621_100100525 Ga0097621_1001005252 50
263 3300006237 Ga0097621_100501085 Ga0097621_1005010851 50
264 3300006358 Ga0068871_100124807 Ga0068871_1001248073 50
265 3300006844 Ga0075428_100002796 Ga0075428_10000279613 50
266 3300006844 Ga0075428_100016284 Ga0075428_1000162841 50
267 3300006844 Ga0075428_100078772 Ga0075428_1000787724 50
268 3300006844 Ga0075428_100091223 Ga0075428_1000912233 50
269 3300006844 Ga0075428_100109417 Ga0075428_1001094174 50
270 3300006844 Ga0075428_100221432 Ga0075428_1002214323 50
271 3300006844 Ga0075428_100264965 Ga0075428_1002649652 50
272 3300006844 Ga0075428_100401352 Ga0075428_1004013523 50
273 3300006844 Ga0075428_100465279 Ga0075428_1004652793 50
274 3300006844 Ga0075428_100566354 Ga0075428_1005663541 50
275 3300006844 Ga0075428_100746288 Ga0075428_1007462882 50
276 3300006844 Ga0075428_100780685 Ga0075428_1007806852 50
277 3300006844 Ga0075428_101092869 Ga0075428_1010928691 50
278 3300006844 Ga0075428_101729396 Ga0075428_1017293962 50
279 3300006846 Ga0075430_100003745 Ga0075430_1000037457 50
280 3300006846 Ga0075430_100008951 Ga0075430_1000089518 50
281 3300006846 Ga0075430_100036044 Ga0075430_1000360444 50
282 3300006846 Ga0075430_100062272 Ga0075430_1000622722 50
283 3300006846 Ga0075430_100079885 Ga0075430_1000798853 50
284 3300006846 Ga0075430_100150682 Ga0075430_1001506822 50
285 3300006846 Ga0075430_100170153 Ga0075430_1001701533 50
286 3300006846 Ga0075430_100285943 Ga0075430_1002859431 50
287 3300006847 Ga0075431_100005537 Ga0075431_10000553711 50
288 3300006847 Ga0075431_100034193 Ga0075431_1000341934 50
289 3300006847 Ga0075431_100042249 Ga0075431_1000422496 50
290 3300006847 Ga0075431_100239719 Ga0075431_1002397193 50
291 3300006847 Ga0075431_100245256 Ga0075431_1002452563 50
292 3300006847 Ga0075431_100332254 Ga0075431_1003322542 50
293 3300006847 Ga0075431_100435569 Ga0075431_1004355692 50
294 3300006847 Ga0075431_100789070 Ga0075431_1007890702 50
295 3300006847 Ga0075431_100897437 Ga0075431_1008974372 50
296 3300006847 Ga0075431_100976500 Ga0075431_1009765002 50
297 3300006847 Ga0075431_101344869 Ga0075431_1013448691 50
298 3300006847 Ga0075431_101656039 Ga0075431_1016560392 50
299 3300006852 Ga0075433_10001398 Ga0075433_100013984 50
300 3300006852 Ga0075433_10069168 Ga0075433_100691683 50
301 3300006852 Ga0075433_10113828 Ga0075433_101138283 50
302 3300006852 Ga0075433_10278156 Ga0075433_102781563 50
303 3300006852 Ga0075433_10307026 Ga0075433_103070262 50
304 3300006852 Ga0075433_10615978 Ga0075433_106159782 50
305 3300006852 Ga0075433_11289663 Ga0075433_112896632 50
306 3300006852 Ga0075433_11596206 Ga0075433_115962062 50
307 3300006852 Ga0075433_11612485 Ga0075433_116124852 50
308 3300006871 Ga0075434_100037785 Ga0075434_1000377854 50
309 3300006871 Ga0075434_100051110 Ga0075434_1000511104 50
310 3300006871 Ga0075434_100094512 Ga0075434_1000945123 50
311 3300006871 Ga0075434_100126059 Ga0075434_1001260593 50
312 3300006871 Ga0075434_100394669 Ga0075434_1003946693 50
313 3300006871 Ga0075434_100506720 Ga0075434_1005067202 50
314 3300006871 Ga0075434_100537724 Ga0075434_1005377241 50
315 3300006871 Ga0075434_100981995 Ga0075434_1009819951 50
316 3300006871 Ga0075434_101852546 Ga0075434_1018525461 50
317 3300006880 Ga0075429_100015697 Ga0075429_1000156978 50
318 3300006880 Ga0075429_100029066 Ga0075429_1000290666 50
319 3300006880 Ga0075429_100057299 Ga0075429_1000572993 50
320 3300006880 Ga0075429_100100865 Ga0075429_1001008653 50
321 3300006880 Ga0075429_100115496 Ga0075429_1001154962 50
322 3300006880 Ga0075429_100316672 Ga0075429_1003166722 50
323 3300006880 Ga0075429_100334401 Ga0075429_1003344013 50
324 3300006880 Ga0075429_100340108 Ga0075429_1003401081 50
325 3300006880 Ga0075429_100438749 Ga0075429_1004387493 50
326 3300006880 Ga0075429_100572330 Ga0075429_1005723302 50
327 3300006880 Ga0075429_100853910 Ga0075429_1008539102 50
328 3300006880 Ga0075429_100930617 Ga0075429_1009306171 50
329 3300006880 Ga0075429_100952181 Ga0075429_1009521812 50
330 3300006881 Ga0068865_100006629 Ga0068865_1000066297 50
331 3300006881 Ga0068865_100284233 Ga0068865_1002842332 50
332 3300006914 Ga0075436_100046776 Ga0075436_1000467764 50
333 3300006914 Ga0075436_100048127 Ga0075436_1000481275 50
