F481589

General Info

Members Datasets Scaffolds Average Seq Length
805 421 1610 123

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100392373|Ga0068857_1003923733
Length 132
Sequence MVMRKFFTALVVIPLGLVFIVFAVANRHFVTVSFDPFNSTDPAIAVSMPLFAVIIAVAILGVAAGGMATWFRQRHWRRAARQHEADARRARAETDALRXAAAVSRAEQQRLPAPSSYGFYGATGRDKQGATL

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
212 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
240 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
241 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
242 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
243 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
316 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
317 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
318 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
319 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
323 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
341 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
344 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
370 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
371 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
375 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
376 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
379 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
380 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
381 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
382 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
383 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
384 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
385 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
386 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
387 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
388 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
389 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
390 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
391 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
392 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
393 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
394 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
395 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
396 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
397 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
398 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
399 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
400 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
401 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
402 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
403 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
408 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
409 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
410 2791355199
411 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
412 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
413 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
414 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
415 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
416 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
417 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
418 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
419 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
420 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
421 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0.37
Isolates 1.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 1.24
Rhizoplane 6.46
Rhizosphere 76.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100392373 3300005577 Bacteria 1290
2 JGI24739J22299_10008433 3300001989 Bacteria 3849
3 JGI24737J22298_10003455 3300001990 Bacteria 5582
4 JGI24735J21928_10010756 3300002067 Bacteria 2908
5 JGI25406J46586_10005215 3300003203 Bacteria 6025
6 JGI25165J46597_1011185 3300003214 Bacteria 1288
7 JGI25153J46596_10009381 3300003215 Bacteria 4558
8 JGI25153J46596_10099580 3300003215 Bacteria 686
9 rootL2_10081179 3300003322 Bacteria 1107
10 Ga0070658_10079273 3300005327 Bacteria 2696
11 Ga0070658_10240747 3300005327 Bacteria 1533
12 Ga0070658_11025100 3300005327 Bacteria 718
13 Ga0070658_11647460 3300005327 Bacteria 556
14 Ga0070676_11334347 3300005328 Bacteria 549
15 Ga0070683_100147368 3300005329 Bacteria 2231
16 Ga0070683_100346160 3300005329 Bacteria 1415
17 Ga0070690_100834939 3300005330 Bacteria 717
18 Ga0070690_101282005 3300005330 Bacteria 586
19 Ga0068869_100264216 3300005334 Bacteria 1378
20 Ga0068869_100339311 3300005334 Bacteria 1222
21 Ga0070666_10467129 3300005335 Bacteria 912
22 Ga0070680_100018066 3300005336 Bacteria 5570
23 Ga0070682_100372167 3300005337 Bacteria 1072
24 Ga0068868_100017439 3300005338 Bacteria 5351
25 Ga0068868_100361227 3300005338 Bacteria 1246
26 Ga0068868_100498228 3300005338 Bacteria 1066
27 Ga0070660_100062560 3300005339 Bacteria 2892
28 Ga0070660_101076338 3300005339 Bacteria 680
29 Ga0070689_101197692 3300005340 Bacteria 682
30 Ga0070691_10313423 3300005341 Bacteria 861
31 Ga0070687_100203360 3300005343 Bacteria 1201
32 Ga0070668_100088248 3300005347 Bacteria 2441
33 Ga0070668_100152558 3300005347 Bacteria 1869
34 Ga0070668_100244844 3300005347 Bacteria 1486
35 Ga0070668_100283108 3300005347 Bacteria 1385
36 Ga0070668_100318145 3300005347 Bacteria 1309
37 Ga0070669_100263323 3300005353 Bacteria 1376
38 Ga0070675_100222959 3300005354 Bacteria 1642
39 Ga0070671_100233097 3300005355 Bacteria 1562
40 Ga0070671_100281890 3300005355 Bacteria 1413
41 Ga0070671_100497528 3300005355 Bacteria 1048
42 Ga0070671_100874210 3300005355 Bacteria 785
43 Ga0070671_100984138 3300005355 Bacteria 739
44 Ga0070674_100088430 3300005356 Bacteria 2230
45 Ga0070674_100128680 3300005356 Bacteria 1884
46 Ga0070673_100372555 3300005364 Bacteria 1271
47 Ga0070688_100754267 3300005365 Bacteria 758
48 Ga0070659_100249855 3300005366 Bacteria 1469
49 Ga0070659_101803191 3300005366 Bacteria 548
50 Ga0070667_100085231 3300005367 Bacteria 2709
51 Ga0070667_101169685 3300005367 Bacteria 720
52 Ga0070703_10016682 3300005406 Bacteria 2109
53 Ga0070714_100089955 3300005435 Bacteria 2688
54 Ga0070713_100046936 3300005436 Bacteria 3547
55 Ga0070713_101764942 3300005436 Bacteria 600
56 Ga0070701_10131050 3300005438 Bacteria 1424
57 Ga0070711_100238081 3300005439 Bacteria 1422
58 Ga0070711_100369070 3300005439 Bacteria 1158
59 Ga0070700_100158471 3300005441 Bacteria 1555
60 Ga0070700_100442001 3300005441 Bacteria 987
61 Ga0070700_100619382 3300005441 Bacteria 850
62 Ga0070708_100994007 3300005445 Bacteria 787
63 Ga0070663_100030169 3300005455 Bacteria 3713
64 Ga0070663_100080063 3300005455 Bacteria 2398
65 Ga0070663_100199891 3300005455 Bacteria 1559
66 Ga0070663_100257390 3300005455 Bacteria 1383
67 Ga0070663_100379742 3300005455 Bacteria 1150
68 Ga0070663_100436715 3300005455 Bacteria 1076
69 Ga0070663_100958409 3300005455 Bacteria 742
70 Ga0070663_101215762 3300005455 Bacteria 663
71 Ga0070678_100171509 3300005456 Bacteria 1767
72 Ga0070678_100391767 3300005456 Bacteria 1205
73 Ga0070678_100564956 3300005456 Bacteria 1011
74 Ga0070662_100040266 3300005457 Bacteria 3326
75 Ga0070662_100148881 3300005457 Bacteria 1820
76 Ga0070662_100158318 3300005457 Bacteria 1769
77 Ga0070662_100209811 3300005457 Bacteria 1549
78 Ga0070681_10065324 3300005458 Bacteria 3607
79 Ga0068867_100110958 3300005459 Bacteria 2107
80 Ga0068867_100634148 3300005459 Bacteria 936
81 Ga0068867_100773717 3300005459 Bacteria 854
82 Ga0068867_101398757 3300005459 Bacteria 649
83 Ga0070685_10163787 3300005466 Bacteria 1419
