F481667
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 806 | 298 | 806 | 50 |
Family's Representative Sequence
| Representative Sequence | 3300050509|nmdc:mga0qj67_1255643_c1|nmdc:mga0qj67_1255643_c1_105_257 |
| Length | 45 |
| Sequence | MLDLMRELWAFMRERKKFWLLPILVGGLVVFTQGSALAPFIYTLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 204 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 208 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 209 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 210 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 211 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 212 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 213 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 229 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 230 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 231 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 232 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 233 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 234 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 235 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 257 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 258 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 259 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 260 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 263 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 264 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 266 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 267 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 272 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 273 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 274 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 275 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 276 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 277 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 278 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 279 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 280 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 296 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0.99 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 0.5 |
| Rhizosphere | 98.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10247975 | 3300001990 | Unclassified | 526 |
| 2 | JGI26145J50221_1001561 | 3300003371 | Bacteria | 1805 |
| 3 | Ga0058859_10071813 | 3300004798 | Bacteria | 2097 |
| 4 | Ga0058860_10944608 | 3300004801 | Unclassified | 1078 |
| 5 | Ga0065704_10654044 | 3300005289 | Unclassified | 565 |
| 6 | Ga0065712_10048009 | 3300005290 | Unclassified | 786 |
| 7 | Ga0065715_10407420 | 3300005293 | Unclassified | 874 |
| 8 | Ga0065707_10153166 | 3300005295 | Bacteria | 1636 |
| 9 | Ga0070658_10932872 | 3300005327 | Unclassified | 755 |
| 10 | Ga0070676_10757969 | 3300005328 | Unclassified | 713 |
| 11 | Ga0070683_100112441 | 3300005329 | Bacteria | 2570 |
| 12 | Ga0070690_100119199 | 3300005330 | Bacteria | 1770 |
| 13 | Ga0070690_100411240 | 3300005330 | Bacteria | 995 |
| 14 | Ga0070690_101189982 | 3300005330 | Unclassified | 607 |
| 15 | Ga0070670_100735181 | 3300005331 | Bacteria | 889 |
| 16 | Ga0070677_10536158 | 3300005333 | Unclassified | 639 |
| 17 | Ga0068869_100131138 | 3300005334 | Bacteria | 1927 |
| 18 | Ga0068869_100927541 | 3300005334 | Bacteria | 755 |
| 19 | Ga0068869_101413723 | 3300005334 | Bacteria | 616 |
| 20 | Ga0070666_10475435 | 3300005335 | Unclassified | 904 |
| 21 | Ga0070680_100002059 | 3300005336 | Bacteria | 14833 |
| 22 | Ga0070680_100275657 | 3300005336 | Unclassified | 1424 |
| 23 | Ga0068868_100393531 | 3300005338 | Bacteria | 1194 |
| 24 | Ga0068868_100752100 | 3300005338 | Unclassified | 876 |
| 25 | Ga0070660_100240370 | 3300005339 | Bacteria | 1475 |
| 26 | Ga0070660_100357290 | 3300005339 | Bacteria | 1204 |
| 27 | Ga0070689_100043834 | 3300005340 | Bacteria | 3440 |
| 28 | Ga0070689_100494724 | 3300005340 | Unclassified | 1047 |
| 29 | Ga0070689_101077864 | 3300005340 | Unclassified | 717 |
| 30 | Ga0070689_101476381 | 3300005340 | Bacteria | 615 |
| 31 | Ga0070691_10019602 | 3300005341 | Bacteria | 3123 |
| 32 | Ga0070691_10113955 | 3300005341 | Bacteria | 1355 |
| 33 | Ga0070687_100100597 | 3300005343 | Bacteria | 1618 |
| 34 | Ga0070687_100762567 | 3300005343 | Bacteria | 682 |
| 35 | Ga0070687_101189531 | 3300005343 | Bacteria | 562 |
| 36 | Ga0070661_100032523 | 3300005344 | Bacteria | 3776 |
| 37 | Ga0070661_101771504 | 3300005344 | Bacteria | 524 |
| 38 | Ga0070692_10880169 | 3300005345 | Viruses | 618 |
| 39 | Ga0070668_100045278 | 3300005347 | Bacteria | 3377 |
| 40 | Ga0070668_100075893 | 3300005347 | Bacteria | 2625 |
| 41 | Ga0070669_100019680 | 3300005353 | Bacteria | 4822 |
| 42 | Ga0070669_100079723 | 3300005353 | Bacteria | 2436 |
| 43 | Ga0070669_100557903 | 3300005353 | Bacteria | 955 |
| 44 | Ga0070675_100029088 | 3300005354 | Bacteria | 4453 |
| 45 | Ga0070675_101158214 | 3300005354 | Unclassified | 711 |
| 46 | Ga0070671_100130065 | 3300005355 | Bacteria | 2120 |
| 47 | Ga0070671_101600420 | 3300005355 | Bacteria | 577 |
| 48 | Ga0070674_100031408 | 3300005356 | Bacteria | 3519 |
| 49 | Ga0070674_100199853 | 3300005356 | Bacteria | 1543 |
| 50 | Ga0070674_101305307 | 3300005356 | Bacteria | 647 |
| 51 | Ga0070673_100002666 | 3300005364 | Bacteria | 10920 |
| 52 | Ga0070673_100069651 | 3300005364 | Unclassified | 2820 |
| 53 | Ga0070673_100089306 | 3300005364 | Bacteria | 2515 |
| 54 | Ga0070673_102145989 | 3300005364 | Bacteria | 531 |
| 55 | Ga0070688_100024928 | 3300005365 | Bacteria | 3536 |
| 56 | Ga0070688_100153245 | 3300005365 | Bacteria | 1577 |
| 57 | Ga0070659_100041847 | 3300005366 | Bacteria | 3582 |
| 58 | Ga0070659_101624143 | 3300005366 | Bacteria | 577 |
| 59 | Ga0070667_100183584 | 3300005367 | Bacteria | 1851 |
| 60 | Ga0070667_100957832 | 3300005367 | Unclassified | 798 |
| 61 | Ga0070667_101176720 | 3300005367 | Bacteria | 717 |
| 62 | Ga0070714_100254765 | 3300005435 | Bacteria | 1624 |
| 63 | Ga0070701_10196160 | 3300005438 | Bacteria | 1191 |
| 64 | Ga0070701_10964533 | 3300005438 | Unclassified | 593 |
| 65 | Ga0070711_100082865 | 3300005439 | Bacteria | 2290 |
| 66 | Ga0070705_100308159 | 3300005440 | Bacteria | 1138 |
| 67 | Ga0070705_100545003 | 3300005440 | Bacteria | 888 |
| 68 | Ga0070700_100025268 | 3300005441 | Bacteria | 3497 |
| 69 | Ga0070700_100270531 | 3300005441 | Bacteria | 1227 |
| 70 | Ga0070700_100865109 | 3300005441 | Unclassified | 733 |
| 71 | Ga0070700_101253340 | 3300005441 | Bacteria | 621 |
| 72 | Ga0070694_100031366 | 3300005444 | Bacteria | 3485 |
| 73 | Ga0070694_101867326 | 3300005444 | Unclassified | 513 |
| 74 | Ga0070708_100221606 | 3300005445 | Bacteria | 1774 |
| 75 | Ga0070708_100238033 | 3300005445 | Bacteria | 1709 |
| 76 | Ga0070708_100555300 | 3300005445 | Bacteria | 1083 |
| 77 | Ga0070708_102218197 | 3300005445 | Unclassified | 507 |
| 78 | Ga0070663_100074878 | 3300005455 | Bacteria | 2473 |
| 79 | Ga0070663_101166080 | 3300005455 | Bacteria | 676 |
| 80 | Ga0070678_100158794 | 3300005456 | Bacteria | 1829 |
| 81 | Ga0070678_100801979 | 3300005456 | Bacteria | 855 |
| 82 | Ga0070678_102093422 | 3300005456 | Bacteria | 536 |
| 83 | Ga0070662_100245139 | 3300005457 | Bacteria | 1438 |
| 84 | Ga0070662_100282808 | 3300005457 | Bacteria | 1343 |
| 85 | Ga0070662_100662994 | 3300005457 | Unclassified | 881 |
| 86 | Ga0070681_10000612 | 3300005458 | Bacteria | 29342 |
| 87 | Ga0070681_10006622 | 3300005458 | Bacteria | 11281 |
| 88 | Ga0070681_10044888 | 3300005458 | Bacteria | 4424 |
| 89 | Ga0068867_100126336 | 3300005459 | Bacteria | 1982 |
| 90 | Ga0068867_100300830 | 3300005459 | Bacteria | 1322 |
| 91 | Ga0068867_100995593 | 3300005459 | Bacteria | 760 |
| 92 | Ga0070685_11485602 | 3300005466 | Unclassified | 522 |
| 93 | Ga0070706_100072236 | 3300005467 | Bacteria | 3193 |
| 94 | Ga0070706_100078810 | 3300005467 | Bacteria | 3050 |
| 95 | Ga0070706_100183798 | 3300005467 | Bacteria | 1952 |
| 96 | Ga0070706_100387146 | 3300005467 | Bacteria | 1302 |
| 97 | Ga0070706_101411583 | 3300005467 | Unclassified | 637 |
| 98 | Ga0070706_101799410 | 3300005467 | Unclassified | 557 |
| 99 | Ga0070707_100290937 | 3300005468 | Bacteria | 1587 |
| 100 | Ga0070707_100632354 | 3300005468 | Unclassified | 1033 |
| 101 | Ga0070707_101185904 | 3300005468 | Bacteria | 730 |
| 102 | Ga0070698_100003892 | 3300005471 | Bacteria | 16413 |
| 103 | Ga0070698_100012841 | 3300005471 | Bacteria | 8871 |
| 104 | Ga0070698_100436686 | 3300005471 | Bacteria | 1244 |
| 105 | Ga0070698_100882090 | 3300005471 | Unclassified | 840 |
| 106 | Ga0070698_101148894 | 3300005471 | Unclassified | 725 |
| 107 | Ga0070698_101725027 | 3300005471 | Bacteria | 579 |
| 108 | Ga0070698_102169158 | 3300005471 | Bacteria | 509 |
| 109 | Ga0070699_100017618 | 3300005518 | Bacteria | 6132 |
| 110 | Ga0070699_100023190 | 3300005518 | Bacteria | 5347 |
| 111 | Ga0070699_100697937 | 3300005518 | Unclassified | 927 |
| 112 | Ga0070699_101161936 | 3300005518 | Bacteria | 708 |
| 113 | Ga0070679_100009667 | 3300005530 | Bacteria | 9122 |
| 114 | Ga0070679_100839969 | 3300005530 | Unclassified | 862 |
| 115 | Ga0070679_101916275 | 3300005530 | Bacteria | 541 |
| 116 | Ga0070684_101016488 | 3300005535 | Bacteria | 778 |
| 117 | Ga0070684_101218166 | 3300005535 | Unclassified | 708 |
| 118 | Ga0070697_100008497 | 3300005536 | Bacteria | 8014 |
| 119 | Ga0070697_100236257 | 3300005536 | Bacteria | 1560 |
| 120 | Ga0070697_100257254 | 3300005536 | Bacteria | 1494 |
| 121 | Ga0070697_100700473 | 3300005536 | Bacteria | 894 |
| 122 | Ga0070697_100855014 | 3300005536 | Bacteria | 806 |
| 123 | Ga0070697_101134556 | 3300005536 | Bacteria | 696 |
| 124 | Ga0070697_101414429 | 3300005536 | Unclassified | 621 |
| 125 | Ga0070697_102130660 | 3300005536 | Bacteria | 502 |
| 126 | Ga0068853_101272002 | 3300005539 | Bacteria | 711 |
| 127 | Ga0070672_100029041 | 3300005543 | Bacteria | 4143 |
| 128 | Ga0070672_100112126 | 3300005543 | Bacteria | 2224 |
| 129 | Ga0070672_100184921 | 3300005543 | Bacteria | 1737 |
| 130 | Ga0070672_100191034 | 3300005543 | Bacteria | 1710 |
| 131 | Ga0070686_100276543 | 3300005544 | Bacteria | 1236 |
| 132 | Ga0070686_100308426 | 3300005544 | Bacteria | 1176 |
| 133 | Ga0070686_101372519 | 3300005544 | Bacteria | 592 |
| 134 | Ga0070686_101791432 | 3300005544 | Unclassified | 522 |
| 135 | Ga0070695_100195923 | 3300005545 | Bacteria | 1441 |
| 136 | Ga0070696_100002400 | 3300005546 | Bacteria | 12401 |
| 137 | Ga0070696_100273636 | 3300005546 | Bacteria | 1285 |
| 138 | Ga0070696_100523096 | 3300005546 | Bacteria | 947 |
| 139 | Ga0070696_100661996 | 3300005546 | Bacteria | 848 |
| 140 | Ga0070696_101157297 | 3300005546 | Unclassified | 652 |
| 141 | Ga0070693_100105159 | 3300005547 | Bacteria | 1727 |
| 142 | Ga0070693_100706294 | 3300005547 | Bacteria | 739 |
| 143 | Ga0070665_100162554 | 3300005548 | Bacteria | 2235 |
| 144 | Ga0070704_100032657 | 3300005549 | Bacteria | 3513 |
| 145 | Ga0070704_100434320 | 3300005549 | Bacteria | 1127 |
| 146 | Ga0070704_101422199 | 3300005549 | Unclassified | 636 |
| 147 | Ga0070704_101856848 | 3300005549 | Unclassified | 558 |
| 148 | Ga0068855_100033978 | 3300005563 | Bacteria | 6083 |
| 149 | Ga0068857_101057545 | 3300005577 | Unclassified | 783 |
| 150 | Ga0068857_101712705 | 3300005577 | Unclassified | 615 |
| 151 | Ga0068857_101945163 | 3300005577 | Unclassified | 576 |
| 152 | Ga0068854_100116537 | 3300005578 | Bacteria | 2022 |
| 153 | Ga0068854_101063181 | 3300005578 | Unclassified | 719 |
| 154 | Ga0068854_101348843 | 3300005578 | Bacteria | 643 |
| 155 | Ga0068854_102010834 | 3300005578 | Bacteria | 533 |
| 156 | Ga0068856_100109899 | 3300005614 | Bacteria | 2754 |
| 157 | Ga0070702_100086826 | 3300005615 | Bacteria | 1888 |
| 158 | Ga0070702_100176040 | 3300005615 | Bacteria | 1396 |
| 159 | Ga0070702_100655211 | 3300005615 | Unclassified | 794 |
| 160 | Ga0070702_101168025 | 3300005615 | Bacteria | 619 |
| 161 | Ga0068852_100629655 | 3300005616 | Bacteria | 1079 |
| 162 | Ga0068859_100117315 | 3300005617 | Bacteria | 2727 |
| 163 | Ga0068859_100139669 | 3300005617 | Bacteria | 2496 |
| 164 | Ga0068859_100178063 | 3300005617 | Bacteria | 2209 |
| 165 | Ga0068859_100416127 | 3300005617 | Bacteria | 1440 |
| 166 | Ga0068859_101884178 | 3300005617 | Unclassified | 660 |
| 167 | Ga0068864_100808080 | 3300005618 | Unclassified | 922 |
| 168 | Ga0068864_102346092 | 3300005618 | Unclassified | 540 |
| 169 | Ga0068866_10165297 | 3300005718 | Bacteria | 1294 |
| 170 | Ga0068866_10477348 | 3300005718 | Unclassified | 821 |
| 171 | Ga0068861_100052875 | 3300005719 | Bacteria | 3089 |
| 172 | Ga0068861_100244284 | 3300005719 | Bacteria | 1528 |
| 173 | Ga0068861_100626979 | 3300005719 | Bacteria | 990 |
| 174 | Ga0068861_102346235 | 3300005719 | Bacteria | 536 |
| 175 | Ga0068870_10173702 | 3300005840 | Bacteria | 1288 |
| 176 | Ga0068863_100230024 | 3300005841 | Unclassified | 1788 |
| 177 | Ga0068858_100164009 | 3300005842 | Bacteria | 2093 |
| 178 | Ga0068858_100487806 | 3300005842 | Bacteria | 1190 |
| 179 | Ga0068858_100850576 | 3300005842 | Bacteria | 891 |
| 180 | Ga0068858_101206012 | 3300005842 | Unclassified | 744 |
| 181 | Ga0068858_101373868 | 3300005842 | Bacteria | 696 |
| 182 | Ga0068858_102491653 | 3300005842 | Unclassified | 511 |
| 183 | Ga0068860_100137552 | 3300005843 | Bacteria | 2346 |
| 184 | Ga0068860_100235307 | 3300005843 | Bacteria | 1780 |
| 185 | Ga0068860_100894598 | 3300005843 | Bacteria | 904 |
| 186 | Ga0068860_101298612 | 3300005843 | Unclassified | 748 |
| 187 | Ga0068860_102236194 | 3300005843 | Bacteria | 568 |
| 188 | Ga0068862_100104397 | 3300005844 | Bacteria | 2482 |