334 3300006931 Ga0097620_100139667 Ga0097620_1001396672 50
335 3300006931 Ga0097620_100416110 Ga0097620_1004161102 50
336 3300006931 Ga0097620_101883779 Ga0097620_1018837791 50
337 3300007076 Ga0075435_100027752 Ga0075435_1000277521 50
338 3300007076 Ga0075435_100270730 Ga0075435_1002707303 50
339 3300007076 Ga0075435_100293944 Ga0075435_1002939443 50
340 3300007076 Ga0075435_100395860 Ga0075435_1003958603 50
341 3300007076 Ga0075435_100484658 Ga0075435_1004846582 50
342 3300007076 Ga0075435_101094569 Ga0075435_1010945692 50
343 3300007076 Ga0075435_101124038 Ga0075435_1011240382 50
344 3300007265 Ga0099794_10301156 Ga0099794_103011562 50
345 3300007265 Ga0099794_10441169 Ga0099794_104411692 50
346 3300009093 Ga0105240_10041272 Ga0105240_100412728 50
347 3300009093 Ga0105240_10162322 Ga0105240_101623223 50
348 3300009093 Ga0105240_10674163 Ga0105240_106741631 50
349 3300009094 Ga0111539_10020928 Ga0111539_100209283 50
350 3300009094 Ga0111539_10060788 Ga0111539_100607883 50
351 3300009094 Ga0111539_10178995 Ga0111539_101789951 50
352 3300009094 Ga0111539_10290129 Ga0111539_102901291 50
353 3300009094 Ga0111539_10702989 Ga0111539_107029892 50
354 3300009094 Ga0111539_10888374 Ga0111539_108883742 50
355 3300009094 Ga0111539_11189737 Ga0111539_111897372 50
356 3300009098 Ga0105245_12441907 Ga0105245_124419072 50
357 3300009101 Ga0105247_10454737 Ga0105247_104547372 50
358 3300009147 Ga0114129_10005952 Ga0114129_1000595215 50
359 3300009147 Ga0114129_10018701 Ga0114129_100187013 50
360 3300009147 Ga0114129_10059350 Ga0114129_100593503 50
361 3300009147 Ga0114129_10069903 Ga0114129_100699035 50
362 3300009147 Ga0114129_10085812 Ga0114129_100858127 50
363 3300009147 Ga0114129_10090670 Ga0114129_100906704 50
364 3300009147 Ga0114129_10111773 Ga0114129_101117733 50
365 3300009147 Ga0114129_10120706 Ga0114129_101207062 50
366 3300009147 Ga0114129_10145165 Ga0114129_101451653 50
367 3300009147 Ga0114129_10168844 Ga0114129_101688442 50
368 3300009147 Ga0114129_10315401 Ga0114129_103154013 50
369 3300009147 Ga0114129_10447922 Ga0114129_104479223 50
370 3300009147 Ga0114129_10489429 Ga0114129_104894294 50
371 3300009147 Ga0114129_10647811 Ga0114129_106478112 50
372 3300009147 Ga0114129_10737160 Ga0114129_107371603 50
373 3300009147 Ga0114129_10986572 Ga0114129_109865722 50
374 3300009147 Ga0114129_11031046 Ga0114129_110310461 50
375 3300009147 Ga0114129_11039326 Ga0114129_110393262 50
376 3300009147 Ga0114129_11058995 Ga0114129_110589951 50
377 3300009147 Ga0114129_11069671 Ga0114129_110696713 50
378 3300009147 Ga0114129_11123895 Ga0114129_111238951 50
379 3300009147 Ga0114129_11206821 Ga0114129_112068213 50
380 3300009147 Ga0114129_11253583 Ga0114129_112535833 50
381 3300009147 Ga0114129_11262640 Ga0114129_112626402 50
382 3300009147 Ga0114129_11362653 Ga0114129_113626531 50
383 3300009147 Ga0114129_11955566 Ga0114129_119555661 50
384 3300009147 Ga0114129_12269091 Ga0114129_122690912 50
385 3300009147 Ga0114129_13470155 Ga0114129_134701551 50
386 3300009148 Ga0105243_10027900 Ga0105243_100279003 50
387 3300009148 Ga0105243_10073463 Ga0105243_100734633 50
388 3300009148 Ga0105243_11501844 Ga0105243_115018442 50
389 3300009176 Ga0105242_10077507 Ga0105242_100775073 50
390 3300009176 Ga0105242_10303063 Ga0105242_103030632 50
391 3300009176 Ga0105242_10591692 Ga0105242_105916922 50
392 3300009177 Ga0105248_10020631 Ga0105248_100206317 50
393 3300009177 Ga0105248_11164825 Ga0105248_111648251 50
394 3300009545 Ga0105237_11025416 Ga0105237_110254161 50
395 3300009551 Ga0105238_10081375 Ga0105238_100813752 50
396 3300009553 Ga0105249_10414861 Ga0105249_104148612 50
397 3300009553 Ga0105249_10596642 Ga0105249_105966422 50
398 3300009553 Ga0105249_11329871 Ga0105249_113298712 50
399 3300009553 Ga0105249_13273966 Ga0105249_132739662 50
400 3300010375 Ga0105239_10091409 Ga0105239_100914094 50
401 3300011119 Ga0105246_11304842 Ga0105246_113048422 50
402 3300013100 Ga0157373_10139082 Ga0157373_101390823 50
403 3300013100 Ga0157373_10347100 Ga0157373_103471003 50
404 3300013102 Ga0157371_10839428 Ga0157371_108394282 50
405 3300013104 Ga0157370_10266267 Ga0157370_102662672 50
406 3300013105 Ga0157369_12308179 Ga0157369_123081791 50
407 3300013296 Ga0157374_10031675 Ga0157374_100316757 50