84 Ga0070706_100980692 3300005467 Bacteria 779
85 Ga0070699_100107520 3300005518 Bacteria 2447
86 Ga0070679_100465962 3300005530 Bacteria 1208
87 Ga0070684_100052912 3300005535 Bacteria 3532
88 Ga0070697_100427399 3300005536 Bacteria 1151
89 Ga0068853_100012905 3300005539 Bacteria 6808
90 Ga0068853_100253527 3300005539 Bacteria 1615
91 Ga0068853_100295620 3300005539 Bacteria 1496
92 Ga0068853_100415656 3300005539 Bacteria 1261
93 Ga0068853_101077099 3300005539 Bacteria 775
94 Ga0068853_101387285 3300005539 Bacteria 679
95 Ga0070672_100138617 3300005543 Bacteria 2005
96 Ga0070672_100213491 3300005543 Bacteria 1617
97 Ga0070672_100328134 3300005543 Bacteria 1302
98 Ga0070672_100469480 3300005543 Bacteria 1086
99 Ga0070672_100841199 3300005543 Bacteria 809
100 Ga0070696_100316547 3300005546 Bacteria 1200
101 Ga0070693_100063435 3300005547 Bacteria 2153
102 Ga0070693_100130227 3300005547 Bacteria 1572
103 Ga0070665_100019142 3300005548 Bacteria 6869
104 Ga0070665_100128458 3300005548 Bacteria 2537
105 Ga0070665_100179785 3300005548 Bacteria 2116
106 Ga0070665_100411600 3300005548 Bacteria 1360
107 Ga0070665_100435153 3300005548 Bacteria 1321
108 Ga0070665_100542951 3300005548 Bacteria 1174
109 Ga0070665_100671254 3300005548 Bacteria 1049
110 Ga0070665_100673360 3300005548 Bacteria 1048
111 Ga0070665_101273452 3300005548 Bacteria 745
112 Ga0070665_101616033 3300005548 Bacteria 656
113 Ga0070704_100633509 3300005549 Bacteria 942
114 Ga0068855_100057419 3300005563 Bacteria 4562
115 Ga0068855_100070689 3300005563 Bacteria 4060
116 Ga0068855_100263706 3300005563 Bacteria 1918
117 Ga0068855_100373102 3300005563 Bacteria 1568
118 Ga0070664_100751088 3300005564 Bacteria 910
119 Ga0068857_100027044 3300005577 Bacteria 5061
120 Ga0068857_101186938 3300005577 Bacteria 739
121 Ga0068854_100055979 3300005578 Bacteria 2841
122 Ga0068854_100096044 3300005578 Bacteria 2213
123 Ga0068854_100840992 3300005578 Bacteria 803
124 Ga0068854_101131792 3300005578 Bacteria 699
125 Ga0068856_100074933 3300005614 Bacteria 3351
126 Ga0068856_100133640 3300005614 Bacteria 2486
127 Ga0070702_100042184 3300005615 Bacteria 2564
128 Ga0070702_100097584 3300005615 Bacteria 1796
129 Ga0070702_100434081 3300005615 Bacteria 949
130 Ga0070702_100720462 3300005615 Bacteria 763
131 Ga0070702_101389587 3300005615 Bacteria 574
132 Ga0068852_100020357 3300005616 Bacteria 5275
133 Ga0068852_100806992 3300005616 Bacteria 953
134 Ga0068852_102280342 3300005616 Bacteria 562
135 Ga0068852_102384920 3300005616 Bacteria 550
136 Ga0068859_100922389 3300005617 Bacteria 957
137 Ga0068859_101416802 3300005617 Bacteria 766
138 Ga0068864_100055720 3300005618 Bacteria 3414
139 Ga0068864_100136663 3300005618 Bacteria 2208
140 Ga0068864_100648827 3300005618 Bacteria 1028
141 Ga0068866_11068919 3300005718 Bacteria 577
142 Ga0068861_100242198 3300005719 Bacteria 1534
143 Ga0068851_10291455 3300005834 Bacteria 936
144 Ga0068851_10304188 3300005834 Bacteria 918
145 Ga0068851_10628174 3300005834 Bacteria 656
146 Ga0068863_100160532 3300005841 Bacteria 2153
147 Ga0068863_100893245 3300005841 Bacteria 889
148 Ga0068863_100925600 3300005841 Bacteria 873
149 Ga0068858_100150267 3300005842 Bacteria 2190
150 Ga0068858_100610224 3300005842 Bacteria 1059
151 Ga0068858_100851340 3300005842 Bacteria 890
152 Ga0068858_101009137 3300005842 Bacteria 816
153 Ga0068860_100112266 3300005843 Bacteria 2606
154 Ga0068860_100871812 3300005843 Bacteria 915
155 Ga0068860_100931250 3300005843 Bacteria 886
156 Ga0068860_101475673 3300005843 Bacteria 702
157 Ga0068862_100183972 3300005844 Bacteria 1877
158 Ga0068862_100858684 3300005844 Bacteria 890
159 Ga0068862_100913977 3300005844 Bacteria 863
160 Ga0081455_10050463 3300005937 Bacteria 3578
161 Ga0081540_1011558 3300005983 Bacteria 5896
162 Ga0081540_1014715 3300005983 Bacteria 4995
163 Ga0081540_1017112 3300005983 Bacteria 4502
164 Ga0081540_1211563 3300005983 Bacteria 697
165 Ga0081539_10000064 3300005985 Bacteria 247020
166 Ga0070717_10097859 3300006028 Bacteria 2486
167 Ga0070717_10180752 3300006028 Bacteria 1838
168 Ga0075365_10117592 3300006038 Bacteria 1831
169 Ga0075365_10154250 3300006038 Bacteria 1598
170 Ga0075365_10215462 3300006038 Bacteria 1346
171 Ga0075365_10225340 3300006038 Bacteria 1315
172 Ga0075368_10021396 3300006042 Bacteria 2456
173 Ga0075368_10118595 3300006042 Bacteria 1094
174 Ga0075368_10196974 3300006042 Bacteria 852
175 Ga0075368_10215681 3300006042 Bacteria 814
176 Ga0075363_100005325 3300006048 Bacteria 5711
177 Ga0075363_100029102 3300006048 Bacteria 2849
178 Ga0075363_100030237 3300006048 Bacteria 2802
179 Ga0075363_100235201 3300006048 Bacteria 1052
180 Ga0075363_100307431 3300006048 Bacteria 921
181 Ga0075363_100385140 3300006048 Bacteria 822
182 Ga0075364_10692632 3300006051 Bacteria 695
183 Ga0070715_10389178 3300006163 Bacteria 772
184 Ga0070716_100595766 3300006173 Bacteria 831
185 Ga0075362_10458062 3300006177 Bacteria 648
186 Ga0075367_10007297 3300006178 Bacteria 5652
187 Ga0075367_10015170 3300006178 Bacteria 4182
188 Ga0075367_10219997 3300006178 Bacteria 1188
189 Ga0075369_10041391 3300006186 Bacteria 1972
190 Ga0075369_10305211 3300006186 Bacteria 743
191 Ga0075366_10350083 3300006195 Bacteria 906
192 Ga0075366_10360031 3300006195 Bacteria 893
193 Ga0097621_100508845 3300006237 Bacteria 1091
194 Ga0075370_10011535 3300006353 Bacteria 4647
195 Ga0075370_10099564 3300006353 Bacteria 1681
196 Ga0075370_10624283 3300006353 Bacteria 653
197 Ga0075370_10662894 3300006353 Bacteria 633
198 Ga0068871_100102292 3300006358 Bacteria 2401
199 Ga0068871_100527879 3300006358 Bacteria 1067
200 Ga0068871_101297350 3300006358 Bacteria 685
201 Ga0075428_100188137 3300006844 Bacteria 2233
202 Ga0075434_100469429 3300006871 Bacteria 1279
203 Ga0068865_100076637 3300006881 Bacteria 2387
204 Ga0068865_100142268 3300006881 Bacteria 1810
205 Ga0097620_100922448 3300006931 Bacteria 957
206 Ga0097620_101416781 3300006931 Bacteria 766
207 Ga0075435_100347253 3300007076 Bacteria 1272
208 Ga0099794_10089242 3300007265 Bacteria 1528
209 Ga0099795_10257165 3300007788 Bacteria 755
210 Ga0099795_10329732 3300007788 Bacteria 678
211 Ga0105244_10161679 3300009036 Bacteria 1069
212 Ga0105250_10182236 3300009092 Bacteria 881
213 Ga0105240_10052947 3300009093 Bacteria 5099
214 Ga0105240_10096404 3300009093 Bacteria 3604
215 Ga0105240_11435480 3300009093 Bacteria 725
216 Ga0105240_11663527 3300009093 Bacteria 667
217 Ga0105240_12409831 3300009093 Bacteria 545
218 Ga0105245_11333720 3300009098 Bacteria 767
219 Ga0105245_12335361 3300009098 Bacteria 588
220 Ga0105243_10088250 3300009148 Bacteria 2548
221 Ga0105243_10604837 3300009148 Bacteria 1056
222 Ga0105243_10827118 3300009148 Bacteria 915
223 Ga0105243_11839052 3300009148 Bacteria 637
224 Ga0105241_10205112 3300009174 Bacteria 1649
225 Ga0105242_10321779 3300009176 Bacteria 1419
226 Ga0105242_10418227 3300009176 Bacteria 1255
227 Ga0105242_10506546 3300009176 Bacteria 1149
228 Ga0105248_10368371 3300009177 Bacteria 1617
229 Ga0105248_10461729 3300009177 Bacteria 1431
230 Ga0105248_12905326 3300009177 Bacteria 546
231 Ga0105237_10056521 3300009545 Bacteria 3928
232 Ga0105237_10110164 3300009545 Bacteria 2745
233 Ga0105237_10146031 3300009545 Bacteria 2360
234 Ga0105237_10453523 3300009545 Bacteria 1288
235 Ga0105237_11809425 3300009545 Bacteria 618
236 Ga0105238_10896088 3300009551 Bacteria 905
237 Ga0105238_11398738 3300009551 Bacteria 727
238 Ga0105249_10244717 3300009553 Bacteria 1775
239 Ga0105249_10965749 3300009553 Bacteria 920
240 Ga0105239_10073098 3300010375 Bacteria 3770
241 Ga0105239_10089479 3300010375 Bacteria 3395