| 189 | Ga0068862_100121605 | 3300005844 | Bacteria | 2302 |
| 190 | Ga0068862_101250191 | 3300005844 | Unclassified | 742 |
| 191 | Ga0068862_101544002 | 3300005844 | Bacteria | 670 |
| 192 | Ga0081455_10003374 | 3300005937 | Bacteria | 18420 |
| 193 | Ga0081455_10005104 | 3300005937 | Bacteria | 14479 |
| 194 | Ga0081455_10005732 | 3300005937 | Bacteria | 13538 |
| 195 | Ga0081455_10165463 | 3300005937 | Bacteria | 1690 |
| 196 | Ga0081538_10003359 | 3300005981 | Bacteria | 15149 |
| 197 | Ga0081538_10007871 | 3300005981 | Bacteria | 9136 |
| 198 | Ga0081538_10025886 | 3300005981 | Plasmid | 4122 |
| 199 | Ga0081540_1004479 | 3300005983 | Bacteria | 10632 |
| 200 | Ga0075432_10032086 | 3300006058 | Bacteria | 1820 |
| 201 | Ga0075432_10101768 | 3300006058 | Bacteria | 1062 |
| 202 | Ga0075432_10572467 | 3300006058 | Unclassified | 513 |
| 203 | Ga0075427_10071128 | 3300006194 | Unclassified | 620 |
| 204 | Ga0097621_100100525 | 3300006237 | Bacteria | 2433 |
| 205 | Ga0097621_100501085 | 3300006237 | Unclassified | 1100 |
| 206 | Ga0068871_100124807 | 3300006358 | Bacteria | 2178 |
| 207 | Ga0075428_100002796 | 3300006844 | Bacteria | 18986 |
| 208 | Ga0075428_100016284 | 3300006844 | Bacteria | 8217 |
| 209 | Ga0075428_100078772 | 3300006844 | Bacteria | 3597 |
| 210 | Ga0075428_100091223 | 3300006844 | Bacteria | 3323 |
| 211 | Ga0075428_100109417 | 3300006844 | Bacteria | 3011 |
| 212 | Ga0075428_100221432 | 3300006844 | Bacteria | 2043 |
| 213 | Ga0075428_100264965 | 3300006844 | Bacteria | 1850 |
| 214 | Ga0075428_100401352 | 3300006844 | Bacteria | 1469 |
| 215 | Ga0075428_100465279 | 3300006844 | Unclassified | 1354 |
| 216 | Ga0075428_100566354 | 3300006844 | Bacteria | 1214 |
| 217 | Ga0075428_100746288 | 3300006844 | Bacteria | 1041 |
| 218 | Ga0075428_100780685 | 3300006844 | Unclassified | 1016 |
| 219 | Ga0075428_101092869 | 3300006844 | Unclassified | 842 |
| 220 | Ga0075428_101729396 | 3300006844 | Bacteria | 652 |
| 221 | Ga0075430_100003745 | 3300006846 | Bacteria | 12777 |
| 222 | Ga0075430_100008951 | 3300006846 | Bacteria | 8455 |
| 223 | Ga0075430_100036044 | 3300006846 | Unclassified | 4194 |
| 224 | Ga0075430_100062272 | 3300006846 | Bacteria | 3134 |
| 225 | Ga0075430_100079885 | 3300006846 | Bacteria | 2740 |
| 226 | Ga0075430_100150682 | 3300006846 | Bacteria | 1937 |
| 227 | Ga0075430_100170153 | 3300006846 | Bacteria | 1812 |
| 228 | Ga0075430_100285943 | 3300006846 | Bacteria | 1364 |
| 229 | Ga0075430_100804333 | 3300006846 | Bacteria | 775 |
| 230 | Ga0075431_100005537 | 3300006847 | Bacteria | 12465 |
| 231 | Ga0075431_100034193 | 3300006847 | Bacteria | 5238 |
| 232 | Ga0075431_100042249 | 3300006847 | Unclassified | 4701 |
| 233 | Ga0075431_100239719 | 3300006847 | Bacteria | 1845 |
| 234 | Ga0075431_100245256 | 3300006847 | Unclassified | 1821 |
| 235 | Ga0075431_100332254 | 3300006847 | Bacteria | 1531 |
| 236 | Ga0075431_100435569 | 3300006847 | Bacteria | 1308 |
| 237 | Ga0075431_100789070 | 3300006847 | Bacteria | 923 |
| 238 | Ga0075431_100897437 | 3300006847 | Bacteria | 856 |
| 239 | Ga0075431_100976500 | 3300006847 | Unclassified | 814 |
| 240 | Ga0075431_101344869 | 3300006847 | Bacteria | 675 |
| 241 | Ga0075431_101656039 | 3300006847 | Bacteria | 597 |
| 242 | Ga0075433_10001398 | 3300006852 | Bacteria | 17801 |
| 243 | Ga0075433_10069168 | 3300006852 | Bacteria | 3100 |
| 244 | Ga0075433_10113828 | 3300006852 | Unclassified | 2400 |
| 245 | Ga0075433_10278156 | 3300006852 | Bacteria | 1483 |
| 246 | Ga0075433_10307026 | 3300006852 | Bacteria | 1404 |
| 247 | Ga0075433_10615978 | 3300006852 | Bacteria | 953 |
| 248 | Ga0075433_11289663 | 3300006852 | Bacteria | 633 |
| 249 | Ga0075433_11596206 | 3300006852 | Unclassified | 563 |
| 250 | Ga0075433_11612485 | 3300006852 | Bacteria | 560 |
| 251 | Ga0075434_100037785 | 3300006871 | Bacteria | 4780 |
| 252 | Ga0075434_100051110 | 3300006871 | Bacteria | 4106 |
| 253 | Ga0075434_100094512 | 3300006871 | Bacteria | 2994 |
| 254 | Ga0075434_100126059 | 3300006871 | Bacteria | 2577 |
| 255 | Ga0075434_100394669 | 3300006871 | Bacteria | 1404 |
| 256 | Ga0075434_100506720 | 3300006871 | Unclassified | 1228 |
| 257 | Ga0075434_100537724 | 3300006871 | Bacteria | 1188 |
| 258 | Ga0075434_100981995 | 3300006871 | Unclassified | 858 |
| 259 | Ga0075434_101852546 | 3300006871 | Bacteria | 610 |
| 260 | Ga0075429_100015697 | 3300006880 | Bacteria | 6562 |
| 261 | Ga0075429_100029066 | 3300006880 | Unclassified | 4800 |
| 262 | Ga0075429_100057299 | 3300006880 | Bacteria | 3392 |
| 263 | Ga0075429_100100865 | 3300006880 | Bacteria | 2520 |
| 264 | Ga0075429_100115496 | 3300006880 | Bacteria | 2346 |
| 265 | Ga0075429_100316672 | 3300006880 | Bacteria | 1365 |
| 266 | Ga0075429_100334401 | 3300006880 | Bacteria | 1326 |
| 267 | Ga0075429_100340108 | 3300006880 | Bacteria | 1314 |
| 268 | Ga0075429_100438749 | 3300006880 | Unclassified | 1144 |
| 269 | Ga0075429_100572330 | 3300006880 | Bacteria | 990 |
| 270 | Ga0075429_100853910 | 3300006880 | Viruses | 797 |
| 271 | Ga0075429_100930617 | 3300006880 | Bacteria | 760 |
| 272 | Ga0075429_100952181 | 3300006880 | Unclassified | 751 |
| 273 | Ga0068865_100006629 | 3300006881 | Bacteria | 7082 |
| 274 | Ga0068865_100284233 | 3300006881 | Bacteria | 1318 |
| 275 | Ga0068865_101043006 | 3300006881 | Unclassified | 718 |
| 276 | Ga0075436_100046776 | 3300006914 | Unclassified | 2984 |
| 277 | Ga0075436_100048127 | 3300006914 | Bacteria | 2942 |
| 278 | Ga0097620_100117317 | 3300006931 | Bacteria | 2727 |
| 279 | Ga0097620_100139667 | 3300006931 | Bacteria | 2496 |
| 280 | Ga0097620_100178053 | 3300006931 | Bacteria | 2209 |
| 281 | Ga0097620_100416110 | 3300006931 | Bacteria | 1440 |
| 282 | Ga0097620_101883779 | 3300006931 | Unclassified | 660 |
| 283 | Ga0075435_100027752 | 3300007076 | Bacteria | 4432 |
| 284 | Ga0075435_100270730 | 3300007076 | Bacteria | 1449 |
| 285 | Ga0075435_100293944 | 3300007076 | Bacteria | 1388 |
| 286 | Ga0075435_100395860 | 3300007076 | Bacteria | 1187 |
| 287 | Ga0075435_100484658 | 3300007076 | Unclassified | 1068 |
| 288 | Ga0075435_101094569 | 3300007076 | Bacteria | 697 |
| 289 | Ga0075435_101124038 | 3300007076 | Bacteria | 687 |
| 290 | Ga0099794_10301156 | 3300007265 | Bacteria | 830 |
| 291 | Ga0099794_10441169 | 3300007265 | Unclassified | 682 |
| 292 | Ga0105240_10041272 | 3300009093 | Bacteria | 5891 |
| 293 | Ga0105240_10162322 | 3300009093 | Bacteria | 2653 |
| 294 | Ga0105240_10674163 | 3300009093 | Bacteria | 1131 |
| 295 | Ga0111539_10020928 | 3300009094 | Bacteria | 8054 |
| 296 | Ga0111539_10060788 | 3300009094 | Bacteria | 4477 |
| 297 | Ga0111539_10178995 | 3300009094 | Bacteria | 2477 |
| 298 | Ga0111539_10290129 | 3300009094 | Bacteria | 1904 |
| 299 | Ga0111539_10702989 | 3300009094 | Unclassified | 1177 |
| 300 | Ga0111539_10888374 | 3300009094 | Bacteria | 1037 |
| 301 | Ga0111539_11189737 | 3300009094 | Unclassified | 885 |
| 302 | Ga0111539_11473899 | 3300009094 | Unclassified | 789 |
| 303 | Ga0105245_12441907 | 3300009098 | Bacteria | 576 |
| 304 | Ga0105247_10454737 | 3300009101 | Bacteria | 924 |
| 305 | Ga0114129_10005952 | 3300009147 | Bacteria | 17264 |
| 306 | Ga0114129_10018701 | 3300009147 | Bacteria | 9868 |
| 307 | Ga0114129_10059350 | 3300009147 | Bacteria | 5349 |
| 308 | Ga0114129_10069903 | 3300009147 | Bacteria | 4895 |
| 309 | Ga0114129_10085812 | 3300009147 | Unclassified | 4367 |
| 310 | Ga0114129_10090670 | 3300009147 | Unclassified | 4237 |
| 311 | Ga0114129_10111773 | 3300009147 | Bacteria | 3769 |
| 312 | Ga0114129_10120706 | 3300009147 | Bacteria | 3609 |
| 313 | Ga0114129_10145165 | 3300009147 | Bacteria | 3251 |
| 314 | Ga0114129_10168844 | 3300009147 | Unclassified | 2984 |
| 315 | Ga0114129_10315401 | 3300009147 | Bacteria | 2080 |
| 316 | Ga0114129_10447922 | 3300009147 | Bacteria | 1694 |
| 317 | Ga0114129_10489429 | 3300009147 | Unclassified | 1608 |
| 318 | Ga0114129_10647811 | 3300009147 | Bacteria | 1364 |
| 319 | Ga0114129_10737160 | 3300009147 | Bacteria | 1263 |
| 320 | Ga0114129_10986572 | 3300009147 | Bacteria | 1062 |
| 321 | Ga0114129_11031046 | 3300009147 | Bacteria | 1034 |
| 322 | Ga0114129_11039326 | 3300009147 | Bacteria | 1029 |
| 323 | Ga0114129_11058995 | 3300009147 | Unclassified | 1018 |
| 324 | Ga0114129_11069671 | 3300009147 | Bacteria | 1012 |
| 325 | Ga0114129_11123895 | 3300009147 | Bacteria | 982 |
| 326 | Ga0114129_11206821 | 3300009147 | Bacteria | 942 |
| 327 | Ga0114129_11253583 | 3300009147 | Bacteria | 921 |
| 328 | Ga0114129_11262640 | 3300009147 | Archaea | 917 |
| 329 | Ga0114129_11362653 | 3300009147 | Bacteria | 877 |
| 330 | Ga0114129_11955566 | 3300009147 | Viruses | 710 |
| 331 | Ga0114129_12269091 | 3300009147 | Unclassified | 652 |
| 332 | Ga0114129_13470155 | 3300009147 | Unclassified | 505 |
| 333 | Ga0105243_10027900 | 3300009148 | Bacteria | 4330 |
| 334 | Ga0105243_10073463 | 3300009148 | Bacteria | 2771 |
| 335 | Ga0105243_11501844 | 3300009148 | Unclassified | 697 |
| 336 | Ga0105242_10077507 | 3300009176 | Bacteria | 2773 |
| 337 | Ga0105242_10303063 | 3300009176 | Bacteria | 1459 |
| 338 | Ga0105242_10591692 | 3300009176 | Unclassified | 1070 |
| 339 | Ga0105248_10020631 | 3300009177 | Bacteria | 7303 |
| 340 | Ga0105248_10223054 | 3300009177 | Bacteria | 2122 |
| 341 | Ga0105248_10364733 | 3300009177 | Bacteria | 1626 |
| 342 | Ga0105248_11164825 | 3300009177 | Unclassified | 871 |
| 343 | Ga0105248_11456340 | 3300009177 | Bacteria | 775 |
| 344 | Ga0105237_11025416 | 3300009545 | Unclassified | 832 |
| 345 | Ga0105238_10081375 | 3300009551 | Bacteria | 3228 |
| 346 | Ga0105249_10414861 | 3300009553 | Bacteria | 1379 |
| 347 | Ga0105249_10596642 | 3300009553 | Bacteria | 1159 |
| 348 | Ga0105249_11329871 | 3300009553 | Bacteria | 790 |
| 349 | Ga0105249_13273966 | 3300009553 | Unclassified | 521 |
| 350 | Ga0105239_10091409 | 3300010375 | Bacteria | 3358 |
| 351 | Ga0105246_11304842 | 3300011119 | Unclassified | 673 |
| 352 | Ga0157373_10139082 | 3300013100 | Bacteria | 1707 |
| 353 | Ga0157373_10347100 | 3300013100 | Bacteria | 1058 |
| 354 | Ga0157373_11448723 | 3300013100 | Bacteria | 523 |
| 355 | Ga0157371_10839428 | 3300013102 | Unclassified | 694 |
| 356 | Ga0157370_10266267 | 3300013104 | Bacteria | 1583 |
| 357 | Ga0157369_12308179 | 3300013105 | Bacteria | 545 |
| 358 | Ga0157374_10031675 | 3300013296 | Bacteria | 4809 |
| 359 | Ga0157374_10101351 | 3300013296 | Unclassified | 2761 |
| 360 | Ga0157378_10009886 | 3300013297 | Bacteria | 8314 |
| 361 | Ga0157378_10073226 | 3300013297 | Bacteria | 3079 |
| 362 | Ga0157378_10224203 | 3300013297 | Unclassified | 1788 |
| 363 | Ga0157378_10280874 | 3300013297 | Unclassified | 1605 |
| 364 | Ga0157378_11995504 | 3300013297 | Bacteria | 630 |
| 365 | Ga0163162_10036544 | 3300013306 | Bacteria | 4897 |
| 366 | Ga0163162_10391041 | 3300013306 | Bacteria | 1523 |
| 367 | Ga0163162_10468141 | 3300013306 | Bacteria | 1392 |
| 368 | Ga0163162_13451638 | 3300013306 | Unclassified | 503 |
| 369 | Ga0157372_10150816 | 3300013307 | Bacteria | 2683 |
| 370 | Ga0157375_10247727 | 3300013308 | Bacteria | 1942 |
| 371 | Ga0157375_11342646 | 3300013308 | Bacteria | 841 |
| 372 | Ga0157375_12360614 | 3300013308 | Unclassified | 634 |
| 373 | Ga0157375_12712092 | 3300013308 | Unclassified | 592 |
| 374 | Ga0163163_12316982 | 3300014325 | Unclassified | 596 |
| 375 | Ga0157380_10028062 | 3300014326 | Bacteria | 4288 |
| 376 | Ga0157380_10161018 | 3300014326 | Bacteria | 1950 |
| 377 | Ga0157380_10463527 | 3300014326 | Bacteria | 1220 |
| 378 | Ga0157380_10597012 | 3300014326 | Bacteria | 1091 |
| 379 | Ga0157377_10014033 | 3300014745 | Bacteria | 4070 |
| 380 | Ga0157377_10185475 | 3300014745 | Bacteria | 1311 |
| 381 | Ga0157377_10383043 | 3300014745 | Unclassified | 953 |
| 382 | Ga0157379_10507094 | 3300014968 | Bacteria | 1119 |
| 383 | Ga0157379_11377274 | 3300014968 | Unclassified | 683 |
| 384 | Ga0157379_11882101 | 3300014968 | Bacteria | 589 |
| 385 | Ga0157376_10024323 | 3300014969 | Bacteria | 4753 |
| 386 | Ga0157376_10959620 | 3300014969 | Bacteria | 876 |
| 387 | Ga0163161_10230912 | 3300017792 | Bacteria | 1436 |
| 388 | Ga0163161_11464390 | 3300017792 | Bacteria | 598 |
| 389 | Ga0207653_10274061 | 3300025885 | Bacteria | 650 |
| 390 | Ga0207642_10200791 | 3300025899 | Unclassified | 1101 |
| 391 | Ga0207710_10196771 | 3300025900 | Bacteria | 994 |
| 392 | Ga0207680_10262129 | 3300025903 | Bacteria | 1196 |
| 393 | Ga0207645_10005980 | 3300025907 | Bacteria | 8758 |
| 394 | Ga0207645_10577425 | 3300025907 | Bacteria | 763 |
| 395 | Ga0207643_10153493 | 3300025908 | Bacteria | 1382 |
| 396 | Ga0207705_10013097 | 3300025909 | Bacteria | 5985 |
| 397 | Ga0207684_10035507 | 3300025910 | Bacteria | 4234 |
| 398 | Ga0207684_10093628 | 3300025910 | Bacteria | 2562 |
| 399 | Ga0207684_10100163 | 3300025910 | Bacteria | 2476 |
| 400 | Ga0207684_10218856 | 3300025910 | Bacteria | 1643 |
| 401 | Ga0207684_10245754 | 3300025910 | Bacteria | 1544 |
| 402 | Ga0207654_10446534 | 3300025911 | Bacteria | 906 |
| 403 | Ga0207707_10001853 | 3300025912 | Bacteria | 19332 |
| 404 | Ga0207707_10094936 | 3300025912 | Bacteria | 2606 |
| 405 | Ga0207707_10138781 | 3300025912 | Bacteria | 2126 |
| 406 | Ga0207695_10192545 | 3300025913 | Bacteria | 1956 |
| 407 | Ga0207663_10059039 | 3300025916 | Bacteria | 2425 |
| 408 | Ga0207660_10007560 | 3300025917 | Bacteria | 7032 |
| 409 | Ga0207660_10192201 | 3300025917 | Bacteria | 1590 |
| 410 | Ga0207660_10247965 | 3300025917 | Bacteria | 1405 |
| 411 | Ga0207660_10770483 | 3300025917 | Unclassified | 785 |
| 412 | Ga0207662_10105303 | 3300025918 | Bacteria | 1753 |
| 413 | Ga0207662_10213519 | 3300025918 | Bacteria | 1253 |
| 414 | Ga0207657_10001811 | 3300025919 | Bacteria | 23057 |
| 415 | Ga0207657_10129247 | 3300025919 | Bacteria | 2072 |