408 3300013296 Ga0157374_10101351 Ga0157374_101013514 50
409 3300013297 Ga0157378_10009886 Ga0157378_100098867 50
410 3300013297 Ga0157378_10073226 Ga0157378_100732263 50
411 3300013297 Ga0157378_10224203 Ga0157378_102242033 50
412 3300013297 Ga0157378_10280874 Ga0157378_102808743 50
413 3300013297 Ga0157378_11995504 Ga0157378_119955041 50
414 3300013306 Ga0163162_10036544 Ga0163162_100365445 50
415 3300013306 Ga0163162_10391041 Ga0163162_103910413 50
416 3300013306 Ga0163162_10468141 Ga0163162_104681413 50
417 3300013306 Ga0163162_13451638 Ga0163162_134516381 50
418 3300013307 Ga0157372_10150816 Ga0157372_101508163 50
419 3300013308 Ga0157375_11342646 Ga0157375_113426461 50
420 3300013308 Ga0157375_12360614 Ga0157375_123606142 50
421 3300013308 Ga0157375_12712092 Ga0157375_127120922 50
422 3300014325 Ga0163163_12316982 Ga0163163_123169821 50
423 3300014326 Ga0157380_10161018 Ga0157380_101610182 50
424 3300014326 Ga0157380_10463527 Ga0157380_104635273 50
425 3300014745 Ga0157377_10185475 Ga0157377_101854753 50
426 3300014745 Ga0157377_10383043 Ga0157377_103830432 50
427 3300014968 Ga0157379_10507094 Ga0157379_105070943 50
428 3300014968 Ga0157379_11377274 Ga0157379_113772742 50
429 3300014968 Ga0157379_11882101 Ga0157379_118821012 50
430 3300014969 Ga0157376_10024323 Ga0157376_100243233 50
431 3300017792 Ga0163161_10230912 Ga0163161_102309122 50
432 3300017792 Ga0163161_11464390 Ga0163161_114643902 50
433 3300025885 Ga0207653_10274061 Ga0207653_102740612 50
434 3300025899 Ga0207642_10200791 Ga0207642_102007913 50
435 3300025900 Ga0207710_10196771 Ga0207710_101967713 50
436 3300025903 Ga0207680_10262129 Ga0207680_102621292 50
437 3300025907 Ga0207645_10005980 Ga0207645_100059801 50
438 3300025908 Ga0207643_10153493 Ga0207643_101534933 50
439 3300025909 Ga0207705_10013097 Ga0207705_100130976 50
440 3300025910 Ga0207684_10035507 Ga0207684_100355074 50
441 3300025910 Ga0207684_10093628 Ga0207684_100936283 50
442 3300025910 Ga0207684_10100163 Ga0207684_101001632 50
443 3300025910 Ga0207684_10218856 Ga0207684_102188562 50
444 3300025910 Ga0207684_10245754 Ga0207684_102457542 50
445 3300025911 Ga0207654_10446534 Ga0207654_104465342 50
446 3300025912 Ga0207707_10001853 Ga0207707_1000185310 50
447 3300025912 Ga0207707_10094936 Ga0207707_100949363 50
448 3300025912 Ga0207707_10138781 Ga0207707_101387813 50
449 3300025913 Ga0207695_10192545 Ga0207695_101925451 50
450 3300025916 Ga0207663_10059039 Ga0207663_100590394 50
451 3300025917 Ga0207660_10007560 Ga0207660_100075607 50
452 3300025917 Ga0207660_10192201 Ga0207660_101922012 50
453 3300025917 Ga0207660_10247965 Ga0207660_102479652 50
454 3300025918 Ga0207662_10105303 Ga0207662_101053032 50
455 3300025918 Ga0207662_10213519 Ga0207662_102135192 50
456 3300025919 Ga0207657_10001811 Ga0207657_100018111 50
457 3300025919 Ga0207657_10129247 Ga0207657_101292472 50
458 3300025919 Ga0207657_10170326 Ga0207657_101703263 50
459 3300025920 Ga0207649_10608382 Ga0207649_106083822 50
460 3300025921 Ga0207652_10007191 Ga0207652_100071915 50
461 3300025921 Ga0207652_10318627 Ga0207652_103186272 50
462 3300025921 Ga0207652_10588075 Ga0207652_105880752 50
463 3300025922 Ga0207646_10253254 Ga0207646_102532542 50
464 3300025923 Ga0207681_10027143 Ga0207681_100271432 50
465 3300025923 Ga0207681_10307967 Ga0207681_103079673 50
466 3300025924 Ga0207694_10071363 Ga0207694_100713635 50
467 3300025925 Ga0207650_10031403 Ga0207650_100314031 50
468 3300025929 Ga0207664_11057657 Ga0207664_110576572 50
469 3300025931 Ga0207644_10342694 Ga0207644_103426942 50
470 3300025931 Ga0207644_10911170 Ga0207644_109111702 50
471 3300025931 Ga0207644_11705092 Ga0207644_117050922 50
472 3300025932 Ga0207690_10592929 Ga0207690_105929292 50
473 3300025933 Ga0207706_10004396 Ga0207706_1000439611 50
474 3300025933 Ga0207706_10006287 Ga0207706_100062874 50
475 3300025934 Ga0207686_10127937 Ga0207686_101279373 50
476 3300025935 Ga0207709_10077069 Ga0207709_100770693 50
477 3300025935 Ga0207709_11279589 Ga0207709_112795891 50
478 3300025935 Ga0207709_11788895 Ga0207709_117888952 50
479 3300025937 Ga0207669_10740531 Ga0207669_107405312 50
480 3300025937 Ga0207669_11696220 Ga0207669_116962202 50
481 3300025938 Ga0207704_10003039 Ga0207704_100030394 50
482 3300025940 Ga0207691_10008091 Ga0207691_1000809111 50