242 Ga0105239_10123251 3300010375 Bacteria 2880
243 Ga0105246_10055737 3300011119 Bacteria 2729
244 Ga0157371_10219937 3300013102 Bacteria 1364
245 Ga0157370_10046316 3300013104 Bacteria 4170
246 Ga0157370_10497902 3300013104 Bacteria 1119
247 Ga0157370_10630783 3300013104 Bacteria 980
248 Ga0157369_10154697 3300013105 Bacteria 2423
249 Ga0157369_11115461 3300013105 Bacteria 806
250 Ga0157374_10053970 3300013296 Bacteria 3748
251 Ga0157374_11925177 3300013296 Bacteria 617
252 Ga0157374_12246950 3300013296 Bacteria 573
253 Ga0157378_10088288 3300013297 Bacteria 2814
254 Ga0157378_10174963 3300013297 Bacteria 2015
255 Ga0157378_10221829 3300013297 Bacteria 1797
256 Ga0157378_11095964 3300013297 Bacteria 833
257 Ga0163162_10134721 3300013306 Bacteria 2581
258 Ga0163162_10440739 3300013306 Bacteria 1435
259 Ga0163162_10579881 3300013306 Bacteria 1249
260 Ga0157372_10147883 3300013307 Bacteria 2710
261 Ga0157372_10976849 3300013307 Bacteria 981
262 Ga0157372_11012270 3300013307 Bacteria 962
263 Ga0157375_10014475 3300013308 Bacteria 7038
264 Ga0157375_10712059 3300013308 Bacteria 1157
265 Ga0157375_10790167 3300013308 Bacteria 1098
266 Ga0157375_10972236 3300013308 Bacteria 990
267 Ga0157375_11281349 3300013308 Bacteria 861
268 Ga0163163_10046730 3300014325 Bacteria 4252
269 Ga0163163_10118812 3300014325 Bacteria 2677
270 Ga0163163_10971652 3300014325 Bacteria 913
271 Ga0163163_12345601 3300014325 Bacteria 592
272 Ga0157380_10260103 3300014326 Bacteria 1576
273 Ga0157380_10270599 3300014326 Bacteria 1549
274 Ga0157380_11229380 3300014326 Bacteria 794
275 Ga0157377_10382528 3300014745 Bacteria 953
276 Ga0157377_10737513 3300014745 Bacteria 719
277 Ga0157379_11007381 3300014968 Bacteria 794
278 Ga0157379_11560050 3300014968 Bacteria 644
279 Ga0157376_10064864 3300014969 Bacteria 3081
280 Ga0157376_10833138 3300014969 Bacteria 937
281 Ga0182007_10091900 3300015262 Bacteria 1000
282 Ga0163161_10139621 3300017792 Bacteria 1834
283 Ga0163161_10338948 3300017792 Bacteria 1192
284 Ga0163161_10350818 3300017792 Bacteria 1173
285 Ga0197907_10455470 3300020069 Bacteria 1277
286 Ga0206356_11459300 3300020070 Bacteria 1666
287 Ga0206353_12005028 3300020082 Bacteria 1458
288 Ga0213874_10051250 3300021377 Bacteria 1267
289 Ga0209233_1001649 3300025261 Bacteria 8688
290 Ga0209758_1007289 3300025297 Bacteria 7587
291 Ga0209758_1148378 3300025297 Bacteria 599
292 Ga0207696_1033097 3300025711 Bacteria 1551
293 Ga0207653_10139414 3300025885 Bacteria 886
294 Ga0207682_10466322 3300025893 Bacteria 598
295 Ga0207692_10047811 3300025898 Bacteria 2150
296 Ga0207642_10054249 3300025899 Bacteria 1828
297 Ga0207688_10073648 3300025901 Bacteria 1942
298 Ga0207688_10351589 3300025901 Bacteria 908
299 Ga0207680_10488353 3300025903 Bacteria 876
300 Ga0207680_11273215 3300025903 Bacteria 523
301 Ga0207647_10005928 3300025904 Bacteria 8911
302 Ga0207647_10139153 3300025904 Bacteria 1423
303 Ga0207685_10382164 3300025905 Bacteria 718
304 Ga0207685_10392504 3300025905 Bacteria 709
305 Ga0207699_10096491 3300025906 Bacteria 1867
306 Ga0207645_10054999 3300025907 Bacteria 2541
307 Ga0207645_10096272 3300025907 Bacteria 1907
308 Ga0207645_10887325 3300025907 Bacteria 606
309 Ga0207643_10041154 3300025908 Bacteria 2603
310 Ga0207643_10527666 3300025908 Bacteria 756
311 Ga0207705_10557994 3300025909 Bacteria 890
312 Ga0207684_10155703 3300025910 Bacteria 1967
313 Ga0207654_10628476 3300025911 Bacteria 768
314 Ga0207695_10069546 3300025913 Bacteria 3602
315 Ga0207695_10182037 3300025913 Bacteria 2022
316 Ga0207695_10270755 3300025913 Bacteria 1594
317 Ga0207671_10155082 3300025914 Bacteria 1771
318 Ga0207671_10362757 3300025914 Bacteria 1150
319 Ga0207671_11203201 3300025914 Bacteria 593
320 Ga0207693_10022773 3300025915 Bacteria 4974
321 Ga0207693_10597003 3300025915 Bacteria 860
322 Ga0207662_10132127 3300025918 Bacteria 1575
323 Ga0207657_10354045 3300025919 Bacteria 1158
324 Ga0207657_11107559 3300025919 Bacteria 605
325 Ga0207649_10355342 3300025920 Bacteria 1086
326 Ga0207649_10398801 3300025920 Bacteria 1029
327 Ga0207649_11498646 3300025920 Bacteria 534
328 Ga0207652_10736342 3300025921 Bacteria 878
329 Ga0207652_11037265 3300025921 Bacteria 719
330 Ga0207646_11593448 3300025922 Bacteria 563
331 Ga0207681_10685122 3300025923 Bacteria 851
332 Ga0207694_10671605 3300025924 Bacteria 873
333 Ga0207650_10106821 3300025925 Bacteria 2162
334 Ga0207650_10568517 3300025925 Bacteria 951
335 Ga0207659_10257806 3300025926 Bacteria 1417
336 Ga0207687_10022560 3300025927 Bacteria 4191
337 Ga0207700_10027465 3300025928 Bacteria 3986
338 Ga0207700_11116048 3300025928 Bacteria 705
339 Ga0207664_10388764 3300025929 Bacteria 1239
340 Ga0207664_10455053 3300025929 Bacteria 1143
341 Ga0207644_10052228 3300025931 Bacteria 2937
342 Ga0207644_10120835 3300025931 Bacteria 1994
343 Ga0207644_10393145 3300025931 Bacteria 1132
344 Ga0207644_10563199 3300025931 Bacteria 944
345 Ga0207644_10983684 3300025931 Bacteria 708
346 Ga0207690_10362134 3300025932 Bacteria 1149
347 Ga0207706_10067851 3300025933 Bacteria 3139
348 Ga0207706_10177906 3300025933 Bacteria 1869
349 Ga0207706_10205187 3300025933 Bacteria 1728
350 Ga0207686_10273571 3300025934 Bacteria 1244
351 Ga0207686_11271611 3300025934 Bacteria 603
352 Ga0207709_10017778 3300025935 Bacteria 3974
353 Ga0207709_10200747 3300025935 Bacteria 1424
354 Ga0207670_10435555 3300025936 Bacteria 1054
355 Ga0207669_10045133 3300025937 Bacteria 2595
356 Ga0207704_10097706 3300025938 Bacteria 1948
357 Ga0207704_10167476 3300025938 Bacteria 1571
358 Ga0207691_10089157 3300025940 Bacteria 2766
359 Ga0207711_10223168 3300025941 Bacteria 1724
360 Ga0207711_10426130 3300025941 Bacteria 1234
361 Ga0207689_10276155 3300025942 Bacteria 1391
362 Ga0207689_10633655 3300025942 Bacteria 900
363 Ga0207661_10309373 3300025944 Bacteria 1418
364 Ga0207661_10397111 3300025944 Bacteria 1250
365 Ga0207661_10775318 3300025944 Bacteria 883
366 Ga0207661_11459510 3300025944 Bacteria 627
367 Ga0207679_10118617 3300025945 Bacteria 2102
368 Ga0207679_11118337 3300025945 Bacteria 723
369 Ga0207667_10010892 3300025949 Bacteria 10602
370 Ga0207667_10153908 3300025949 Bacteria 2366
371 Ga0207667_10218640 3300025949 Bacteria 1952
372 Ga0207667_10314164 3300025949 Bacteria 1600
373 Ga0207667_11836754 3300025949 Bacteria 569
374 Ga0207651_10165775 3300025960 Bacteria 1737
375 Ga0207651_11036248 3300025960 Bacteria 734
376 Ga0207712_10112906 3300025961 Bacteria 2041
377 Ga0207712_10235683 3300025961 Bacteria 1472
378 Ga0207668_10011583 3300025972 Bacteria 5364
379 Ga0207668_10228215 3300025972 Bacteria 1499
380 Ga0207668_11241656 3300025972 Bacteria 670
381 Ga0207640_10021376 3300025981 Bacteria 3856
382 Ga0207640_10133311 3300025981 Bacteria 1799
383 Ga0207640_10467749 3300025981 Bacteria 1043
384 Ga0207640_10660578 3300025981 Bacteria 892
385 Ga0207640_11173404 3300025981 Bacteria 682
386 Ga0207658_10903353 3300025986 Bacteria 804
387 Ga0207677_10013346 3300026023 Bacteria 4757
388 Ga0207677_10722110 3300026023 Bacteria 886
389 Ga0207677_10760149 3300026023 Bacteria 865
390 Ga0207703_10101793 3300026035 Bacteria 2436
391 Ga0207703_11912629 3300026035 Bacteria 569
392 Ga0207639_10019626 3300026041 Bacteria 4824
393 Ga0207639_10248379 3300026041 Bacteria 1550
394 Ga0207639_10445340 3300026041 Bacteria 1175
395 Ga0207639_10818650 3300026041 Bacteria 868
396 Ga0207639_10848347 3300026041 Bacteria 853
397 Ga0207639_11452700 3300026041 Bacteria 644
398 Ga0207678_10052756 3300026067 Bacteria 3507
399 Ga0207678_10164026 3300026067 Bacteria 1897
400 Ga0207678_10186718 3300026067 Bacteria 1771
401 Ga0207678_10230153 3300026067 Bacteria 1587