| 416 | Ga0207657_10170326 | 3300025919 | Bacteria | 1764 |
| 417 | Ga0207649_10608382 | 3300025920 | Unclassified | 841 |
| 418 | Ga0207652_10007191 | 3300025921 | Bacteria | 8983 |
| 419 | Ga0207652_10318627 | 3300025921 | Bacteria | 1404 |
| 420 | Ga0207652_10588075 | 3300025921 | Bacteria | 999 |
| 421 | Ga0207646_10253254 | 3300025922 | Bacteria | 1591 |
| 422 | Ga0207646_11175456 | 3300025922 | Unclassified | 673 |
| 423 | Ga0207681_10027143 | 3300025923 | Bacteria | 3700 |
| 424 | Ga0207681_10267618 | 3300025923 | Bacteria | 1340 |
| 425 | Ga0207681_10307967 | 3300025923 | Bacteria | 1255 |
| 426 | Ga0207694_10071363 | 3300025924 | Bacteria | 2714 |
| 427 | Ga0207650_10031403 | 3300025925 | Bacteria | 3835 |
| 428 | Ga0207650_10583585 | 3300025925 | Unclassified | 939 |
| 429 | Ga0207659_10069896 | 3300025926 | Bacteria | 2559 |
| 430 | Ga0207664_11057657 | 3300025929 | Bacteria | 726 |
| 431 | Ga0207644_10030659 | 3300025931 | Bacteria | 3742 |
| 432 | Ga0207644_10342694 | 3300025931 | Bacteria | 1212 |
| 433 | Ga0207644_10911170 | 3300025931 | Unclassified | 737 |
| 434 | Ga0207644_11705092 | 3300025931 | Unclassified | 528 |
| 435 | Ga0207690_10592929 | 3300025932 | Bacteria | 904 |
| 436 | Ga0207690_11255031 | 3300025932 | Bacteria | 619 |
| 437 | Ga0207706_10004396 | 3300025933 | Bacteria | 13245 |
| 438 | Ga0207706_10006287 | 3300025933 | Bacteria | 11036 |
| 439 | Ga0207706_10135695 | 3300025933 | Bacteria | 2165 |
| 440 | Ga0207686_10127937 | 3300025934 | Bacteria | 1738 |
| 441 | Ga0207709_10077069 | 3300025935 | Bacteria | 2136 |
| 442 | Ga0207709_11279589 | 3300025935 | Bacteria | 606 |
| 443 | Ga0207709_11788895 | 3300025935 | Bacteria | 511 |
| 444 | Ga0207669_10740531 | 3300025937 | Unclassified | 811 |
| 445 | Ga0207669_11696220 | 3300025937 | Bacteria | 540 |
| 446 | Ga0207704_10003039 | 3300025938 | Bacteria | 7581 |
| 447 | Ga0207704_11367407 | 3300025938 | Unclassified | 606 |
| 448 | Ga0207691_10008091 | 3300025940 | Bacteria | 10098 |
| 449 | Ga0207691_10016009 | 3300025940 | Bacteria | 7122 |
| 450 | Ga0207691_10203055 | 3300025940 | Bacteria | 1724 |
| 451 | Ga0207691_10255908 | 3300025940 | Bacteria | 1510 |
| 452 | Ga0207691_11584994 | 3300025940 | Bacteria | 533 |
| 453 | Ga0207711_10251537 | 3300025941 | Bacteria | 1623 |
| 454 | Ga0207711_10474898 | 3300025941 | Unclassified | 1165 |
| 455 | Ga0207711_10741307 | 3300025941 | Unclassified | 916 |
| 456 | Ga0207711_11553490 | 3300025941 | Unclassified | 605 |
| 457 | Ga0207711_11975395 | 3300025941 | Bacteria | 526 |
| 458 | Ga0207689_10007800 | 3300025942 | Bacteria | 9367 |
| 459 | Ga0207689_11221738 | 3300025942 | Unclassified | 632 |
| 460 | Ga0207689_11317704 | 3300025942 | Bacteria | 606 |
| 461 | Ga0207689_11709149 | 3300025942 | Unclassified | 521 |
| 462 | Ga0207661_10105383 | 3300025944 | Bacteria | 2376 |
| 463 | Ga0207661_11118754 | 3300025944 | Bacteria | 725 |
| 464 | Ga0207679_10066283 | 3300025945 | Bacteria | 2705 |
| 465 | Ga0207679_10533558 | 3300025945 | Bacteria | 1051 |
| 466 | Ga0207667_10028912 | 3300025949 | Bacteria | 6017 |
| 467 | Ga0207651_10033306 | 3300025960 | Bacteria | 3322 |
| 468 | Ga0207651_10052560 | 3300025960 | Unclassified | 2779 |
| 469 | Ga0207651_10217962 | 3300025960 | Unclassified | 1541 |
| 470 | Ga0207651_10349858 | 3300025960 | Unclassified | 1244 |
| 471 | Ga0207651_10473454 | 3300025960 | Bacteria | 1078 |
| 472 | Ga0207651_11342025 | 3300025960 | Unclassified | 643 |
| 473 | Ga0207712_10019630 | 3300025961 | Bacteria | 4417 |
| 474 | Ga0207712_10382695 | 3300025961 | Bacteria | 1178 |
| 475 | Ga0207668_10145186 | 3300025972 | Bacteria | 1830 |
| 476 | Ga0207668_10145661 | 3300025972 | Bacteria | 1827 |
| 477 | Ga0207640_10015236 | 3300025981 | Bacteria | 4447 |
| 478 | Ga0207640_10055844 | 3300025981 | Bacteria | 2589 |
| 479 | Ga0207640_10525755 | 3300025981 | Bacteria | 989 |
| 480 | Ga0207658_11810880 | 3300025986 | Unclassified | 557 |
| 481 | Ga0207677_10199772 | 3300026023 | Bacteria | 1588 |
| 482 | Ga0207677_10280493 | 3300026023 | Bacteria | 1367 |
| 483 | Ga0207703_10356353 | 3300026035 | Unclassified | 1348 |
| 484 | Ga0207703_10896009 | 3300026035 | Bacteria | 849 |
| 485 | Ga0207703_11459870 | 3300026035 | Bacteria | 658 |
| 486 | Ga0207708_10002116 | 3300026075 | Bacteria | 14637 |
| 487 | Ga0207708_10316947 | 3300026075 | Bacteria | 1271 |
| 488 | Ga0207702_10334611 | 3300026078 | Bacteria | 1445 |
| 489 | Ga0207641_10159670 | 3300026088 | Bacteria | 2049 |
| 490 | Ga0207641_10929371 | 3300026088 | Bacteria | 865 |
| 491 | Ga0207641_11252878 | 3300026088 | Bacteria | 742 |
| 492 | Ga0207648_10000971 | 3300026089 | Bacteria | 32341 |
| 493 | Ga0207648_10396934 | 3300026089 | Bacteria | 1249 |
| 494 | Ga0207648_11150676 | 3300026089 | Bacteria | 728 |
| 495 | Ga0207676_11033927 | 3300026095 | Unclassified | 810 |
| 496 | Ga0207676_11977322 | 3300026095 | Bacteria | 582 |
| 497 | Ga0207674_10340583 | 3300026116 | Bacteria | 1450 |
| 498 | Ga0207674_11455612 | 3300026116 | Bacteria | 654 |
| 499 | Ga0207675_100029601 | 3300026118 | Bacteria | 5100 |
| 500 | Ga0207675_100211591 | 3300026118 | Bacteria | 1865 |
| 501 | Ga0207675_100364633 | 3300026118 | Bacteria | 1418 |
| 502 | Ga0207675_101012175 | 3300026118 | Unclassified | 849 |
| 503 | Ga0207683_10002617 | 3300026121 | Bacteria | 15711 |
| 504 | Ga0207683_10169630 | 3300026121 | Bacteria | 1976 |
| 505 | Ga0207698_10849701 | 3300026142 | Bacteria | 918 |
| 506 | Ga0209969_1000761 | 3300027360 | Bacteria | 4316 |
| 507 | Ga0209967_1001515 | 3300027364 | Bacteria | 2979 |
| 508 | Ga0209981_1000933 | 3300027378 | Bacteria | 3663 |
| 509 | Ga0209996_1000443 | 3300027395 | Bacteria | 4990 |
| 510 | Ga0209996_1053866 | 3300027395 | Unclassified | 612 |
| 511 | Ga0209984_1000288 | 3300027424 | Bacteria | 5713 |
| 512 | Ga0210000_1000168 | 3300027462 | Bacteria | 9449 |
| 513 | Ga0209995_1024174 | 3300027471 | Bacteria | 1011 |
| 514 | Ga0209968_1000142 | 3300027526 | Bacteria | 12474 |
| 515 | Ga0209968_1015903 | 3300027526 | Bacteria | 1193 |
| 516 | Ga0209999_1003539 | 3300027543 | Bacteria | 2798 |
| 517 | Ga0209982_1000124 | 3300027552 | Bacteria | 8417 |
| 518 | Ga0209970_1001779 | 3300027614 | Bacteria | 3734 |
| 519 | Ga0210002_1000032 | 3300027617 | Bacteria | 21467 |
| 520 | Ga0209971_1003221 | 3300027682 | Bacteria | 3890 |
| 521 | Ga0209966_1000451 | 3300027695 | Bacteria | 11482 |
| 522 | Ga0209974_10000674 | 3300027876 | Bacteria | 11586 |
| 523 | Ga0209974_10101986 | 3300027876 | Unclassified | 1004 |
| 524 | Ga0209974_10216048 | 3300027876 | Bacteria | 712 |
| 525 | Ga0207428_10121154 | 3300027907 | Bacteria | 2006 |
| 526 | Ga0207428_10534782 | 3300027907 | Bacteria | 849 |
| 527 | Ga0207428_10665786 | 3300027907 | Bacteria | 746 |
| 528 | Ga0268265_10066606 | 3300028380 | Bacteria | 2785 |
| 529 | Ga0268265_11024627 | 3300028380 | Unclassified | 816 |
| 530 | Ga0268265_11124903 | 3300028380 | Unclassified | 780 |
| 531 | Ga0268265_11565388 | 3300028380 | Bacteria | 664 |
| 532 | Ga0268264_10113987 | 3300028381 | Bacteria | 2373 |
| 533 | Ga0268264_10525700 | 3300028381 | Bacteria | 1157 |
| 534 | Ga0268264_10593189 | 3300028381 | Bacteria | 1091 |
| 535 | Ga0268264_11380669 | 3300028381 | Unclassified | 715 |
| 536 | Ga0307513_10478142 | 3300031456 | Bacteria | 966 |
| 537 | Ga0307408_101179431 | 3300031548 | Unclassified | 713 |
| 538 | Ga0307408_102320362 | 3300031548 | Unclassified | 520 |
| 539 | Ga0307413_10532301 | 3300031824 | Bacteria | 950 |
| 540 | Ga0307413_11215390 | 3300031824 | Unclassified | 656 |
| 541 | Ga0307410_10507054 | 3300031852 | Unclassified | 993 |
| 542 | Ga0307407_10438252 | 3300031903 | Bacteria | 946 |
| 543 | Ga0307407_10551922 | 3300031903 | Unclassified | 852 |
| 544 | Ga0307412_11643733 | 3300031911 | Unclassified | 587 |
| 545 | Ga0307412_11926529 | 3300031911 | Unclassified | 546 |
| 546 | Ga0307409_100479462 | 3300031995 | Bacteria | 1207 |
| 547 | Ga0307409_100561028 | 3300031995 | Bacteria | 1123 |
| 548 | Ga0307409_100969066 | 3300031995 | Bacteria | 867 |
| 549 | Ga0307416_100562758 | 3300032002 | Bacteria | 1215 |
| 550 | Ga0307416_101751564 | 3300032002 | Bacteria | 726 |
| 551 | Ga0307414_10870171 | 3300032004 | Unclassified | 825 |
| 552 | Ga0307411_10125104 | 3300032005 | Bacteria | 1868 |
| 553 | Ga0307411_11667166 | 3300032005 | Unclassified | 589 |
| 554 | Ga0373952_0126114 | 3300035092 | Bacteria | 699 |
| 555 | Ga0373961_0217632 | 3300035241 | Unclassified | 680 |
| 556 | Ga0373931_0223976 | 3300035691 | Bacteria | 1134 |
| 557 | Ga0451804_0682386 | 3300041463 | Bacteria | 620 |
| 558 | Ga0451839_1028224 | 3300041496 | Bacteria | 1643 |
| 559 | Ga0439443_122779 | 3300042003 | Unclassified | 511 |
| 560 | Ga0439452_036385 | 3300042010 | Unclassified | 1180 |
| 561 | Ga0439455_0208547 | 3300042012 | Unclassified | 567 |
| 562 | Ga0439435_0116623 | 3300042436 | Bacteria | 833 |
| 563 | Ga0439460_0013298 | 3300042461 | Bacteria | 2152 |
| 564 | Ga0453683_0368198 | 3300044673 | Bacteria | 924 |
| 565 | Ga0451576_0141115 | 3300045051 | Bacteria | 2512 |
| 566 | Ga0451576_1218775 | 3300045051 | Bacteria | 786 |
| 567 | Ga0451576_1814643 | 3300045051 | Unclassified | 630 |
| 568 | Ga0451576_2213190 | 3300045051 | Unclassified | 564 |
| 569 | Ga0466967_0248470 | 3300045976 | Bacteria | 1699 |
| 570 | Ga0466967_0602113 | 3300045976 | Unclassified | 1085 |
| 571 | Ga0495651_0773283 | 3300046462 | Bacteria | 594 |
| 572 | Ga0495580_0277214 | 3300046472 | Bacteria | 1144 |
| 573 | Ga0495594_0109102 | 3300046499 | Bacteria | 1560 |
| 574 | Ga0495622_0290316 | 3300046557 | Bacteria | 714 |
| 575 | Ga0495635_0273624 | 3300046663 | Bacteria | 1135 |
| 576 | Ga0495669_0097567 | 3300046684 | Bacteria | 1363 |
| 577 | Ga0495669_0149782 | 3300046684 | Bacteria | 1104 |
| 578 | Ga0495636_0153379 | 3300047318 | Bacteria | 1035 |
| 579 | Ga0495636_0251204 | 3300047318 | Unclassified | 818 |
| 580 | Ga0495636_0488785 | 3300047318 | Unclassified | 594 |
| 581 | Ga0496107_1185333 | 3300048910 | Bacteria | 549 |
| 582 | Ga0496108_0363127 | 3300048911 | Bacteria | 1264 |
| 583 | Ga0496109_2063592 | 3300048912 | Unclassified | 502 |
| 584 | Ga0501308_042964 | 3300049128 | Unclassified | 642 |
| 585 | Ga0501309_030012 | 3300049129 | Unclassified | 799 |
| 586 | Ga0501291_027180 | 3300049514 | Unclassified | 946 |
| 587 | Ga0501291_150631 | 3300049514 | Unclassified | 525 |
| 588 | Ga0501292_012798 | 3300049515 | Bacteria | 1284 |
| 589 | Ga0501297_007146 | 3300049520 | Bacteria | 1205 |
| 590 | Ga0501298_007475 | 3300049521 | Bacteria | 1812 |
| 591 | Ga0501299_046582 | 3300049522 | Bacteria | 885 |
| 592 | Ga0501299_054238 | 3300049522 | Unclassified | 835 |
| 593 | Ga0501300_010301 | 3300049523 | Bacteria | 1363 |
| 594 | Ga0501301_046108 | 3300049524 | Bacteria | 508 |
| 595 | Ga0501312_054022 | 3300049528 | Unclassified | 683 |
| 596 | Ga0501316_057555 | 3300049532 | Unclassified | 570 |
| 597 | Ga0501325_045027 | 3300049541 | Unclassified | 547 |
| 598 | Ga0501033_0711916 | 3300049570 | Unclassified | 683 |
| 599 | Ga0501036_0298082 | 3300049572 | Bacteria | 1349 |
| 600 | Ga0501036_1112489 | 3300049572 | Bacteria | 645 |
| 601 | Ga0501036_1391954 | 3300049572 | Unclassified | 569 |
| 602 | Ga0501037_0672638 | 3300049573 | Bacteria | 691 |
| 603 | Ga0501038_0544123 | 3300049574 | Bacteria | 884 |
| 604 | Ga0501038_0800968 | 3300049574 | Bacteria | 700 |
| 605 | Ga0501039_0266690 | 3300049575 | Bacteria | 1346 |
| 606 | Ga0501039_0288264 | 3300049575 | Bacteria | 1291 |
| 607 | Ga0501039_0446086 | 3300049575 | Bacteria | 1016 |
| 608 | Ga0501039_0872042 | 3300049575 | Unclassified | 701 |
| 609 | Ga0501040_0316662 | 3300049576 | Bacteria | 1116 |
| 610 | Ga0501040_0473941 | 3300049576 | Unclassified | 902 |
| 611 | Ga0501041_0485039 | 3300049577 | Unclassified | 786 |
| 612 | Ga0501041_0501239 | 3300049577 | Unclassified | 772 |
| 613 | Ga0501041_1010942 | 3300049577 | Unclassified | 535 |
| 614 | Ga0501042_0216155 | 3300049578 | Unclassified | 1383 |
| 615 | Ga0501042_0258918 | 3300049578 | Bacteria | 1256 |
| 616 | Ga0501042_0398607 | 3300049578 | Bacteria | 997 |
| 617 | Ga0501042_0768036 | 3300049578 | Bacteria | 701 |
| 618 | Ga0501042_1403916 | 3300049578 | Unclassified | 509 |
| 619 | Ga0501046_0788146 | 3300049580 | Unclassified | 666 |
| 620 | Ga0501067_0131716 | 3300049583 | Unclassified | 1392 |
| 621 | Ga0501068_0060454 | 3300049584 | Unclassified | 2301 |
| 622 | Ga0501068_1145828 | 3300049584 | Bacteria | 515 |
| 623 | Ga0501069_0166196 | 3300049585 | Unclassified | 1272 |
| 624 | Ga0501071_0076663 | 3300049587 | Bacteria | 2442 |
| 625 | Ga0501071_1614489 | 3300049587 | Bacteria | 501 |
| 626 | Ga0501072_0192406 | 3300049588 | Unclassified | 1627 |
| 627 | Ga0501072_0290973 | 3300049588 | Bacteria | 1299 |
| 628 | Ga0501072_1113735 | 3300049588 | Unclassified | 614 |
| 629 | Ga0501074_1284421 | 3300049590 | Unclassified | 513 |
| 630 | Ga0501075_0040870 | 3300049591 | Bacteria | 3475 |
| 631 | Ga0501075_0047523 | 3300049591 | Bacteria | 3225 |
| 632 | Ga0501075_0068688 | 3300049591 | Bacteria | 2678 |
| 633 | Ga0501075_0274771 | 3300049591 | Bacteria | 1284 |
| 634 | Ga0501075_0336075 | 3300049591 | Bacteria | 1151 |
| 635 | Ga0501076_0275666 | 3300049592 | Bacteria | 1378 |
| 636 | Ga0501076_0281350 | 3300049592 | Bacteria | 1363 |
| 637 | Ga0501076_0447731 | 3300049592 | Bacteria | 1063 |
| 638 | Ga0501076_0469402 | 3300049592 | Unclassified | 1036 |
| 639 | Ga0501077_0082459 | 3300049593 | Bacteria | 2038 |
| 640 | Ga0501077_0089549 | 3300049593 | Bacteria | 1950 |
| 641 | Ga0501077_0216671 | 3300049593 | Bacteria | 1217 |
| 642 | Ga0501077_0729289 | 3300049593 | Unclassified | 637 |
| 643 | Ga0501206_020076 | 3300049653 | Bacteria | 948 |
| 644 | Ga0501209_131927 | 3300049656 | Unclassified | 746 |