483 3300025940 Ga0207691_10203055 Ga0207691_102030552 50
484 3300025940 Ga0207691_11584994 Ga0207691_115849941 50
485 3300025941 Ga0207711_10741307 Ga0207711_107413072 50
486 3300025941 Ga0207711_11553490 Ga0207711_115534902 50
487 3300025942 Ga0207689_10007800 Ga0207689_1000780011 50
488 3300025942 Ga0207689_11709149 Ga0207689_117091491 50
489 3300025944 Ga0207661_10105383 Ga0207661_101053834 50
490 3300025944 Ga0207661_11118754 Ga0207661_111187542 50
491 3300025945 Ga0207679_10066283 Ga0207679_100662831 50
492 3300025945 Ga0207679_10533558 Ga0207679_105335583 50
493 3300025949 Ga0207667_10028912 Ga0207667_100289123 50
494 3300025960 Ga0207651_10217962 Ga0207651_102179623 50
495 3300025960 Ga0207651_10349858 Ga0207651_103498583 50
496 3300025960 Ga0207651_10473454 Ga0207651_104734543 50
497 3300025961 Ga0207712_10019630 Ga0207712_100196304 50
498 3300025961 Ga0207712_10382695 Ga0207712_103826952 50
499 3300025972 Ga0207668_10145186 Ga0207668_101451863 50
500 3300025972 Ga0207668_10145661 Ga0207668_101456611 50
501 3300025981 Ga0207640_10015236 Ga0207640_100152363 50
502 3300025981 Ga0207640_10055844 Ga0207640_100558442 50
503 3300025981 Ga0207640_10525755 Ga0207640_105257552 50
504 3300026023 Ga0207677_10199772 Ga0207677_101997723 50
505 3300026035 Ga0207703_10896009 Ga0207703_108960092 50
506 3300026035 Ga0207703_11459870 Ga0207703_114598702 50
507 3300026075 Ga0207708_10002116 Ga0207708_1000211612 50
508 3300026078 Ga0207702_10334611 Ga0207702_103346112 50
509 3300026088 Ga0207641_10929371 Ga0207641_109293711 50
510 3300026089 Ga0207648_10000971 Ga0207648_1000097132 50
511 3300026089 Ga0207648_10396934 Ga0207648_103969341 50
512 3300026095 Ga0207676_11977322 Ga0207676_119773221 50
513 3300026116 Ga0207674_10340583 Ga0207674_103405833 50
514 3300026116 Ga0207674_11455612 Ga0207674_114556122 50
515 3300026118 Ga0207675_100029601 Ga0207675_1000296015 50
516 3300026118 Ga0207675_100211591 Ga0207675_1002115913 50
517 3300026118 Ga0207675_101012175 Ga0207675_1010121752 50
518 3300026121 Ga0207683_10002617 Ga0207683_1000261719 50
519 3300026142 Ga0207698_10849701 Ga0207698_108497011 50
520 3300027360 Ga0209969_1000761 Ga0209969_10007614 50
521 3300027364 Ga0209967_1001515 Ga0209967_10015154 50
522 3300027378 Ga0209981_1000933 Ga0209981_10009333 50
523 3300027395 Ga0209996_1000443 Ga0209996_10004433 50
524 3300027395 Ga0209996_1053866 Ga0209996_10538661 50
525 3300027424 Ga0209984_1000288 Ga0209984_10002882 50
526 3300027462 Ga0210000_1000168 Ga0210000_10001687 50
527 3300027471 Ga0209995_1024174 Ga0209995_10241742 50
528 3300027526 Ga0209968_1000142 Ga0209968_10001427 50
529 3300027526 Ga0209968_1015903 Ga0209968_10159033 50
530 3300027543 Ga0209999_1003539 Ga0209999_10035393 50
531 3300027552 Ga0209982_1000124 Ga0209982_10001244 50
532 3300027614 Ga0209970_1001779 Ga0209970_10017793 50
533 3300027617 Ga0210002_1000032 Ga0210002_100003223 50
534 3300027682 Ga0209971_1003221 Ga0209971_10032213 50
535 3300027695 Ga0209966_1000451 Ga0209966_10004514 50
536 3300027876 Ga0209974_10000674 Ga0209974_100006744 50
537 3300027876 Ga0209974_10101986 Ga0209974_101019863 50
538 3300027876 Ga0209974_10216048 Ga0209974_102160481 50
539 3300027907 Ga0207428_10121154 Ga0207428_101211542 50
540 3300027907 Ga0207428_10534782 Ga0207428_105347822 50
541 3300027907 Ga0207428_10665786 Ga0207428_106657862 50
542 3300028380 Ga0268265_10066606 Ga0268265_100666064 50
543 3300028380 Ga0268265_11024627 Ga0268265_110246272 50
544 3300028380 Ga0268265_11124903 Ga0268265_111249032 50
545 3300028381 Ga0268264_10113987 Ga0268264_101139873 50
546 3300028381 Ga0268264_10525700 Ga0268264_105257003 50
547 3300028381 Ga0268264_10593189 Ga0268264_105931892 50
548 3300028381 Ga0268264_11380669 Ga0268264_113806691 50
549 3300031456 Ga0307513_10478142 Ga0307513_104781422 50
550 3300031548 Ga0307408_101179431 Ga0307408_1011794312 50
551 3300031824 Ga0307413_10532301 Ga0307413_105323012 50
552 3300031911 Ga0307412_11643733 Ga0307412_116437332 50
553 3300031995 Ga0307409_100479462 Ga0307409_1004794621 50
554 3300032002 Ga0307416_101751564 Ga0307416_1017515642 50
555 3300032004 Ga0307414_10870171 Ga0307414_108701712 50
556 3300032005 Ga0307411_10125104 Ga0307411_101251043 50