402 Ga0207678_10309026 3300026067 Bacteria 1359
403 Ga0207678_10392416 3300026067 Bacteria 1201
404 Ga0207678_10851107 3300026067 Bacteria 806
405 Ga0207678_11958303 3300026067 Bacteria 510
406 Ga0207708_10202129 3300026075 Bacteria 1585
407 Ga0207708_10433663 3300026075 Bacteria 1092
408 Ga0207702_10052064 3300026078 Bacteria 3462
409 Ga0207702_10172952 3300026078 Bacteria 1982
410 Ga0207702_12202795 3300026078 Bacteria 540
411 Ga0207641_10380170 3300026088 Bacteria 1352
412 Ga0207641_10708850 3300026088 Bacteria 991
413 Ga0207648_10043468 3300026089 Bacteria 3943
414 Ga0207648_10592262 3300026089 Bacteria 1021
415 Ga0207648_10780756 3300026089 Bacteria 888
416 Ga0207648_10883846 3300026089 Bacteria 834
417 Ga0207676_10107064 3300026095 Bacteria 2331
418 Ga0207676_10184366 3300026095 Bacteria 1830
419 Ga0207676_10380481 3300026095 Bacteria 1314
420 Ga0207674_10021710 3300026116 Bacteria 6909
421 Ga0207674_10153404 3300026116 Bacteria 2260
422 Ga0207675_100251355 3300026118 Bacteria 1711
423 Ga0207675_100400302 3300026118 Bacteria 1353
424 Ga0207675_100806480 3300026118 Bacteria 952
425 Ga0207683_10061295 3300026121 Bacteria 3310
426 Ga0207683_10091111 3300026121 Bacteria 2716
427 Ga0207683_10180544 3300026121 Bacteria 1914
428 Ga0207698_10385807 3300026142 Bacteria 1334
429 Ga0207698_10537740 3300026142 Bacteria 1143
430 Ga0207698_10861096 3300026142 Bacteria 912
431 Ga0209813_10073936 3300027866 Bacteria 1114
432 Ga0209813_10480531 3300027866 Bacteria 513
433 Ga0268266_10002812 3300028379 Bacteria 18151
434 Ga0268266_10029434 3300028379 Bacteria 4668
435 Ga0268266_10112122 3300028379 Bacteria 2417
436 Ga0268266_10162168 3300028379 Bacteria 2023
437 Ga0268266_10298002 3300028379 Bacteria 1503
438 Ga0268266_10329585 3300028379 Bacteria 1430
439 Ga0268266_11857886 3300028379 Bacteria 577
440 Ga0268265_10241057 3300028380 Bacteria 1595
441 Ga0268265_10544813 3300028380 Bacteria 1100
442 Ga0268265_11520132 3300028380 Bacteria 673
443 Ga0268264_10614413 3300028381 Bacteria 1072
444 Ga0268264_11440428 3300028381 Bacteria 699
445 Ga0268264_11736126 3300028381 Bacteria 634
446 Ga0265334_10084157 3300028573 Bacteria 1168
447 Ga0307517_10294956 3300028786 Bacteria 913
448 Ga0265330_10031347 3300031235 Bacteria 2383
449 Ga0265316_10415928 3300031344 Bacteria 967
450 Ga0307509_10103672 3300031507 Bacteria 2872
451 Ga0307509_10919713 3300031507 Bacteria 540
452 Ga0307408_100192648 3300031548 Bacteria 1644
453 Ga0307408_100374703 3300031548 Bacteria 1215
454 Ga0307408_100508238 3300031548 Bacteria 1056
455 Ga0307405_10226358 3300031731 Bacteria 1376
456 Ga0307405_10259172 3300031731 Bacteria 1298
457 Ga0307405_10315312 3300031731 Bacteria 1192
458 Ga0307413_10589433 3300031824 Bacteria 908
459 Ga0307410_10562951 3300031852 Bacteria 946
460 Ga0307406_10826365 3300031901 Bacteria 784
461 Ga0307412_10707487 3300031911 Bacteria 865
462 Ga0307412_10822305 3300031911 Bacteria 808
463 Ga0307409_101901819 3300031995 Bacteria 624
464 Ga0307416_100775170 3300032002 Bacteria 1053
465 Ga0307416_101040643 3300032002 Bacteria 922
466 Ga0307416_101305825 3300032002 Bacteria 831
467 Ga0307416_102753952 3300032002 Bacteria 588
468 Ga0307414_10192703 3300032004 Bacteria 1651
469 Ga0307411_10610492 3300032005 Bacteria 939
470 Ga0307415_100179163 3300032126 Bacteria 1661
471 Ga0307415_101429907 3300032126 Bacteria 659
472 Ga0307510_10012380 3300033180 Bacteria 10113
473 Ga0373930_0017613 3300034816 Bacteria 1364
474 Ga0373938_0008298 3300034957 Bacteria 1852
475 Ga0373952_0018680 3300035092 Bacteria 1436
476 Ga0373923_0044018 3300035111 Bacteria 1849
477 Ga0373936_0330504 3300035113 Bacteria 692
478 Ga0373953_0017348 3300035117 Bacteria 2645
479 Ga0373954_0000485 3300035118 Bacteria 14918
480 Ga0373956_0002322 3300035119 Bacteria 7818
481 Ga0373957_0002098 3300035120 Bacteria 5594
482 Ga0373943_0296076 3300035170 Bacteria 918
483 Ga0373943_0613897 3300035170 Bacteria 641
484 Ga0373946_0052531 3300035171 Bacteria 1710
485 Ga0373955_0001048 3300035172 Bacteria 11759
486 Ga0373961_0410104 3300035241 Bacteria 522
487 Ga0373962_0132155 3300035242 Bacteria 804
488 Ga0373924_0011160 3300035410 Bacteria 3329
489 Ga0373931_0001548 3300035691 Bacteria 9916
490 Ga0373935_0179475 3300035692 Bacteria 1453
491 Ga0373927_0022428 3300035695 Bacteria 4136
492 Ga0373927_0148417 3300035695 Bacteria 1535
493 Ga0373933_0006053 3300035724 Bacteria 6581
494 Ga0373947_0500014 3300035725 Bacteria 826
495 Ga0373937_0012128 3300036401 Bacteria 7565
496 Ga0373937_0425321 3300036401 Bacteria 1261
497 Ga0373925_0045291 3300037068 Bacteria 3268
498 Ga0373925_0068132 3300037068 Bacteria 2685
499 Ga0373925_0081956 3300037068 Bacteria 2454
500 Ga0395899_0346753 3300037312 Bacteria 994
501 Ga0395900_0021426 3300037418 Bacteria 6608
502 Ga0395900_0169580 3300037418 Bacteria 2223
503 Ga0395900_0494704 3300037418 Bacteria 1174
504 Ga0395898_0194856 3300037466 Bacteria 1936
505 Ga0395905_0108510 3300037471 Bacteria 2606
506 Ga0395905_0113191 3300037471 Bacteria 2549
507 Ga0395901_0391985 3300038443 Bacteria 1428
508 Ga0395901_0698863 3300038443 Bacteria 1012
509 Ga0436363_1098998 3300039450 Bacteria 8015
510 Ga0451793_1118957 3300041452 Bacteria 749
511 Ga0451798_0469240 3300041458 Bacteria 708
512 Ga0451839_1325167 3300041496 Bacteria 638
513 Ga0450897_048031 3300042128 Bacteria 511
514 Ga0439458_0063552 3300042157 Bacteria 925
515 Ga0466961_0118370 3300044693 Bacteria 1664
516 Ga0466968_0617894 3300044735 Bacteria 548
517 Ga0466957_0821185 3300044842 Bacteria 661
518 Ga0466959_0074260 3300045049 Bacteria 2459
519 Ga0495617_057234 3300046452 Bacteria 1292
520 Ga0495627_134649 3300046453 Bacteria 694
521 Ga0495592_0000993 3300046454 Bacteria 19682
522 Ga0495603_0011755 3300046455 Bacteria 5297
523 Ga0495603_0041753 3300046455 Bacteria 2742
524 Ga0495603_0153105 3300046455 Bacteria 1339
525 Ga0495603_0162976 3300046455 Bacteria 1293
526 Ga0495629_0000337 3300046459 Bacteria 40017
527 Ga0495629_0046968 3300046459 Bacteria 3028
528 Ga0495629_0189723 3300046459 Bacteria 1423
529 Ga0495638_0051601 3300046460 Bacteria 2565
530 Ga0495638_0237924 3300046460 Bacteria 1009
531 Ga0495641_0075362 3300046461 Bacteria 1513
532 Ga0495651_0003587 3300046462 Bacteria 11904
533 Ga0495651_0088120 3300046462 Bacteria 2333
534 Ga0495653_0010108 3300046463 Bacteria 7721
535 Ga0495650_0036682 3300046471 Bacteria 2142
536 Ga0495650_0271239 3300046471 Bacteria 573
537 Ga0495605_0057517 3300046474 Bacteria 1871
538 Ga0495605_0106659 3300046474 Bacteria 1282
539 Ga0495605_0241954 3300046474 Bacteria 774
540 Ga0495639_0088681 3300046475 Bacteria 1449
541 Ga0495639_0147393 3300046475 Bacteria 1134
542 Ga0495664_0006563 3300046477 Bacteria 6428
543 Ga0495664_0348115 3300046477 Bacteria 892
544 Ga0495584_0198382 3300046491 Bacteria 1020
545 Ga0495584_0261356 3300046491 Bacteria 880
546 Ga0495585_0035860 3300046492 Bacteria 2800
547 Ga0495585_0059441 3300046492 Bacteria 2106
548 Ga0495585_0077818 3300046492 Bacteria 1800
549 Ga0495594_0204962 3300046499 Bacteria 1124
550 Ga0495596_0072077 3300046500 Bacteria 1341
551 Ga0495607_0288053 3300046501 Bacteria 777
552 Ga0495606_0068246 3300046507 Bacteria 2250
553 Ga0495606_0535219 3300046507 Bacteria 585
554 Ga0495608_0001320 3300046511 Bacteria 17655
555 Ga0495618_0004991 3300046514 Bacteria 8108
556 Ga0495620_0149069 3300046515 Bacteria 912
557 Ga0495620_0205065 3300046515 Bacteria 758
558 Ga0495628_0016528 3300046516 Bacteria 6154
559 Ga0495628_0735780 3300046516 Bacteria 694
560 Ga0495631_0063228 3300046518 Bacteria 1603
561 Ga0495631_0122509 3300046518 Bacteria 1118
562 Ga0495631_0367840 3300046518 Bacteria 612
563 Ga0495632_0118457 3300046519 Bacteria 1238