| 645 | Ga0501217_156755 | 3300049661 | Unclassified | 684 |
| 646 | Ga0501217_331337 | 3300049661 | Unclassified | 509 |
| 647 | Ga0501230_021571 | 3300049667 | Bacteria | 1130 |
| 648 | Ga0501233_003818 | 3300049668 | Bacteria | 2731 |
| 649 | Ga0501235_020905 | 3300049669 | Bacteria | 1453 |
| 650 | Ga0501249_091286 | 3300049679 | Unclassified | 723 |
| 651 | Ga0501253_032144 | 3300049683 | Bacteria | 1008 |
| 652 | Ga0501260_003362 | 3300049689 | Bacteria | 1433 |
| 653 | Ga0501261_026218 | 3300049690 | Unclassified | 861 |
| 654 | Ga0501219_005770 | 3300049703 | Unclassified | 883 |
| 655 | Ga0501229_014462 | 3300049706 | Unclassified | 1017 |
| 656 | Ga0501079_0045000 | 3300049741 | Bacteria | 3407 |
| 657 | Ga0501079_1014712 | 3300049741 | Unclassified | 654 |
| 658 | Ga0501079_1402425 | 3300049741 | Bacteria | 550 |
| 659 | Ga0501079_1647540 | 3300049741 | Unclassified | 505 |
| 660 | Ga0501080_1003199 | 3300049742 | Bacteria | 724 |
| 661 | Ga0501080_1358112 | 3300049742 | Unclassified | 607 |
| 662 | Ga0501080_1664427 | 3300049742 | Unclassified | 539 |
| 663 | Ga0501081_0234706 | 3300049743 | Bacteria | 1337 |
| 664 | Ga0501081_0425208 | 3300049743 | Bacteria | 985 |
| 665 | Ga0501081_1040655 | 3300049743 | Bacteria | 619 |
| 666 | Ga0501265_072078 | 3300049762 | Unclassified | 585 |
| 667 | Ga0501266_026730 | 3300049763 | Unclassified | 809 |
| 668 | Ga0501271_043819 | 3300049768 | Unclassified | 590 |
| 669 | Ga0501272_032630 | 3300049769 | Bacteria | 668 |
| 670 | Ga0501273_092545 | 3300049770 | Unclassified | 516 |
| 671 | Ga0501276_006317 | 3300049773 | Unclassified | 930 |
| 672 | Ga0501279_043427 | 3300049775 | Unclassified | 696 |
| 673 | Ga0501280_053797 | 3300049776 | Unclassified | 684 |
| 674 | Ga0501281_08569 | 3300049777 | Unclassified | 716 |
| 675 | Ga0501283_004428 | 3300049779 | Bacteria | 1899 |
| 676 | Ga0501283_004543 | 3300049779 | Bacteria | 1881 |
| 677 | Ga0501035_0809918 | 3300049822 | Bacteria | 748 |
| 678 | Ga0501035_0841069 | 3300049822 | Bacteria | 731 |
| 679 | Ga0501045_0519574 | 3300049824 | Bacteria | 884 |
| 680 | Ga0501045_0803480 | 3300049824 | Bacteria | 693 |
| 681 | Ga0501045_1319687 | 3300049824 | Bacteria | 525 |
| 682 | Ga0501212_081802 | 3300049851 | Unclassified | 585 |
| 683 | nmdc:mga05p37_134729_c1 | 3300050507 | Bacteria | 3030 |
| 684 | nmdc:mga05p37_135081_c2 | 3300050507 | Bacteria | 2725 |
| 685 | nmdc:mga05p37_136481_c1 | 3300050507 | Unclassified | 3008 |
| 686 | nmdc:mga05p37_1387628_c1 | 3300050507 | Unclassified | 709 |
| 687 | nmdc:mga05p37_145658_c1 | 3300050507 | Bacteria | 2901 |
| 688 | nmdc:mga05p37_179730_c1 | 3300050507 | Bacteria | 2575 |
| 689 | nmdc:mga05p37_201724_c1 | 3300050507 | Bacteria | 2408 |
| 690 | nmdc:mga05p37_202684_c1 | 3300050507 | Bacteria | 2402 |
| 691 | nmdc:mga05p37_2093548_c1 | 3300050507 | Bacteria | 531 |
| 692 | nmdc:mga05p37_231660_c1 | 3300050507 | Bacteria | 2225 |
| 693 | nmdc:mga05p37_314714_c1 | 3300050507 | Bacteria | 1854 |
| 694 | nmdc:mga05p37_323056_c1 | 3300050507 | Bacteria | 1826 |
| 695 | nmdc:mga05p37_32779_c1 | 3300050507 | Bacteria | 6356 |
| 696 | nmdc:mga05p37_393924_c1 | 3300050507 | Bacteria | 1619 |
| 697 | nmdc:mga05p37_405769_c1 | 3300050507 | Unclassified | 1590 |
| 698 | nmdc:mga05p37_49008_c1 | 3300050507 | Bacteria | 5194 |
| 699 | nmdc:mga05p37_50844_c1 | 3300050507 | Bacteria | 5097 |
| 700 | nmdc:mga05p37_52220_c1 | 3300050507 | Bacteria | 5027 |
| 701 | nmdc:mga05p37_545809_c1 | 3300050507 | Bacteria | 1321 |
| 702 | nmdc:mga05p37_550686_c1 | 3300050507 | Bacteria | 1313 |
| 703 | nmdc:mga05p37_609079_c1 | 3300050507 | Bacteria | 1231 |
| 704 | nmdc:mga05p37_912703_c1 | 3300050507 | Unclassified | 945 |
| 705 | nmdc:mga05p37_92103_c1 | 3300050507 | Bacteria | 3735 |
| 706 | nmdc:mga05p37_993881_c1 | 3300050507 | Unclassified | 892 |
| 707 | nmdc:mga09592_1113313_c1 | 3300050508 | Unclassified | 656 |
| 708 | nmdc:mga09592_1164313_c1 | 3300050508 | Unclassified | 639 |
| 709 | nmdc:mga09592_1193799_c1 | 3300050508 | Unclassified | 629 |
| 710 | nmdc:mga09592_1353381_c1 | 3300050508 | Bacteria | 584 |
| 711 | nmdc:mga09592_137997_c1 | 3300050508 | Bacteria | 2101 |
| 712 | nmdc:mga09592_1555585_c1 | 3300050508 | Unclassified | 537 |
| 713 | nmdc:mga09592_186148_c1 | 3300050508 | Bacteria | 1797 |
| 714 | nmdc:mga09592_18945_c1 | 3300050508 | Bacteria | 5647 |
| 715 | nmdc:mga09592_290521_c2 | 3300050508 | Bacteria | 621 |
| 716 | nmdc:mga09592_322593_c1 | 3300050508 | Unclassified | 1338 |
| 717 | nmdc:mga09592_331019_c1 | 3300050508 | Unclassified | 1319 |
| 718 | nmdc:mga09592_556788_c1 | 3300050508 | Bacteria | 985 |
| 719 | nmdc:mga09592_590815_c1 | 3300050508 | Unclassified | 952 |
| 720 | nmdc:mga09592_639_c1 | 3300050508 | Bacteria | 26621 |
| 721 | nmdc:mga09592_745033_c1 | 3300050508 | Unclassified | 832 |
| 722 | nmdc:mga09592_82197_c1 | 3300050508 | Bacteria | 2745 |
| 723 | nmdc:mga0qj67_1051448_c1 | 3300050509 | Unclassified | 637 |
| 724 | nmdc:mga0qj67_1055249_c1 | 3300050509 | Unclassified | 636 |
| 725 | nmdc:mga0qj67_1255643_c1 | 3300050509 | Bacteria | 575 |
| 726 | nmdc:mga0qj67_1434475_c1 | 3300050509 | Bacteria | 532 |
| 727 | nmdc:mga0qj67_159861_c1 | 3300050509 | Bacteria | 1829 |
| 728 | nmdc:mga0qj67_2718_c1 | 3300050509 | Bacteria | 12680 |
| 729 | nmdc:mga0qj67_4545_c1 | 3300050509 | Bacteria | 10054 |
| 730 | nmdc:mga0qj67_624736_c1 | 3300050509 | Unclassified | 861 |
| 731 | nmdc:mga0qj67_90121_c1 | 3300050509 | Unclassified | 2463 |
| 732 | nmdc:mga0qj67_96471_c1 | 3300050509 | Bacteria | 2380 |
| 733 | nmdc:mga06r32_1116398_c1 | 3300050510 | Viruses | 737 |
| 734 | nmdc:mga06r32_1274011_c1 | 3300050510 | Bacteria | 680 |
| 735 | nmdc:mga06r32_130201_c1 | 3300050510 | Unclassified | 2062 |
| 736 | nmdc:mga06r32_1428985_c1 | 3300050510 | Bacteria | 633 |
| 737 | nmdc:mga06r32_1467434_c1 | 3300050510 | Bacteria | 623 |
| 738 | nmdc:mga06r32_29065_c1 | 3300050510 | Bacteria | 5177 |
| 739 | nmdc:mga06r32_5095_c1 | 3300050510 | Bacteria | 11818 |
| 740 | nmdc:mga06r32_543806_c1 | 3300050510 | Bacteria | 1136 |
| 741 | nmdc:mga06r32_581912_c1 | 3300050510 | Bacteria | 1092 |
| 742 | nmdc:mga06r32_604142_c1 | 3300050510 | Bacteria | 1068 |
| 743 | nmdc:mga06r32_650721_c1 | 3300050510 | Bacteria | 1022 |
| 744 | nmdc:mga06r32_698615_c1 | 3300050510 | Bacteria | 980 |
| 745 | nmdc:mga06r32_742176_c1 | 3300050510 | Unclassified | 945 |
| 746 | nmdc:mga06r32_771229_c1 | 3300050510 | Unclassified | 924 |
| 747 | nmdc:mga06r32_925195_c1 | 3300050510 | Unclassified | 827 |
| 748 | nmdc:mga08y16_1057315_c1 | 3300050511 | Bacteria | 789 |
| 749 | nmdc:mga08y16_160828_c1 | 3300050511 | Bacteria | 2333 |
| 750 | nmdc:mga08y16_1748466_c1 | 3300050511 | Unclassified | 576 |
| 751 | nmdc:mga08y16_1916788_c1 | 3300050511 | Unclassified | 543 |
| 752 | nmdc:mga08y16_23063_c1 | 3300050511 | Bacteria | 6571 |
| 753 | nmdc:mga08y16_253154_c1 | 3300050511 | Bacteria | 1820 |
| 754 | nmdc:mga08y16_253658_c1 | 3300050511 | Bacteria | 1818 |
| 755 | nmdc:mga08y16_590497_c1 | 3300050511 | Bacteria | 1120 |
| 756 | nmdc:mga0n895_1244982_c1 | 3300050512 | Bacteria | 717 |
| 757 | nmdc:mga0n895_2032327_c1 | 3300050512 | Unclassified | 532 |
| 758 | nmdc:mga0n895_226986_c1 | 3300050512 | Bacteria | 1896 |
| 759 | nmdc:mga0n895_239822_c1 | 3300050512 | Bacteria | 1840 |
| 760 | nmdc:mga0n895_358965_c1 | 3300050512 | Bacteria | 1476 |
| 761 | nmdc:mga0n895_482369_c1 | 3300050512 | Bacteria | 1250 |
| 762 | nmdc:mga0n895_611736_c1 | 3300050512 | Bacteria | 1091 |
| 763 | nmdc:mga0n895_673787_c1 | 3300050512 | Bacteria | 1032 |
| 764 | nmdc:mga0n895_726099_c1 | 3300050512 | Bacteria | 988 |
| 765 | nmdc:mga0n895_7975_c1 | 3300050512 | Bacteria | 9132 |
| 766 | nmdc:mga0n895_972033_c1 | 3300050512 | Bacteria | 831 |
| 767 | nmdc:mga0n895_989502_c1 | 3300050512 | Unclassified | 823 |
| 768 | nmdc:mga0n895_99107_c1 | 3300050512 | Bacteria | 2922 |
| 769 | nmdc:mga0rr50_1731616_c1 | 3300050513 | Bacteria | 526 |
| 770 | nmdc:mga0rr50_195324_c1 | 3300050513 | Bacteria | 1660 |
| 771 | nmdc:mga0rr50_234067_c1 | 3300050513 | Bacteria | 1521 |
| 772 | nmdc:mga0rr50_309030_c1 | 3300050513 | Bacteria | 1324 |
| 773 | nmdc:mga0rr50_659_c1 | 3300050513 | Bacteria | 18530 |
| 774 | nmdc:mga0rr50_935784_c1 | 3300050513 | Bacteria | 739 |
| 775 | nmdc:mga08x19_187928_c1 | 3300050514 | Bacteria | 1412 |
| 776 | nmdc:mga08x19_311529_c1 | 3300050514 | Bacteria | 1094 |
| 777 | nmdc:mga08x19_45516_c1 | 3300050514 | Bacteria | 2804 |
| 778 | nmdc:mga08x19_483799_c1 | 3300050514 | Unclassified | 873 |
| 779 | nmdc:mga0a205_1038677_c1 | 3300050515 | Unclassified | 666 |
| 780 | nmdc:mga0a205_123268_c1 | 3300050515 | Bacteria | 2491 |
| 781 | nmdc:mga0a205_1233287_c1 | 3300050515 | Unclassified | 596 |
| 782 | nmdc:mga0a205_140160_c1 | 3300050515 | Bacteria | 2319 |
| 783 | nmdc:mga0a205_338398_c1 | 3300050515 | Bacteria | 1374 |
| 784 | nmdc:mga0a205_35291_c1 | 3300050515 | Bacteria | 4801 |
| 785 | nmdc:mga0a205_361_c1 | 3300050515 | Bacteria | 34318 |
| 786 | nmdc:mga0a205_454776_c1 | 3300050515 | Unclassified | 1140 |
| 787 | nmdc:mga0a205_46142_c2 | 3300050515 | Bacteria | 1052 |
| 788 | nmdc:mga0a205_469668_c1 | 3300050515 | Bacteria | 1117 |
| 789 | nmdc:mga0a205_541447_c1 | 3300050515 | Bacteria | 1020 |
| 790 | nmdc:mga0a205_635039_c1 | 3300050515 | Bacteria | 919 |
| 791 | nmdc:mga0a205_7044_c1 | 3300050515 | Bacteria | 10157 |
| 792 | nmdc:mga0a205_92973_c1 | 3300050515 | Bacteria | 2914 |
| 793 | Ga0500647_0337980 | 3300053091 | Bacteria | 631 |
| 794 | Ga0501084_0349202 | 3300054114 | Bacteria | 1250 |
| 795 | Ga0501084_0912633 | 3300054114 | Unclassified | 739 |
| 796 | Ga0501084_1080816 | 3300054114 | Unclassified | 674 |
| 797 | Ga0501084_1237462 | 3300054114 | Bacteria | 626 |
| 798 | Ga0590075_035851 | 3300059424 | Bacteria | 1264 |
| 799 | Ga0590075_177103 | 3300059424 | Unclassified | 564 |
| 800 | Ga0587084_147291 | 3300059477 | Bacteria | 515 |
| 801 | Ga0501082_0156966 | 3300060353 | Unclassified | 1977 |
| 802 | Ga0501082_0400572 | 3300060353 | Bacteria | 1198 |
| 803 | Ga0501082_1510686 | 3300060353 | Unclassified | 586 |
| 804 | Ga0530510_0124959 | 3300061734 | Bacteria | 1891 |
| 805 | Ga0530510_0575062 | 3300061734 | Bacteria | 856 |
| 806 | Ga0530510_0741731 | 3300061734 | Bacteria | 749 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006846 | Ga0075430_100804333 | Ga0075430_1008043331 | 45 |
| 2 | 3300031548 | Ga0307408_102320362 | Ga0307408_1023203621 | 45 |
| 3 | 3300031911 | Ga0307412_11926529 | Ga0307412_119265292 | 45 |
| 4 | 3300050509 | nmdc:mga0qj67_1255643_c1 | nmdc:mga0qj67_1255643_c1_105_257 | 45 |
| 5 | 3300005444 | Ga0070694_101867326 | Ga0070694_1018673261 | 46 |
| 6 | 3300050512 | nmdc:mga0n895_2032327_c1 | nmdc:mga0n895_2032327_c1_35_175 | 46 |
| 7 | 3300013100 | Ga0157373_11448723 | Ga0157373_114487231 | 47 |
| 8 | 3300026088 | Ga0207641_10159670 | Ga0207641_101596702 | 47 |
| 9 | 3300005327 | Ga0070658_10932872 | Ga0070658_109328722 | 49 |
| 10 | 3300005328 | Ga0070676_10757969 | Ga0070676_107579692 | 49 |
| 11 | 3300005330 | Ga0070690_100411240 | Ga0070690_1004112402 | 49 |
| 12 | 3300005334 | Ga0068869_100927541 | Ga0068869_1009275411 | 49 |
| 13 | 3300005335 | Ga0070666_10475435 | Ga0070666_104754352 | 49 |
| 14 | 3300005340 | Ga0070689_100494724 | Ga0070689_1004947242 | 49 |
| 15 | 3300005340 | Ga0070689_101476381 | Ga0070689_1014763812 | 49 |
| 16 | 3300005343 | Ga0070687_100762567 | Ga0070687_1007625671 | 49 |
| 17 | 3300005344 | Ga0070661_101771504 | Ga0070661_1017715042 | 49 |
| 18 | 3300005353 | Ga0070669_100019680 | Ga0070669_1000196804 | 49 |
| 19 | 3300005354 | Ga0070675_100029088 | Ga0070675_1000290885 | 49 |
| 20 | 3300005355 | Ga0070671_100130065 | Ga0070671_1001300652 | 49 |
| 21 | 3300005355 | Ga0070671_101600420 | Ga0070671_1016004202 | 49 |
| 22 | 3300005356 | Ga0070674_100199853 | Ga0070674_1001998532 | 49 |
| 23 | 3300005364 | Ga0070673_100002666 | Ga0070673_10000266610 | 49 |
| 24 | 3300005364 | Ga0070673_100069651 | Ga0070673_1000696512 | 49 |
| 25 | 3300005364 | Ga0070673_100089306 | Ga0070673_1000893062 | 49 |
| 26 | 3300005365 | Ga0070688_100153245 | Ga0070688_1001532451 | 49 |
| 27 | 3300005366 | Ga0070659_101624143 | Ga0070659_1016241431 | 49 |
| 28 | 3300005367 | Ga0070667_100183584 | Ga0070667_1001835843 | 49 |
| 29 | 3300005367 | Ga0070667_101176720 | Ga0070667_1011767202 | 49 |
| 30 | 3300005441 | Ga0070700_101253340 | Ga0070700_1012533402 | 49 |
| 31 | 3300005456 | Ga0070678_100801979 | Ga0070678_1008019792 | 49 |
| 32 | 3300005456 | Ga0070678_102093422 | Ga0070678_1020934221 | 49 |
| 33 | 3300005457 | Ga0070662_100662994 | Ga0070662_1006629941 | 49 |
| 34 | 3300005468 | Ga0070707_100632354 | Ga0070707_1006323543 | 49 |
| 35 | 3300005468 | Ga0070707_101185904 | Ga0070707_1011859042 | 49 |
| 36 | 3300005471 | Ga0070698_101148894 | Ga0070698_1011488942 | 49 |
| 37 | 3300005518 | Ga0070699_101161936 | Ga0070699_1011619362 | 49 |
| 38 | 3300005535 | Ga0070684_101016488 | Ga0070684_1010164881 | 49 |
| 39 | 3300005535 | Ga0070684_101218166 | Ga0070684_1012181662 | 49 |
| 40 | 3300005543 | Ga0070672_100029041 | Ga0070672_1000290413 | 49 |
| 41 | 3300005543 | Ga0070672_100184921 | Ga0070672_1001849213 | 49 |
| 42 | 3300005544 | Ga0070686_101372519 | Ga0070686_1013725192 | 49 |
| 43 | 3300005547 | Ga0070693_100706294 | Ga0070693_1007062942 | 49 |
| 44 | 3300005615 | Ga0070702_100086826 | Ga0070702_1000868263 | 49 |
| 45 | 3300005617 | Ga0068859_100117315 | Ga0068859_1001173153 | 49 |
| 46 | 3300005617 | Ga0068859_100178063 | Ga0068859_1001780632 | 49 |
| 47 | 3300005618 | Ga0068864_100808080 | Ga0068864_1008080803 | 49 |
| 48 | 3300005618 | Ga0068864_102346092 | Ga0068864_1023460922 | 49 |
| 49 | 3300005719 | Ga0068861_100052875 | Ga0068861_1000528752 | 49 |