557 3300032005 Ga0307411_11667166 Ga0307411_116671662 50
558 3300035092 Ga0373952_0126114 Ga0373952_0126114_192_344 50
559 3300035241 Ga0373961_0217632 Ga0373961_0217632_216_368 50
560 3300035691 Ga0373931_0223976 Ga0373931_0223976_869_1021 50
561 3300041463 Ga0451804_0682386 Ga0451804_0682386_176_328 50
562 3300041496 Ga0451839_1028224 Ga0451839_1028224_1063_1215 50
563 3300042003 Ga0439443_122779 Ga0439443_122779_326_478 50
564 3300042010 Ga0439452_036385 Ga0439452_036385_982_1134 50
565 3300042012 Ga0439455_0208547 Ga0439455_0208547_254_406 50
566 3300042436 Ga0439435_0116623 Ga0439435_0116623_67_219 50
567 3300042461 Ga0439460_0013298 Ga0439460_0013298_1804_1956 50
568 3300044673 Ga0453683_0368198 Ga0453683_0368198_562_714 50
569 3300045051 Ga0451576_0141115 Ga0451576_0141115_280_432 50
570 3300045051 Ga0451576_1218775 Ga0451576_1218775_433_585 50
571 3300045051 Ga0451576_1814643 Ga0451576_1814643_411_563 50
572 3300045051 Ga0451576_2213190 Ga0451576_2213190_346_498 50
573 3300045976 Ga0466967_0248470 Ga0466967_0248470_639_791 50
574 3300045976 Ga0466967_0602113 Ga0466967_0602113_371_523 50
575 3300046462 Ga0495651_0773283 Ga0495651_0773283_156_308 50
576 3300046472 Ga0495580_0277214 Ga0495580_0277214_675_827 50
577 3300046499 Ga0495594_0109102 Ga0495594_0109102_706_858 50
578 3300046557 Ga0495622_0290316 Ga0495622_0290316_183_335 50
579 3300046663 Ga0495635_0273624 Ga0495635_0273624_62_214 50
580 3300046684 Ga0495669_0097567 Ga0495669_0097567_613_765 50
581 3300047318 Ga0495636_0153379 Ga0495636_0153379_419_571 50
582 3300047318 Ga0495636_0251204 Ga0495636_0251204_373_525 50
583 3300048910 Ga0496107_1185333 Ga0496107_1185333_370_522 50
584 3300048911 Ga0496108_0363127 Ga0496108_0363127_417_569 50
585 3300048912 Ga0496109_2063592 Ga0496109_2063592_222_374 50
586 3300049128 Ga0501308_042964 Ga0501308_042964_368_520 50
587 3300049129 Ga0501309_030012 Ga0501309_030012_347_499 50
588 3300049514 Ga0501291_027180 Ga0501291_027180_100_252 50
589 3300049514 Ga0501291_150631 Ga0501291_150631_346_498 50
590 3300049515 Ga0501292_012798 Ga0501292_012798_1042_1194 50
591 3300049520 Ga0501297_007146 Ga0501297_007146_814_966 50
592 3300049521 Ga0501298_007475 Ga0501298_007475_1448_1600 50
593 3300049522 Ga0501299_046582 Ga0501299_046582_311_463 50
594 3300049522 Ga0501299_054238 Ga0501299_054238_565_717 50
595 3300049523 Ga0501300_010301 Ga0501300_010301_287_439 50
596 3300049524 Ga0501301_046108 Ga0501301_046108_12_164 50
597 3300049528 Ga0501312_054022 Ga0501312_054022_512_664 50
598 3300049532 Ga0501316_057555 Ga0501316_057555_98_250 50
599 3300049541 Ga0501325_045027 Ga0501325_045027_104_256 50
600 3300049570 Ga0501033_0711916 Ga0501033_0711916_348_500 50
601 3300049572 Ga0501036_0298082 Ga0501036_0298082_652_804 50
602 3300049572 Ga0501036_1112489 Ga0501036_1112489_31_183 50
603 3300049572 Ga0501036_1391954 Ga0501036_1391954_109_261 50
604 3300049573 Ga0501037_0672638 Ga0501037_0672638_462_614 50
605 3300049574 Ga0501038_0544123 Ga0501038_0544123_654_806 50
606 3300049574 Ga0501038_0800968 Ga0501038_0800968_15_167 50
607 3300049575 Ga0501039_0266690 Ga0501039_0266690_238_390 50
608 3300049575 Ga0501039_0288264 Ga0501039_0288264_718_870 50
609 3300049575 Ga0501039_0446086 Ga0501039_0446086_18_170 50
610 3300049575 Ga0501039_0872042 Ga0501039_0872042_76_228 50
611 3300049576 Ga0501040_0316662 Ga0501040_0316662_942_1094 50
612 3300049576 Ga0501040_0473941 Ga0501040_0473941_460_612 50
613 3300049577 Ga0501041_0485039 Ga0501041_0485039_25_177 50
614 3300049577 Ga0501041_0501239 Ga0501041_0501239_257_409 50
615 3300049577 Ga0501041_1010942 Ga0501041_1010942_24_176 50
616 3300049578 Ga0501042_0216155 Ga0501042_0216155_988_1149 50
617 3300049578 Ga0501042_0258918 Ga0501042_0258918_215_367 50
618 3300049578 Ga0501042_0398607 Ga0501042_0398607_132_284 50
619 3300049578 Ga0501042_0768036 Ga0501042_0768036_59_211 50
620 3300049578 Ga0501042_1403916 Ga0501042_1403916_157_309 50
621 3300049580 Ga0501046_0788146 Ga0501046_0788146_175_327 50
622 3300049583 Ga0501067_0131716 Ga0501067_0131716_618_770 50
623 3300049584 Ga0501068_0060454 Ga0501068_0060454_572_724 50
624 3300049584 Ga0501068_1145828 Ga0501068_1145828_344_496 50
625 3300049585 Ga0501069_0166196 Ga0501069_0166196_1004_1156 50