564 Ga0495643_0053086 3300046522 Bacteria 2174
565 Ga0495644_0022633 3300046523 Bacteria 2395
566 Ga0495663_0032813 3300046525 Bacteria 1548
567 Ga0495666_0064258 3300046526 Bacteria 1752
568 Ga0495642_0133238 3300046528 Bacteria 1070
569 Ga0495652_0001922 3300046529 Bacteria 22097
570 Ga0495654_0165217 3300046530 Bacteria 969
571 Ga0495640_0718324 3300046533 Bacteria 599
572 Ga0495587_0003825 3300046536 Bacteria 9992
573 Ga0495587_0766015 3300046536 Bacteria 528
574 Ga0495598_0019538 3300046537 Bacteria 1778
575 Ga0495597_0180705 3300046542 Bacteria 853
576 Ga0495645_0023410 3300046543 Bacteria 4472
577 Ga0495645_0071654 3300046543 Bacteria 2498
578 Ga0495622_0006549 3300046557 Bacteria 5401
579 Ga0495622_0188835 3300046557 Bacteria 922
580 Ga0495633_0125598 3300046558 Bacteria 1187
581 Ga0495667_0000270 3300046559 Bacteria 33708
582 Ga0495656_0003938 3300046615 Bacteria 5044
583 Ga0495656_0052846 3300046615 Bacteria 1743
584 Ga0495656_0095532 3300046615 Bacteria 1366
585 Ga0495668_0070207 3300046616 Bacteria 1925
586 Ga0495668_0163757 3300046616 Bacteria 1218
587 Ga0495634_0015449 3300046642 Bacteria 5486
588 Ga0495611_0093853 3300046648 Bacteria 1388
589 Ga0495625_0516814 3300046660 Bacteria 728
590 Ga0495635_0000834 3300046663 Bacteria 20192
591 Ga0495635_0318248 3300046663 Bacteria 1042
592 Ga0495659_0017123 3300046664 Bacteria 2397
593 Ga0495659_0030338 3300046664 Bacteria 1881
594 Ga0495661_0289104 3300046665 Bacteria 824
595 Ga0495588_0076930 3300046674 Bacteria 1739
596 Ga0495588_0148198 3300046674 Bacteria 1240
597 Ga0495657_0007029 3300046675 Bacteria 8728
598 Ga0495599_0000635 3300046678 Bacteria 19831
599 Ga0495623_0392075 3300046679 Bacteria 749
600 Ga0495646_0002988 3300046680 Bacteria 10483
601 Ga0495669_0039585 3300046684 Bacteria 2087
602 Ga0495669_0128597 3300046684 Bacteria 1191
603 Ga0495670_0064280 3300046691 Bacteria 1848
604 Ga0495670_0136577 3300046691 Bacteria 1280
605 Ga0495671_0139842 3300046692 Bacteria 1180
606 Ga0495671_0544261 3300046692 Bacteria 553
607 Ga0495589_0064956 3300046794 Bacteria 1789
608 Ga0495600_0000400 3300046809 Bacteria 22448
609 Ga0495600_0063160 3300046809 Bacteria 2420
610 Ga0495600_0165461 3300046809 Bacteria 1429
611 Ga0495581_0118703 3300047315 Bacteria 1539
612 Ga0495581_0314132 3300047315 Bacteria 915
613 Ga0495604_0001388 3300047317 Bacteria 19846
614 Ga0495636_0104202 3300047318 Bacteria 1243
615 Ga0495674_0118784 3300047319 Bacteria 2235
616 Ga0495672_0013378 3300047320 Bacteria 5664
617 Ga0495676_0045100 3300047321 Bacteria 3592
618 Ga0495680_0002455 3300047322 Bacteria 18966
619 Ga0495683_0067711 3300047323 Bacteria 1758
620 Ga0495675_0002361 3300047444 Bacteria 11267
621 Ga0495677_0018701 3300047445 Bacteria 2511
622 Ga0495685_028214 3300047447 Bacteria 1931
623 Ga0495685_071635 3300047447 Bacteria 1160
624 Ga0495681_0145261 3300047470 Bacteria 999
625 Ga0495684_0000766 3300047471 Bacteria 25966
626 Ga0495686_0099192 3300047472 Bacteria 1759
627 Ga0495686_0534594 3300047472 Bacteria 614
628 Ga0495593_0000120 3300047673 Bacteria 37884
629 Ga0495602_0003415 3300048088 Bacteria 16424
630 Ga0495615_0052504 3300048090 Bacteria 1053
631 Ga0495615_0197472 3300048090 Bacteria 619
632 Ga0495626_0286842 3300048091 Bacteria 653
633 Ga0495626_0413670 3300048091 Bacteria 520
634 Ga0496100_0043594 3300048903 Bacteria 2870
635 Ga0496100_0061023 3300048903 Bacteria 2483
636 Ga0496100_0129496 3300048903 Bacteria 1776
637 Ga0496101_0378583 3300048904 Bacteria 1113
638 Ga0496101_0417662 3300048904 Bacteria 1057
639 Ga0496102_0001803 3300048905 Bacteria 18529
640 Ga0496102_0093012 3300048905 Bacteria 2793
641 Ga0496102_0124592 3300048905 Bacteria 2408
642 Ga0496102_0286813 3300048905 Bacteria 1552
643 Ga0496102_0353723 3300048905 Bacteria 1383
644 Ga0496103_0312029 3300048906 Bacteria 1012
645 Ga0496103_0336299 3300048906 Bacteria 971
646 Ga0496104_0003129 3300048907 Bacteria 14269
647 Ga0496104_0248522 3300048907 Bacteria 1691
648 Ga0496105_0009706 3300048908 Bacteria 7538
649 Ga0496105_0026604 3300048908 Bacteria 4721
650 Ga0496105_0268532 3300048908 Bacteria 1378
651 Ga0496106_0025341 3300048909 Bacteria 4413
652 Ga0496106_0067913 3300048909 Bacteria 2718
653 Ga0496106_0170028 3300048909 Bacteria 1727
654 Ga0496106_0213519 3300048909 Bacteria 1538
655 Ga0496107_0032300 3300048910 Bacteria 3741
656 Ga0496107_0054072 3300048910 Bacteria 2897
657 Ga0496107_0171793 3300048910 Bacteria 1609
658 Ga0496107_1053741 3300048910 Bacteria 589
659 Ga0496108_0029193 3300048911 Bacteria 4566
660 Ga0496108_0284308 3300048911 Bacteria 1440
661 Ga0496109_0022102 3300048912 Bacteria 5630
662 Ga0496109_0043861 3300048912 Bacteria 4055
663 Ga0496110_0013612 3300048913 Bacteria 6734
664 Ga0496110_0065175 3300048913 Bacteria 3220
665 Ga0496110_0542371 3300048913 Bacteria 1057
666 Ga0496111_0037247 3300048914 Bacteria 3481
667 Ga0496111_0051421 3300048914 Bacteria 2974
668 Ga0496112_0072990 3300048915 Bacteria 3392
669 Ga0496112_0097212 3300048915 Bacteria 2915
670 Ga0496112_0242306 3300048915 Bacteria 1755
671 Ga0496112_1045728 3300048915 Bacteria 735
672 Ga0496113_0013883 3300048916 Bacteria 5475
673 Ga0496113_0050419 3300048916 Bacteria 3103
674 Ga0496114_0034023 3300048917 Bacteria 4202
675 Ga0496114_0040283 3300048917 Bacteria 3867
676 Ga0496114_0096292 3300048917 Bacteria 2520
677 Ga0496114_0139459 3300048917 Bacteria 2098
678 Ga0496114_0184721 3300048917 Bacteria 1822
679 Ga0496115_0008944 3300048918 Bacteria 7428
680 Ga0496115_0078503 3300048918 Bacteria 2686
681 Ga0496115_0106248 3300048918 Bacteria 2304
682 Ga0496115_0315235 3300048918 Bacteria 1280
683 Ga0496115_0360506 3300048918 Bacteria 1185
684 Ga0496117_0270062 3300048920 Bacteria 917
685 Ga0496117_0565982 3300048920 Bacteria 538
686 Ga0496119_0297492 3300048922 Bacteria 797
687 Ga0496119_0352247 3300048922 Bacteria 713
688 Ga0496121_0051493 3300048924 Bacteria 3467
689 Ga0496121_0090679 3300048924 Bacteria 2389
690 Ga0496121_0197991 3300048924 Bacteria 1434
691 Ga0496121_0235468 3300048924 Bacteria 1280
692 Ga0496121_0464333 3300048924 Bacteria 812
693 Ga0496121_0573675 3300048924 Bacteria 701
694 Ga0496122_0043747 3300048925 Bacteria 3504
695 Ga0496123_0038344 3300048926 Bacteria 3369
696 Ga0496124_0139199 3300048927 Bacteria 1917
697 Ga0496124_0622139 3300048927 Bacteria 698
698 Ga0496124_0744982 3300048927 Bacteria 615
699 Ga0496125_0162134 3300048928 Bacteria 1517
700 Ga0496126_0087116 3300048929 Bacteria 2751
701 Ga0496126_0118789 3300048929 Bacteria 2295
702 Ga0496126_0119044 3300048929 Bacteria 2292
703 Ga0496126_0132769 3300048929 Bacteria 2150
704 Ga0496126_0160450 3300048929 Bacteria 1921
705 Ga0496126_0433879 3300048929 Bacteria 1060
706 Ga0496126_0660339 3300048929 Bacteria 817
707 Ga0495682_0122386 3300049460 Bacteria 931
708 Ga0495682_0363110 3300049460 Bacteria 510
709 Ga0501067_0272173 3300049583 Bacteria 943
710 Ga0501069_0098303 3300049585 Bacteria 1660
711 Ga0501075_0118801 3300049591 Bacteria 2011
712 Ga0501076_0784019 3300049592 Bacteria 786
713 Ga0501079_1334294 3300049741 Bacteria 565
714 Ga0501080_0562766 3300049742 Bacteria 1015
715 Ga0501044_0103068 3300049823 Bacteria 2868
716 Ga0501045_0412969 3300049824 Bacteria 1004
717 nmdc:mga03n38_17813_c1 3300050490 Bacteria 2445
718 nmdc:mga03n38_398046_c1 3300050490 Bacteria 758
719 nmdc:mga03n38_491791_c1 3300050490 Bacteria 687
720 nmdc:mga03n38_571478_c1 3300050490 Bacteria 641
721 nmdc:mga03n38_5980_c1 3300050490 Bacteria 4193
722 nmdc:mga0yw44_368591_c1 3300050492 Bacteria 969
723 nmdc:mga0yw44_45205_c1 3300050492 Bacteria 2639
724 nmdc:mga0yw44_506038_c1 3300050492 Bacteria 820