| 50 | 3300005842 | Ga0068858_101206012 | Ga0068858_1012060122 | 49 |
| 51 | 3300005844 | Ga0068862_101544002 | Ga0068862_1015440022 | 49 |
| 52 | 3300006881 | Ga0068865_101043006 | Ga0068865_1010430061 | 49 |
| 53 | 3300006931 | Ga0097620_100117317 | Ga0097620_1001173172 | 49 |
| 54 | 3300006931 | Ga0097620_100178053 | Ga0097620_1001780532 | 49 |
| 55 | 3300009094 | Ga0111539_11473899 | Ga0111539_114738992 | 49 |
| 56 | 3300009177 | Ga0105248_10223054 | Ga0105248_102230541 | 49 |
| 57 | 3300009177 | Ga0105248_10364733 | Ga0105248_103647332 | 49 |
| 58 | 3300009177 | Ga0105248_11456340 | Ga0105248_114563402 | 49 |
| 59 | 3300013308 | Ga0157375_10247727 | Ga0157375_102477273 | 49 |
| 60 | 3300014326 | Ga0157380_10028062 | Ga0157380_100280624 | 49 |
| 61 | 3300014326 | Ga0157380_10597012 | Ga0157380_105970122 | 49 |
| 62 | 3300014745 | Ga0157377_10014033 | Ga0157377_100140333 | 49 |
| 63 | 3300014969 | Ga0157376_10959620 | Ga0157376_109596201 | 49 |
| 64 | 3300025907 | Ga0207645_10577425 | Ga0207645_105774253 | 49 |
| 65 | 3300025917 | Ga0207660_10770483 | Ga0207660_107704832 | 49 |
| 66 | 3300025922 | Ga0207646_11175456 | Ga0207646_111754562 | 49 |
| 67 | 3300025923 | Ga0207681_10267618 | Ga0207681_102676182 | 49 |
| 68 | 3300025925 | Ga0207650_10583585 | Ga0207650_105835852 | 49 |
| 69 | 3300025926 | Ga0207659_10069896 | Ga0207659_100698963 | 49 |
| 70 | 3300025931 | Ga0207644_10030659 | Ga0207644_100306592 | 49 |
| 71 | 3300025932 | Ga0207690_11255031 | Ga0207690_112550312 | 49 |
| 72 | 3300025933 | Ga0207706_10135695 | Ga0207706_101356952 | 49 |
| 73 | 3300025938 | Ga0207704_11367407 | Ga0207704_113674071 | 49 |
| 74 | 3300025940 | Ga0207691_10016009 | Ga0207691_100160095 | 49 |
| 75 | 3300025940 | Ga0207691_10255908 | Ga0207691_102559083 | 49 |
| 76 | 3300025941 | Ga0207711_10251537 | Ga0207711_102515372 | 49 |
| 77 | 3300025941 | Ga0207711_10474898 | Ga0207711_104748983 | 49 |
| 78 | 3300025941 | Ga0207711_11975395 | Ga0207711_119753951 | 49 |
| 79 | 3300025942 | Ga0207689_11221738 | Ga0207689_112217381 | 49 |
| 80 | 3300025942 | Ga0207689_11317704 | Ga0207689_113177042 | 49 |
| 81 | 3300025960 | Ga0207651_10033306 | Ga0207651_100333063 | 49 |
| 82 | 3300025960 | Ga0207651_10052560 | Ga0207651_100525604 | 49 |
| 83 | 3300025960 | Ga0207651_11342025 | Ga0207651_113420251 | 49 |
| 84 | 3300025986 | Ga0207658_11810880 | Ga0207658_118108801 | 49 |
| 85 | 3300026023 | Ga0207677_10280493 | Ga0207677_102804933 | 49 |
| 86 | 3300026035 | Ga0207703_10356353 | Ga0207703_103563532 | 49 |
| 87 | 3300026075 | Ga0207708_10316947 | Ga0207708_103169473 | 49 |
| 88 | 3300026088 | Ga0207641_11252878 | Ga0207641_112528782 | 49 |
| 89 | 3300026089 | Ga0207648_11150676 | Ga0207648_111506762 | 49 |
| 90 | 3300026095 | Ga0207676_11033927 | Ga0207676_110339272 | 49 |
| 91 | 3300026118 | Ga0207675_100364633 | Ga0207675_1003646332 | 49 |
| 92 | 3300026121 | Ga0207683_10169630 | Ga0207683_101696303 | 49 |
| 93 | 3300028380 | Ga0268265_11565388 | Ga0268265_115653882 | 49 |
| 94 | 3300031824 | Ga0307413_11215390 | Ga0307413_112153901 | 49 |
| 95 | 3300031852 | Ga0307410_10507054 | Ga0307410_105070542 | 49 |
| 96 | 3300031903 | Ga0307407_10438252 | Ga0307407_104382522 | 49 |
| 97 | 3300031903 | Ga0307407_10551922 | Ga0307407_105519222 | 49 |
| 98 | 3300031995 | Ga0307409_100561028 | Ga0307409_1005610282 | 49 |
| 99 | 3300031995 | Ga0307409_100969066 | Ga0307409_1009690663 | 49 |
| 100 | 3300032002 | Ga0307416_100562758 | Ga0307416_1005627583 | 49 |
| 101 | 3300046684 | Ga0495669_0149782 | Ga0495669_0149782_202_366 | 49 |
| 102 | 3300047318 | Ga0495636_0488785 | Ga0495636_0488785_55_219 | 49 |
| 103 | 3300001990 | JGI24737J22298_10247975 | JGI24737J22298_102479751 | 50 |
| 104 | 3300003371 | JGI26145J50221_1001561 | JGI26145J50221_10015613 | 50 |
| 105 | 3300004798 | Ga0058859_10071813 | Ga0058859_100718133 | 50 |
| 106 | 3300004801 | Ga0058860_10944608 | Ga0058860_109446083 | 50 |
| 107 | 3300005289 | Ga0065704_10654044 | Ga0065704_106540441 | 50 |
| 108 | 3300005290 | Ga0065712_10048009 | Ga0065712_100480091 | 50 |
| 109 | 3300005293 | Ga0065715_10407420 | Ga0065715_104074201 | 50 |
| 110 | 3300005295 | Ga0065707_10153166 | Ga0065707_101531663 | 50 |
| 111 | 3300005329 | Ga0070683_100112441 | Ga0070683_1001124412 | 50 |
| 112 | 3300005330 | Ga0070690_100119199 | Ga0070690_1001191993 | 50 |
| 113 | 3300005330 | Ga0070690_101189982 | Ga0070690_1011899822 | 50 |
| 114 | 3300005331 | Ga0070670_100735181 | Ga0070670_1007351813 | 50 |
| 115 | 3300005333 | Ga0070677_10536158 | Ga0070677_105361582 | 50 |
| 116 | 3300005334 | Ga0068869_100131138 | Ga0068869_1001311383 | 50 |
| 117 | 3300005334 | Ga0068869_101413723 | Ga0068869_1014137232 | 50 |
| 118 | 3300005336 | Ga0070680_100002059 | Ga0070680_10000205914 | 50 |
| 119 | 3300005336 | Ga0070680_100275657 | Ga0070680_1002756572 | 50 |
| 120 | 3300005338 | Ga0068868_100393531 | Ga0068868_1003935311 | 50 |
| 121 | 3300005338 | Ga0068868_100752100 | Ga0068868_1007521002 | 50 |
| 122 | 3300005339 | Ga0070660_100240370 | Ga0070660_1002403702 | 50 |
| 123 | 3300005339 | Ga0070660_100357290 | Ga0070660_1003572902 | 50 |
| 124 | 3300005340 | Ga0070689_100043834 | Ga0070689_1000438343 | 50 |
| 125 | 3300005340 | Ga0070689_101077864 | Ga0070689_1010778642 | 50 |
| 126 | 3300005341 | Ga0070691_10019602 | Ga0070691_100196023 | 50 |
| 127 | 3300005341 | Ga0070691_10113955 | Ga0070691_101139552 | 50 |
| 128 | 3300005343 | Ga0070687_100100597 | Ga0070687_1001005973 | 50 |
| 129 | 3300005343 | Ga0070687_101189531 | Ga0070687_1011895312 | 50 |
| 130 | 3300005344 | Ga0070661_100032523 | Ga0070661_1000325234 | 50 |
| 131 | 3300005345 | Ga0070692_10880169 | Ga0070692_108801691 | 50 |
| 132 | 3300005347 | Ga0070668_100045278 | Ga0070668_1000452783 | 50 |
| 133 | 3300005347 | Ga0070668_100075893 | Ga0070668_1000758933 | 50 |
| 134 | 3300005353 | Ga0070669_100079723 | Ga0070669_1000797232 | 50 |
| 135 | 3300005353 | Ga0070669_100557903 | Ga0070669_1005579033 | 50 |
| 136 | 3300005354 | Ga0070675_101158214 | Ga0070675_1011582142 | 50 |
| 137 | 3300005356 | Ga0070674_100031408 | Ga0070674_1000314085 | 50 |
| 138 | 3300005356 | Ga0070674_101305307 | Ga0070674_1013053071 | 50 |
| 139 | 3300005364 | Ga0070673_102145989 | Ga0070673_1021459892 | 50 |
| 140 | 3300005365 | Ga0070688_100024928 | Ga0070688_1000249284 | 50 |
| 141 | 3300005366 | Ga0070659_100041847 | Ga0070659_1000418472 | 50 |
| 142 | 3300005367 | Ga0070667_100957832 | Ga0070667_1009578322 | 50 |
| 143 | 3300005435 | Ga0070714_100254765 | Ga0070714_1002547653 | 50 |
| 144 | 3300005438 | Ga0070701_10196160 | Ga0070701_101961602 | 50 |
| 145 | 3300005438 | Ga0070701_10964533 | Ga0070701_109645331 | 50 |
| 146 | 3300005439 | Ga0070711_100082865 | Ga0070711_1000828653 | 50 |
| 147 | 3300005440 | Ga0070705_100308159 | Ga0070705_1003081592 | 50 |
| 148 | 3300005440 | Ga0070705_100545003 | Ga0070705_1005450033 | 50 |
| 149 | 3300005441 | Ga0070700_100025268 | Ga0070700_1000252682 | 50 |
| 150 | 3300005441 | Ga0070700_100270531 | Ga0070700_1002705312 | 50 |
| 151 | 3300005441 | Ga0070700_100865109 | Ga0070700_1008651091 | 50 |
| 152 | 3300005444 | Ga0070694_100031366 | Ga0070694_1000313664 | 50 |
| 153 | 3300005445 | Ga0070708_100221606 | Ga0070708_1002216061 | 50 |
| 154 | 3300005445 | Ga0070708_100238033 | Ga0070708_1002380332 | 50 |
| 155 | 3300005445 | Ga0070708_100555300 | Ga0070708_1005553002 | 50 |
| 156 | 3300005445 | Ga0070708_102218197 | Ga0070708_1022181971 | 50 |
| 157 | 3300005455 | Ga0070663_100074878 | Ga0070663_1000748782 | 50 |
| 158 | 3300005455 | Ga0070663_101166080 | Ga0070663_1011660802 | 50 |
| 159 | 3300005456 | Ga0070678_100158794 | Ga0070678_1001587943 | 50 |
| 160 | 3300005457 | Ga0070662_100245139 | Ga0070662_1002451393 | 50 |
| 161 | 3300005457 | Ga0070662_100282808 | Ga0070662_1002828082 | 50 |
| 162 | 3300005458 | Ga0070681_10000612 | Ga0070681_1000061219 | 50 |
| 163 | 3300005458 | Ga0070681_10006622 | Ga0070681_1000662210 | 50 |
| 164 | 3300005458 | Ga0070681_10044888 | Ga0070681_100448884 | 50 |
| 165 | 3300005459 | Ga0068867_100126336 | Ga0068867_1001263362 | 50 |
| 166 | 3300005459 | Ga0068867_100300830 | Ga0068867_1003008302 | 50 |
| 167 | 3300005459 | Ga0068867_100995593 | Ga0068867_1009955933 | 50 |
| 168 | 3300005466 | Ga0070685_11485602 | Ga0070685_114856021 | 50 |
| 169 | 3300005467 | Ga0070706_100072236 | Ga0070706_1000722363 | 50 |
| 170 | 3300005467 | Ga0070706_100078810 | Ga0070706_1000788103 | 50 |
| 171 | 3300005467 | Ga0070706_100183798 | Ga0070706_1001837984 | 50 |
| 172 | 3300005467 | Ga0070706_100387146 | Ga0070706_1003871463 | 50 |
| 173 | 3300005467 | Ga0070706_101411583 | Ga0070706_1014115831 | 50 |
| 174 | 3300005467 | Ga0070706_101799410 | Ga0070706_1017994101 | 50 |
| 175 | 3300005468 | Ga0070707_100290937 | Ga0070707_1002909371 | 50 |
| 176 | 3300005471 | Ga0070698_100003892 | Ga0070698_10000389215 | 50 |
| 177 | 3300005471 | Ga0070698_100012841 | Ga0070698_1000128415 | 50 |
| 178 | 3300005471 | Ga0070698_100436686 | Ga0070698_1004366862 | 50 |
| 179 | 3300005471 | Ga0070698_100882090 | Ga0070698_1008820901 | 50 |
| 180 | 3300005471 | Ga0070698_101725027 | Ga0070698_1017250272 | 50 |
| 181 | 3300005471 | Ga0070698_102169158 | Ga0070698_1021691581 | 50 |
| 182 | 3300005518 | Ga0070699_100017618 | Ga0070699_1000176187 | 50 |
| 183 | 3300005518 | Ga0070699_100023190 | Ga0070699_1000231905 | 50 |
| 184 | 3300005518 | Ga0070699_100697937 | Ga0070699_1006979371 | 50 |
| 185 | 3300005530 | Ga0070679_100009667 | Ga0070679_10000966710 | 50 |
| 186 | 3300005530 | Ga0070679_100839969 | Ga0070679_1008399693 | 50 |
| 187 | 3300005530 | Ga0070679_101916275 | Ga0070679_1019162752 | 50 |
| 188 | 3300005536 | Ga0070697_100008497 | Ga0070697_1000084977 | 50 |
| 189 | 3300005536 | Ga0070697_100236257 | Ga0070697_1002362572 | 50 |
| 190 | 3300005536 | Ga0070697_100257254 | Ga0070697_1002572541 | 50 |
| 191 | 3300005536 | Ga0070697_100700473 | Ga0070697_1007004733 | 50 |
| 192 | 3300005536 | Ga0070697_100855014 | Ga0070697_1008550142 | 50 |
| 193 | 3300005536 | Ga0070697_101134556 | Ga0070697_1011345562 | 50 |
| 194 | 3300005536 | Ga0070697_101414429 | Ga0070697_1014144292 | 50 |
| 195 | 3300005536 | Ga0070697_102130660 | Ga0070697_1021306601 | 50 |
| 196 | 3300005539 | Ga0068853_101272002 | Ga0068853_1012720022 | 50 |
| 197 | 3300005543 | Ga0070672_100112126 | Ga0070672_1001121263 | 50 |
| 198 | 3300005543 | Ga0070672_100191034 | Ga0070672_1001910343 | 50 |
| 199 | 3300005544 | Ga0070686_100276543 | Ga0070686_1002765433 | 50 |
| 200 | 3300005544 | Ga0070686_100308426 | Ga0070686_1003084263 | 50 |
| 201 | 3300005544 | Ga0070686_101791432 | Ga0070686_1017914322 | 50 |
| 202 | 3300005545 | Ga0070695_100195923 | Ga0070695_1001959232 | 50 |
| 203 | 3300005546 | Ga0070696_100002400 | Ga0070696_1000024007 | 50 |
| 204 | 3300005546 | Ga0070696_100273636 | Ga0070696_1002736363 | 50 |
| 205 | 3300005546 | Ga0070696_100523096 | Ga0070696_1005230962 | 50 |
| 206 | 3300005546 | Ga0070696_100661996 | Ga0070696_1006619962 | 50 |
| 207 | 3300005546 | Ga0070696_101157297 | Ga0070696_1011572971 | 50 |
| 208 | 3300005547 | Ga0070693_100105159 | Ga0070693_1001051593 | 50 |
| 209 | 3300005548 | Ga0070665_100162554 | Ga0070665_1001625543 | 50 |
| 210 | 3300005549 | Ga0070704_100032657 | Ga0070704_1000326571 | 50 |
| 211 | 3300005549 | Ga0070704_100434320 | Ga0070704_1004343201 | 50 |
| 212 | 3300005549 | Ga0070704_101422199 | Ga0070704_1014221992 | 50 |
| 213 | 3300005549 | Ga0070704_101856848 | Ga0070704_1018568481 | 50 |
| 214 | 3300005563 | Ga0068855_100033978 | Ga0068855_1000339784 | 50 |
| 215 | 3300005577 | Ga0068857_101057545 | Ga0068857_1010575452 | 50 |
| 216 | 3300005577 | Ga0068857_101712705 | Ga0068857_1017127052 | 50 |
| 217 | 3300005577 | Ga0068857_101945163 | Ga0068857_1019451632 | 50 |
| 218 | 3300005578 | Ga0068854_100116537 | Ga0068854_1001165372 | 50 |
| 219 | 3300005578 | Ga0068854_101063181 | Ga0068854_1010631811 | 50 |
| 220 | 3300005578 | Ga0068854_101348843 | Ga0068854_1013488432 | 50 |
| 221 | 3300005578 | Ga0068854_102010834 | Ga0068854_1020108341 | 50 |
| 222 | 3300005614 | Ga0068856_100109899 | Ga0068856_1001098992 | 50 |
| 223 | 3300005615 | Ga0070702_100176040 | Ga0070702_1001760401 | 50 |
| 224 | 3300005615 | Ga0070702_100655211 | Ga0070702_1006552112 | 50 |
| 225 | 3300005615 | Ga0070702_101168025 | Ga0070702_1011680251 | 50 |
| 226 | 3300005616 | Ga0068852_100629655 | Ga0068852_1006296553 | 50 |
| 227 | 3300005617 | Ga0068859_100139669 | Ga0068859_1001396693 | 50 |
| 228 | 3300005617 | Ga0068859_100416127 | Ga0068859_1004161272 | 50 |
| 229 | 3300005617 | Ga0068859_101884178 | Ga0068859_1018841781 | 50 |
| 230 | 3300005718 | Ga0068866_10165297 | Ga0068866_101652972 | 50 |
| 231 | 3300005718 | Ga0068866_10477348 | Ga0068866_104773481 | 50 |
| 232 | 3300005719 | Ga0068861_100244284 | Ga0068861_1002442843 | 50 |
| 233 | 3300005719 | Ga0068861_100626979 | Ga0068861_1006269793 | 50 |
| 234 | 3300005719 | Ga0068861_102346235 | Ga0068861_1023462351 | 50 |
| 235 | 3300005840 | Ga0068870_10173702 | Ga0068870_101737021 | 50 |
| 236 | 3300005841 | Ga0068863_100230024 | Ga0068863_1002300242 | 50 |
| 237 | 3300005842 | Ga0068858_100164009 | Ga0068858_1001640092 | 50 |
| 238 | 3300005842 | Ga0068858_100487806 | Ga0068858_1004878062 | 50 |
| 239 | 3300005842 | Ga0068858_100850576 | Ga0068858_1008505763 | 50 |
| 240 | 3300005842 | Ga0068858_101373868 | Ga0068858_1013738682 | 50 |
| 241 | 3300005842 | Ga0068858_102491653 | Ga0068858_1024916532 | 50 |
| 242 | 3300005843 | Ga0068860_100137552 | Ga0068860_1001375523 | 50 |
| 243 | 3300005843 | Ga0068860_100235307 | Ga0068860_1002353073 | 50 |
| 244 | 3300005843 | Ga0068860_100894598 | Ga0068860_1008945983 | 50 |
| 245 | 3300005843 | Ga0068860_101298612 | Ga0068860_1012986122 | 50 |