626 3300049587 Ga0501071_0076663 Ga0501071_0076663_259_411 50
627 3300049587 Ga0501071_1614489 Ga0501071_1614489_241_393 50
628 3300049588 Ga0501072_0192406 Ga0501072_0192406_872_1024 50
629 3300049588 Ga0501072_0290973 Ga0501072_0290973_685_837 50
630 3300049588 Ga0501072_1113735 Ga0501072_1113735_258_410 50
631 3300049590 Ga0501074_1284421 Ga0501074_1284421_23_175 50
632 3300049591 Ga0501075_0040870 Ga0501075_0040870_37_189 50
633 3300049591 Ga0501075_0047523 Ga0501075_0047523_89_241 50
634 3300049591 Ga0501075_0068688 Ga0501075_0068688_272_424 50
635 3300049591 Ga0501075_0274771 Ga0501075_0274771_371_523 50
636 3300049591 Ga0501075_0336075 Ga0501075_0336075_658_810 50
637 3300049592 Ga0501076_0275666 Ga0501076_0275666_684_836 50
638 3300049592 Ga0501076_0281350 Ga0501076_0281350_349_510 50
639 3300049592 Ga0501076_0447731 Ga0501076_0447731_35_187 50
640 3300049592 Ga0501076_0469402 Ga0501076_0469402_462_614 50
641 3300049593 Ga0501077_0082459 Ga0501077_0082459_48_209 50
642 3300049593 Ga0501077_0089549 Ga0501077_0089549_1722_1874 50
643 3300049593 Ga0501077_0216671 Ga0501077_0216671_556_708 50
644 3300049593 Ga0501077_0729289 Ga0501077_0729289_343_495 50
645 3300049653 Ga0501206_020076 Ga0501206_020076_722_874 50
646 3300049656 Ga0501209_131927 Ga0501209_131927_38_190 50
647 3300049661 Ga0501217_156755 Ga0501217_156755_196_348 50
648 3300049661 Ga0501217_331337 Ga0501217_331337_103_255 50
649 3300049667 Ga0501230_021571 Ga0501230_021571_814_966 50
650 3300049668 Ga0501233_003818 Ga0501233_003818_792_944 50
651 3300049669 Ga0501235_020905 Ga0501235_020905_64_216 50
652 3300049679 Ga0501249_091286 Ga0501249_091286_399_551 50
653 3300049683 Ga0501253_032144 Ga0501253_032144_193_345 50
654 3300049689 Ga0501260_003362 Ga0501260_003362_225_377 50
655 3300049690 Ga0501261_026218 Ga0501261_026218_222_374 50
656 3300049703 Ga0501219_005770 Ga0501219_005770_694_846 50
657 3300049706 Ga0501229_014462 Ga0501229_014462_159_311 50
658 3300049741 Ga0501079_0045000 Ga0501079_0045000_472_624 50
659 3300049741 Ga0501079_1014712 Ga0501079_1014712_479_631 50
660 3300049741 Ga0501079_1402425 Ga0501079_1402425_278_430 50
661 3300049741 Ga0501079_1647540 Ga0501079_1647540_74_226 50
662 3300049742 Ga0501080_1003199 Ga0501080_1003199_207_359 50
663 3300049742 Ga0501080_1358112 Ga0501080_1358112_250_402 50
664 3300049742 Ga0501080_1664427 Ga0501080_1664427_157_309 50
665 3300049743 Ga0501081_0234706 Ga0501081_0234706_1172_1324 50
666 3300049743 Ga0501081_0425208 Ga0501081_0425208_198_359 50
667 3300049743 Ga0501081_1040655 Ga0501081_1040655_186_338 50
668 3300049762 Ga0501265_072078 Ga0501265_072078_288_440 50
669 3300049763 Ga0501266_026730 Ga0501266_026730_508_660 50
670 3300049768 Ga0501271_043819 Ga0501271_043819_207_359 50
671 3300049769 Ga0501272_032630 Ga0501272_032630_427_579 50
672 3300049770 Ga0501273_092545 Ga0501273_092545_240_392 50
673 3300049773 Ga0501276_006317 Ga0501276_006317_504_656 50
674 3300049775 Ga0501279_043427 Ga0501279_043427_413_565 50
675 3300049776 Ga0501280_053797 Ga0501280_053797_430_582 50
676 3300049777 Ga0501281_08569 Ga0501281_08569_202_354 50
677 3300049779 Ga0501283_004428 Ga0501283_004428_851_1003 50
678 3300049779 Ga0501283_004543 Ga0501283_004543_375_527 50
679 3300049822 Ga0501035_0809918 Ga0501035_0809918_561_713 50
680 3300049822 Ga0501035_0841069 Ga0501035_0841069_19_171 50
681 3300049824 Ga0501045_0519574 Ga0501045_0519574_124_285 50
682 3300049824 Ga0501045_0803480 Ga0501045_0803480_291_443 50
683 3300049824 Ga0501045_1319687 Ga0501045_1319687_351_503 50
684 3300049851 Ga0501212_081802 Ga0501212_081802_284_436 50
685 3300050507 nmdc:mga05p37_134729_c1 nmdc:mga05p37_134729_c1_2293_2445 50
686 3300050507 nmdc:mga05p37_135081_c2 nmdc:mga05p37_135081_c2_1508_1660 50
687 3300050507 nmdc:mga05p37_136481_c1 nmdc:mga05p37_136481_c1_2666_2818 50
688 3300050507 nmdc:mga05p37_1387628_c1 nmdc:mga05p37_1387628_c1_103_255 50
689 3300050507 nmdc:mga05p37_145658_c1 nmdc:mga05p37_145658_c1_1456_1608 50
690 3300050507 nmdc:mga05p37_179730_c1 nmdc:mga05p37_179730_c1_1438_1590 50
691 3300050507 nmdc:mga05p37_201724_c1 nmdc:mga05p37_201724_c1_1962_2114 50
692 3300050507 nmdc:mga05p37_202684_c1 nmdc:mga05p37_202684_c1_1635_1787 50