725 nmdc:mga0k408_217087_c1 3300050493 Bacteria 803
726 nmdc:mga06z11_1635_c1 3300050494 Bacteria 8385
727 nmdc:mga06z11_178552_c1 3300050494 Bacteria 1223
728 nmdc:mga06z11_335085_c1 3300050494 Bacteria 904
729 nmdc:mga06z11_60308_c1 3300050494 Bacteria 1975
730 nmdc:mga04h51_344917_c1 3300050495 Bacteria 615
731 nmdc:mga07m45_110229_c1 3300050496 Bacteria 1585
732 nmdc:mga07m45_162470_c1 3300050496 Bacteria 1297
733 nmdc:mga07m45_4675_c1 3300050496 Bacteria 6719
734 nmdc:mga08y16_173922_c1 3300050511 Bacteria 2236
735 nmdc:mga08y16_245669_c1 3300050511 Bacteria 1849
736 nmdc:mga0n895_612369_c1 3300050512 Bacteria 1090
737 nmdc:mga0rr50_476887_c1 3300050513 Bacteria 1059
738 nmdc:mga0a205_193600_c1 3300050515 Bacteria 1924
739 nmdc:mga0sz30_126269_c1 3300050516 Bacteria 1126
740 Ga0495601_0019393 3300053077 Bacteria 4147
741 Ga0495612_0435781 3300053078 Bacteria 598
742 Ga0500635_0096629 3300053080 Bacteria 1082
743 Ga0495655_0033329 3300053083 Bacteria 1267
744 Ga0495655_0034609 3300053083 Bacteria 1251
745 Ga0495655_0107462 3300053083 Bacteria 834
746 Ga0495595_0005744 3300053084 Bacteria 5026
747 Ga0495595_0263637 3300053084 Bacteria 864
748 Ga0495619_0004552 3300053085 Bacteria 8856
749 Ga0495619_0302881 3300053085 Bacteria 1107
750 Ga0500644_0294185 3300053088 Bacteria 694
751 Ga0500581_318590 3300053089 Bacteria 608
752 Ga0500583_0064312 3300053092 Bacteria 1739
753 Ga0500651_0088595 3300053093 Bacteria 1908
754 Ga0500651_0156231 3300053093 Bacteria 1366
755 Ga0500651_0502013 3300053093 Bacteria 669
756 Ga0500566_0010050 3300053094 Bacteria 5581
757 Ga0500566_0165313 3300053094 Bacteria 1149
758 Ga0500641_0014875 3300053096 Bacteria 2877
759 Ga0500554_012553 3300053102 Bacteria 2133
760 Ga0500562_167943 3300053108 Bacteria 596
761 Ga0500582_208300 3300053114 Bacteria 653
762 Ga0500592_027125 3300053116 Bacteria 924
763 Ga0500594_0233577 3300053118 Bacteria 610
764 Ga0500595_009735 3300053119 Bacteria 3864
765 Ga0500595_012199 3300053119 Bacteria 3331
766 Ga0500595_018065 3300053119 Bacteria 2586
767 Ga0500595_079764 3300053119 Bacteria 960
768 Ga0500617_042203 3300053124 Bacteria 2039
769 Ga0500642_0263260 3300053130 Bacteria 788
770 Ga0500655_081262 3300053133 Bacteria 667
771 Ga0500658_0095144 3300053134 Bacteria 1293
772 Ga0500559_0103752 3300053136 Bacteria 1312
773 Ga0500568_0097974 3300053139 Bacteria 1102
774 Ga0500577_0038066 3300053142 Bacteria 1734
775 Ga0500588_0212781 3300053146 Bacteria 719
776 Ga0500589_353926 3300053147 Bacteria 503
777 Ga0500590_235468 3300053148 Bacteria 742
778 Ga0500603_038751 3300053150 Bacteria 1263
779 Ga0500604_0236430 3300053151 Bacteria 631
780 Ga0500622_0046249 3300053156 Bacteria 2251
781 Ga0500622_0140857 3300053156 Bacteria 1150
782 Ga0500627_0257751 3300053158 Bacteria 770
783 Ga0500638_013381 3300053162 Bacteria 3709
784 Ga0500636_0016050 3300053177 Bacteria 4413
785 Ga0500636_0078991 3300053177 Bacteria 1898
786 Ga0500611_133847 3300053727 Bacteria 670
787 Ga0500609_013175 3300053731 Bacteria 1119
788 Ga0501084_1435220 3300054114 Bacteria 578
789 Ga0501082_0746738 3300060353 Bacteria 856
790 Ga0466962_0013365 3300061719 Bacteria 3952
791 2513694284 2513237101 Bacteria 7952346
792 2723841524 2721755755 Bacteria 8322773
793 2728750177 2728368998 Bacteria 8720350
794 2793079247
795 2874608181 2874604998 Bacteria 7834745
796 2876813400 2876808645 Bacteria 8824342
797 2879113049 2879110137 Bacteria 8907982
798 2889035631 2889033259 Bacteria 9099371
799 2922364108 2922361189 Bacteria 7436256
800 2922392684 2922386360 Bacteria 7017218
801 8006928526 8006926726 Bacteria 6749210
802 8006969247 8006964411 Bacteria 8966052
803 8006990803 8006984368 Bacteria 9651211
804 8006996705 8006994254 Bacteria 8309700
805 8056675623 8056673599 Bacteria 7871253
806 Ga0068857_100392373
807 JGI24739J22299_10008433
808 JGI24737J22298_10003455
809 JGI24735J21928_10010756
810 JGI25406J46586_10005215
811 JGI25165J46597_1011185
812 JGI25153J46596_10009381
813 JGI25153J46596_10099580
814 rootL2_10081179
815 Ga0070658_10079273
816 Ga0070658_10240747
817 Ga0070658_11025100
818 Ga0070658_11647460
819 Ga0070676_11334347
820 Ga0070683_100147368
821 Ga0070683_100346160
822 Ga0070690_100834939
823 Ga0070690_101282005
824 Ga0068869_100264216
825 Ga0068869_100339311
826 Ga0070666_10467129
827 Ga0070680_100018066
828 Ga0070682_100372167
829 Ga0068868_100017439
830 Ga0068868_100361227
831 Ga0068868_100498228
832 Ga0070660_100062560
833 Ga0070660_101076338
834 Ga0070689_101197692
835 Ga0070691_10313423
836 Ga0070687_100203360
837 Ga0070668_100088248
838 Ga0070668_100152558
839 Ga0070668_100244844
840 Ga0070668_100283108
841 Ga0070668_100318145
842 Ga0070669_100263323
843 Ga0070675_100222959
844 Ga0070671_100233097
845 Ga0070671_100281890
846 Ga0070671_100497528
847 Ga0070671_100874210
848 Ga0070671_100984138
849 Ga0070674_100088430
850 Ga0070674_100128680
851 Ga0070673_100372555
852 Ga0070688_100754267
853 Ga0070659_100249855
854 Ga0070659_101803191
855 Ga0070667_100085231
856 Ga0070667_101169685
857 Ga0070703_10016682
858 Ga0070714_100089955
859 Ga0070713_100046936
860 Ga0070713_101764942
861 Ga0070701_10131050
862 Ga0070711_100238081
863 Ga0070711_100369070
864 Ga0070700_100158471
865 Ga0070700_100442001
866 Ga0070700_100619382
867 Ga0070708_100994007
868 Ga0070663_100030169
869 Ga0070663_100080063
870 Ga0070663_100199891
871 Ga0070663_100257390
872 Ga0070663_100379742
873 Ga0070663_100436715
874 Ga0070663_100958409
875 Ga0070663_101215762
876 Ga0070678_100171509
877 Ga0070678_100391767
878 Ga0070678_100564956
879 Ga0070662_100040266
880 Ga0070662_100148881
881 Ga0070662_100158318
882 Ga0070662_100209811
883 Ga0070681_10065324
884 Ga0068867_100110958
885 Ga0068867_100634148
886 Ga0068867_100773717
887 Ga0068867_101398757
888 Ga0070685_10163787
889 Ga0070706_100980692
890 Ga0070699_100107520
891 Ga0070679_100465962
892 Ga0070684_100052912
893 Ga0070697_100427399
894 Ga0068853_100012905
895 Ga0068853_100253527
896 Ga0068853_100295620
897 Ga0068853_100415656
898 Ga0068853_101077099
899 Ga0068853_101387285
900 Ga0070672_100138617
901 Ga0070672_100213491
902 Ga0070672_100328134
903 Ga0070672_100469480
904 Ga0070672_100841199
905 Ga0070696_100316547
906 Ga0070693_100063435
907 Ga0070693_100130227
908 Ga0070665_100019142
909 Ga0070665_100128458
910 Ga0070665_100179785
911 Ga0070665_100411600
912 Ga0070665_100435153
913 Ga0070665_100542951
914 Ga0070665_100671254
915 Ga0070665_100673360
916 Ga0070665_101273452
917 Ga0070665_101616033
918 Ga0070704_100633509
919 Ga0068855_100057419
920 Ga0068855_100070689
921 Ga0068855_100263706
922 Ga0068855_100373102
923 Ga0070664_100751088
924 Ga0068857_100027044
925 Ga0068857_101186938
926 Ga0068854_100055979
927 Ga0068854_100096044
928 Ga0068854_100840992
929 Ga0068854_101131792
930 Ga0068856_100074933
931 Ga0068856_100133640
932 Ga0070702_100042184
933 Ga0070702_100097584
934 Ga0070702_100434081
935 Ga0070702_100720462
936 Ga0070702_101389587
937 Ga0068852_100020357
938 Ga0068852_100806992
939 Ga0068852_102280342
940 Ga0068852_102384920
941 Ga0068859_100922389
942 Ga0068859_101416802
943 Ga0068864_100055720
944 Ga0068864_100136663
945 Ga0068864_100648827
946 Ga0068866_11068919
947 Ga0068861_100242198
948 Ga0068851_10291455
949 Ga0068851_10304188
950 Ga0068851_10628174
951 Ga0068863_100160532
952 Ga0068863_100893245
953 Ga0068863_100925600
954 Ga0068858_100150267
955 Ga0068858_100610224
956 Ga0068858_100851340
957 Ga0068858_101009137
958 Ga0068860_100112266
959 Ga0068860_100871812
960 Ga0068860_100931250
961 Ga0068860_101475673
962 Ga0068862_100183972
963 Ga0068862_100858684
964 Ga0068862_100913977
965 Ga0081455_10050463
966 Ga0081540_1011558