| 246 | 3300005843 | Ga0068860_102236194 | Ga0068860_1022361941 | 50 |
| 247 | 3300005844 | Ga0068862_100104397 | Ga0068862_1001043972 | 50 |
| 248 | 3300005844 | Ga0068862_100121605 | Ga0068862_1001216053 | 50 |
| 249 | 3300005844 | Ga0068862_101250191 | Ga0068862_1012501912 | 50 |
| 250 | 3300005937 | Ga0081455_10003374 | Ga0081455_1000337410 | 50 |
| 251 | 3300005937 | Ga0081455_10005104 | Ga0081455_1000510416 | 50 |
| 252 | 3300005937 | Ga0081455_10005732 | Ga0081455_100057325 | 50 |
| 253 | 3300005937 | Ga0081455_10165463 | Ga0081455_101654632 | 50 |
| 254 | 3300005981 | Ga0081538_10003359 | Ga0081538_1000335912 | 50 |
| 255 | 3300005981 | Ga0081538_10007871 | Ga0081538_100078711 | 50 |
| 256 | 3300005981 | Ga0081538_10025886 | Ga0081538_100258865 | 50 |
| 257 | 3300005983 | Ga0081540_1004479 | Ga0081540_100447911 | 50 |
| 258 | 3300006058 | Ga0075432_10032086 | Ga0075432_100320862 | 50 |
| 259 | 3300006058 | Ga0075432_10101768 | Ga0075432_101017682 | 50 |
| 260 | 3300006058 | Ga0075432_10572467 | Ga0075432_105724672 | 50 |
| 261 | 3300006194 | Ga0075427_10071128 | Ga0075427_100711282 | 50 |
| 262 | 3300006237 | Ga0097621_100100525 | Ga0097621_1001005252 | 50 |
| 263 | 3300006237 | Ga0097621_100501085 | Ga0097621_1005010851 | 50 |
| 264 | 3300006358 | Ga0068871_100124807 | Ga0068871_1001248073 | 50 |
| 265 | 3300006844 | Ga0075428_100002796 | Ga0075428_10000279613 | 50 |
| 266 | 3300006844 | Ga0075428_100016284 | Ga0075428_1000162841 | 50 |
| 267 | 3300006844 | Ga0075428_100078772 | Ga0075428_1000787724 | 50 |
| 268 | 3300006844 | Ga0075428_100091223 | Ga0075428_1000912233 | 50 |
| 269 | 3300006844 | Ga0075428_100109417 | Ga0075428_1001094174 | 50 |
| 270 | 3300006844 | Ga0075428_100221432 | Ga0075428_1002214323 | 50 |
| 271 | 3300006844 | Ga0075428_100264965 | Ga0075428_1002649652 | 50 |
| 272 | 3300006844 | Ga0075428_100401352 | Ga0075428_1004013523 | 50 |
| 273 | 3300006844 | Ga0075428_100465279 | Ga0075428_1004652793 | 50 |
| 274 | 3300006844 | Ga0075428_100566354 | Ga0075428_1005663541 | 50 |
| 275 | 3300006844 | Ga0075428_100746288 | Ga0075428_1007462882 | 50 |
| 276 | 3300006844 | Ga0075428_100780685 | Ga0075428_1007806852 | 50 |
| 277 | 3300006844 | Ga0075428_101092869 | Ga0075428_1010928691 | 50 |
| 278 | 3300006844 | Ga0075428_101729396 | Ga0075428_1017293962 | 50 |
| 279 | 3300006846 | Ga0075430_100003745 | Ga0075430_1000037457 | 50 |
| 280 | 3300006846 | Ga0075430_100008951 | Ga0075430_1000089518 | 50 |
| 281 | 3300006846 | Ga0075430_100036044 | Ga0075430_1000360444 | 50 |
| 282 | 3300006846 | Ga0075430_100062272 | Ga0075430_1000622722 | 50 |
| 283 | 3300006846 | Ga0075430_100079885 | Ga0075430_1000798853 | 50 |
| 284 | 3300006846 | Ga0075430_100150682 | Ga0075430_1001506822 | 50 |
| 285 | 3300006846 | Ga0075430_100170153 | Ga0075430_1001701533 | 50 |
| 286 | 3300006846 | Ga0075430_100285943 | Ga0075430_1002859431 | 50 |
| 287 | 3300006847 | Ga0075431_100005537 | Ga0075431_10000553711 | 50 |
| 288 | 3300006847 | Ga0075431_100034193 | Ga0075431_1000341934 | 50 |
| 289 | 3300006847 | Ga0075431_100042249 | Ga0075431_1000422496 | 50 |
| 290 | 3300006847 | Ga0075431_100239719 | Ga0075431_1002397193 | 50 |
| 291 | 3300006847 | Ga0075431_100245256 | Ga0075431_1002452563 | 50 |
| 292 | 3300006847 | Ga0075431_100332254 | Ga0075431_1003322542 | 50 |
| 293 | 3300006847 | Ga0075431_100435569 | Ga0075431_1004355692 | 50 |
| 294 | 3300006847 | Ga0075431_100789070 | Ga0075431_1007890702 | 50 |
| 295 | 3300006847 | Ga0075431_100897437 | Ga0075431_1008974372 | 50 |
| 296 | 3300006847 | Ga0075431_100976500 | Ga0075431_1009765002 | 50 |
| 297 | 3300006847 | Ga0075431_101344869 | Ga0075431_1013448691 | 50 |
| 298 | 3300006847 | Ga0075431_101656039 | Ga0075431_1016560392 | 50 |
| 299 | 3300006852 | Ga0075433_10001398 | Ga0075433_100013984 | 50 |
| 300 | 3300006852 | Ga0075433_10069168 | Ga0075433_100691683 | 50 |
| 301 | 3300006852 | Ga0075433_10113828 | Ga0075433_101138283 | 50 |
| 302 | 3300006852 | Ga0075433_10278156 | Ga0075433_102781563 | 50 |
| 303 | 3300006852 | Ga0075433_10307026 | Ga0075433_103070262 | 50 |
| 304 | 3300006852 | Ga0075433_10615978 | Ga0075433_106159782 | 50 |
| 305 | 3300006852 | Ga0075433_11289663 | Ga0075433_112896632 | 50 |
| 306 | 3300006852 | Ga0075433_11596206 | Ga0075433_115962062 | 50 |
| 307 | 3300006852 | Ga0075433_11612485 | Ga0075433_116124852 | 50 |
| 308 | 3300006871 | Ga0075434_100037785 | Ga0075434_1000377854 | 50 |
| 309 | 3300006871 | Ga0075434_100051110 | Ga0075434_1000511104 | 50 |
| 310 | 3300006871 | Ga0075434_100094512 | Ga0075434_1000945123 | 50 |
| 311 | 3300006871 | Ga0075434_100126059 | Ga0075434_1001260593 | 50 |
| 312 | 3300006871 | Ga0075434_100394669 | Ga0075434_1003946693 | 50 |
| 313 | 3300006871 | Ga0075434_100506720 | Ga0075434_1005067202 | 50 |
| 314 | 3300006871 | Ga0075434_100537724 | Ga0075434_1005377241 | 50 |
| 315 | 3300006871 | Ga0075434_100981995 | Ga0075434_1009819951 | 50 |
| 316 | 3300006871 | Ga0075434_101852546 | Ga0075434_1018525461 | 50 |
| 317 | 3300006880 | Ga0075429_100015697 | Ga0075429_1000156978 | 50 |
| 318 | 3300006880 | Ga0075429_100029066 | Ga0075429_1000290666 | 50 |
| 319 | 3300006880 | Ga0075429_100057299 | Ga0075429_1000572993 | 50 |
| 320 | 3300006880 | Ga0075429_100100865 | Ga0075429_1001008653 | 50 |
| 321 | 3300006880 | Ga0075429_100115496 | Ga0075429_1001154962 | 50 |
| 322 | 3300006880 | Ga0075429_100316672 | Ga0075429_1003166722 | 50 |
| 323 | 3300006880 | Ga0075429_100334401 | Ga0075429_1003344013 | 50 |
| 324 | 3300006880 | Ga0075429_100340108 | Ga0075429_1003401081 | 50 |
| 325 | 3300006880 | Ga0075429_100438749 | Ga0075429_1004387493 | 50 |
| 326 | 3300006880 | Ga0075429_100572330 | Ga0075429_1005723302 | 50 |
| 327 | 3300006880 | Ga0075429_100853910 | Ga0075429_1008539102 | 50 |
| 328 | 3300006880 | Ga0075429_100930617 | Ga0075429_1009306171 | 50 |
| 329 | 3300006880 | Ga0075429_100952181 | Ga0075429_1009521812 | 50 |
| 330 | 3300006881 | Ga0068865_100006629 | Ga0068865_1000066297 | 50 |
| 331 | 3300006881 | Ga0068865_100284233 | Ga0068865_1002842332 | 50 |
| 332 | 3300006914 | Ga0075436_100046776 | Ga0075436_1000467764 | 50 |
| 333 | 3300006914 | Ga0075436_100048127 | Ga0075436_1000481275 | 50 |
| 334 | 3300006931 | Ga0097620_100139667 | Ga0097620_1001396672 | 50 |
| 335 | 3300006931 | Ga0097620_100416110 | Ga0097620_1004161102 | 50 |
| 336 | 3300006931 | Ga0097620_101883779 | Ga0097620_1018837791 | 50 |
| 337 | 3300007076 | Ga0075435_100027752 | Ga0075435_1000277521 | 50 |
| 338 | 3300007076 | Ga0075435_100270730 | Ga0075435_1002707303 | 50 |
| 339 | 3300007076 | Ga0075435_100293944 | Ga0075435_1002939443 | 50 |
| 340 | 3300007076 | Ga0075435_100395860 | Ga0075435_1003958603 | 50 |
| 341 | 3300007076 | Ga0075435_100484658 | Ga0075435_1004846582 | 50 |
| 342 | 3300007076 | Ga0075435_101094569 | Ga0075435_1010945692 | 50 |
| 343 | 3300007076 | Ga0075435_101124038 | Ga0075435_1011240382 | 50 |
| 344 | 3300007265 | Ga0099794_10301156 | Ga0099794_103011562 | 50 |
| 345 | 3300007265 | Ga0099794_10441169 | Ga0099794_104411692 | 50 |
| 346 | 3300009093 | Ga0105240_10041272 | Ga0105240_100412728 | 50 |
| 347 | 3300009093 | Ga0105240_10162322 | Ga0105240_101623223 | 50 |
| 348 | 3300009093 | Ga0105240_10674163 | Ga0105240_106741631 | 50 |
| 349 | 3300009094 | Ga0111539_10020928 | Ga0111539_100209283 | 50 |
| 350 | 3300009094 | Ga0111539_10060788 | Ga0111539_100607883 | 50 |
| 351 | 3300009094 | Ga0111539_10178995 | Ga0111539_101789951 | 50 |
| 352 | 3300009094 | Ga0111539_10290129 | Ga0111539_102901291 | 50 |
| 353 | 3300009094 | Ga0111539_10702989 | Ga0111539_107029892 | 50 |
| 354 | 3300009094 | Ga0111539_10888374 | Ga0111539_108883742 | 50 |
| 355 | 3300009094 | Ga0111539_11189737 | Ga0111539_111897372 | 50 |
| 356 | 3300009098 | Ga0105245_12441907 | Ga0105245_124419072 | 50 |
| 357 | 3300009101 | Ga0105247_10454737 | Ga0105247_104547372 | 50 |
| 358 | 3300009147 | Ga0114129_10005952 | Ga0114129_1000595215 | 50 |
| 359 | 3300009147 | Ga0114129_10018701 | Ga0114129_100187013 | 50 |
| 360 | 3300009147 | Ga0114129_10059350 | Ga0114129_100593503 | 50 |
| 361 | 3300009147 | Ga0114129_10069903 | Ga0114129_100699035 | 50 |
| 362 | 3300009147 | Ga0114129_10085812 | Ga0114129_100858127 | 50 |
| 363 | 3300009147 | Ga0114129_10090670 | Ga0114129_100906704 | 50 |
| 364 | 3300009147 | Ga0114129_10111773 | Ga0114129_101117733 | 50 |
| 365 | 3300009147 | Ga0114129_10120706 | Ga0114129_101207062 | 50 |
| 366 | 3300009147 | Ga0114129_10145165 | Ga0114129_101451653 | 50 |
| 367 | 3300009147 | Ga0114129_10168844 | Ga0114129_101688442 | 50 |
| 368 | 3300009147 | Ga0114129_10315401 | Ga0114129_103154013 | 50 |
| 369 | 3300009147 | Ga0114129_10447922 | Ga0114129_104479223 | 50 |
| 370 | 3300009147 | Ga0114129_10489429 | Ga0114129_104894294 | 50 |
| 371 | 3300009147 | Ga0114129_10647811 | Ga0114129_106478112 | 50 |
| 372 | 3300009147 | Ga0114129_10737160 | Ga0114129_107371603 | 50 |
| 373 | 3300009147 | Ga0114129_10986572 | Ga0114129_109865722 | 50 |
| 374 | 3300009147 | Ga0114129_11031046 | Ga0114129_110310461 | 50 |
| 375 | 3300009147 | Ga0114129_11039326 | Ga0114129_110393262 | 50 |
| 376 | 3300009147 | Ga0114129_11058995 | Ga0114129_110589951 | 50 |
| 377 | 3300009147 | Ga0114129_11069671 | Ga0114129_110696713 | 50 |
| 378 | 3300009147 | Ga0114129_11123895 | Ga0114129_111238951 | 50 |
| 379 | 3300009147 | Ga0114129_11206821 | Ga0114129_112068213 | 50 |
| 380 | 3300009147 | Ga0114129_11253583 | Ga0114129_112535833 | 50 |
| 381 | 3300009147 | Ga0114129_11262640 | Ga0114129_112626402 | 50 |
| 382 | 3300009147 | Ga0114129_11362653 | Ga0114129_113626531 | 50 |
| 383 | 3300009147 | Ga0114129_11955566 | Ga0114129_119555661 | 50 |
| 384 | 3300009147 | Ga0114129_12269091 | Ga0114129_122690912 | 50 |
| 385 | 3300009147 | Ga0114129_13470155 | Ga0114129_134701551 | 50 |
| 386 | 3300009148 | Ga0105243_10027900 | Ga0105243_100279003 | 50 |
| 387 | 3300009148 | Ga0105243_10073463 | Ga0105243_100734633 | 50 |
| 388 | 3300009148 | Ga0105243_11501844 | Ga0105243_115018442 | 50 |
| 389 | 3300009176 | Ga0105242_10077507 | Ga0105242_100775073 | 50 |
| 390 | 3300009176 | Ga0105242_10303063 | Ga0105242_103030632 | 50 |
| 391 | 3300009176 | Ga0105242_10591692 | Ga0105242_105916922 | 50 |
| 392 | 3300009177 | Ga0105248_10020631 | Ga0105248_100206317 | 50 |
| 393 | 3300009177 | Ga0105248_11164825 | Ga0105248_111648251 | 50 |
| 394 | 3300009545 | Ga0105237_11025416 | Ga0105237_110254161 | 50 |
| 395 | 3300009551 | Ga0105238_10081375 | Ga0105238_100813752 | 50 |
| 396 | 3300009553 | Ga0105249_10414861 | Ga0105249_104148612 | 50 |
| 397 | 3300009553 | Ga0105249_10596642 | Ga0105249_105966422 | 50 |
| 398 | 3300009553 | Ga0105249_11329871 | Ga0105249_113298712 | 50 |
| 399 | 3300009553 | Ga0105249_13273966 | Ga0105249_132739662 | 50 |
| 400 | 3300010375 | Ga0105239_10091409 | Ga0105239_100914094 | 50 |
| 401 | 3300011119 | Ga0105246_11304842 | Ga0105246_113048422 | 50 |
| 402 | 3300013100 | Ga0157373_10139082 | Ga0157373_101390823 | 50 |
| 403 | 3300013100 | Ga0157373_10347100 | Ga0157373_103471003 | 50 |
| 404 | 3300013102 | Ga0157371_10839428 | Ga0157371_108394282 | 50 |
| 405 | 3300013104 | Ga0157370_10266267 | Ga0157370_102662672 | 50 |
| 406 | 3300013105 | Ga0157369_12308179 | Ga0157369_123081791 | 50 |
| 407 | 3300013296 | Ga0157374_10031675 | Ga0157374_100316757 | 50 |
| 408 | 3300013296 | Ga0157374_10101351 | Ga0157374_101013514 | 50 |
| 409 | 3300013297 | Ga0157378_10009886 | Ga0157378_100098867 | 50 |
| 410 | 3300013297 | Ga0157378_10073226 | Ga0157378_100732263 | 50 |
| 411 | 3300013297 | Ga0157378_10224203 | Ga0157378_102242033 | 50 |
| 412 | 3300013297 | Ga0157378_10280874 | Ga0157378_102808743 | 50 |
| 413 | 3300013297 | Ga0157378_11995504 | Ga0157378_119955041 | 50 |
| 414 | 3300013306 | Ga0163162_10036544 | Ga0163162_100365445 | 50 |
| 415 | 3300013306 | Ga0163162_10391041 | Ga0163162_103910413 | 50 |
| 416 | 3300013306 | Ga0163162_10468141 | Ga0163162_104681413 | 50 |
| 417 | 3300013306 | Ga0163162_13451638 | Ga0163162_134516381 | 50 |
| 418 | 3300013307 | Ga0157372_10150816 | Ga0157372_101508163 | 50 |
| 419 | 3300013308 | Ga0157375_11342646 | Ga0157375_113426461 | 50 |
| 420 | 3300013308 | Ga0157375_12360614 | Ga0157375_123606142 | 50 |
| 421 | 3300013308 | Ga0157375_12712092 | Ga0157375_127120922 | 50 |
| 422 | 3300014325 | Ga0163163_12316982 | Ga0163163_123169821 | 50 |
| 423 | 3300014326 | Ga0157380_10161018 | Ga0157380_101610182 | 50 |
| 424 | 3300014326 | Ga0157380_10463527 | Ga0157380_104635273 | 50 |
| 425 | 3300014745 | Ga0157377_10185475 | Ga0157377_101854753 | 50 |
| 426 | 3300014745 | Ga0157377_10383043 | Ga0157377_103830432 | 50 |
| 427 | 3300014968 | Ga0157379_10507094 | Ga0157379_105070943 | 50 |
| 428 | 3300014968 | Ga0157379_11377274 | Ga0157379_113772742 | 50 |
| 429 | 3300014968 | Ga0157379_11882101 | Ga0157379_118821012 | 50 |
| 430 | 3300014969 | Ga0157376_10024323 | Ga0157376_100243233 | 50 |
| 431 | 3300017792 | Ga0163161_10230912 | Ga0163161_102309122 | 50 |
| 432 | 3300017792 | Ga0163161_11464390 | Ga0163161_114643902 | 50 |
| 433 | 3300025885 | Ga0207653_10274061 | Ga0207653_102740612 | 50 |
| 434 | 3300025899 | Ga0207642_10200791 | Ga0207642_102007913 | 50 |
| 435 | 3300025900 | Ga0207710_10196771 | Ga0207710_101967713 | 50 |
| 436 | 3300025903 | Ga0207680_10262129 | Ga0207680_102621292 | 50 |
| 437 | 3300025907 | Ga0207645_10005980 | Ga0207645_100059801 | 50 |
| 438 | 3300025908 | Ga0207643_10153493 | Ga0207643_101534933 | 50 |
| 439 | 3300025909 | Ga0207705_10013097 | Ga0207705_100130976 | 50 |
| 440 | 3300025910 | Ga0207684_10035507 | Ga0207684_100355074 | 50 |
| 441 | 3300025910 | Ga0207684_10093628 | Ga0207684_100936283 | 50 |
| 442 | 3300025910 | Ga0207684_10100163 | Ga0207684_101001632 | 50 |
| 443 | 3300025910 | Ga0207684_10218856 | Ga0207684_102188562 | 50 |