693 3300050507 nmdc:mga05p37_2093548_c1 nmdc:mga05p37_2093548_c1_354_506 50
694 3300050507 nmdc:mga05p37_231660_c1 nmdc:mga05p37_231660_c1_1457_1609 50
695 3300050507 nmdc:mga05p37_314714_c1 nmdc:mga05p37_314714_c1_145_297 50
696 3300050507 nmdc:mga05p37_323056_c1 nmdc:mga05p37_323056_c1_829_981 50
697 3300050507 nmdc:mga05p37_32779_c1 nmdc:mga05p37_32779_c1_1431_1583 50
698 3300050507 nmdc:mga05p37_393924_c1 nmdc:mga05p37_393924_c1_947_1099 50
699 3300050507 nmdc:mga05p37_405769_c1 nmdc:mga05p37_405769_c1_800_952 50
700 3300050507 nmdc:mga05p37_49008_c1 nmdc:mga05p37_49008_c1_3988_4140 50
701 3300050507 nmdc:mga05p37_50844_c1 nmdc:mga05p37_50844_c1_4317_4469 50
702 3300050507 nmdc:mga05p37_52220_c1 nmdc:mga05p37_52220_c1_4850_5002 50
703 3300050507 nmdc:mga05p37_545809_c1 nmdc:mga05p37_545809_c1_629_781 50
704 3300050507 nmdc:mga05p37_550686_c1 nmdc:mga05p37_550686_c1_318_470 50
705 3300050507 nmdc:mga05p37_609079_c1 nmdc:mga05p37_609079_c1_556_708 50
706 3300050507 nmdc:mga05p37_912703_c1 nmdc:mga05p37_912703_c1_121_273 50
707 3300050507 nmdc:mga05p37_92103_c1 nmdc:mga05p37_92103_c1_1303_1455 50
708 3300050507 nmdc:mga05p37_993881_c1 nmdc:mga05p37_993881_c1_546_698 50
709 3300050508 nmdc:mga09592_1113313_c1 nmdc:mga09592_1113313_c1_101_253 50
710 3300050508 nmdc:mga09592_1164313_c1 nmdc:mga09592_1164313_c1_285_443 50
711 3300050508 nmdc:mga09592_1193799_c1 nmdc:mga09592_1193799_c1_254_406 50
712 3300050508 nmdc:mga09592_1353381_c1 nmdc:mga09592_1353381_c1_306_458 50
713 3300050508 nmdc:mga09592_137997_c1 nmdc:mga09592_137997_c1_1426_1587 50
714 3300050508 nmdc:mga09592_1555585_c1 nmdc:mga09592_1555585_c1_210_362 50
715 3300050508 nmdc:mga09592_186148_c1 nmdc:mga09592_186148_c1_16_168 50
716 3300050508 nmdc:mga09592_18945_c1 nmdc:mga09592_18945_c1_2304_2456 50
717 3300050508 nmdc:mga09592_290521_c2 nmdc:mga09592_290521_c2_183_335 50
718 3300050508 nmdc:mga09592_322593_c1 nmdc:mga09592_322593_c1_634_786 50
719 3300050508 nmdc:mga09592_331019_c1 nmdc:mga09592_331019_c1_297_449 50
720 3300050508 nmdc:mga09592_556788_c1 nmdc:mga09592_556788_c1_113_265 50
721 3300050508 nmdc:mga09592_590815_c1 nmdc:mga09592_590815_c1_162_314 50
722 3300050508 nmdc:mga09592_639_c1 nmdc:mga09592_639_c1_12438_12590 50
723 3300050508 nmdc:mga09592_745033_c1 nmdc:mga09592_745033_c1_501_653 50
724 3300050508 nmdc:mga09592_82197_c1 nmdc:mga09592_82197_c1_581_733 50
725 3300050509 nmdc:mga0qj67_1051448_c1 nmdc:mga0qj67_1051448_c1_103_255 50
726 3300050509 nmdc:mga0qj67_1055249_c1 nmdc:mga0qj67_1055249_c1_248_400 50
727 3300050509 nmdc:mga0qj67_1434475_c1 nmdc:mga0qj67_1434475_c1_203_355 50
728 3300050509 nmdc:mga0qj67_159861_c1 nmdc:mga0qj67_159861_c1_1254_1406 50
729 3300050509 nmdc:mga0qj67_2718_c1 nmdc:mga0qj67_2718_c1_5747_5899 50
730 3300050509 nmdc:mga0qj67_4545_c1 nmdc:mga0qj67_4545_c1_9850_10002 50
731 3300050509 nmdc:mga0qj67_624736_c1 nmdc:mga0qj67_624736_c1_604_756 50
732 3300050509 nmdc:mga0qj67_90121_c1 nmdc:mga0qj67_90121_c1_1712_1864 50
733 3300050509 nmdc:mga0qj67_96471_c1 nmdc:mga0qj67_96471_c1_1010_1162 50
734 3300050510 nmdc:mga06r32_1116398_c1 nmdc:mga06r32_1116398_c1_122_274 50
735 3300050510 nmdc:mga06r32_1274011_c1 nmdc:mga06r32_1274011_c1_509_661 50
736 3300050510 nmdc:mga06r32_130201_c1 nmdc:mga06r32_130201_c1_1677_1829 50
737 3300050510 nmdc:mga06r32_1428985_c1 nmdc:mga06r32_1428985_c1_298_450 50
738 3300050510 nmdc:mga06r32_1467434_c1 nmdc:mga06r32_1467434_c1_352_504 50
739 3300050510 nmdc:mga06r32_29065_c1 nmdc:mga06r32_29065_c1_4004_4156 50
740 3300050510 nmdc:mga06r32_5095_c1 nmdc:mga06r32_5095_c1_8182_8334 50
741 3300050510 nmdc:mga06r32_543806_c1 nmdc:mga06r32_543806_c1_469_621 50
742 3300050510 nmdc:mga06r32_581912_c1 nmdc:mga06r32_581912_c1_867_1019 50
743 3300050510 nmdc:mga06r32_604142_c1 nmdc:mga06r32_604142_c1_582_734 50
744 3300050510 nmdc:mga06r32_650721_c1 nmdc:mga06r32_650721_c1_481_633 50
745 3300050510 nmdc:mga06r32_698615_c1 nmdc:mga06r32_698615_c1_335_487 50
746 3300050510 nmdc:mga06r32_742176_c1 nmdc:mga06r32_742176_c1_479_631 50
747 3300050510 nmdc:mga06r32_771229_c1 nmdc:mga06r32_771229_c1_458_610 50
748 3300050510 nmdc:mga06r32_925195_c1 nmdc:mga06r32_925195_c1_640_792 50
749 3300050511 nmdc:mga08y16_1057315_c1 nmdc:mga08y16_1057315_c1_128_280 50
750 3300050511 nmdc:mga08y16_160828_c1 nmdc:mga08y16_160828_c1_73_225 50
751 3300050511 nmdc:mga08y16_1748466_c1 nmdc:mga08y16_1748466_c1_303_455 50
752 3300050511 nmdc:mga08y16_1916788_c1 nmdc:mga08y16_1916788_c1_266_418 50
753 3300050511 nmdc:mga08y16_23063_c1 nmdc:mga08y16_23063_c1_3878_4030 50
754 3300050511 nmdc:mga08y16_253154_c1 nmdc:mga08y16_253154_c1_480_632 50
755 3300050511 nmdc:mga08y16_253658_c1 nmdc:mga08y16_253658_c1_292_444 50
756 3300050511 nmdc:mga08y16_590497_c1 nmdc:mga08y16_590497_c1_124_276 50
757 3300050512 nmdc:mga0n895_1244982_c1 nmdc:mga0n895_1244982_c1_297_449 50
758 3300050512 nmdc:mga0n895_226986_c1 nmdc:mga0n895_226986_c1_1277_1429 50
759 3300050512 nmdc:mga0n895_239822_c1 nmdc:mga0n895_239822_c1_23_175 50
760 3300050512 nmdc:mga0n895_358965_c1 nmdc:mga0n895_358965_c1_785_937 50
761 3300050512 nmdc:mga0n895_482369_c1 nmdc:mga0n895_482369_c1_446_598 50
762 3300050512 nmdc:mga0n895_611736_c1 nmdc:mga0n895_611736_c1_747_899 50
763 3300050512 nmdc:mga0n895_673787_c1 nmdc:mga0n895_673787_c1_708_860 50
764 3300050512 nmdc:mga0n895_726099_c1 nmdc:mga0n895_726099_c1_70_222 50
765 3300050512 nmdc:mga0n895_7975_c1 nmdc:mga0n895_7975_c1_6837_6989 50
766 3300050512 nmdc:mga0n895_972033_c1 nmdc:mga0n895_972033_c1_511_663 50
767 3300050512 nmdc:mga0n895_989502_c1 nmdc:mga0n895_989502_c1_153_305 50
768 3300050512 nmdc:mga0n895_99107_c1 nmdc:mga0n895_99107_c1_59_211 50
769 3300050513 nmdc:mga0rr50_1731616_c1 nmdc:mga0rr50_1731616_c1_328_480 50
770 3300050513 nmdc:mga0rr50_195324_c1 nmdc:mga0rr50_195324_c1_1025_1177 50
771 3300050513 nmdc:mga0rr50_234067_c1 nmdc:mga0rr50_234067_c1_1088_1240 50
772 3300050513 nmdc:mga0rr50_309030_c1 nmdc:mga0rr50_309030_c1_91_243 50
773 3300050513 nmdc:mga0rr50_659_c1 nmdc:mga0rr50_659_c1_8971_9123 50
774 3300050513 nmdc:mga0rr50_935784_c1 nmdc:mga0rr50_935784_c1_376_528 50
775 3300050514 nmdc:mga08x19_187928_c1 nmdc:mga08x19_187928_c1_642_794 50
776 3300050514 nmdc:mga08x19_311529_c1 nmdc:mga08x19_311529_c1_251_403 50
777 3300050514 nmdc:mga08x19_45516_c1 nmdc:mga08x19_45516_c1_315_467 50
778 3300050514 nmdc:mga08x19_483799_c1 nmdc:mga08x19_483799_c1_620_772 50
779 3300050515 nmdc:mga0a205_1038677_c1 nmdc:mga0a205_1038677_c1_479_631 50
780 3300050515 nmdc:mga0a205_123268_c1 nmdc:mga0a205_123268_c1_1596_1748 50
781 3300050515 nmdc:mga0a205_1233287_c1 nmdc:mga0a205_1233287_c1_145_297 50
782 3300050515 nmdc:mga0a205_140160_c1 nmdc:mga0a205_140160_c1_480_632 50
783 3300050515 nmdc:mga0a205_338398_c1 nmdc:mga0a205_338398_c1_481_633 50
784 3300050515 nmdc:mga0a205_35291_c1 nmdc:mga0a205_35291_c1_3807_3959 50
785 3300050515 nmdc:mga0a205_361_c1 nmdc:mga0a205_361_c1_22249_22401 50
786 3300050515 nmdc:mga0a205_454776_c1 nmdc:mga0a205_454776_c1_797_949 50
787 3300050515 nmdc:mga0a205_46142_c2 nmdc:mga0a205_46142_c2_611_763 50
788 3300050515 nmdc:mga0a205_469668_c1 nmdc:mga0a205_469668_c1_213_365 50
789 3300050515 nmdc:mga0a205_541447_c1 nmdc:mga0a205_541447_c1_350_502 50
790 3300050515 nmdc:mga0a205_635039_c1 nmdc:mga0a205_635039_c1_183_335 50
791 3300050515 nmdc:mga0a205_7044_c1 nmdc:mga0a205_7044_c1_1578_1730 50
792 3300050515 nmdc:mga0a205_92973_c1 nmdc:mga0a205_92973_c1_1519_1671 50
793 3300053091 Ga0500647_0337980 Ga0500647_0337980_57_209 50
794 3300054114 Ga0501084_0349202 Ga0501084_0349202_691_852 50
795 3300054114 Ga0501084_0912633 Ga0501084_0912633_381_533 50
796 3300054114 Ga0501084_1080816 Ga0501084_1080816_103_255 50
797 3300054114 Ga0501084_1237462 Ga0501084_1237462_219_371 50
798 3300059424 Ga0590075_035851 Ga0590075_035851_897_1049 50
799 3300059424 Ga0590075_177103 Ga0590075_177103_128_280 50
800 3300059477 Ga0587084_147291 Ga0587084_147291_106_258 50
801 3300060353 Ga0501082_0156966 Ga0501082_0156966_312_473 50
802 3300060353 Ga0501082_0400572 Ga0501082_0400572_571_723 50
803 3300060353 Ga0501082_1510686 Ga0501082_1510686_246_398 50
804 3300061734 Ga0530510_0124959 Ga0530510_0124959_274_426 50
805 3300061734 Ga0530510_0575062 Ga0530510_0575062_186_338 50
806 3300061734 Ga0530510_0741731 Ga0530510_0741731_181_333 50

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19451

DUF5989

Family of unknown function (DUF5989)

2

45

0.96

Feature Viewer

pLDDT pTM Quality
84.88 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map