967 Ga0081540_1014715
968 Ga0081540_1017112
969 Ga0081540_1211563
970 Ga0081539_10000064
971 Ga0070717_10097859
972 Ga0070717_10180752
973 Ga0075365_10117592
974 Ga0075365_10154250
975 Ga0075365_10215462
976 Ga0075365_10225340
977 Ga0075368_10021396
978 Ga0075368_10118595
979 Ga0075368_10196974
980 Ga0075368_10215681
981 Ga0075363_100005325
982 Ga0075363_100029102
983 Ga0075363_100030237
984 Ga0075363_100235201
985 Ga0075363_100307431
986 Ga0075363_100385140
987 Ga0075364_10692632
988 Ga0070715_10389178
989 Ga0070716_100595766
990 Ga0075362_10458062
991 Ga0075367_10007297
992 Ga0075367_10015170
993 Ga0075367_10219997
994 Ga0075369_10041391
995 Ga0075369_10305211
996 Ga0075366_10350083
997 Ga0075366_10360031
998 Ga0097621_100508845
999 Ga0075370_10011535
1000 Ga0075370_10099564
1001 Ga0075370_10624283
1002 Ga0075370_10662894
1003 Ga0068871_100102292
1004 Ga0068871_100527879
1005 Ga0068871_101297350
1006 Ga0075428_100188137
1007 Ga0075434_100469429
1008 Ga0068865_100076637
1009 Ga0068865_100142268
1010 Ga0097620_100922448
1011 Ga0097620_101416781
1012 Ga0075435_100347253
1013 Ga0099794_10089242
1014 Ga0099795_10257165
1015 Ga0099795_10329732
1016 Ga0105244_10161679
1017 Ga0105250_10182236
1018 Ga0105240_10052947
1019 Ga0105240_10096404
1020 Ga0105240_11435480
1021 Ga0105240_11663527
1022 Ga0105240_12409831
1023 Ga0105245_11333720
1024 Ga0105245_12335361
1025 Ga0105243_10088250
1026 Ga0105243_10604837
1027 Ga0105243_10827118
1028 Ga0105243_11839052
1029 Ga0105241_10205112
1030 Ga0105242_10321779
1031 Ga0105242_10418227
1032 Ga0105242_10506546
1033 Ga0105248_10368371
1034 Ga0105248_10461729
1035 Ga0105248_12905326
1036 Ga0105237_10056521
1037 Ga0105237_10110164
1038 Ga0105237_10146031
1039 Ga0105237_10453523
1040 Ga0105237_11809425
1041 Ga0105238_10896088
1042 Ga0105238_11398738
1043 Ga0105249_10244717
1044 Ga0105249_10965749
1045 Ga0105239_10073098
1046 Ga0105239_10089479
1047 Ga0105239_10123251
1048 Ga0105246_10055737
1049 Ga0157371_10219937
1050 Ga0157370_10046316
1051 Ga0157370_10497902
1052 Ga0157370_10630783
1053 Ga0157369_10154697
1054 Ga0157369_11115461
1055 Ga0157374_10053970
1056 Ga0157374_11925177
1057 Ga0157374_12246950
1058 Ga0157378_10088288
1059 Ga0157378_10174963
1060 Ga0157378_10221829
1061 Ga0157378_11095964
1062 Ga0163162_10134721
1063 Ga0163162_10440739
1064 Ga0163162_10579881
1065 Ga0157372_10147883
1066 Ga0157372_10976849
1067 Ga0157372_11012270
1068 Ga0157375_10014475
1069 Ga0157375_10712059
1070 Ga0157375_10790167
1071 Ga0157375_10972236
1072 Ga0157375_11281349
1073 Ga0163163_10046730
1074 Ga0163163_10118812
1075 Ga0163163_10971652
1076 Ga0163163_12345601
1077 Ga0157380_10260103
1078 Ga0157380_10270599
1079 Ga0157380_11229380
1080 Ga0157377_10382528
1081 Ga0157377_10737513
1082 Ga0157379_11007381
1083 Ga0157379_11560050
1084 Ga0157376_10064864
1085 Ga0157376_10833138
1086 Ga0182007_10091900
1087 Ga0163161_10139621
1088 Ga0163161_10338948
1089 Ga0163161_10350818
1090 Ga0197907_10455470
1091 Ga0206356_11459300
1092 Ga0206353_12005028
1093 Ga0213874_10051250
1094 Ga0209233_1001649
1095 Ga0209758_1007289
1096 Ga0209758_1148378
1097 Ga0207696_1033097
1098 Ga0207653_10139414
1099 Ga0207682_10466322
1100 Ga0207692_10047811
1101 Ga0207642_10054249
1102 Ga0207688_10073648
1103 Ga0207688_10351589
1104 Ga0207680_10488353
1105 Ga0207680_11273215
1106 Ga0207647_10005928
1107 Ga0207647_10139153
1108 Ga0207685_10382164
1109 Ga0207685_10392504
1110 Ga0207699_10096491
1111 Ga0207645_10054999
1112 Ga0207645_10096272
1113 Ga0207645_10887325
1114 Ga0207643_10041154
1115 Ga0207643_10527666
1116 Ga0207705_10557994
1117 Ga0207684_10155703
1118 Ga0207654_10628476
1119 Ga0207695_10069546
1120 Ga0207695_10182037
1121 Ga0207695_10270755
1122 Ga0207671_10155082
1123 Ga0207671_10362757
1124 Ga0207671_11203201
1125 Ga0207693_10022773
1126 Ga0207693_10597003
1127 Ga0207662_10132127
1128 Ga0207657_10354045
1129 Ga0207657_11107559
1130 Ga0207649_10355342
1131 Ga0207649_10398801
1132 Ga0207649_11498646
1133 Ga0207652_10736342
1134 Ga0207652_11037265
1135 Ga0207646_11593448
1136 Ga0207681_10685122
1137 Ga0207694_10671605
1138 Ga0207650_10106821
1139 Ga0207650_10568517
1140 Ga0207659_10257806
1141 Ga0207687_10022560
1142 Ga0207700_10027465
1143 Ga0207700_11116048
1144 Ga0207664_10388764
1145 Ga0207664_10455053
1146 Ga0207644_10052228
1147 Ga0207644_10120835
1148 Ga0207644_10393145
1149 Ga0207644_10563199
1150 Ga0207644_10983684
1151 Ga0207690_10362134
1152 Ga0207706_10067851
1153 Ga0207706_10177906
1154 Ga0207706_10205187
1155 Ga0207686_10273571
1156 Ga0207686_11271611
1157 Ga0207709_10017778
1158 Ga0207709_10200747
1159 Ga0207670_10435555
1160 Ga0207669_10045133
1161 Ga0207704_10097706
1162 Ga0207704_10167476
1163 Ga0207691_10089157
1164 Ga0207711_10223168
1165 Ga0207711_10426130
1166 Ga0207689_10276155
1167 Ga0207689_10633655
1168 Ga0207661_10309373
1169 Ga0207661_10397111
1170 Ga0207661_10775318
1171 Ga0207661_11459510
1172 Ga0207679_10118617
1173 Ga0207679_11118337
1174 Ga0207667_10010892
1175 Ga0207667_10153908
1176 Ga0207667_10218640
1177 Ga0207667_10314164
1178 Ga0207667_11836754
1179 Ga0207651_10165775
1180 Ga0207651_11036248
1181 Ga0207712_10112906
1182 Ga0207712_10235683
1183 Ga0207668_10011583
1184 Ga0207668_10228215
1185 Ga0207668_11241656
1186 Ga0207640_10021376
1187 Ga0207640_10133311
1188 Ga0207640_10467749
1189 Ga0207640_10660578
1190 Ga0207640_11173404
1191 Ga0207658_10903353
1192 Ga0207677_10013346
1193 Ga0207677_10722110
1194 Ga0207677_10760149
1195 Ga0207703_10101793
1196 Ga0207703_11912629
1197 Ga0207639_10019626
1198 Ga0207639_10248379
1199 Ga0207639_10445340
1200 Ga0207639_10818650
1201 Ga0207639_10848347
1202 Ga0207639_11452700
1203 Ga0207678_10052756
1204 Ga0207678_10164026
1205 Ga0207678_10186718
1206 Ga0207678_10230153
1207 Ga0207678_10309026
1208 Ga0207678_10392416
1209 Ga0207678_10851107
1210 Ga0207678_11958303
1211 Ga0207708_10202129
1212 Ga0207708_10433663
1213 Ga0207702_10052064
1214 Ga0207702_10172952
1215 Ga0207702_12202795
1216 Ga0207641_10380170
1217 Ga0207641_10708850
1218 Ga0207648_10043468
1219 Ga0207648_10592262
1220 Ga0207648_10780756
1221 Ga0207648_10883846
1222 Ga0207676_10107064
1223 Ga0207676_10184366
1224 Ga0207676_10380481
1225 Ga0207674_10021710
1226 Ga0207674_10153404
1227 Ga0207675_100251355
1228 Ga0207675_100400302
1229 Ga0207675_100806480
1230 Ga0207683_10061295
1231 Ga0207683_10091111
1232 Ga0207683_10180544
1233 Ga0207698_10385807
1234 Ga0207698_10537740
1235 Ga0207698_10861096
1236 Ga0209813_10073936
1237 Ga0209813_10480531
1238 Ga0268266_10002812
1239 Ga0268266_10029434
1240 Ga0268266_10112122
1241 Ga0268266_10162168
1242 Ga0268266_10298002
1243 Ga0268266_10329585
1244 Ga0268266_11857886
1245 Ga0268265_10241057
1246 Ga0268265_10544813
1247 Ga0268265_11520132
1248 Ga0268264_10614413
1249 Ga0268264_11440428
1250 Ga0268264_11736126
1251 Ga0265334_10084157
1252 Ga0307517_10294956
1253 Ga0265330_10031347
1254 Ga0265316_10415928
1255 Ga0307509_10103672
1256 Ga0307509_10919713
1257 Ga0307408_100192648
1258 Ga0307408_100374703
1259 Ga0307408_100508238
1260 Ga0307405_10226358
1261 Ga0307405_10259172
1262 Ga0307405_10315312
1263 Ga0307413_10589433
1264 Ga0307410_10562951
1265 Ga0307406_10826365
1266 Ga0307412_10707487
1267 Ga0307412_10822305
1268 Ga0307409_101901819
1269 Ga0307416_100775170
1270 Ga0307416_101040643
1271 Ga0307416_101305825
1272 Ga0307416_102753952
1273 Ga0307414_10192703
1274 Ga0307411_10610492
1275 Ga0307415_100179163
1276 Ga0307415_101429907
1277 Ga0307510_10012380
1278 Ga0373930_0017613
1279 Ga0373938_0008298
1280 Ga0373952_0018680
1281 Ga0373923_0044018
1282 Ga0373936_0330504
1283 Ga0373953_0017348
1284 Ga0373954_0000485
1285 Ga0373956_0002322