| 444 | 3300025910 | Ga0207684_10245754 | Ga0207684_102457542 | 50 |
| 445 | 3300025911 | Ga0207654_10446534 | Ga0207654_104465342 | 50 |
| 446 | 3300025912 | Ga0207707_10001853 | Ga0207707_1000185310 | 50 |
| 447 | 3300025912 | Ga0207707_10094936 | Ga0207707_100949363 | 50 |
| 448 | 3300025912 | Ga0207707_10138781 | Ga0207707_101387813 | 50 |
| 449 | 3300025913 | Ga0207695_10192545 | Ga0207695_101925451 | 50 |
| 450 | 3300025916 | Ga0207663_10059039 | Ga0207663_100590394 | 50 |
| 451 | 3300025917 | Ga0207660_10007560 | Ga0207660_100075607 | 50 |
| 452 | 3300025917 | Ga0207660_10192201 | Ga0207660_101922012 | 50 |
| 453 | 3300025917 | Ga0207660_10247965 | Ga0207660_102479652 | 50 |
| 454 | 3300025918 | Ga0207662_10105303 | Ga0207662_101053032 | 50 |
| 455 | 3300025918 | Ga0207662_10213519 | Ga0207662_102135192 | 50 |
| 456 | 3300025919 | Ga0207657_10001811 | Ga0207657_100018111 | 50 |
| 457 | 3300025919 | Ga0207657_10129247 | Ga0207657_101292472 | 50 |
| 458 | 3300025919 | Ga0207657_10170326 | Ga0207657_101703263 | 50 |
| 459 | 3300025920 | Ga0207649_10608382 | Ga0207649_106083822 | 50 |
| 460 | 3300025921 | Ga0207652_10007191 | Ga0207652_100071915 | 50 |
| 461 | 3300025921 | Ga0207652_10318627 | Ga0207652_103186272 | 50 |
| 462 | 3300025921 | Ga0207652_10588075 | Ga0207652_105880752 | 50 |
| 463 | 3300025922 | Ga0207646_10253254 | Ga0207646_102532542 | 50 |
| 464 | 3300025923 | Ga0207681_10027143 | Ga0207681_100271432 | 50 |
| 465 | 3300025923 | Ga0207681_10307967 | Ga0207681_103079673 | 50 |
| 466 | 3300025924 | Ga0207694_10071363 | Ga0207694_100713635 | 50 |
| 467 | 3300025925 | Ga0207650_10031403 | Ga0207650_100314031 | 50 |
| 468 | 3300025929 | Ga0207664_11057657 | Ga0207664_110576572 | 50 |
| 469 | 3300025931 | Ga0207644_10342694 | Ga0207644_103426942 | 50 |
| 470 | 3300025931 | Ga0207644_10911170 | Ga0207644_109111702 | 50 |
| 471 | 3300025931 | Ga0207644_11705092 | Ga0207644_117050922 | 50 |
| 472 | 3300025932 | Ga0207690_10592929 | Ga0207690_105929292 | 50 |
| 473 | 3300025933 | Ga0207706_10004396 | Ga0207706_1000439611 | 50 |
| 474 | 3300025933 | Ga0207706_10006287 | Ga0207706_100062874 | 50 |
| 475 | 3300025934 | Ga0207686_10127937 | Ga0207686_101279373 | 50 |
| 476 | 3300025935 | Ga0207709_10077069 | Ga0207709_100770693 | 50 |
| 477 | 3300025935 | Ga0207709_11279589 | Ga0207709_112795891 | 50 |
| 478 | 3300025935 | Ga0207709_11788895 | Ga0207709_117888952 | 50 |
| 479 | 3300025937 | Ga0207669_10740531 | Ga0207669_107405312 | 50 |
| 480 | 3300025937 | Ga0207669_11696220 | Ga0207669_116962202 | 50 |
| 481 | 3300025938 | Ga0207704_10003039 | Ga0207704_100030394 | 50 |
| 482 | 3300025940 | Ga0207691_10008091 | Ga0207691_1000809111 | 50 |
| 483 | 3300025940 | Ga0207691_10203055 | Ga0207691_102030552 | 50 |
| 484 | 3300025940 | Ga0207691_11584994 | Ga0207691_115849941 | 50 |
| 485 | 3300025941 | Ga0207711_10741307 | Ga0207711_107413072 | 50 |
| 486 | 3300025941 | Ga0207711_11553490 | Ga0207711_115534902 | 50 |
| 487 | 3300025942 | Ga0207689_10007800 | Ga0207689_1000780011 | 50 |
| 488 | 3300025942 | Ga0207689_11709149 | Ga0207689_117091491 | 50 |
| 489 | 3300025944 | Ga0207661_10105383 | Ga0207661_101053834 | 50 |
| 490 | 3300025944 | Ga0207661_11118754 | Ga0207661_111187542 | 50 |
| 491 | 3300025945 | Ga0207679_10066283 | Ga0207679_100662831 | 50 |
| 492 | 3300025945 | Ga0207679_10533558 | Ga0207679_105335583 | 50 |
| 493 | 3300025949 | Ga0207667_10028912 | Ga0207667_100289123 | 50 |
| 494 | 3300025960 | Ga0207651_10217962 | Ga0207651_102179623 | 50 |
| 495 | 3300025960 | Ga0207651_10349858 | Ga0207651_103498583 | 50 |
| 496 | 3300025960 | Ga0207651_10473454 | Ga0207651_104734543 | 50 |
| 497 | 3300025961 | Ga0207712_10019630 | Ga0207712_100196304 | 50 |
| 498 | 3300025961 | Ga0207712_10382695 | Ga0207712_103826952 | 50 |
| 499 | 3300025972 | Ga0207668_10145186 | Ga0207668_101451863 | 50 |
| 500 | 3300025972 | Ga0207668_10145661 | Ga0207668_101456611 | 50 |
| 501 | 3300025981 | Ga0207640_10015236 | Ga0207640_100152363 | 50 |
| 502 | 3300025981 | Ga0207640_10055844 | Ga0207640_100558442 | 50 |
| 503 | 3300025981 | Ga0207640_10525755 | Ga0207640_105257552 | 50 |
| 504 | 3300026023 | Ga0207677_10199772 | Ga0207677_101997723 | 50 |
| 505 | 3300026035 | Ga0207703_10896009 | Ga0207703_108960092 | 50 |
| 506 | 3300026035 | Ga0207703_11459870 | Ga0207703_114598702 | 50 |
| 507 | 3300026075 | Ga0207708_10002116 | Ga0207708_1000211612 | 50 |
| 508 | 3300026078 | Ga0207702_10334611 | Ga0207702_103346112 | 50 |
| 509 | 3300026088 | Ga0207641_10929371 | Ga0207641_109293711 | 50 |
| 510 | 3300026089 | Ga0207648_10000971 | Ga0207648_1000097132 | 50 |
| 511 | 3300026089 | Ga0207648_10396934 | Ga0207648_103969341 | 50 |
| 512 | 3300026095 | Ga0207676_11977322 | Ga0207676_119773221 | 50 |
| 513 | 3300026116 | Ga0207674_10340583 | Ga0207674_103405833 | 50 |
| 514 | 3300026116 | Ga0207674_11455612 | Ga0207674_114556122 | 50 |
| 515 | 3300026118 | Ga0207675_100029601 | Ga0207675_1000296015 | 50 |
| 516 | 3300026118 | Ga0207675_100211591 | Ga0207675_1002115913 | 50 |
| 517 | 3300026118 | Ga0207675_101012175 | Ga0207675_1010121752 | 50 |
| 518 | 3300026121 | Ga0207683_10002617 | Ga0207683_1000261719 | 50 |
| 519 | 3300026142 | Ga0207698_10849701 | Ga0207698_108497011 | 50 |
| 520 | 3300027360 | Ga0209969_1000761 | Ga0209969_10007614 | 50 |
| 521 | 3300027364 | Ga0209967_1001515 | Ga0209967_10015154 | 50 |
| 522 | 3300027378 | Ga0209981_1000933 | Ga0209981_10009333 | 50 |
| 523 | 3300027395 | Ga0209996_1000443 | Ga0209996_10004433 | 50 |
| 524 | 3300027395 | Ga0209996_1053866 | Ga0209996_10538661 | 50 |
| 525 | 3300027424 | Ga0209984_1000288 | Ga0209984_10002882 | 50 |
| 526 | 3300027462 | Ga0210000_1000168 | Ga0210000_10001687 | 50 |
| 527 | 3300027471 | Ga0209995_1024174 | Ga0209995_10241742 | 50 |
| 528 | 3300027526 | Ga0209968_1000142 | Ga0209968_10001427 | 50 |
| 529 | 3300027526 | Ga0209968_1015903 | Ga0209968_10159033 | 50 |
| 530 | 3300027543 | Ga0209999_1003539 | Ga0209999_10035393 | 50 |
| 531 | 3300027552 | Ga0209982_1000124 | Ga0209982_10001244 | 50 |
| 532 | 3300027614 | Ga0209970_1001779 | Ga0209970_10017793 | 50 |
| 533 | 3300027617 | Ga0210002_1000032 | Ga0210002_100003223 | 50 |
| 534 | 3300027682 | Ga0209971_1003221 | Ga0209971_10032213 | 50 |
| 535 | 3300027695 | Ga0209966_1000451 | Ga0209966_10004514 | 50 |
| 536 | 3300027876 | Ga0209974_10000674 | Ga0209974_100006744 | 50 |
| 537 | 3300027876 | Ga0209974_10101986 | Ga0209974_101019863 | 50 |
| 538 | 3300027876 | Ga0209974_10216048 | Ga0209974_102160481 | 50 |
| 539 | 3300027907 | Ga0207428_10121154 | Ga0207428_101211542 | 50 |
| 540 | 3300027907 | Ga0207428_10534782 | Ga0207428_105347822 | 50 |
| 541 | 3300027907 | Ga0207428_10665786 | Ga0207428_106657862 | 50 |
| 542 | 3300028380 | Ga0268265_10066606 | Ga0268265_100666064 | 50 |
| 543 | 3300028380 | Ga0268265_11024627 | Ga0268265_110246272 | 50 |
| 544 | 3300028380 | Ga0268265_11124903 | Ga0268265_111249032 | 50 |
| 545 | 3300028381 | Ga0268264_10113987 | Ga0268264_101139873 | 50 |
| 546 | 3300028381 | Ga0268264_10525700 | Ga0268264_105257003 | 50 |
| 547 | 3300028381 | Ga0268264_10593189 | Ga0268264_105931892 | 50 |
| 548 | 3300028381 | Ga0268264_11380669 | Ga0268264_113806691 | 50 |
| 549 | 3300031456 | Ga0307513_10478142 | Ga0307513_104781422 | 50 |
| 550 | 3300031548 | Ga0307408_101179431 | Ga0307408_1011794312 | 50 |
| 551 | 3300031824 | Ga0307413_10532301 | Ga0307413_105323012 | 50 |
| 552 | 3300031911 | Ga0307412_11643733 | Ga0307412_116437332 | 50 |
| 553 | 3300031995 | Ga0307409_100479462 | Ga0307409_1004794621 | 50 |
| 554 | 3300032002 | Ga0307416_101751564 | Ga0307416_1017515642 | 50 |
| 555 | 3300032004 | Ga0307414_10870171 | Ga0307414_108701712 | 50 |
| 556 | 3300032005 | Ga0307411_10125104 | Ga0307411_101251043 | 50 |
| 557 | 3300032005 | Ga0307411_11667166 | Ga0307411_116671662 | 50 |
| 558 | 3300035092 | Ga0373952_0126114 | Ga0373952_0126114_192_344 | 50 |
| 559 | 3300035241 | Ga0373961_0217632 | Ga0373961_0217632_216_368 | 50 |
| 560 | 3300035691 | Ga0373931_0223976 | Ga0373931_0223976_869_1021 | 50 |
| 561 | 3300041463 | Ga0451804_0682386 | Ga0451804_0682386_176_328 | 50 |
| 562 | 3300041496 | Ga0451839_1028224 | Ga0451839_1028224_1063_1215 | 50 |
| 563 | 3300042003 | Ga0439443_122779 | Ga0439443_122779_326_478 | 50 |
| 564 | 3300042010 | Ga0439452_036385 | Ga0439452_036385_982_1134 | 50 |
| 565 | 3300042012 | Ga0439455_0208547 | Ga0439455_0208547_254_406 | 50 |
| 566 | 3300042436 | Ga0439435_0116623 | Ga0439435_0116623_67_219 | 50 |
| 567 | 3300042461 | Ga0439460_0013298 | Ga0439460_0013298_1804_1956 | 50 |
| 568 | 3300044673 | Ga0453683_0368198 | Ga0453683_0368198_562_714 | 50 |
| 569 | 3300045051 | Ga0451576_0141115 | Ga0451576_0141115_280_432 | 50 |
| 570 | 3300045051 | Ga0451576_1218775 | Ga0451576_1218775_433_585 | 50 |
| 571 | 3300045051 | Ga0451576_1814643 | Ga0451576_1814643_411_563 | 50 |
| 572 | 3300045051 | Ga0451576_2213190 | Ga0451576_2213190_346_498 | 50 |
| 573 | 3300045976 | Ga0466967_0248470 | Ga0466967_0248470_639_791 | 50 |
| 574 | 3300045976 | Ga0466967_0602113 | Ga0466967_0602113_371_523 | 50 |
| 575 | 3300046462 | Ga0495651_0773283 | Ga0495651_0773283_156_308 | 50 |
| 576 | 3300046472 | Ga0495580_0277214 | Ga0495580_0277214_675_827 | 50 |
| 577 | 3300046499 | Ga0495594_0109102 | Ga0495594_0109102_706_858 | 50 |
| 578 | 3300046557 | Ga0495622_0290316 | Ga0495622_0290316_183_335 | 50 |
| 579 | 3300046663 | Ga0495635_0273624 | Ga0495635_0273624_62_214 | 50 |
| 580 | 3300046684 | Ga0495669_0097567 | Ga0495669_0097567_613_765 | 50 |
| 581 | 3300047318 | Ga0495636_0153379 | Ga0495636_0153379_419_571 | 50 |
| 582 | 3300047318 | Ga0495636_0251204 | Ga0495636_0251204_373_525 | 50 |
| 583 | 3300048910 | Ga0496107_1185333 | Ga0496107_1185333_370_522 | 50 |
| 584 | 3300048911 | Ga0496108_0363127 | Ga0496108_0363127_417_569 | 50 |
| 585 | 3300048912 | Ga0496109_2063592 | Ga0496109_2063592_222_374 | 50 |
| 586 | 3300049128 | Ga0501308_042964 | Ga0501308_042964_368_520 | 50 |
| 587 | 3300049129 | Ga0501309_030012 | Ga0501309_030012_347_499 | 50 |
| 588 | 3300049514 | Ga0501291_027180 | Ga0501291_027180_100_252 | 50 |
| 589 | 3300049514 | Ga0501291_150631 | Ga0501291_150631_346_498 | 50 |
| 590 | 3300049515 | Ga0501292_012798 | Ga0501292_012798_1042_1194 | 50 |
| 591 | 3300049520 | Ga0501297_007146 | Ga0501297_007146_814_966 | 50 |
| 592 | 3300049521 | Ga0501298_007475 | Ga0501298_007475_1448_1600 | 50 |
| 593 | 3300049522 | Ga0501299_046582 | Ga0501299_046582_311_463 | 50 |
| 594 | 3300049522 | Ga0501299_054238 | Ga0501299_054238_565_717 | 50 |
| 595 | 3300049523 | Ga0501300_010301 | Ga0501300_010301_287_439 | 50 |
| 596 | 3300049524 | Ga0501301_046108 | Ga0501301_046108_12_164 | 50 |
| 597 | 3300049528 | Ga0501312_054022 | Ga0501312_054022_512_664 | 50 |
| 598 | 3300049532 | Ga0501316_057555 | Ga0501316_057555_98_250 | 50 |
| 599 | 3300049541 | Ga0501325_045027 | Ga0501325_045027_104_256 | 50 |
| 600 | 3300049570 | Ga0501033_0711916 | Ga0501033_0711916_348_500 | 50 |
| 601 | 3300049572 | Ga0501036_0298082 | Ga0501036_0298082_652_804 | 50 |
| 602 | 3300049572 | Ga0501036_1112489 | Ga0501036_1112489_31_183 | 50 |
| 603 | 3300049572 | Ga0501036_1391954 | Ga0501036_1391954_109_261 | 50 |
| 604 | 3300049573 | Ga0501037_0672638 | Ga0501037_0672638_462_614 | 50 |
| 605 | 3300049574 | Ga0501038_0544123 | Ga0501038_0544123_654_806 | 50 |
| 606 | 3300049574 | Ga0501038_0800968 | Ga0501038_0800968_15_167 | 50 |
| 607 | 3300049575 | Ga0501039_0266690 | Ga0501039_0266690_238_390 | 50 |
| 608 | 3300049575 | Ga0501039_0288264 | Ga0501039_0288264_718_870 | 50 |
| 609 | 3300049575 | Ga0501039_0446086 | Ga0501039_0446086_18_170 | 50 |
| 610 | 3300049575 | Ga0501039_0872042 | Ga0501039_0872042_76_228 | 50 |
| 611 | 3300049576 | Ga0501040_0316662 | Ga0501040_0316662_942_1094 | 50 |
| 612 | 3300049576 | Ga0501040_0473941 | Ga0501040_0473941_460_612 | 50 |
| 613 | 3300049577 | Ga0501041_0485039 | Ga0501041_0485039_25_177 | 50 |
| 614 | 3300049577 | Ga0501041_0501239 | Ga0501041_0501239_257_409 | 50 |
| 615 | 3300049577 | Ga0501041_1010942 | Ga0501041_1010942_24_176 | 50 |
| 616 | 3300049578 | Ga0501042_0216155 | Ga0501042_0216155_988_1149 | 50 |
| 617 | 3300049578 | Ga0501042_0258918 | Ga0501042_0258918_215_367 | 50 |
| 618 | 3300049578 | Ga0501042_0398607 | Ga0501042_0398607_132_284 | 50 |
| 619 | 3300049578 | Ga0501042_0768036 | Ga0501042_0768036_59_211 | 50 |
| 620 | 3300049578 | Ga0501042_1403916 | Ga0501042_1403916_157_309 | 50 |
| 621 | 3300049580 | Ga0501046_0788146 | Ga0501046_0788146_175_327 | 50 |
| 622 | 3300049583 | Ga0501067_0131716 | Ga0501067_0131716_618_770 | 50 |
| 623 | 3300049584 | Ga0501068_0060454 | Ga0501068_0060454_572_724 | 50 |
| 624 | 3300049584 | Ga0501068_1145828 | Ga0501068_1145828_344_496 | 50 |
| 625 | 3300049585 | Ga0501069_0166196 | Ga0501069_0166196_1004_1156 | 50 |
| 626 | 3300049587 | Ga0501071_0076663 | Ga0501071_0076663_259_411 | 50 |
| 627 | 3300049587 | Ga0501071_1614489 | Ga0501071_1614489_241_393 | 50 |
| 628 | 3300049588 | Ga0501072_0192406 | Ga0501072_0192406_872_1024 | 50 |
| 629 | 3300049588 | Ga0501072_0290973 | Ga0501072_0290973_685_837 | 50 |
| 630 | 3300049588 | Ga0501072_1113735 | Ga0501072_1113735_258_410 | 50 |
| 631 | 3300049590 | Ga0501074_1284421 | Ga0501074_1284421_23_175 | 50 |
| 632 | 3300049591 | Ga0501075_0040870 | Ga0501075_0040870_37_189 | 50 |
| 633 | 3300049591 | Ga0501075_0047523 | Ga0501075_0047523_89_241 | 50 |
| 634 | 3300049591 | Ga0501075_0068688 | Ga0501075_0068688_272_424 | 50 |
| 635 | 3300049591 | Ga0501075_0274771 | Ga0501075_0274771_371_523 | 50 |
| 636 | 3300049591 | Ga0501075_0336075 | Ga0501075_0336075_658_810 | 50 |
| 637 | 3300049592 | Ga0501076_0275666 | Ga0501076_0275666_684_836 | 50 |
| 638 | 3300049592 | Ga0501076_0281350 | Ga0501076_0281350_349_510 | 50 |