1286 Ga0373957_0002098
1287 Ga0373943_0296076
1288 Ga0373943_0613897
1289 Ga0373946_0052531
1290 Ga0373955_0001048
1291 Ga0373961_0410104
1292 Ga0373962_0132155
1293 Ga0373924_0011160
1294 Ga0373931_0001548
1295 Ga0373935_0179475
1296 Ga0373927_0022428
1297 Ga0373927_0148417
1298 Ga0373933_0006053
1299 Ga0373947_0500014
1300 Ga0373937_0012128
1301 Ga0373937_0425321
1302 Ga0373925_0045291
1303 Ga0373925_0068132
1304 Ga0373925_0081956
1305 Ga0395899_0346753
1306 Ga0395900_0021426
1307 Ga0395900_0169580
1308 Ga0395900_0494704
1309 Ga0395898_0194856
1310 Ga0395905_0108510
1311 Ga0395905_0113191
1312 Ga0395901_0391985
1313 Ga0395901_0698863
1314 Ga0436363_1098998
1315 Ga0451793_1118957
1316 Ga0451798_0469240
1317 Ga0451839_1325167
1318 Ga0450897_048031
1319 Ga0439458_0063552
1320 Ga0466961_0118370
1321 Ga0466968_0617894
1322 Ga0466957_0821185
1323 Ga0466959_0074260
1324 Ga0495617_057234
1325 Ga0495627_134649
1326 Ga0495592_0000993
1327 Ga0495603_0011755
1328 Ga0495603_0041753
1329 Ga0495603_0153105
1330 Ga0495603_0162976
1331 Ga0495629_0000337
1332 Ga0495629_0046968
1333 Ga0495629_0189723
1334 Ga0495638_0051601
1335 Ga0495638_0237924
1336 Ga0495641_0075362
1337 Ga0495651_0003587
1338 Ga0495651_0088120
1339 Ga0495653_0010108
1340 Ga0495650_0036682
1341 Ga0495650_0271239
1342 Ga0495605_0057517
1343 Ga0495605_0106659
1344 Ga0495605_0241954
1345 Ga0495639_0088681
1346 Ga0495639_0147393
1347 Ga0495664_0006563
1348 Ga0495664_0348115
1349 Ga0495584_0198382
1350 Ga0495584_0261356
1351 Ga0495585_0035860
1352 Ga0495585_0059441
1353 Ga0495585_0077818
1354 Ga0495594_0204962
1355 Ga0495596_0072077
1356 Ga0495607_0288053
1357 Ga0495606_0068246
1358 Ga0495606_0535219
1359 Ga0495608_0001320
1360 Ga0495618_0004991
1361 Ga0495620_0149069
1362 Ga0495620_0205065
1363 Ga0495628_0016528
1364 Ga0495628_0735780
1365 Ga0495631_0063228
1366 Ga0495631_0122509
1367 Ga0495631_0367840
1368 Ga0495632_0118457
1369 Ga0495643_0053086
1370 Ga0495644_0022633
1371 Ga0495663_0032813
1372 Ga0495666_0064258
1373 Ga0495642_0133238
1374 Ga0495652_0001922
1375 Ga0495654_0165217
1376 Ga0495640_0718324
1377 Ga0495587_0003825
1378 Ga0495587_0766015
1379 Ga0495598_0019538
1380 Ga0495597_0180705
1381 Ga0495645_0023410
1382 Ga0495645_0071654
1383 Ga0495622_0006549
1384 Ga0495622_0188835
1385 Ga0495633_0125598
1386 Ga0495667_0000270
1387 Ga0495656_0003938
1388 Ga0495656_0052846
1389 Ga0495656_0095532
1390 Ga0495668_0070207
1391 Ga0495668_0163757
1392 Ga0495634_0015449
1393 Ga0495611_0093853
1394 Ga0495625_0516814
1395 Ga0495635_0000834
1396 Ga0495635_0318248
1397 Ga0495659_0017123
1398 Ga0495659_0030338
1399 Ga0495661_0289104
1400 Ga0495588_0076930
1401 Ga0495588_0148198
1402 Ga0495657_0007029
1403 Ga0495599_0000635
1404 Ga0495623_0392075
1405 Ga0495646_0002988
1406 Ga0495669_0039585
1407 Ga0495669_0128597
1408 Ga0495670_0064280
1409 Ga0495670_0136577
1410 Ga0495671_0139842
1411 Ga0495671_0544261
1412 Ga0495589_0064956
1413 Ga0495600_0000400
1414 Ga0495600_0063160
1415 Ga0495600_0165461
1416 Ga0495581_0118703
1417 Ga0495581_0314132
1418 Ga0495604_0001388
1419 Ga0495636_0104202
1420 Ga0495674_0118784
1421 Ga0495672_0013378
1422 Ga0495676_0045100
1423 Ga0495680_0002455
1424 Ga0495683_0067711
1425 Ga0495675_0002361
1426 Ga0495677_0018701
1427 Ga0495685_028214
1428 Ga0495685_071635
1429 Ga0495681_0145261
1430 Ga0495684_0000766
1431 Ga0495686_0099192
1432 Ga0495686_0534594
1433 Ga0495593_0000120
1434 Ga0495602_0003415
1435 Ga0495615_0052504
1436 Ga0495615_0197472
1437 Ga0495626_0286842
1438 Ga0495626_0413670
1439 Ga0496100_0043594
1440 Ga0496100_0061023
1441 Ga0496100_0129496
1442 Ga0496101_0378583
1443 Ga0496101_0417662
1444 Ga0496102_0001803
1445 Ga0496102_0093012
1446 Ga0496102_0124592
1447 Ga0496102_0286813
1448 Ga0496102_0353723
1449 Ga0496103_0312029
1450 Ga0496103_0336299
1451 Ga0496104_0003129
1452 Ga0496104_0248522
1453 Ga0496105_0009706
1454 Ga0496105_0026604
1455 Ga0496105_0268532
1456 Ga0496106_0025341
1457 Ga0496106_0067913
1458 Ga0496106_0170028
1459 Ga0496106_0213519
1460 Ga0496107_0032300
1461 Ga0496107_0054072
1462 Ga0496107_0171793
1463 Ga0496107_1053741
1464 Ga0496108_0029193
1465 Ga0496108_0284308
1466 Ga0496109_0022102
1467 Ga0496109_0043861
1468 Ga0496110_0013612
1469 Ga0496110_0065175
1470 Ga0496110_0542371
1471 Ga0496111_0037247
1472 Ga0496111_0051421
1473 Ga0496112_0072990
1474 Ga0496112_0097212
1475 Ga0496112_0242306
1476 Ga0496112_1045728
1477 Ga0496113_0013883
1478 Ga0496113_0050419
1479 Ga0496114_0034023
1480 Ga0496114_0040283
1481 Ga0496114_0096292
1482 Ga0496114_0139459
1483 Ga0496114_0184721
1484 Ga0496115_0008944
1485 Ga0496115_0078503
1486 Ga0496115_0106248
1487 Ga0496115_0315235
1488 Ga0496115_0360506
1489 Ga0496117_0270062
1490 Ga0496117_0565982
1491 Ga0496119_0297492
1492 Ga0496119_0352247
1493 Ga0496121_0051493
1494 Ga0496121_0090679
1495 Ga0496121_0197991
1496 Ga0496121_0235468
1497 Ga0496121_0464333
1498 Ga0496121_0573675
1499 Ga0496122_0043747
1500 Ga0496123_0038344
1501 Ga0496124_0139199
1502 Ga0496124_0622139
1503 Ga0496124_0744982
1504 Ga0496125_0162134
1505 Ga0496126_0087116
1506 Ga0496126_0118789
1507 Ga0496126_0119044
1508 Ga0496126_0132769
1509 Ga0496126_0160450
1510 Ga0496126_0433879
1511 Ga0496126_0660339
1512 Ga0495682_0122386
1513 Ga0495682_0363110
1514 Ga0501067_0272173
1515 Ga0501069_0098303
1516 Ga0501075_0118801
1517 Ga0501076_0784019
1518 Ga0501079_1334294
1519 Ga0501080_0562766
1520 Ga0501044_0103068
1521 Ga0501045_0412969
1522 nmdc:mga03n38_17813_c1
1523 nmdc:mga03n38_398046_c1
1524 nmdc:mga03n38_491791_c1
1525 nmdc:mga03n38_571478_c1
1526 nmdc:mga03n38_5980_c1
1527 nmdc:mga0yw44_368591_c1
1528 nmdc:mga0yw44_45205_c1
1529 nmdc:mga0yw44_506038_c1
1530 nmdc:mga0k408_217087_c1
1531 nmdc:mga06z11_1635_c1
1532 nmdc:mga06z11_178552_c1
1533 nmdc:mga06z11_335085_c1
1534 nmdc:mga06z11_60308_c1
1535 nmdc:mga04h51_344917_c1
1536 nmdc:mga07m45_110229_c1
1537 nmdc:mga07m45_162470_c1
1538 nmdc:mga07m45_4675_c1
1539 nmdc:mga08y16_173922_c1
1540 nmdc:mga08y16_245669_c1
1541 nmdc:mga0n895_612369_c1
1542 nmdc:mga0rr50_476887_c1
1543 nmdc:mga0a205_193600_c1
1544 nmdc:mga0sz30_126269_c1
1545 Ga0495601_0019393
1546 Ga0495612_0435781
1547 Ga0500635_0096629
1548 Ga0495655_0033329
1549 Ga0495655_0034609
1550 Ga0495655_0107462
1551 Ga0495595_0005744
1552 Ga0495595_0263637
1553 Ga0495619_0004552
1554 Ga0495619_0302881
1555 Ga0500644_0294185
1556 Ga0500581_318590
1557 Ga0500583_0064312
1558 Ga0500651_0088595
1559 Ga0500651_0156231
1560 Ga0500651_0502013
1561 Ga0500566_0010050
1562 Ga0500566_0165313
1563 Ga0500641_0014875
1564 Ga0500554_012553
1565 Ga0500562_167943
1566 Ga0500582_208300
1567 Ga0500592_027125
1568 Ga0500594_0233577
1569 Ga0500595_009735
1570 Ga0500595_012199
1571 Ga0500595_018065
1572 Ga0500595_079764
1573 Ga0500617_042203
1574 Ga0500642_0263260
1575 Ga0500655_081262
1576 Ga0500658_0095144
1577 Ga0500559_0103752
1578 Ga0500568_0097974
1579 Ga0500577_0038066
1580 Ga0500588_0212781
1581 Ga0500589_353926
1582 Ga0500590_235468
1583 Ga0500603_038751
1584 Ga0500604_0236430
1585 Ga0500622_0046249
1586 Ga0500622_0140857
1587 Ga0500627_0257751
1588 Ga0500638_013381
1589 Ga0500636_0016050
1590 Ga0500636_0078991
1591 Ga0500611_133847
1592 Ga0500609_013175
1593 Ga0501084_1435220
1594 Ga0501082_0746738
1595 Ga0466962_0013365
1596 2513694284
1597 2723841524
1598 2728750177
1599 2793079247
1600 2874608181
1601 2876813400
1602 2879113049
1603 2889035631
1604 2922364108
1605 2922392684
1606 8006928526
1607 8006969247
1608 8006990803
1609 8006996705
1610 8056675623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06305

LapA_dom

Lipopolysaccharide assembly protein A domain

26

95

0.89

Map