| 639 | 3300049592 | Ga0501076_0447731 | Ga0501076_0447731_35_187 | 50 |
| 640 | 3300049592 | Ga0501076_0469402 | Ga0501076_0469402_462_614 | 50 |
| 641 | 3300049593 | Ga0501077_0082459 | Ga0501077_0082459_48_209 | 50 |
| 642 | 3300049593 | Ga0501077_0089549 | Ga0501077_0089549_1722_1874 | 50 |
| 643 | 3300049593 | Ga0501077_0216671 | Ga0501077_0216671_556_708 | 50 |
| 644 | 3300049593 | Ga0501077_0729289 | Ga0501077_0729289_343_495 | 50 |
| 645 | 3300049653 | Ga0501206_020076 | Ga0501206_020076_722_874 | 50 |
| 646 | 3300049656 | Ga0501209_131927 | Ga0501209_131927_38_190 | 50 |
| 647 | 3300049661 | Ga0501217_156755 | Ga0501217_156755_196_348 | 50 |
| 648 | 3300049661 | Ga0501217_331337 | Ga0501217_331337_103_255 | 50 |
| 649 | 3300049667 | Ga0501230_021571 | Ga0501230_021571_814_966 | 50 |
| 650 | 3300049668 | Ga0501233_003818 | Ga0501233_003818_792_944 | 50 |
| 651 | 3300049669 | Ga0501235_020905 | Ga0501235_020905_64_216 | 50 |
| 652 | 3300049679 | Ga0501249_091286 | Ga0501249_091286_399_551 | 50 |
| 653 | 3300049683 | Ga0501253_032144 | Ga0501253_032144_193_345 | 50 |
| 654 | 3300049689 | Ga0501260_003362 | Ga0501260_003362_225_377 | 50 |
| 655 | 3300049690 | Ga0501261_026218 | Ga0501261_026218_222_374 | 50 |
| 656 | 3300049703 | Ga0501219_005770 | Ga0501219_005770_694_846 | 50 |
| 657 | 3300049706 | Ga0501229_014462 | Ga0501229_014462_159_311 | 50 |
| 658 | 3300049741 | Ga0501079_0045000 | Ga0501079_0045000_472_624 | 50 |
| 659 | 3300049741 | Ga0501079_1014712 | Ga0501079_1014712_479_631 | 50 |
| 660 | 3300049741 | Ga0501079_1402425 | Ga0501079_1402425_278_430 | 50 |
| 661 | 3300049741 | Ga0501079_1647540 | Ga0501079_1647540_74_226 | 50 |
| 662 | 3300049742 | Ga0501080_1003199 | Ga0501080_1003199_207_359 | 50 |
| 663 | 3300049742 | Ga0501080_1358112 | Ga0501080_1358112_250_402 | 50 |
| 664 | 3300049742 | Ga0501080_1664427 | Ga0501080_1664427_157_309 | 50 |
| 665 | 3300049743 | Ga0501081_0234706 | Ga0501081_0234706_1172_1324 | 50 |
| 666 | 3300049743 | Ga0501081_0425208 | Ga0501081_0425208_198_359 | 50 |
| 667 | 3300049743 | Ga0501081_1040655 | Ga0501081_1040655_186_338 | 50 |
| 668 | 3300049762 | Ga0501265_072078 | Ga0501265_072078_288_440 | 50 |
| 669 | 3300049763 | Ga0501266_026730 | Ga0501266_026730_508_660 | 50 |
| 670 | 3300049768 | Ga0501271_043819 | Ga0501271_043819_207_359 | 50 |
| 671 | 3300049769 | Ga0501272_032630 | Ga0501272_032630_427_579 | 50 |
| 672 | 3300049770 | Ga0501273_092545 | Ga0501273_092545_240_392 | 50 |
| 673 | 3300049773 | Ga0501276_006317 | Ga0501276_006317_504_656 | 50 |
| 674 | 3300049775 | Ga0501279_043427 | Ga0501279_043427_413_565 | 50 |
| 675 | 3300049776 | Ga0501280_053797 | Ga0501280_053797_430_582 | 50 |
| 676 | 3300049777 | Ga0501281_08569 | Ga0501281_08569_202_354 | 50 |
| 677 | 3300049779 | Ga0501283_004428 | Ga0501283_004428_851_1003 | 50 |
| 678 | 3300049779 | Ga0501283_004543 | Ga0501283_004543_375_527 | 50 |
| 679 | 3300049822 | Ga0501035_0809918 | Ga0501035_0809918_561_713 | 50 |
| 680 | 3300049822 | Ga0501035_0841069 | Ga0501035_0841069_19_171 | 50 |
| 681 | 3300049824 | Ga0501045_0519574 | Ga0501045_0519574_124_285 | 50 |
| 682 | 3300049824 | Ga0501045_0803480 | Ga0501045_0803480_291_443 | 50 |
| 683 | 3300049824 | Ga0501045_1319687 | Ga0501045_1319687_351_503 | 50 |
| 684 | 3300049851 | Ga0501212_081802 | Ga0501212_081802_284_436 | 50 |
| 685 | 3300050507 | nmdc:mga05p37_134729_c1 | nmdc:mga05p37_134729_c1_2293_2445 | 50 |
| 686 | 3300050507 | nmdc:mga05p37_135081_c2 | nmdc:mga05p37_135081_c2_1508_1660 | 50 |
| 687 | 3300050507 | nmdc:mga05p37_136481_c1 | nmdc:mga05p37_136481_c1_2666_2818 | 50 |
| 688 | 3300050507 | nmdc:mga05p37_1387628_c1 | nmdc:mga05p37_1387628_c1_103_255 | 50 |
| 689 | 3300050507 | nmdc:mga05p37_145658_c1 | nmdc:mga05p37_145658_c1_1456_1608 | 50 |
| 690 | 3300050507 | nmdc:mga05p37_179730_c1 | nmdc:mga05p37_179730_c1_1438_1590 | 50 |
| 691 | 3300050507 | nmdc:mga05p37_201724_c1 | nmdc:mga05p37_201724_c1_1962_2114 | 50 |
| 692 | 3300050507 | nmdc:mga05p37_202684_c1 | nmdc:mga05p37_202684_c1_1635_1787 | 50 |
| 693 | 3300050507 | nmdc:mga05p37_2093548_c1 | nmdc:mga05p37_2093548_c1_354_506 | 50 |
| 694 | 3300050507 | nmdc:mga05p37_231660_c1 | nmdc:mga05p37_231660_c1_1457_1609 | 50 |
| 695 | 3300050507 | nmdc:mga05p37_314714_c1 | nmdc:mga05p37_314714_c1_145_297 | 50 |
| 696 | 3300050507 | nmdc:mga05p37_323056_c1 | nmdc:mga05p37_323056_c1_829_981 | 50 |
| 697 | 3300050507 | nmdc:mga05p37_32779_c1 | nmdc:mga05p37_32779_c1_1431_1583 | 50 |
| 698 | 3300050507 | nmdc:mga05p37_393924_c1 | nmdc:mga05p37_393924_c1_947_1099 | 50 |
| 699 | 3300050507 | nmdc:mga05p37_405769_c1 | nmdc:mga05p37_405769_c1_800_952 | 50 |
| 700 | 3300050507 | nmdc:mga05p37_49008_c1 | nmdc:mga05p37_49008_c1_3988_4140 | 50 |
| 701 | 3300050507 | nmdc:mga05p37_50844_c1 | nmdc:mga05p37_50844_c1_4317_4469 | 50 |
| 702 | 3300050507 | nmdc:mga05p37_52220_c1 | nmdc:mga05p37_52220_c1_4850_5002 | 50 |
| 703 | 3300050507 | nmdc:mga05p37_545809_c1 | nmdc:mga05p37_545809_c1_629_781 | 50 |
| 704 | 3300050507 | nmdc:mga05p37_550686_c1 | nmdc:mga05p37_550686_c1_318_470 | 50 |
| 705 | 3300050507 | nmdc:mga05p37_609079_c1 | nmdc:mga05p37_609079_c1_556_708 | 50 |
| 706 | 3300050507 | nmdc:mga05p37_912703_c1 | nmdc:mga05p37_912703_c1_121_273 | 50 |
| 707 | 3300050507 | nmdc:mga05p37_92103_c1 | nmdc:mga05p37_92103_c1_1303_1455 | 50 |
| 708 | 3300050507 | nmdc:mga05p37_993881_c1 | nmdc:mga05p37_993881_c1_546_698 | 50 |
| 709 | 3300050508 | nmdc:mga09592_1113313_c1 | nmdc:mga09592_1113313_c1_101_253 | 50 |
| 710 | 3300050508 | nmdc:mga09592_1164313_c1 | nmdc:mga09592_1164313_c1_285_443 | 50 |
| 711 | 3300050508 | nmdc:mga09592_1193799_c1 | nmdc:mga09592_1193799_c1_254_406 | 50 |
| 712 | 3300050508 | nmdc:mga09592_1353381_c1 | nmdc:mga09592_1353381_c1_306_458 | 50 |
| 713 | 3300050508 | nmdc:mga09592_137997_c1 | nmdc:mga09592_137997_c1_1426_1587 | 50 |
| 714 | 3300050508 | nmdc:mga09592_1555585_c1 | nmdc:mga09592_1555585_c1_210_362 | 50 |
| 715 | 3300050508 | nmdc:mga09592_186148_c1 | nmdc:mga09592_186148_c1_16_168 | 50 |
| 716 | 3300050508 | nmdc:mga09592_18945_c1 | nmdc:mga09592_18945_c1_2304_2456 | 50 |
| 717 | 3300050508 | nmdc:mga09592_290521_c2 | nmdc:mga09592_290521_c2_183_335 | 50 |
| 718 | 3300050508 | nmdc:mga09592_322593_c1 | nmdc:mga09592_322593_c1_634_786 | 50 |
| 719 | 3300050508 | nmdc:mga09592_331019_c1 | nmdc:mga09592_331019_c1_297_449 | 50 |
| 720 | 3300050508 | nmdc:mga09592_556788_c1 | nmdc:mga09592_556788_c1_113_265 | 50 |
| 721 | 3300050508 | nmdc:mga09592_590815_c1 | nmdc:mga09592_590815_c1_162_314 | 50 |
| 722 | 3300050508 | nmdc:mga09592_639_c1 | nmdc:mga09592_639_c1_12438_12590 | 50 |
| 723 | 3300050508 | nmdc:mga09592_745033_c1 | nmdc:mga09592_745033_c1_501_653 | 50 |
| 724 | 3300050508 | nmdc:mga09592_82197_c1 | nmdc:mga09592_82197_c1_581_733 | 50 |
| 725 | 3300050509 | nmdc:mga0qj67_1051448_c1 | nmdc:mga0qj67_1051448_c1_103_255 | 50 |
| 726 | 3300050509 | nmdc:mga0qj67_1055249_c1 | nmdc:mga0qj67_1055249_c1_248_400 | 50 |
| 727 | 3300050509 | nmdc:mga0qj67_1434475_c1 | nmdc:mga0qj67_1434475_c1_203_355 | 50 |
| 728 | 3300050509 | nmdc:mga0qj67_159861_c1 | nmdc:mga0qj67_159861_c1_1254_1406 | 50 |
| 729 | 3300050509 | nmdc:mga0qj67_2718_c1 | nmdc:mga0qj67_2718_c1_5747_5899 | 50 |
| 730 | 3300050509 | nmdc:mga0qj67_4545_c1 | nmdc:mga0qj67_4545_c1_9850_10002 | 50 |
| 731 | 3300050509 | nmdc:mga0qj67_624736_c1 | nmdc:mga0qj67_624736_c1_604_756 | 50 |
| 732 | 3300050509 | nmdc:mga0qj67_90121_c1 | nmdc:mga0qj67_90121_c1_1712_1864 | 50 |
| 733 | 3300050509 | nmdc:mga0qj67_96471_c1 | nmdc:mga0qj67_96471_c1_1010_1162 | 50 |
| 734 | 3300050510 | nmdc:mga06r32_1116398_c1 | nmdc:mga06r32_1116398_c1_122_274 | 50 |
| 735 | 3300050510 | nmdc:mga06r32_1274011_c1 | nmdc:mga06r32_1274011_c1_509_661 | 50 |
| 736 | 3300050510 | nmdc:mga06r32_130201_c1 | nmdc:mga06r32_130201_c1_1677_1829 | 50 |
| 737 | 3300050510 | nmdc:mga06r32_1428985_c1 | nmdc:mga06r32_1428985_c1_298_450 | 50 |
| 738 | 3300050510 | nmdc:mga06r32_1467434_c1 | nmdc:mga06r32_1467434_c1_352_504 | 50 |
| 739 | 3300050510 | nmdc:mga06r32_29065_c1 | nmdc:mga06r32_29065_c1_4004_4156 | 50 |
| 740 | 3300050510 | nmdc:mga06r32_5095_c1 | nmdc:mga06r32_5095_c1_8182_8334 | 50 |
| 741 | 3300050510 | nmdc:mga06r32_543806_c1 | nmdc:mga06r32_543806_c1_469_621 | 50 |
| 742 | 3300050510 | nmdc:mga06r32_581912_c1 | nmdc:mga06r32_581912_c1_867_1019 | 50 |
| 743 | 3300050510 | nmdc:mga06r32_604142_c1 | nmdc:mga06r32_604142_c1_582_734 | 50 |
| 744 | 3300050510 | nmdc:mga06r32_650721_c1 | nmdc:mga06r32_650721_c1_481_633 | 50 |
| 745 | 3300050510 | nmdc:mga06r32_698615_c1 | nmdc:mga06r32_698615_c1_335_487 | 50 |
| 746 | 3300050510 | nmdc:mga06r32_742176_c1 | nmdc:mga06r32_742176_c1_479_631 | 50 |
| 747 | 3300050510 | nmdc:mga06r32_771229_c1 | nmdc:mga06r32_771229_c1_458_610 | 50 |
| 748 | 3300050510 | nmdc:mga06r32_925195_c1 | nmdc:mga06r32_925195_c1_640_792 | 50 |
| 749 | 3300050511 | nmdc:mga08y16_1057315_c1 | nmdc:mga08y16_1057315_c1_128_280 | 50 |
| 750 | 3300050511 | nmdc:mga08y16_160828_c1 | nmdc:mga08y16_160828_c1_73_225 | 50 |
| 751 | 3300050511 | nmdc:mga08y16_1748466_c1 | nmdc:mga08y16_1748466_c1_303_455 | 50 |
| 752 | 3300050511 | nmdc:mga08y16_1916788_c1 | nmdc:mga08y16_1916788_c1_266_418 | 50 |
| 753 | 3300050511 | nmdc:mga08y16_23063_c1 | nmdc:mga08y16_23063_c1_3878_4030 | 50 |
| 754 | 3300050511 | nmdc:mga08y16_253154_c1 | nmdc:mga08y16_253154_c1_480_632 | 50 |
| 755 | 3300050511 | nmdc:mga08y16_253658_c1 | nmdc:mga08y16_253658_c1_292_444 | 50 |
| 756 | 3300050511 | nmdc:mga08y16_590497_c1 | nmdc:mga08y16_590497_c1_124_276 | 50 |
| 757 | 3300050512 | nmdc:mga0n895_1244982_c1 | nmdc:mga0n895_1244982_c1_297_449 | 50 |
| 758 | 3300050512 | nmdc:mga0n895_226986_c1 | nmdc:mga0n895_226986_c1_1277_1429 | 50 |
| 759 | 3300050512 | nmdc:mga0n895_239822_c1 | nmdc:mga0n895_239822_c1_23_175 | 50 |
| 760 | 3300050512 | nmdc:mga0n895_358965_c1 | nmdc:mga0n895_358965_c1_785_937 | 50 |
| 761 | 3300050512 | nmdc:mga0n895_482369_c1 | nmdc:mga0n895_482369_c1_446_598 | 50 |
| 762 | 3300050512 | nmdc:mga0n895_611736_c1 | nmdc:mga0n895_611736_c1_747_899 | 50 |
| 763 | 3300050512 | nmdc:mga0n895_673787_c1 | nmdc:mga0n895_673787_c1_708_860 | 50 |
| 764 | 3300050512 | nmdc:mga0n895_726099_c1 | nmdc:mga0n895_726099_c1_70_222 | 50 |
| 765 | 3300050512 | nmdc:mga0n895_7975_c1 | nmdc:mga0n895_7975_c1_6837_6989 | 50 |
| 766 | 3300050512 | nmdc:mga0n895_972033_c1 | nmdc:mga0n895_972033_c1_511_663 | 50 |
| 767 | 3300050512 | nmdc:mga0n895_989502_c1 | nmdc:mga0n895_989502_c1_153_305 | 50 |
| 768 | 3300050512 | nmdc:mga0n895_99107_c1 | nmdc:mga0n895_99107_c1_59_211 | 50 |
| 769 | 3300050513 | nmdc:mga0rr50_1731616_c1 | nmdc:mga0rr50_1731616_c1_328_480 | 50 |
| 770 | 3300050513 | nmdc:mga0rr50_195324_c1 | nmdc:mga0rr50_195324_c1_1025_1177 | 50 |
| 771 | 3300050513 | nmdc:mga0rr50_234067_c1 | nmdc:mga0rr50_234067_c1_1088_1240 | 50 |
| 772 | 3300050513 | nmdc:mga0rr50_309030_c1 | nmdc:mga0rr50_309030_c1_91_243 | 50 |
| 773 | 3300050513 | nmdc:mga0rr50_659_c1 | nmdc:mga0rr50_659_c1_8971_9123 | 50 |
| 774 | 3300050513 | nmdc:mga0rr50_935784_c1 | nmdc:mga0rr50_935784_c1_376_528 | 50 |
| 775 | 3300050514 | nmdc:mga08x19_187928_c1 | nmdc:mga08x19_187928_c1_642_794 | 50 |
| 776 | 3300050514 | nmdc:mga08x19_311529_c1 | nmdc:mga08x19_311529_c1_251_403 | 50 |
| 777 | 3300050514 | nmdc:mga08x19_45516_c1 | nmdc:mga08x19_45516_c1_315_467 | 50 |
| 778 | 3300050514 | nmdc:mga08x19_483799_c1 | nmdc:mga08x19_483799_c1_620_772 | 50 |
| 779 | 3300050515 | nmdc:mga0a205_1038677_c1 | nmdc:mga0a205_1038677_c1_479_631 | 50 |
| 780 | 3300050515 | nmdc:mga0a205_123268_c1 | nmdc:mga0a205_123268_c1_1596_1748 | 50 |
| 781 | 3300050515 | nmdc:mga0a205_1233287_c1 | nmdc:mga0a205_1233287_c1_145_297 | 50 |
| 782 | 3300050515 | nmdc:mga0a205_140160_c1 | nmdc:mga0a205_140160_c1_480_632 | 50 |
| 783 | 3300050515 | nmdc:mga0a205_338398_c1 | nmdc:mga0a205_338398_c1_481_633 | 50 |
| 784 | 3300050515 | nmdc:mga0a205_35291_c1 | nmdc:mga0a205_35291_c1_3807_3959 | 50 |
| 785 | 3300050515 | nmdc:mga0a205_361_c1 | nmdc:mga0a205_361_c1_22249_22401 | 50 |
| 786 | 3300050515 | nmdc:mga0a205_454776_c1 | nmdc:mga0a205_454776_c1_797_949 | 50 |
| 787 | 3300050515 | nmdc:mga0a205_46142_c2 | nmdc:mga0a205_46142_c2_611_763 | 50 |
| 788 | 3300050515 | nmdc:mga0a205_469668_c1 | nmdc:mga0a205_469668_c1_213_365 | 50 |
| 789 | 3300050515 | nmdc:mga0a205_541447_c1 | nmdc:mga0a205_541447_c1_350_502 | 50 |
| 790 | 3300050515 | nmdc:mga0a205_635039_c1 | nmdc:mga0a205_635039_c1_183_335 | 50 |
| 791 | 3300050515 | nmdc:mga0a205_7044_c1 | nmdc:mga0a205_7044_c1_1578_1730 | 50 |
| 792 | 3300050515 | nmdc:mga0a205_92973_c1 | nmdc:mga0a205_92973_c1_1519_1671 | 50 |
| 793 | 3300053091 | Ga0500647_0337980 | Ga0500647_0337980_57_209 | 50 |
| 794 | 3300054114 | Ga0501084_0349202 | Ga0501084_0349202_691_852 | 50 |
| 795 | 3300054114 | Ga0501084_0912633 | Ga0501084_0912633_381_533 | 50 |
| 796 | 3300054114 | Ga0501084_1080816 | Ga0501084_1080816_103_255 | 50 |
| 797 | 3300054114 | Ga0501084_1237462 | Ga0501084_1237462_219_371 | 50 |
| 798 | 3300059424 | Ga0590075_035851 | Ga0590075_035851_897_1049 | 50 |
| 799 | 3300059424 | Ga0590075_177103 | Ga0590075_177103_128_280 | 50 |
| 800 | 3300059477 | Ga0587084_147291 | Ga0587084_147291_106_258 | 50 |
| 801 | 3300060353 | Ga0501082_0156966 | Ga0501082_0156966_312_473 | 50 |
| 802 | 3300060353 | Ga0501082_0400572 | Ga0501082_0400572_571_723 | 50 |
| 803 | 3300060353 | Ga0501082_1510686 | Ga0501082_1510686_246_398 | 50 |
| 804 | 3300061734 | Ga0530510_0124959 | Ga0530510_0124959_274_426 | 50 |
| 805 | 3300061734 | Ga0530510_0575062 | Ga0530510_0575062_186_338 | 50 |
| 806 | 3300061734 | Ga0530510_0741731 | Ga0530510_0741731_181_333 | 50 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar