F481498

General Info

Members Datasets Scaffolds Average Seq Length
803 305 803 145

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100952075|Ga0068864_1009520751
Length 168
Sequence MPFGPLCLWPRRAEQWCSRGLSHAVKTFVATPSDRQRDWLIVDATGQTLGRLATQIADALRGKRKPTYTPHIDTGDFVVVINAEKIAVTGNKRADKLYHRHSGYPGGLKTRTLNDMLERRPEEVIRLAVKGMLPRNRLARKQITKLKVYAGPDHPHAAQKPQPMETHS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
73 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
89 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
146 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
185 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
189 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
291 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
295 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 3.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 8.72
Rhizosphere 84.43
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002561 3300003203 Bacteria 8584
2 JGI25407J50210_10085676 3300003373 Bacteria 781
3 Ga0058861_12004293 3300004800 Bacteria 750
4 Ga0070683_100016302 3300005329 Bacteria 6551
5 Ga0070683_100489595 3300005329 Bacteria 1174
6 Ga0070683_100499048 3300005329 Bacteria 1163
7 Ga0070670_100893914 3300005331 Bacteria 805
8 Ga0070680_100001187 3300005336 Bacteria 18758
9 Ga0070682_100018480 3300005337 Bacteria 4077
10 Ga0070682_100357653 3300005337 Bacteria 1091
11 Ga0068868_100386029 3300005338 Bacteria 1206
12 Ga0070660_100082250 3300005339 Bacteria 2528
13 Ga0070660_100661699 3300005339 Bacteria 875
14 Ga0070661_100018973 3300005344 Bacteria 4897
15 Ga0070692_10072955 3300005345 Bacteria 1833
16 Ga0070692_10123232 3300005345 Bacteria 1448
17 Ga0070692_10559306 3300005345 Bacteria 751
18 Ga0070668_100311482 3300005347 Bacteria 1323
19 Ga0070669_101482361 3300005353 Bacteria 590
20 Ga0070671_100922039 3300005355 Bacteria 764
21 Ga0070688_100560484 3300005365 Bacteria 870
22 Ga0070659_100031342 3300005366 Bacteria 4117
23 Ga0070659_100350301 3300005366 Bacteria 1239
24 Ga0070659_100792790 3300005366 Bacteria 824
25 Ga0070714_100020853 3300005435 Bacteria 5356
26 Ga0070714_100164862 3300005435 Bacteria 2007
27 Ga0070714_100245552 3300005435 Bacteria 1654
28 Ga0070714_100514681 3300005435 Bacteria 1142
29 Ga0070714_100838808 3300005435 Bacteria 891
30 Ga0070713_100065622 3300005436 Bacteria 3050
31 Ga0070713_100500159 3300005436 Bacteria 1147
32 Ga0070701_10200377 3300005438 Bacteria 1180
33 Ga0070701_10449642 3300005438 Bacteria 827
34 Ga0070701_10647880 3300005438 Bacteria 705
35 Ga0070700_100259415 3300005441 Bacteria 1251
36 Ga0070700_100556894 3300005441 Bacteria 892
37 Ga0070663_100229924 3300005455 Bacteria 1460
38 Ga0070663_100395474 3300005455 Bacteria 1128
39 Ga0070663_100855566 3300005455 Bacteria 783
40 Ga0070662_100003455 3300005457 Bacteria 9853
41 Ga0070662_100793372 3300005457 Bacteria 805
42 Ga0070681_10316943 3300005458 Bacteria 1469
43 Ga0070681_10431836 3300005458 Bacteria 1229
44 Ga0070681_10821752 3300005458 Bacteria 847
45 Ga0070685_10376867 3300005466 Bacteria 977
46 Ga0070699_100498188 3300005518 Bacteria 1106
47 Ga0070679_100122043 3300005530 Bacteria 2590
48 Ga0070679_100180153 3300005530 Bacteria 2086
49 Ga0070679_100357278 3300005530 Bacteria 1408
50 Ga0070684_100009562 3300005535 Bacteria 7639
51 Ga0070684_100035389 3300005535 Bacteria 4274
52 Ga0068853_100185745 3300005539 Bacteria 1887
53 Ga0068853_100569853 3300005539 Bacteria 1074
54 Ga0068853_100993200 3300005539 Bacteria 808
55 Ga0070695_100493412 3300005545 Bacteria 946
56 Ga0070695_100882835 3300005545 Bacteria 721
57 Ga0070696_100139810 3300005546 Bacteria 1769
58 Ga0070665_100001216 3300005548 Bacteria 31377
59 Ga0070664_101073810 3300005564 Bacteria 758
60 Ga0068854_100126809 3300005578 Bacteria 1945
61 Ga0068854_100192698 3300005578 Bacteria 1598
62 Ga0068856_100006897 3300005614 Bacteria 11109
63 Ga0068856_100195443 3300005614 Bacteria 2037
64 Ga0070702_100057860 3300005615 Bacteria 2243
65 Ga0068852_100009403 3300005616 Bacteria 7260
66 Ga0068852_100192369 3300005616 Bacteria 1926
67 Ga0068852_101873349 3300005616 Bacteria 622
68 Ga0068859_100479965 3300005617 Bacteria 1339
69 Ga0068864_100204497 3300005618 Bacteria 1815
70 Ga0068864_100952075 3300005618 Bacteria 850
71 Ga0068864_101208342 3300005618 Bacteria 755
72 Ga0068866_10204449 3300005718 Bacteria 1182
73 Ga0068861_100014162 3300005719 Bacteria 5593
74 Ga0068861_100511264 3300005719 Bacteria 1088
75 Ga0068863_100986656 3300005841 Bacteria 845
76 Ga0068863_101562070 3300005841 Bacteria 669
77 Ga0068858_100238167 3300005842 Bacteria 1726
78 Ga0068862_101150507 3300005844 Bacteria 773
79 Ga0081455_10099870 3300005937 Bacteria 2333
80 Ga0081455_10171225 3300005937 Bacteria 1654
81 Ga0081538_10000609 3300005981 Bacteria 39610
82 Ga0081538_10002557 3300005981 Bacteria 17683
83 Ga0081538_10022872 3300005981 Bacteria 4511
84 Ga0081538_10172463 3300005981 Bacteria 941
85 Ga0081538_10202953 3300005981 Bacteria 811
86 Ga0081540_1001376 3300005983 Bacteria 21079
87 Ga0081540_1033321 3300005983 Bacteria 2799
88 Ga0081539_10000855 3300005985 Bacteria 58253
89 Ga0081539_10005617 3300005985 Bacteria 12624
90 Ga0081539_10012636 3300005985 Bacteria 6475
91 Ga0081539_10044377 3300005985 Bacteria 2567
92 Ga0081539_10314162 3300005985 Bacteria 669
93 Ga0070717_10122002 3300006028 Bacteria 2233
94 Ga0070717_10552407 3300006028 Bacteria 1043
95 Ga0075365_10595340 3300006038 Bacteria 782
96 Ga0075432_10028964 3300006058 Bacteria 1911
97 Ga0075432_10061273 3300006058 Bacteria 1340
98 Ga0075428_100016116 3300006844 Bacteria 8261
99 Ga0075428_100022509 3300006844 Bacteria 6978
100 Ga0075428_100597740 3300006844 Bacteria 1179
101 Ga0075428_101360316 3300006844 Bacteria 746
102 Ga0075428_102036170 3300006844 Bacteria 595
103 Ga0075430_100082707 3300006846 Bacteria 2690
104 Ga0075431_100103948 3300006847 Bacteria 2931
105 Ga0075431_100137029 3300006847 Bacteria 2524
106 Ga0075431_100335634 3300006847 Bacteria 1522
107 Ga0075433_10186100 3300006852 Bacteria 1848
108 Ga0075433_10634960 3300006852 Bacteria 937
109 Ga0075434_100603220 3300006871 Bacteria 1117
110 Ga0075429_100026641 3300006880 Bacteria 5020
111 Ga0097620_100479975 3300006931 Bacteria 1339
112 Ga0099795_10157658 3300007788 Bacteria 934
113 Ga0105240_10173545 3300009093 Bacteria 2551
114 Ga0105240_11167292 3300009093 Bacteria 817
115 Ga0111539_10100528 3300009094 Bacteria 3395
116 Ga0111539_10143602 3300009094 Bacteria 2794
117 Ga0111539_10713949 3300009094 Bacteria 1167
118 Ga0111539_10931528 3300009094 Bacteria 1010
119 Ga0111539_11149772 3300009094 Bacteria 902
120 Ga0111539_11500027 3300009094 Bacteria 782
121 Ga0111539_13528572 3300009094 Bacteria 502
122 Ga0105245_10011999 3300009098 Bacteria 7533
123 Ga0105245_10035645 3300009098 Bacteria 4417
124 Ga0105245_10187372 3300009098 Bacteria 1980
125 Ga0105245_11015018 3300009098 Bacteria 874
126 Ga0105245_11056895 3300009098 Bacteria 857
127 Ga0105245_11197293 3300009098 Bacteria 808
128 Ga0114129_10000969 3300009147 Bacteria 37546
129 Ga0114129_10393711 3300009147 Bacteria 1827
130 Ga0114129_10581080 3300009147 Bacteria 1454
131 Ga0114129_10911879 3300009147 Bacteria 1113
132 Ga0105243_10878688 3300009148 Bacteria 890
133 Ga0105243_11513013 3300009148 Bacteria 695
134 Ga0105241_10791027 3300009174 Bacteria 873
135 Ga0105241_10994159 3300009174 Bacteria 784
136 Ga0105241_11614759 3300009174 Bacteria 627
137 Ga0105242_10383300 3300009176 Bacteria 1307
138 Ga0105242_10776519 3300009176 Bacteria 946
139 Ga0105242_11136904 3300009176 Bacteria 797
140 Ga0105248_10354448 3300009177 Bacteria 1652
141 Ga0105237_10039876 3300009545 Bacteria 4738
142 Ga0105237_12291746 3300009545 Bacteria 550
143 Ga0105238_10005680 3300009551 Bacteria 12331
144 Ga0105238_11438209 3300009551 Bacteria 717
145 Ga0105238_11675084 3300009551 Bacteria 667
146 Ga0105249_10029745 3300009553 Bacteria 4934
147 Ga0105239_10225089 3300010375 Bacteria 2104
148 Ga0105239_10548475 3300010375 Bacteria 1316
149 Ga0105239_10658856 3300010375 Bacteria 1196
150 Ga0105246_10304065 3300011119 Bacteria 1289
151 Ga0105246_11043792 3300011119 Bacteria 743
152 Ga0105246_12021804 3300011119 Bacteria 556
153 Ga0157318_1004370 3300012482 Bacteria 859
154 Ga0157326_1067527 3300012513 Bacteria 560
155 Ga0157371_10944850 3300013102 Bacteria 655
156 Ga0157370_10102279 3300013104 Bacteria 2683
157 Ga0157369_10053608 3300013105 Bacteria 4357
158 Ga0157369_11177688 3300013105 Bacteria 782
159 Ga0157374_12391395 3300013296 Bacteria 556
160 Ga0163162_10574923 3300013306 Bacteria 1254
161 Ga0157372_10082070 3300013307 Bacteria 3649
162 Ga0157372_10636804 3300013307 Bacteria 1242
163 Ga0157375_10374218 3300013308 Bacteria 1591
164 Ga0163163_10066202 3300014325 Bacteria 3588
165 Ga0163163_10354935 3300014325 Bacteria 1522
166 Ga0163163_12069435 3300014325 Bacteria 629
167 Ga0182008_10149866 3300014497 Bacteria 1170
168 Ga0182008_10386045 3300014497 Bacteria 749
169 Ga0157377_10041436 3300014745 Bacteria 2555
170 Ga0157377_10206077 3300014745 Bacteria 1251
171 Ga0157379_10733829 3300014968 Bacteria 929
172 Ga0157376_11019280 3300014969 Bacteria 851
173 Ga0163161_10073443 3300017792 Bacteria 2506
174 Ga0163161_10863699 3300017792 Bacteria 764
175 Ga0163161_11436343 3300017792 Bacteria 604
176 Ga0206356_10680965 3300020070 Bacteria 1478
177 Ga0206356_11810994 3300020070 Bacteria 993
178 Ga0206355_1004939 3300020076 Bacteria 757
179 Ga0206355_1170366 3300020076 Bacteria 788
180 Ga0206351_10527688 3300020077 Bacteria 1134
181 Ga0206352_10494801 3300020078 Bacteria 1256
182 Ga0206350_10035847 3300020080 Bacteria 1058
183 Ga0206350_10779252 3300020080 Bacteria 639
184 Ga0206354_10027879 3300020081 Bacteria 1002
185 Ga0206354_11445525 3300020081 Bacteria 2333
186 Ga0206353_10344325 3300020082 Bacteria 3651
187 Ga0154015_1195879 3300020610 Bacteria 750
188 Ga0213873_10033504 3300021358 Bacteria 1289
189 Ga0213874_10026474 3300021377 Bacteria 1643
190 Ga0213876_10018927 3300021384 Bacteria 3637
191 Ga0213876_10025380 3300021384 Bacteria 3127
192 Ga0213876_10029606 3300021384 Bacteria 2885
193 Ga0213876_10066784 3300021384 Bacteria 1899
194 Ga0213876_10082342 3300021384 Bacteria 1702
195 Ga0213875_10029897 3300021388 Bacteria 2582
196 Ga0213875_10165622 3300021388 Bacteria 1037
197 Ga0213875_10188388 3300021388 Bacteria 970
198 Ga0213875_10381447 3300021388 Bacteria 671
199 Ga0224712_10035564 3300022467 Bacteria 1839
200 Ga0207656_10399932 3300025321 Bacteria 690
201 Ga0207642_10217019 3300025899 Bacteria 1067
202 Ga0207688_10020155 3300025901 Bacteria 3639
203 Ga0207688_10176460 3300025901 Bacteria 1273
204 Ga0207645_10032906 3300025907 Bacteria 3333
205 Ga0207707_10028789 3300025912 Bacteria 4854
206 Ga0207707_10076450 3300025912 Bacteria 2922
207 Ga0207707_10608894 3300025912 Bacteria 924
208 Ga0207707_10684323 3300025912 Bacteria 862
209 Ga0207671_10097690 3300025914 Bacteria 2221
210 Ga0207660_10003979 3300025917 Bacteria 9630
211 Ga0207662_10132703 3300025918 Bacteria 1571
212 Ga0207657_10054080 3300025919 Bacteria 3474
213 Ga0207657_10123216 3300025919 Bacteria 2131
214 Ga0207657_10569618 3300025919 Bacteria 885
215 Ga0207649_10009548 3300025920 Bacteria 5312
216 Ga0207652_10040922 3300025921 Bacteria 3937
217 Ga0207652_10071355 3300025921 Bacteria 3018
218 Ga0207652_10406215 3300025921 Bacteria 1229
219 Ga0207681_10258694 3300025923 Bacteria 1362
220 Ga0207694_10120174 3300025924 Bacteria 2097
221 Ga0207694_11226551 3300025924 Bacteria 634
222 Ga0207650_10823575 3300025925 Bacteria 787
223 Ga0207687_10142632 3300025927 Bacteria 1819
224 Ga0207687_10247670 3300025927 Bacteria 1415
225 Ga0207687_11526366 3300025927 Bacteria 574
226 Ga0207700_10509953 3300025928 Bacteria 1065
227 Ga0207664_10002085 3300025929 Bacteria 13152
228 Ga0207664_10045569 3300025929 Bacteria 3440
229 Ga0207664_10106114 3300025929 Bacteria 2329
230 Ga0207664_10394068 3300025929 Bacteria 1231
231 Ga0207644_10402593 3300025931 Bacteria 1119
232 Ga0207690_10060160 3300025932 Bacteria 2577
233 Ga0207690_11020039 3300025932 Bacteria 689
234 Ga0207706_10002888 3300025933 Bacteria 16643
235 Ga0207706_11424780 3300025933 Bacteria 568
236 Ga0207669_10506454 3300025937 Bacteria 967
237 Ga0207704_10082187 3300025938 Bacteria 2086
238 Ga0207704_11162371 3300025938 Bacteria 657
239 Ga0207665_11096546 3300025939 Bacteria 634
240 Ga0207711_10883635 3300025941 Bacteria 831
241 Ga0207661_10000288 3300025944 Bacteria 31795
242 Ga0207661_10038642 3300025944 Bacteria 3742
243 Ga0207661_10375702 3300025944 Bacteria 1286
244 Ga0207679_10105839 3300025945 Bacteria 2210
245 Ga0207667_10708763 3300025949 Bacteria 1008
246 Ga0207712_10003500 3300025961 Bacteria 9906
247 Ga0207668_10075148 3300025972 Bacteria 2429
248 Ga0207640_10103829 3300025981 Bacteria 1999
249 Ga0207640_10559374 3300025981 Bacteria 962
250 Ga0207640_10697903 3300025981 Bacteria 870
251 Ga0207703_10185950 3300026035 Bacteria 1836
252 Ga0207703_10793620 3300026035 Bacteria 904
253 Ga0207703_10936907 3300026035 Bacteria 830
254 Ga0207639_10083671 3300026041 Bacteria 2533
255 Ga0207639_10474219 3300026041 Bacteria 1140
256 Ga0207639_11075956 3300026041 Bacteria 754
257 Ga0207678_10108572 3300026067 Bacteria 2367
258 Ga0207678_10320789 3300026067 Bacteria 1333
259 Ga0207678_10523714 3300026067 Bacteria 1035
260 Ga0207708_10266909 3300026075 Bacteria 1383
261 Ga0207708_11014035 3300026075 Bacteria 722
262 Ga0207708_11056978 3300026075 Bacteria 707
263 Ga0207702_10199328 3300026078 Bacteria 1854
264 Ga0207702_11140681 3300026078 Bacteria 774
265 Ga0207641_10948738 3300026088 Bacteria 856
266 Ga0207648_10971498 3300026089 Bacteria 795
267 Ga0207676_10068992 3300026095 Bacteria 2830
268 Ga0207676_10303918 3300026095 Bacteria 1458
269 Ga0207676_10614898 3300026095 Bacteria 1045
270 Ga0207674_10798510 3300026116 Bacteria 911
271 Ga0207675_100051759 3300026118 Bacteria 3832
272 Ga0207675_100063891 3300026118 Bacteria 3439
273 Ga0207675_101479991 3300026118 Bacteria 700
274 Ga0207675_102147281 3300026118 Bacteria 574
275 Ga0207683_10270017 3300026121 Bacteria 1554
276 Ga0207698_10010680 3300026142 Bacteria 5920
277 Ga0207698_10588334 3300026142 Bacteria 1096
278 Ga0207698_10716120 3300026142 Bacteria 997
279 Ga0207428_10007695 3300027907 Bacteria 9804
280 Ga0207428_10009667 3300027907 Bacteria 8642
281 Ga0207428_10140109 3300027907 Bacteria 1846
282 Ga0268266_10009612 3300028379 Bacteria 8502
283 Ga0268265_10399004 3300028380 Bacteria 1271
284 Ga0265319_1000097 3300028563 Bacteria 67491
285 Ga0265334_10100208 3300028573 Bacteria 1049
286 Ga0265338_10008957 3300028800 Bacteria 12038
287 Ga0265330_10168436 3300031235 Unclassified 929
288 Ga0265320_10026669 3300031240 Bacteria 3021
289 Ga0265320_10036874 3300031240 Bacteria 2468
290 Ga0265339_10155864 3300031249 Bacteria 1152
291 Ga0265331_10035613 3300031250 Bacteria 2448
292 Ga0265316_10010445 3300031344 Bacteria 8458
293 Ga0307408_102250947 3300031548 Bacteria 527
294 Ga0307405_10321368 3300031731 Bacteria 1182
295 Ga0307405_10777308 3300031731 Bacteria 800
296 Ga0307413_10110642 3300031824 Bacteria 1838
297 Ga0307413_10698490 3300031824 Bacteria 842
298 Ga0307410_10393225 3300031852 Bacteria 1118
299 Ga0307410_11617515 3300031852 Bacteria 573
300 Ga0307406_10182790 3300031901 Bacteria 1528
301 Ga0307406_10311237 3300031901 Bacteria 1214
302 Ga0307407_10065365 3300031903 Bacteria 2141
303 Ga0307412_10248490 3300031911 Bacteria 1380
304 Ga0307412_10457644 3300031911 Bacteria 1053
305 Ga0307409_100004882 3300031995 Bacteria 7624
306 Ga0307409_100329332 3300031995 Bacteria 1433
307 Ga0307409_100399676 3300031995 Bacteria 1312
308 Ga0307409_100990518 3300031995 Bacteria 858
309 Ga0307416_100087720 3300032002 Bacteria 2657
310 Ga0307416_100123099 3300032002 Bacteria 2317
311 Ga0307416_100504378 3300032002 Bacteria 1275
312 Ga0307416_100646132 3300032002 Bacteria 1142
313 Ga0307414_10483905 3300032004 Bacteria 1092
314 Ga0307411_10041242 3300032005 Bacteria 2935
315 Ga0307411_10348548 3300032005 Bacteria 1206
316 Ga0307411_10547220 3300032005 Bacteria 987
317 Ga0307411_11078640 3300032005 Bacteria 723
318 Ga0307415_100001467 3300032126 Bacteria 11289
319 Ga0307415_100051622 3300032126 Bacteria 2792
320 Ga0307415_100079264 3300032126 Bacteria 2339
321 Ga0307415_100111304 3300032126 Bacteria 2032
322 Ga0307415_100228450 3300032126 Bacteria 1497
323 Ga0373930_0216654 3300034816 Bacteria 503
324 Ga0373929_0157502 3300035085 Bacteria 613
325 Ga0373932_0057361 3300035112 Bacteria 1174
326 Ga0373939_0027083 3300035114 Bacteria 1621
327 Ga0373960_0026941 3300035121 Bacteria 1574
328 Ga0373962_0073604 3300035242 Bacteria 1025
329 Ga0373931_0133676 3300035691 Bacteria 1430
330 Ga0373925_0409513 3300037068 Bacteria 1107
331 Ga0373925_0909188 3300037068 Bacteria 725
332 Ga0395899_0454778 3300037312 Bacteria 838
333 Ga0395900_0004774 3300037418 Bacteria 14282
334 Ga0395900_0063841 3300037418 Bacteria 3785
335 Ga0395900_0269360 3300037418 Bacteria 1698
336 Ga0395900_0348447 3300037418 Bacteria 1455
337 Ga0395898_0010298 3300037466 Bacteria 9785
338 Ga0395898_0024260 3300037466 Bacteria 6117
339 Ga0395898_0134416 3300037466 Bacteria 2368
340 Ga0395898_0272422 3300037466 Bacteria 1614
341 Ga0395898_0571184 3300037466 Bacteria 1073
342 Ga0395898_1279656 3300037466 Bacteria 663
343 Ga0395905_0021339 3300037471 Bacteria 6127
344 Ga0395905_0135978 3300037471 Bacteria 2312
345 Ga0395905_0154752 3300037471 Bacteria 2156
346 Ga0395905_0337434 3300037471 Bacteria 1398
347 Ga0395905_1141356 3300037471 Bacteria 683
348 Ga0395905_1333057 3300037471 Bacteria 622
349 Ga0436364_0004771 3300037853 Bacteria 795
350 Ga0436364_0030377 3300037853 Bacteria 2234
351 Ga0436364_0080723 3300037853 Bacteria 513
352 Ga0436364_0396681 3300037853 Bacteria 1622
353 Ga0436364_0741604 3300037853 Bacteria 1512
354 Ga0436364_0871788 3300037853 Bacteria 1426
355 Ga0436364_0901605 3300037853 Bacteria 4171
356 Ga0436364_1115546 3300037853 Unclassified 645
357 Ga0436364_1172909 3300037853 Bacteria 768
358 Ga0436364_1215096 3300037853 Bacteria 1050
359 Ga0436364_1243845 3300037853 Bacteria 41855
360 Ga0436364_1341460 3300037853 Bacteria 2030
361 Ga0395901_0011234 3300038443 Bacteria 9071
362 Ga0395901_0018758 3300038443 Bacteria 7067
363 Ga0395901_0046349 3300038443 Bacteria 4515
364 Ga0395901_0076345 3300038443 Bacteria 3495
365 Ga0395901_0382259 3300038443 Bacteria 1449
366 Ga0395901_0507504 3300038443 Bacteria 1227
367 Ga0395901_0970955 3300038443 Bacteria 827
368 Ga0395901_1218065 3300038443 Bacteria 718
369 Ga0395901_2145430 3300038443 Bacteria 503
370 Ga0436365_0056826 3300039437 Bacteria 1826
371 Ga0436365_0246988 3300039437 Unclassified 686
372 Ga0436365_0377309 3300039437 Bacteria 26799
373 Ga0436365_0629338 3300039437 Bacteria 12277
374 Ga0436365_0686509 3300039437 Bacteria 4330
375 Ga0436365_0925381 3300039437 Bacteria 20601
376 Ga0436365_0979777 3300039437 Bacteria 653
377 Ga0436365_1362716 3300039437 Bacteria 3981
378 Ga0436365_1426124 3300039437 Bacteria 1015
379 Ga0436365_1749779 3300039437 Bacteria 801
380 Ga0436360_0783578 3300039438 Bacteria 2194
381 Ga0436361_0135380 3300039447 Bacteria 691
382 Ga0436363_0048403 3300039450 Bacteria 23056
383 Ga0436363_0116001 3300039450 Bacteria 48959
384 Ga0436363_0522014 3300039450 Bacteria 502
385 Ga0436363_0889944 3300039450 Bacteria 608
386 Ga0436363_1138467 3300039450 Bacteria 7131
387 Ga0436363_1237855 3300039450 Bacteria 828
388 Ga0436363_1357623 3300039450 Bacteria 755
389 Ga0436363_1492506 3300039450 Bacteria 7016
390 Ga0436362_0457422 3300039453 Bacteria 3762
391 Ga0436362_0584602 3300039453 Bacteria 766
392 Ga0436362_0701279 3300039453 Bacteria 599
393 Ga0436362_0981668 3300039453 Bacteria 3311
394 Ga0436362_1113699 3300039453 Bacteria 1412
395 Ga0451789_0140835 3300041443 Bacteria 570
396 Ga0451789_0556213 3300041443 Bacteria 683
397 Ga0451793_0641740 3300041452 Bacteria 872
398 Ga0451802_0239322 3300041460 Bacteria 576
399 Ga0451833_0530491 3300041491 Bacteria 607
400 Ga0451839_0688520 3300041496 Bacteria 627
401 Ga0451839_1509325 3300041496 Bacteria 699
402 Ga0451847_0823104 3300041503 Bacteria 713
403 Ga0451853_0405189 3300041512 Bacteria 634
404 Ga0451853_2806980 3300041512 Bacteria 1186
405 Ga0439456_044439 3300042013 Bacteria 966
406 Ga0466969_0022458 3300044656 Bacteria 3256
407 Ga0466972_0374120 3300044658 Bacteria 667
408 Ga0466965_0182485 3300044683 Bacteria 1107
409 Ga0466965_0530780 3300044683 Bacteria 663
410 Ga0466966_0072552 3300044684 Bacteria 2155
411 Ga0466966_0119859 3300044684 Bacteria 1617
412 Ga0466961_0100396 3300044693 Bacteria 1823
413 Ga0466961_0271386 3300044693 Bacteria 1039
414 Ga0466961_0356705 3300044693 Bacteria 890
415 Ga0466963_0025323 3300044694 Bacteria 3783
416 Ga0466963_0038967 3300044694 Bacteria 3110
417 Ga0466963_0163567 3300044694 Bacteria 1550
418 Ga0466964_0328872 3300044706 Bacteria 779
419 Ga0466964_0353920 3300044706 Bacteria 755
420 Ga0466971_0007903 3300044719 Bacteria 4633
421 Ga0466971_0502270 3300044719 Bacteria 599
422 Ga0466968_0075108 3300044735 Bacteria 1477
423 Ga0466970_0108101 3300044765 Bacteria 1518
424 Ga0466957_0031049 3300044842 Bacteria 3192
425 Ga0466957_0041883 3300044842 Bacteria 2769
426 Ga0466960_0292997 3300044901 Bacteria 915
427 Ga0466959_0002562 3300045049 Bacteria 11666
428 Ga0466959_0056212 3300045049 Bacteria 2872
429 Ga0466959_0192572 3300045049 Bacteria 1422
430 Ga0466959_0252885 3300045049 Bacteria 1215
431 Ga0466959_0554167 3300045049 Bacteria 775
432 Ga0466958_0000390 3300045836 Bacteria 17922
433 Ga0466958_0008361 3300045836 Bacteria 5736
434 Ga0466958_0016389 3300045836 Bacteria 4267
435 Ga0466958_0017509 3300045836 Bacteria 4144
436 Ga0466958_0073362 3300045836 Bacteria 2096
437 Ga0466958_0085389 3300045836 Bacteria 1947
438 Ga0466958_0570142 3300045836 Bacteria 736
439 Ga0466967_0018136 3300045976 Bacteria 5615
440 Ga0466967_0018566 3300045976 Bacteria 5562
441 Ga0466967_0136661 3300045976 Bacteria 2280
442 Ga0466967_0203668 3300045976 Bacteria 1875
443 Ga0466967_0516030 3300045976 Bacteria 1174
444 Ga0466967_0520308 3300045976 Bacteria 1169
445 Ga0466967_0558035 3300045976 Bacteria 1128
446 Ga0466967_1210043 3300045976 Bacteria 753
447 Ga0466967_1973643 3300045976 Bacteria 580
448 Ga0466967_2297668 3300045976 Bacteria 535
449 Ga0495591_126008 3300046458 Bacteria 623
450 Ga0495650_0000035 3300046471 Bacteria 403799
451 Ga0495580_0192297 3300046472 Bacteria 1407
452 Ga0495664_0315387 3300046477 Bacteria 943
453 Ga0495596_0051722 3300046500 Bacteria 1609
454 Ga0495596_0082243 3300046500 Bacteria 1250
455 Ga0495596_0124409 3300046500 Bacteria 1001
456 Ga0495631_0238232 3300046518 Bacteria 776
457 Ga0495652_0156606 3300046529 Bacteria 1773
458 Ga0495586_0199568 3300046535 Bacteria 1134
459 Ga0495645_0000021 3300046543 Bacteria 137604
460 Ga0495645_0467011 3300046543 Bacteria 794
461 Ga0495656_0162620 3300046615 Bacteria 1086
462 Ga0495611_0125972 3300046648 Bacteria 1195
463 Ga0495588_0576341 3300046674 Bacteria 590
464 Ga0495646_0208112 3300046680 Bacteria 1063
465 Ga0495589_0455424 3300046794 Bacteria 585
466 Ga0495589_0490143 3300046794 Bacteria 561
467 Ga0495676_0434319 3300047321 Bacteria 868
468 Ga0495685_209504 3300047447 Bacteria 624
469 Ga0496100_0080961 3300048903 Bacteria 2193
470 Ga0496100_0388679 3300048903 Bacteria 1061
471 Ga0496100_0840347 3300048903 Bacteria 720
472 Ga0496100_1094920 3300048903 Bacteria 628
473 Ga0496101_0019094 3300048904 Bacteria 4673
474 Ga0496101_0750386 3300048904 Bacteria 770
475 Ga0496102_0188959 3300048905 Bacteria 1941
476 Ga0496102_0293644 3300048905 Bacteria 1532
477 Ga0496102_0314905 3300048905 Bacteria 1474
478 Ga0496102_0683732 3300048905 Bacteria 949
479 Ga0496102_0702416 3300048905 Bacteria 934
480 Ga0496102_0771461 3300048905 Bacteria 884
481 Ga0496102_0958199 3300048905 Bacteria 777
482 Ga0496102_1890432 3300048905 Bacteria 514
483 Ga0496103_0655064 3300048906 Bacteria 667
484 Ga0496104_0073599 3300048907 Bacteria 3250
485 Ga0496104_0356471 3300048907 Bacteria 1375
486 Ga0496104_0585175 3300048907 Bacteria 1026
487 Ga0496104_0620841 3300048907 Bacteria 991
488 Ga0496104_0902804 3300048907 Bacteria 788
489 Ga0496105_0082828 3300048908 Bacteria 2649
490 Ga0496105_0257842 3300048908 Bacteria 1411
491 Ga0496105_0541784 3300048908 Bacteria 909
492 Ga0496106_0377939 3300048909 Bacteria 1138
493 Ga0496106_0993567 3300048909 Bacteria 660
494 Ga0496107_0285475 3300048910 Bacteria 1228
495 Ga0496107_0359022 3300048910 Bacteria 1084
496 Ga0496107_0812916 3300048910 Bacteria 684
497 Ga0496108_0101040 3300048911 Bacteria 2460
498 Ga0496108_0266088 3300048911 Bacteria 1492
499 Ga0496108_0574922 3300048911 Bacteria 982
500 Ga0496108_0666013 3300048911 Bacteria 904
501 Ga0496108_0770631 3300048911 Bacteria 831
502 Ga0496108_0817843 3300048911 Bacteria 803
503 Ga0496109_0030445 3300048912 Bacteria 4837
504 Ga0496109_0160082 3300048912 Bacteria 2109
505 Ga0496109_0285287 3300048912 Bacteria 1556
506 Ga0496109_0391092 3300048912 Bacteria 1314
507 Ga0496109_0422619 3300048912 Bacteria 1259
508 Ga0496109_0680175 3300048912 Bacteria 966
509 Ga0496109_0830318 3300048912 Bacteria 862
510 Ga0496110_0049120 3300048913 Bacteria 3700
511 Ga0496110_0239922 3300048913 Bacteria 1649
512 Ga0496110_0241456 3300048913 Bacteria 1644
513 Ga0496110_0441955 3300048913 Bacteria 1185
514 Ga0496110_0851979 3300048913 Bacteria 817
515 Ga0496110_1300747 3300048913 Bacteria 636
516 Ga0496111_0123371 3300048914 Bacteria 1914
517 Ga0496111_0158792 3300048914 Bacteria 1678
518 Ga0496111_0508593 3300048914 Bacteria 886
519 Ga0496111_0917221 3300048914 Bacteria 630
520 Ga0496112_0098448 3300048915 Bacteria 2894
521 Ga0496112_0135049 3300048915 Bacteria 2437
522 Ga0496112_0142067 3300048915 Bacteria 2370
523 Ga0496112_0170265 3300048915 Bacteria 2143
524 Ga0496112_0258625 3300048915 Bacteria 1691
525 Ga0496112_0304069 3300048915 Bacteria 1540
526 Ga0496112_0465692 3300048915 Bacteria 1201
527 Ga0496113_0081128 3300048916 Bacteria 2486
528 Ga0496113_0177392 3300048916 Bacteria 1688
529 Ga0496113_0347887 3300048916 Bacteria 1189
530 Ga0496113_1214819 3300048916 Bacteria 588
531 Ga0496114_0030344 3300048917 Bacteria 4448
532 Ga0496114_0130988 3300048917 Bacteria 2166
533 Ga0496114_0812047 3300048917 Bacteria 814
534 Ga0496115_1221897 3300048918 Bacteria 564
535 Ga0496117_0310934 3300048920 Bacteria 830
536 Ga0496118_0289160 3300048921 Bacteria 907
537 Ga0496121_0002418 3300048924 Bacteria 28600
538 Ga0496121_0096566 3300048924 Bacteria 2293
539 Ga0496126_0493732 3300048929 Bacteria 979
540 Ga0501307_082546 3300049162 Bacteria 527
541 Ga0501312_120312 3300049528 Bacteria 507
542 Ga0501317_025142 3300049533 Bacteria 832
543 Ga0501318_028572 3300049534 Bacteria 747
544 Ga0501321_065047 3300049537 Bacteria 558
545 Ga0501031_0000110 3300049568 Bacteria 43369
546 Ga0501031_0001029 3300049568 Bacteria 16912
547 Ga0501031_0008013 3300049568 Bacteria 6878
548 Ga0501031_0301511 3300049568 Bacteria 1038
549 Ga0501031_0359284 3300049568 Bacteria 942
550 Ga0501031_0708328 3300049568 Bacteria 646
551 Ga0501032_0002593 3300049569 Bacteria 14144
552 Ga0501032_0013542 3300049569 Bacteria 5797
553 Ga0501032_0091631 3300049569 Bacteria 2016
554 Ga0501032_0255208 3300049569 Bacteria 1138
555 Ga0501033_0000920 3300049570 Bacteria 26908
556 Ga0501033_0167440 3300049570 Bacteria 1579
557 Ga0501033_0446248 3300049570 Bacteria 899
558 Ga0501034_0401251 3300049571 Bacteria 1294
559 Ga0501034_0819378 3300049571 Bacteria 822
560 Ga0501034_1569484 3300049571 Bacteria 531
561 Ga0501036_0009055 3300049572 Bacteria 8187
562 Ga0501036_0009848 3300049572 Bacteria 7867
563 Ga0501036_0010718 3300049572 Bacteria 7576
564 Ga0501036_0969446 3300049572 Bacteria 696
565 Ga0501036_1070728 3300049572 Bacteria 659
566 Ga0501037_0000519 3300049573 Bacteria 30933
567 Ga0501037_0077066 3300049573 Bacteria 2419
568 Ga0501037_0163053 3300049573 Bacteria 1588
569 Ga0501037_0213037 3300049573 Bacteria 1362
570 Ga0501037_0225487 3300049573 Bacteria 1317
571 Ga0501037_0684599 3300049573 Bacteria 683
572 Ga0501038_0002971 3300049574 Bacteria 15803
573 Ga0501038_0013567 3300049574 Bacteria 7425
574 Ga0501038_0048444 3300049574 Bacteria 3677
575 Ga0501038_0129622 3300049574 Bacteria 2072
576 Ga0501039_0005307 3300049575 Bacteria 9744
577 Ga0501039_0010620 3300049575 Bacteria 7016
578 Ga0501039_0018960 3300049575 Bacteria 5280
579 Ga0501039_0021617 3300049575 Bacteria 4936
580 Ga0501039_0042160 3300049575 Bacteria 3526
581 Ga0501039_0139133 3300049575 Bacteria 1907
582 Ga0501039_0159891 3300049575 Bacteria 1770
583 Ga0501040_0000149 3300049576 Bacteria 38433
584 Ga0501040_0000605 3300049576 Bacteria 21929
585 Ga0501040_0009383 3300049576 Bacteria 6375
586 Ga0501040_0010866 3300049576 Bacteria 5952
587 Ga0501040_0012892 3300049576 Bacteria 5491
588 Ga0501040_0099693 3300049576 Bacteria 2025
589 Ga0501040_0154634 3300049576 Bacteria 1619
590 Ga0501040_0208691 3300049576 Bacteria 1388
591 Ga0501040_0571149 3300049576 Bacteria 816
592 Ga0501040_0767355 3300049576 Bacteria 698
593 Ga0501041_0000695 3300049577 Bacteria 17865
594 Ga0501041_0006732 3300049577 Bacteria 6736
595 Ga0501041_0054595 3300049577 Bacteria 2437
596 Ga0501041_0097179 3300049577 Bacteria 1821
597 Ga0501041_0124234 3300049577 Bacteria 1605
598 Ga0501041_0127195 3300049577 Bacteria 1586
599 Ga0501041_0599821 3300049577 Bacteria 703
600 Ga0501042_0000013 3300049578 Bacteria 53996
601 Ga0501042_0001965 3300049578 Bacteria 12373
602 Ga0501042_0008702 3300049578 Bacteria 6731
603 Ga0501042_0011094 3300049578 Bacteria 6069
604 Ga0501042_0174346 3300049578 Bacteria 1551
605 Ga0501042_0333984 3300049578 Bacteria 1095
606 Ga0501043_0001920 3300049579 Bacteria 17801
607 Ga0501043_0012580 3300049579 Bacteria 6617
608 Ga0501043_0037712 3300049579 Bacteria 3800
609 Ga0501043_0157759 3300049579 Bacteria 1774
610 Ga0501043_0255464 3300049579 Bacteria 1349
611 Ga0501043_0640510 3300049579 Bacteria 781
612 Ga0501046_0000177 3300049580 Bacteria 65024
613 Ga0501046_0003529 3300049580 Bacteria 14324
614 Ga0501046_0025301 3300049580 Bacteria 4859
615 Ga0501046_0194086 3300049580 Bacteria 1514
616 Ga0501046_0345491 3300049580 Bacteria 1081
617 Ga0501047_0047657 3300049581 Bacteria 4139
618 Ga0501047_0056401 3300049581 Bacteria 3798
619 Ga0501048_0000042 3300049582 Bacteria 62023
620 Ga0501048_0008646 3300049582 Bacteria 7680
621 Ga0501048_0009610 3300049582 Bacteria 7256
622 Ga0501048_0010708 3300049582 Bacteria 6839
623 Ga0501048_0059411 3300049582 Bacteria 2709
624 Ga0501048_0074928 3300049582 Bacteria 2388
625 Ga0501048_0091431 3300049582 Bacteria 2146
626 Ga0501067_0006213 3300049583 Bacteria 6621
627 Ga0501067_0039753 3300049583 Bacteria 2611
628 Ga0501068_0000051 3300049584 Bacteria 45579
629 Ga0501068_0030531 3300049584 Bacteria 3197
630 Ga0501068_0041886 3300049584 Bacteria 2753
631 Ga0501068_0045622 3300049584 Bacteria 2640
632 Ga0501068_0505631 3300049584 Bacteria 784
633 Ga0501069_0006340 3300049585 Bacteria 6183
634 Ga0501069_0009216 3300049585 Bacteria 5206
635 Ga0501069_0011434 3300049585 Bacteria 4701
636 Ga0501069_0058019 3300049585 Bacteria 2159
637 Ga0501069_0292862 3300049585 Bacteria 954
638 Ga0501070_0006578 3300049586 Bacteria 9892
639 Ga0501070_0190159 3300049586 Bacteria 1688
640 Ga0501070_0265383 3300049586 Bacteria 1403
641 Ga0501070_0342970 3300049586 Bacteria 1213
642 Ga0501070_0455950 3300049586 Bacteria 1030
643 Ga0501070_0787616 3300049586 Bacteria 747
644 Ga0501070_0979584 3300049586 Bacteria 656
645 Ga0501071_0000031 3300049587 Bacteria 47260
646 Ga0501071_0001902 3300049587 Bacteria 12432
647 Ga0501071_0028671 3300049587 Bacteria 3924
648 Ga0501071_0061757 3300049587 Bacteria 2714
649 Ga0501071_0093183 3300049587 Bacteria 2215
650 Ga0501071_0190553 3300049587 Bacteria 1538
651 Ga0501071_0273817 3300049587 Bacteria 1277
652 Ga0501071_0398754 3300049587 Bacteria 1050
653 Ga0501071_0463983 3300049587 Bacteria 970
654 Ga0501072_0000260 3300049588 Bacteria 38663
655 Ga0501072_0000465 3300049588 Bacteria 29220
656 Ga0501072_0000950 3300049588 Bacteria 21351
657 Ga0501072_0060605 3300049588 Bacteria 2983
658 Ga0501072_0096619 3300049588 Bacteria 2347
659 Ga0501072_0117660 3300049588 Bacteria 2117
660 Ga0501072_0332742 3300049588 Bacteria 1206
661 Ga0501072_0731973 3300049588 Bacteria 776
662 Ga0501073_0002772 3300049589 Bacteria 13121
663 Ga0501073_0068788 3300049589 Bacteria 2467
664 Ga0501073_0088020 3300049589 Bacteria 2159
665 Ga0501073_0401842 3300049589 Bacteria 946
666 Ga0501074_0005531 3300049590 Bacteria 9088
667 Ga0501074_0015271 3300049590 Bacteria 5581
668 Ga0501074_0024223 3300049590 Bacteria 4411
669 Ga0501074_0042186 3300049590 Bacteria 3301
670 Ga0501074_0055663 3300049590 Bacteria 2850
671 Ga0501074_0384636 3300049590 Bacteria 995
672 Ga0501074_0423276 3300049590 Bacteria 944
673 Ga0501074_0647617 3300049590 Bacteria 746
674 Ga0501075_0000032 3300049591 Bacteria 56088
675 Ga0501075_0000266 3300049591 Bacteria 28552
676 Ga0501075_0026654 3300049591 Bacteria 4257
677 Ga0501075_0030659 3300049591 Bacteria 3984
678 Ga0501075_0100423 3300049591 Bacteria 2197
679 Ga0501075_0151277 3300049591 Bacteria 1769
680 Ga0501075_0174901 3300049591 Bacteria 1638
681 Ga0501075_0915656 3300049591 Bacteria 666
682 Ga0501076_0000195 3300049592 Bacteria 36390
683 Ga0501076_0001745 3300049592 Bacteria 14699
684 Ga0501076_0003830 3300049592 Bacteria 10594
685 Ga0501076_0027659 3300049592 Bacteria 4398
686 Ga0501076_0039015 3300049592 Bacteria 3728
687 Ga0501076_0043421 3300049592 Bacteria 3542
688 Ga0501076_0115334 3300049592 Bacteria 2174
689 Ga0501076_0355667 3300049592 Bacteria 1203
690 Ga0501076_0675481 3300049592 Bacteria 852
691 Ga0501077_0000257 3300049593 Bacteria 31357
692 Ga0501077_0005655 3300049593 Bacteria 7619
693 Ga0501077_0008277 3300049593 Bacteria 6433
694 Ga0501077_0024371 3300049593 Bacteria 3842
695 Ga0501077_0052953 3300049593 Bacteria 2576
696 Ga0501077_0190559 3300049593 Bacteria 1303
697 Ga0501077_0521449 3300049593 Bacteria 762
698 Ga0501077_0589942 3300049593 Bacteria 713
699 Ga0501079_0000749 3300049741 Bacteria 22070
700 Ga0501079_0011634 3300049741 Bacteria 6719
701 Ga0501079_0016893 3300049741 Bacteria 5573
702 Ga0501079_0047508 3300049741 Bacteria 3311
703 Ga0501079_0143423 3300049741 Bacteria 1861
704 Ga0501079_0179684 3300049741 Bacteria 1651
705 Ga0501079_0460738 3300049741 Bacteria 998
706 Ga0501079_0526340 3300049741 Bacteria 929
707 Ga0501079_0586052 3300049741 Bacteria 877
708 Ga0501080_0000105 3300049742 Bacteria 57665
709 Ga0501080_0030475 3300049742 Bacteria 5025
710 Ga0501080_0102221 3300049742 Bacteria 2659
711 Ga0501080_0793233 3300049742 Bacteria 831
712 Ga0501080_1046182 3300049742 Bacteria 706
713 Ga0501081_0000691 3300049743 Bacteria 19472
714 Ga0501081_0001230 3300049743 Bacteria 15579
715 Ga0501081_0008744 3300049743 Bacteria 6582
716 Ga0501081_0017489 3300049743 Bacteria 4747
717 Ga0501081_0036932 3300049743 Bacteria 3332
718 Ga0501083_0000081 3300049744 Bacteria 64501
719 Ga0501083_0060437 3300049744 Bacteria 2531
720 Ga0501083_0060770 3300049744 Bacteria 2524
721 Ga0501083_0225394 3300049744 Bacteria 1221
722 Ga0501083_0354404 3300049744 Bacteria 954
723 Ga0501083_0657783 3300049744 Bacteria 681
724 Ga0501283_084547 3300049779 Bacteria 601
725 Ga0501035_0019615 3300049822 Bacteria 6213
726 Ga0501035_0020439 3300049822 Bacteria 6080
727 Ga0501035_0050590 3300049822 Bacteria 3723
728 Ga0501035_0119800 3300049822 Bacteria 2301
729 Ga0501035_0284169 3300049822 Bacteria 1398
730 Ga0501035_0475416 3300049822 Bacteria 1031
731 Ga0501044_0086637 3300049823 Bacteria 3163
732 Ga0501044_0090376 3300049823 Bacteria 3089
733 Ga0501044_0207151 3300049823 Bacteria 1917
734 Ga0501044_0233557 3300049823 Bacteria 1785
735 Ga0501044_0523920 3300049823 Bacteria 1085
736 Ga0501045_0000251 3300049824 Bacteria 30848
737 Ga0501045_0001160 3300049824 Bacteria 17470
738 Ga0501045_0001843 3300049824 Bacteria 14321
739 Ga0501045_0033780 3300049824 Bacteria 3710
740 Ga0501045_0065496 3300049824 Bacteria 2667
741 Ga0501045_0071628 3300049824 Bacteria 2551
742 Ga0501045_0197935 3300049824 Bacteria 1497
743 Ga0501045_0357746 3300049824 Bacteria 1086
744 nmdc:mga0yw44_1043433_c1 3300050492 Bacteria 553
745 nmdc:mga05p37_174736_c1 3300050507 Bacteria 2618
746 nmdc:mga05p37_601_c1 3300050507 Bacteria 39708
747 nmdc:mga09592_494883_c1 3300050508 Bacteria 1053
748 nmdc:mga09592_85491_c1 3300050508 Bacteria 2691
749 nmdc:mga0qj67_679236_c1 3300050509 Bacteria 820
750 nmdc:mga0qj67_80129_c1 3300050509 Bacteria 2616
751 nmdc:mga06r32_1039226_c1 3300050510 Bacteria 770
752 nmdc:mga06r32_112492_c1 3300050510 Bacteria 2679
753 nmdc:mga06r32_157746_c1 3300050510 Bacteria 2251
754 nmdc:mga06r32_698689_c1 3300050510 Bacteria 980
755 nmdc:mga08y16_175117_c1 3300050511 Bacteria 2228
756 nmdc:mga08y16_224746_c1 3300050511 Bacteria 1943
757 nmdc:mga08y16_368826_c1 3300050511 Bacteria 1473
758 nmdc:mga08y16_66597_c1 3300050511 Bacteria 3759
759 nmdc:mga0n895_1184425_c1 3300050512 Bacteria 738
760 nmdc:mga0a205_1139612_c1 3300050515 Bacteria 627
761 nmdc:mga0a205_114467_c1 3300050515 Bacteria 2596
762 nmdc:mga0a205_583408_c1 3300050515 Bacteria 972
763 Ga0495655_0038525 3300053083 Bacteria 1207
764 Ga0495655_0069115 3300053083 Bacteria 983
765 Ga0495655_0194494 3300053083 Bacteria 660
766 Ga0500588_0260216 3300053146 Bacteria 653
767 Ga0500616_0005292 3300053153 Bacteria 8809
768 Ga0501084_0000995 3300054114 Bacteria 22022
769 Ga0501084_0001035 3300054114 Bacteria 21607
770 Ga0501084_0001602 3300054114 Bacteria 17929
771 Ga0501084_0016686 3300054114 Bacteria 6099
772 Ga0501084_0028523 3300054114 Bacteria 4666
773 Ga0501084_0304376 3300054114 Bacteria 1346
774 Ga0501084_0336705 3300054114 Bacteria 1275
775 Ga0501084_0345153 3300054114 Bacteria 1257
776 Ga0501084_0353888 3300054114 Bacteria 1240
777 Ga0590071_050409 3300059421 Bacteria 1009
778 Ga0590077_097541 3300059426 Bacteria 686
779 Ga0587070_170148 3300059491 Bacteria 560
780 Ga0587082_102320 3300059504 Bacteria 626
781 Ga0587083_0104451 3300059505 Bacteria 710
782 Ga0587088_106084 3300059508 Bacteria 633
783 Ga0587094_065064 3300059513 Bacteria 646
784 Ga0587069_082382 3300059642 Bacteria 630
785 Ga0587076_079530 3300059645 Bacteria 697
786 Ga0501082_0002033 3300060353 Bacteria 17790
787 Ga0501082_0002542 3300060353 Bacteria 15978
788 Ga0501082_0007967 3300060353 Bacteria 9144
789 Ga0501082_0008023 3300060353 Bacteria 9113
790 Ga0501082_0017121 3300060353 Bacteria 6244
791 Ga0501082_0063916 3300060353 Bacteria 3169
792 Ga0501082_0065211 3300060353 Bacteria 3136
793 Ga0501082_0106426 3300060353 Bacteria 2427
794 Ga0501082_0206490 3300060353 Bacteria 1709
795 Ga0501082_0506207 3300060353 Bacteria 1055
796 Ga0501082_0645165 3300060353 Bacteria 926
797 Ga0466962_0000616 3300061719 Bacteria 15791
798 Ga0530510_0000155 3300061734 Bacteria 40902
799 Ga0530510_0000483 3300061734 Bacteria 25575
800 Ga0530510_0006704 3300061734 Bacteria 8028
801 Ga0530510_0019946 3300061734 Bacteria 4764
802 Ga0530510_0069096 3300061734 Bacteria 2563
803 Ga0530510_0372296 3300061734 Bacteria 1074

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041496 Ga0451839_0688520 Ga0451839_0688520_151_579 136
2 3300012513 Ga0157326_1067527 Ga0157326_10675271 137
3 3300013296 Ga0157374_12391395 Ga0157374_123913951 140
4 3300026088 Ga0207641_10948738 Ga0207641_109487381 140
5 3300046543 Ga0495645_0000021 Ga0495645_0000021_118352_118774 140
6 3300005366 Ga0070659_100792790 Ga0070659_1007927902 142
7 3300009176 Ga0105242_11136904 Ga0105242_111369041 142
8 3300031235 Ga0265330_10168436 Ga0265330_101684362 142
9 3300031240 Ga0265320_10036874 Ga0265320_100368743 142
10 3300031249 Ga0265339_10155864 Ga0265339_101558641 142
11 3300031250 Ga0265331_10035613 Ga0265331_100356133 142
12 3300031344 Ga0265316_10010445 Ga0265316_100104456 142
13 3300049568 Ga0501031_0000110 Ga0501031_0000110_104_532 142
14 3300049568 Ga0501031_0359284 Ga0501031_0359284_386_814 142
15 3300049569 Ga0501032_0002593 Ga0501032_0002593_7211_7639 142
16 3300049570 Ga0501033_0000920 Ga0501033_0000920_4741_5169 142
17 3300049571 Ga0501034_0819378 Ga0501034_0819378_121_549 142
18 3300049571 Ga0501034_1569484 Ga0501034_1569484_72_500 142
19 3300049572 Ga0501036_0009055 Ga0501036_0009055_351_779 142
20 3300049572 Ga0501036_0969446 Ga0501036_0969446_52_480 142
21 3300049573 Ga0501037_0000519 Ga0501037_0000519_13399_13827 142
22 3300049573 Ga0501037_0163053 Ga0501037_0163053_402_830 142
23 3300049574 Ga0501038_0002971 Ga0501038_0002971_3091_3519 142
24 3300049574 Ga0501038_0013567 Ga0501038_0013567_1208_1636 142
25 3300049575 Ga0501039_0005307 Ga0501039_0005307_1973_2401 142
26 3300049575 Ga0501039_0010620 Ga0501039_0010620_5830_6258 142
27 3300049576 Ga0501040_0000605 Ga0501040_0000605_6987_7415 142
28 3300049576 Ga0501040_0012892 Ga0501040_0012892_3091_3519 142
29 3300049576 Ga0501040_0154634 Ga0501040_0154634_168_596 142
30 3300049576 Ga0501040_0571149 Ga0501040_0571149_188_616 142
31 3300049577 Ga0501041_0000695 Ga0501041_0000695_14962_15390 142
32 3300049577 Ga0501041_0006732 Ga0501041_0006732_5958_6386 142
33 3300049577 Ga0501041_0127195 Ga0501041_0127195_913_1341 142
34 3300049578 Ga0501042_0000013 Ga0501042_0000013_50690_51118 142
35 3300049578 Ga0501042_0001965 Ga0501042_0001965_6831_7259 142
36 3300049578 Ga0501042_0174346 Ga0501042_0174346_211_639 142
37 3300049579 Ga0501043_0001920 Ga0501043_0001920_14898_15326 142
38 3300049579 Ga0501043_0037712 Ga0501043_0037712_759_1187 142
39 3300049580 Ga0501046_0000177 Ga0501046_0000177_49634_50062 142
40 3300049580 Ga0501046_0003529 Ga0501046_0003529_5194_5622 142
41 3300049581 Ga0501047_0047657 Ga0501047_0047657_3438_3866 142
42 3300049582 Ga0501048_0000042 Ga0501048_0000042_58590_59018 142
43 3300049582 Ga0501048_0008646 Ga0501048_0008646_2852_3280 142
44 3300049582 Ga0501048_0010708 Ga0501048_0010708_759_1187 142
45 3300049583 Ga0501067_0039753 Ga0501067_0039753_2082_2510 142
46 3300049584 Ga0501068_0000051 Ga0501068_0000051_8085_8513 142
47 3300049584 Ga0501068_0045622 Ga0501068_0045622_1862_2290 142
48 3300049585 Ga0501069_0009216 Ga0501069_0009216_4377_4805 142
49 3300049585 Ga0501069_0011434 Ga0501069_0011434_2548_2976 142
50 3300049586 Ga0501070_0006578 Ga0501070_0006578_9386_9814 142
51 3300049586 Ga0501070_0787616 Ga0501070_0787616_106_534 142
52 3300049586 Ga0501070_0979584 Ga0501070_0979584_121_549 142
53 3300049587 Ga0501071_0000031 Ga0501071_0000031_31871_32299 142
54 3300049587 Ga0501071_0001902 Ga0501071_0001902_4912_5340 142
55 3300049588 Ga0501072_0000260 Ga0501072_0000260_117_545 142
56 3300049588 Ga0501072_0000950 Ga0501072_0000950_6323_6751 142
57 3300049588 Ga0501072_0731973 Ga0501072_0731973_142_570 142
58 3300049589 Ga0501073_0002772 Ga0501073_0002772_5251_5679 142
59 3300049589 Ga0501073_0068788 Ga0501073_0068788_925_1353 142
60 3300049589 Ga0501073_0401842 Ga0501073_0401842_32_460 142
61 3300049590 Ga0501074_0005531 Ga0501074_0005531_7225_7653 142
62 3300049590 Ga0501074_0015271 Ga0501074_0015271_4395_4823 142
63 3300049590 Ga0501074_0647617 Ga0501074_0647617_188_616 142
64 3300049591 Ga0501075_0000032 Ga0501075_0000032_55539_55967 142
65 3300049591 Ga0501075_0000266 Ga0501075_0000266_5790_6218 142
66 3300049591 Ga0501075_0100423 Ga0501075_0100423_470_898 142
67 3300049592 Ga0501076_0001745 Ga0501076_0001745_1436_1864 142
68 3300049592 Ga0501076_0003830 Ga0501076_0003830_5790_6218 142
69 3300049592 Ga0501076_0675481 Ga0501076_0675481_285_713 142
70 3300049593 Ga0501077_0000257 Ga0501077_0000257_12281_12709 142
71 3300049593 Ga0501077_0008277 Ga0501077_0008277_1115_1543 142
72 3300049593 Ga0501077_0052953 Ga0501077_0052953_486_914 142
73 3300049593 Ga0501077_0589942 Ga0501077_0589942_126_554 142
74 3300049741 Ga0501079_0000749 Ga0501079_0000749_10918_11346 142
75 3300049741 Ga0501079_0016893 Ga0501079_0016893_3197_3625 142
76 3300049741 Ga0501079_0047508 Ga0501079_0047508_656_1084 142
77 3300049742 Ga0501080_0000105 Ga0501080_0000105_45550_45978 142
78 3300049742 Ga0501080_1046182 Ga0501080_1046182_214_642 142
79 3300049743 Ga0501081_0000691 Ga0501081_0000691_16569_16997 142
80 3300049743 Ga0501081_0001230 Ga0501081_0001230_5243_5671 142
81 3300049743 Ga0501081_0036932 Ga0501081_0036932_2596_3024 142
82 3300049744 Ga0501083_0000081 Ga0501083_0000081_3138_3566 142
83 3300049822 Ga0501035_0019615 Ga0501035_0019615_1973_2401 142
84 3300049822 Ga0501035_0119800 Ga0501035_0119800_759_1187 142
85 3300049823 Ga0501044_0086637 Ga0501044_0086637_122_550 142
86 3300049823 Ga0501044_0090376 Ga0501044_0090376_2540_2968 142
87 3300049824 Ga0501045_0001160 Ga0501045_0001160_122_550 142
88 3300049824 Ga0501045_0001843 Ga0501045_0001843_13772_14200 142
89 3300049824 Ga0501045_0033780 Ga0501045_0033780_3272_3700 142
90 3300054114 Ga0501084_0000995 Ga0501084_0000995_11173_11601 142
91 3300054114 Ga0501084_0001035 Ga0501084_0001035_10007_10435 142
92 3300054114 Ga0501084_0001602 Ga0501084_0001602_1846_2274 142
93 3300054114 Ga0501084_0353888 Ga0501084_0353888_26_454 142
94 3300060353 Ga0501082_0002542 Ga0501082_0002542_10293_10721 142
95 3300060353 Ga0501082_0007967 Ga0501082_0007967_7281_7709 142
96 3300060353 Ga0501082_0017121 Ga0501082_0017121_2341_2769 142
97 3300060353 Ga0501082_0645165 Ga0501082_0645165_28_456 142
98 3300061734 Ga0530510_0000155 Ga0530510_0000155_38119_38547 142
99 3300061734 Ga0530510_0000483 Ga0530510_0000483_5790_6218 142
100 3300061734 Ga0530510_0372296 Ga0530510_0372296_636_1064 142
101 3300005545 Ga0070695_100882835 Ga0070695_1008828352 143
102 3300005981 Ga0081538_10000609 Ga0081538_1000060938 143
103 3300009176 Ga0105242_10383300 Ga0105242_103833002 143
104 3300021384 Ga0213876_10018927 Ga0213876_100189274 143
105 3300026035 Ga0207703_10936907 Ga0207703_109369072 143
106 3300028800 Ga0265338_10008957 Ga0265338_1000895722 143
107 3300037853 Ga0436364_1115546 Ga0436364_1115546_145_576 143
108 3300037853 Ga0436364_1341460 Ga0436364_1341460_1084_1515 143
109 3300039437 Ga0436365_0629338 Ga0436365_0629338_2470_2901 143
110 3300041491 Ga0451833_0530491 Ga0451833_0530491_90_521 143
111 3300045836 Ga0466958_0008361 Ga0466958_0008361_1290_1721 143
112 3300048905 Ga0496102_0771461 Ga0496102_0771461_73_510 143
113 3300048907 Ga0496104_0356471 Ga0496104_0356471_575_1012 143
114 3300048910 Ga0496107_0812916 Ga0496107_0812916_62_499 143
115 3300048912 Ga0496109_0680175 Ga0496109_0680175_13_450 143
116 3300048913 Ga0496110_0241456 Ga0496110_0241456_138_575 143
117 3300048914 Ga0496111_0508593 Ga0496111_0508593_342_779 143
118 3300048915 Ga0496112_0142067 Ga0496112_0142067_1153_1590 143
119 3300048916 Ga0496113_0081128 Ga0496113_0081128_511_948 143
120 3300049568 Ga0501031_0001029 Ga0501031_0001029_3776_4225 143
121 3300049568 Ga0501031_0008013 Ga0501031_0008013_3538_3972 143
122 3300049569 Ga0501032_0013542 Ga0501032_0013542_4646_5080 143
123 3300049569 Ga0501032_0091631 Ga0501032_0091631_477_908 143
124 3300049570 Ga0501033_0167440 Ga0501033_0167440_429_863 143
125 3300049571 Ga0501034_0401251 Ga0501034_0401251_717_1148 143
126 3300049572 Ga0501036_0009848 Ga0501036_0009848_5201_5650 143
127 3300049572 Ga0501036_0010718 Ga0501036_0010718_5375_5809 143
128 3300049573 Ga0501037_0077066 Ga0501037_0077066_1594_2028 143
129 3300049573 Ga0501037_0225487 Ga0501037_0225487_768_1199 143
130 3300049574 Ga0501038_0048444 Ga0501038_0048444_105_554 143
131 3300049574 Ga0501038_0129622 Ga0501038_0129622_1049_1483 143
132 3300049575 Ga0501039_0018960 Ga0501039_0018960_2397_2828 143
133 3300049575 Ga0501039_0042160 Ga0501039_0042160_96_530 143
134 3300049575 Ga0501039_0159891 Ga0501039_0159891_21_452 143
135 3300049576 Ga0501040_0000149 Ga0501040_0000149_3691_4140 143
136 3300049576 Ga0501040_0009383 Ga0501040_0009383_1666_2097 143
137 3300049577 Ga0501041_0054595 Ga0501041_0054595_1285_1716 143
138 3300049577 Ga0501041_0097179 Ga0501041_0097179_676_1107 143
139 3300049578 Ga0501042_0011094 Ga0501042_0011094_3636_4067 143
140 3300049579 Ga0501043_0012580 Ga0501043_0012580_5740_6174 143
141 3300049579 Ga0501043_0157759 Ga0501043_0157759_703_1152 143
142 3300049580 Ga0501046_0025301 Ga0501046_0025301_1594_2028 143
143 3300049581 Ga0501047_0056401 Ga0501047_0056401_2003_2437 143
144 3300049582 Ga0501048_0009610 Ga0501048_0009610_3965_4396 143
145 3300049582 Ga0501048_0059411 Ga0501048_0059411_170_604 143
146 3300049583 Ga0501067_0006213 Ga0501067_0006213_3283_3717 143
147 3300049584 Ga0501068_0030531 Ga0501068_0030531_531_965 143
148 3300049584 Ga0501068_0041886 Ga0501068_0041886_373_822 143
149 3300049585 Ga0501069_0006340 Ga0501069_0006340_3498_3932 143
150 3300049585 Ga0501069_0058019 Ga0501069_0058019_315_764 143
151 3300049586 Ga0501070_0190159 Ga0501070_0190159_77_508 143
152 3300049586 Ga0501070_0342970 Ga0501070_0342970_644_1093 143
153 3300049586 Ga0501070_0455950 Ga0501070_0455950_167_601 143
154 3300049587 Ga0501071_0028671 Ga0501071_0028671_240_671 143
155 3300049587 Ga0501071_0061757 Ga0501071_0061757_1995_2429 143
156 3300049587 Ga0501071_0190553 Ga0501071_0190553_1070_1501 143
157 3300049587 Ga0501071_0273817 Ga0501071_0273817_748_1179 143
158 3300049588 Ga0501072_0000465 Ga0501072_0000465_28723_29154 143
159 3300049588 Ga0501072_0060605 Ga0501072_0060605_1889_2320 143
160 3300049588 Ga0501072_0332742 Ga0501072_0332742_531_965 143
161 3300049589 Ga0501073_0088020 Ga0501073_0088020_574_1008 143
162 3300049590 Ga0501074_0024223 Ga0501074_0024223_177_608 143
163 3300049590 Ga0501074_0042186 Ga0501074_0042186_233_664 143
164 3300049590 Ga0501074_0055663 Ga0501074_0055663_717_1151 143
165 3300049591 Ga0501075_0030659 Ga0501075_0030659_178_609 143
166 3300049591 Ga0501075_0174901 Ga0501075_0174901_399_830 143
167 3300049592 Ga0501076_0000195 Ga0501076_0000195_5950_6399 143
168 3300049592 Ga0501076_0039015 Ga0501076_0039015_3281_3712 143
169 3300049592 Ga0501076_0355667 Ga0501076_0355667_11_445 143
170 3300049593 Ga0501077_0005655 Ga0501077_0005655_5819_6268 143
171 3300049593 Ga0501077_0024371 Ga0501077_0024371_2214_2645 143
172 3300049741 Ga0501079_0011634 Ga0501079_0011634_3979_4410 143
173 3300049741 Ga0501079_0526340 Ga0501079_0526340_339_773 143
174 3300049741 Ga0501079_0586052 Ga0501079_0586052_166_597 143
175 3300049742 Ga0501080_0030475 Ga0501080_0030475_2776_3210 143
176 3300049743 Ga0501081_0008744 Ga0501081_0008744_3814_4263 143
177 3300049744 Ga0501083_0060437 Ga0501083_0060437_1325_1759 143
178 3300049744 Ga0501083_0060770 Ga0501083_0060770_1239_1670 143
179 3300049744 Ga0501083_0657783 Ga0501083_0657783_74_505 143
180 3300049822 Ga0501035_0020439 Ga0501035_0020439_595_1044 143
181 3300049822 Ga0501035_0050590 Ga0501035_0050590_2991_3425 143
182 3300049822 Ga0501035_0475416 Ga0501035_0475416_540_971 143
183 3300049823 Ga0501044_0207151 Ga0501044_0207151_1408_1857 143
184 3300049823 Ga0501044_0233557 Ga0501044_0233557_302_736 143
185 3300049824 Ga0501045_0000251 Ga0501045_0000251_24459_24890 143
186 3300049824 Ga0501045_0065496 Ga0501045_0065496_1261_1692 143
187 3300054114 Ga0501084_0016686 Ga0501084_0016686_2236_2670 143
188 3300054114 Ga0501084_0028523 Ga0501084_0028523_478_909 143
189 3300060353 Ga0501082_0002033 Ga0501082_0002033_3608_4057 143
190 3300060353 Ga0501082_0008023 Ga0501082_0008023_1662_2096 143
191 3300060353 Ga0501082_0065211 Ga0501082_0065211_2624_3055 143
192 3300060353 Ga0501082_0106426 Ga0501082_0106426_32_463 143
193 3300061734 Ga0530510_0006704 Ga0530510_0006704_4289_4720 143
194 3300061734 Ga0530510_0069096 Ga0530510_0069096_259_690 143
195 3300003203 JGI25406J46586_10002561 JGI25406J46586_100025618 144
196 3300003373 JGI25407J50210_10085676 JGI25407J50210_100856761 144
197 3300004800 Ga0058861_12004293 Ga0058861_120042931 144
198 3300005329 Ga0070683_100016302 Ga0070683_1000163026 144
199 3300005329 Ga0070683_100489595 Ga0070683_1004895952 144
200 3300005329 Ga0070683_100499048 Ga0070683_1004990481 144
201 3300005331 Ga0070670_100893914 Ga0070670_1008939141 144
202 3300005336 Ga0070680_100001187 Ga0070680_1000011873 144
203 3300005337 Ga0070682_100018480 Ga0070682_1000184803 144
204 3300005337 Ga0070682_100357653 Ga0070682_1003576532 144
205 3300005338 Ga0068868_100386029 Ga0068868_1003860292 144
206 3300005339 Ga0070660_100082250 Ga0070660_1000822502 144
207 3300005339 Ga0070660_100661699 Ga0070660_1006616992 144
208 3300005344 Ga0070661_100018973 Ga0070661_1000189734 144
209 3300005345 Ga0070692_10072955 Ga0070692_100729552 144
210 3300005345 Ga0070692_10123232 Ga0070692_101232321 144
211 3300005345 Ga0070692_10559306 Ga0070692_105593062 144
212 3300005347 Ga0070668_100311482 Ga0070668_1003114822 144
213 3300005353 Ga0070669_101482361 Ga0070669_1014823611 144
214 3300005355 Ga0070671_100922039 Ga0070671_1009220391 144
215 3300005365 Ga0070688_100560484 Ga0070688_1005604841 144
216 3300005366 Ga0070659_100031342 Ga0070659_1000313424 144
217 3300005366 Ga0070659_100350301 Ga0070659_1003503012 144
218 3300005435 Ga0070714_100020853 Ga0070714_1000208536 144
219 3300005435 Ga0070714_100164862 Ga0070714_1001648622 144
220 3300005435 Ga0070714_100245552 Ga0070714_1002455522 144
221 3300005435 Ga0070714_100514681 Ga0070714_1005146812 144
222 3300005435 Ga0070714_100838808 Ga0070714_1008388081 144
223 3300005436 Ga0070713_100065622 Ga0070713_1000656221 144
224 3300005436 Ga0070713_100500159 Ga0070713_1005001592 144
225 3300005438 Ga0070701_10200377 Ga0070701_102003772 144
226 3300005438 Ga0070701_10449642 Ga0070701_104496422 144
227 3300005438 Ga0070701_10647880 Ga0070701_106478802 144
228 3300005441 Ga0070700_100259415 Ga0070700_1002594152 144
229 3300005441 Ga0070700_100556894 Ga0070700_1005568942 144
230 3300005455 Ga0070663_100229924 Ga0070663_1002299242 144
231 3300005455 Ga0070663_100395474 Ga0070663_1003954741 144
232 3300005455 Ga0070663_100855566 Ga0070663_1008555661 144
233 3300005457 Ga0070662_100003455 Ga0070662_10000345510 144
234 3300005457 Ga0070662_100793372 Ga0070662_1007933722 144
235 3300005458 Ga0070681_10316943 Ga0070681_103169432 144
236 3300005458 Ga0070681_10431836 Ga0070681_104318361 144
237 3300005458 Ga0070681_10821752 Ga0070681_108217522 144
238 3300005466 Ga0070685_10376867 Ga0070685_103768672 144
239 3300005518 Ga0070699_100498188 Ga0070699_1004981882 144
240 3300005530 Ga0070679_100122043 Ga0070679_1001220432 144
241 3300005530 Ga0070679_100180153 Ga0070679_1001801532 144
242 3300005530 Ga0070679_100357278 Ga0070679_1003572782 144
243 3300005535 Ga0070684_100009562 Ga0070684_1000095627 144
244 3300005535 Ga0070684_100035389 Ga0070684_1000353893 144
245 3300005539 Ga0068853_100185745 Ga0068853_1001857452 144
246 3300005539 Ga0068853_100569853 Ga0068853_1005698532 144
247 3300005539 Ga0068853_100993200 Ga0068853_1009932001 144
248 3300005545 Ga0070695_100493412 Ga0070695_1004934122 144
249 3300005546 Ga0070696_100139810 Ga0070696_1001398102 144
250 3300005548 Ga0070665_100001216 Ga0070665_10000121611 144
251 3300005564 Ga0070664_101073810 Ga0070664_1010738102 144
252 3300005578 Ga0068854_100126809 Ga0068854_1001268092 144
253 3300005578 Ga0068854_100192698 Ga0068854_1001926982 144
254 3300005614 Ga0068856_100006897 Ga0068856_1000068977 144
255 3300005614 Ga0068856_100195443 Ga0068856_1001954433 144
256 3300005615 Ga0070702_100057860 Ga0070702_1000578603 144
257 3300005616 Ga0068852_100009403 Ga0068852_1000094035 144
258 3300005616 Ga0068852_100192369 Ga0068852_1001923692 144
259 3300005616 Ga0068852_101873349 Ga0068852_1018733491 144
260 3300005617 Ga0068859_100479965 Ga0068859_1004799652 144
261 3300005618 Ga0068864_100204497 Ga0068864_1002044972 144
262 3300005618 Ga0068864_100952075 Ga0068864_1009520751 144
263 3300005618 Ga0068864_101208342 Ga0068864_1012083422 144
264 3300005718 Ga0068866_10204449 Ga0068866_102044492 144
265 3300005719 Ga0068861_100014162 Ga0068861_1000141625 144
266 3300005719 Ga0068861_100511264 Ga0068861_1005112642 144
267 3300005841 Ga0068863_100986656 Ga0068863_1009866562 144
268 3300005841 Ga0068863_101562070 Ga0068863_1015620701 144
269 3300005842 Ga0068858_100238167 Ga0068858_1002381672 144
270 3300005844 Ga0068862_101150507 Ga0068862_1011505071 144
271 3300005937 Ga0081455_10099870 Ga0081455_100998702 144
272 3300005937 Ga0081455_10171225 Ga0081455_101712253 144
273 3300005981 Ga0081538_10002557 Ga0081538_1000255710 144
274 3300005981 Ga0081538_10022872 Ga0081538_100228724 144
275 3300005981 Ga0081538_10172463 Ga0081538_101724631 144
276 3300005981 Ga0081538_10202953 Ga0081538_102029531 144
277 3300005983 Ga0081540_1001376 Ga0081540_10013764 144
278 3300005983 Ga0081540_1033321 Ga0081540_10333212 144
279 3300005985 Ga0081539_10000855 Ga0081539_1000085525 144
280 3300005985 Ga0081539_10005617 Ga0081539_100056175 144
281 3300005985 Ga0081539_10012636 Ga0081539_100126366 144
282 3300005985 Ga0081539_10044377 Ga0081539_100443771 144
283 3300005985 Ga0081539_10314162 Ga0081539_103141621 144
284 3300006028 Ga0070717_10122002 Ga0070717_101220021 144
285 3300006028 Ga0070717_10552407 Ga0070717_105524072 144
286 3300006038 Ga0075365_10595340 Ga0075365_105953402 144
287 3300006058 Ga0075432_10028964 Ga0075432_100289642 144
288 3300006058 Ga0075432_10061273 Ga0075432_100612732 144
289 3300006844 Ga0075428_100016116 Ga0075428_1000161164 144
290 3300006844 Ga0075428_100022509 Ga0075428_1000225092 144
291 3300006844 Ga0075428_100597740 Ga0075428_1005977402 144
292 3300006844 Ga0075428_101360316 Ga0075428_1013603162 144
293 3300006844 Ga0075428_102036170 Ga0075428_1020361701 144
294 3300006846 Ga0075430_100082707 Ga0075430_1000827073 144
295 3300006847 Ga0075431_100103948 Ga0075431_1001039483 144
296 3300006847 Ga0075431_100137029 Ga0075431_1001370292 144
297 3300006847 Ga0075431_100335634 Ga0075431_1003356342 144
298 3300006852 Ga0075433_10186100 Ga0075433_101861002 144
299 3300006852 Ga0075433_10634960 Ga0075433_106349601 144
300 3300006871 Ga0075434_100603220 Ga0075434_1006032202 144
301 3300006880 Ga0075429_100026641 Ga0075429_1000266413 144
302 3300006931 Ga0097620_100479975 Ga0097620_1004799752 144
303 3300007788 Ga0099795_10157658 Ga0099795_101576582 144
304 3300009093 Ga0105240_10173545 Ga0105240_101735452 144
305 3300009093 Ga0105240_11167292 Ga0105240_111672921 144
306 3300009094 Ga0111539_10100528 Ga0111539_101005282 144
307 3300009094 Ga0111539_10143602 Ga0111539_101436022 144
308 3300009094 Ga0111539_10713949 Ga0111539_107139491 144
309 3300009094 Ga0111539_10931528 Ga0111539_109315281 144
310 3300009094 Ga0111539_11149772 Ga0111539_111497721 144
311 3300009094 Ga0111539_11500027 Ga0111539_115000271 144
312 3300009094 Ga0111539_13528572 Ga0111539_135285721 144
313 3300009098 Ga0105245_10011999 Ga0105245_100119996 144
314 3300009098 Ga0105245_10035645 Ga0105245_100356453 144
315 3300009098 Ga0105245_10187372 Ga0105245_101873722 144
316 3300009098 Ga0105245_11015018 Ga0105245_110150181 144
317 3300009098 Ga0105245_11056895 Ga0105245_110568951 144
318 3300009098 Ga0105245_11197293 Ga0105245_111972931 144
319 3300009147 Ga0114129_10000969 Ga0114129_1000096945 144
320 3300009147 Ga0114129_10393711 Ga0114129_103937112 144
321 3300009147 Ga0114129_10581080 Ga0114129_105810802 144
322 3300009147 Ga0114129_10911879 Ga0114129_109118791 144
323 3300009148 Ga0105243_10878688 Ga0105243_108786882 144
324 3300009148 Ga0105243_11513013 Ga0105243_115130131 144
325 3300009174 Ga0105241_10791027 Ga0105241_107910271 144
326 3300009174 Ga0105241_10994159 Ga0105241_109941592 144
327 3300009174 Ga0105241_11614759 Ga0105241_116147591 144
328 3300009176 Ga0105242_10776519 Ga0105242_107765191 144
329 3300009177 Ga0105248_10354448 Ga0105248_103544482 144
330 3300009545 Ga0105237_10039876 Ga0105237_100398762 144
331 3300009545 Ga0105237_12291746 Ga0105237_122917461 144
332 3300009551 Ga0105238_10005680 Ga0105238_100056806 144
333 3300009551 Ga0105238_11438209 Ga0105238_114382092 144
334 3300009551 Ga0105238_11675084 Ga0105238_116750842 144
335 3300009553 Ga0105249_10029745 Ga0105249_100297452 144
336 3300010375 Ga0105239_10225089 Ga0105239_102250893 144
337 3300010375 Ga0105239_10548475 Ga0105239_105484752 144
338 3300010375 Ga0105239_10658856 Ga0105239_106588562 144
339 3300011119 Ga0105246_10304065 Ga0105246_103040652 144
340 3300011119 Ga0105246_11043792 Ga0105246_110437922 144
341 3300011119 Ga0105246_12021804 Ga0105246_120218041 144
342 3300012482 Ga0157318_1004370 Ga0157318_10043702 144
343 3300013102 Ga0157371_10944850 Ga0157371_109448501 144
344 3300013104 Ga0157370_10102279 Ga0157370_101022792 144
345 3300013105 Ga0157369_10053608 Ga0157369_100536084 144
346 3300013105 Ga0157369_11177688 Ga0157369_111776881 144
347 3300013306 Ga0163162_10574923 Ga0163162_105749232 144
348 3300013307 Ga0157372_10082070 Ga0157372_100820704 144
349 3300013307 Ga0157372_10636804 Ga0157372_106368042 144
350 3300013308 Ga0157375_10374218 Ga0157375_103742182 144
351 3300014325 Ga0163163_10066202 Ga0163163_100662024 144
352 3300014325 Ga0163163_10354935 Ga0163163_103549352 144
353 3300014325 Ga0163163_12069435 Ga0163163_120694351 144
354 3300014497 Ga0182008_10149866 Ga0182008_101498662 144
355 3300014497 Ga0182008_10386045 Ga0182008_103860452 144
356 3300014745 Ga0157377_10041436 Ga0157377_100414363 144
357 3300014745 Ga0157377_10206077 Ga0157377_102060771 144
358 3300014968 Ga0157379_10733829 Ga0157379_107338292 144
359 3300014969 Ga0157376_11019280 Ga0157376_110192801 144
360 3300017792 Ga0163161_10073443 Ga0163161_100734432 144
361 3300017792 Ga0163161_10863699 Ga0163161_108636992 144
362 3300017792 Ga0163161_11436343 Ga0163161_114363432 144
363 3300020070 Ga0206356_10680965 Ga0206356_106809651 144
364 3300020070 Ga0206356_11810994 Ga0206356_118109942 144
365 3300020076 Ga0206355_1004939 Ga0206355_10049392 144
366 3300020076 Ga0206355_1170366 Ga0206355_11703662 144
367 3300020077 Ga0206351_10527688 Ga0206351_105276881 144
368 3300020078 Ga0206352_10494801 Ga0206352_104948012 144
369 3300020080 Ga0206350_10035847 Ga0206350_100358472 144
370 3300020080 Ga0206350_10779252 Ga0206350_107792521 144
371 3300020081 Ga0206354_10027879 Ga0206354_100278792 144
372 3300020081 Ga0206354_11445525 Ga0206354_114455252 144
373 3300020082 Ga0206353_10344325 Ga0206353_103443254 144
374 3300020610 Ga0154015_1195879 Ga0154015_11958792 144
375 3300021358 Ga0213873_10033504 Ga0213873_100335042 144
376 3300021377 Ga0213874_10026474 Ga0213874_100264742 144
377 3300021384 Ga0213876_10025380 Ga0213876_100253803 144
378 3300021384 Ga0213876_10029606 Ga0213876_100296063 144
379 3300021384 Ga0213876_10066784 Ga0213876_100667842 144
380 3300021384 Ga0213876_10082342 Ga0213876_100823422 144
381 3300021388 Ga0213875_10029897 Ga0213875_100298971 144
382 3300021388 Ga0213875_10165622 Ga0213875_101656221 144
383 3300021388 Ga0213875_10188388 Ga0213875_101883882 144
384 3300021388 Ga0213875_10381447 Ga0213875_103814472 144
385 3300022467 Ga0224712_10035564 Ga0224712_100355641 144
386 3300025321 Ga0207656_10399932 Ga0207656_103999322 144
387 3300025899 Ga0207642_10217019 Ga0207642_102170192 144
388 3300025901 Ga0207688_10020155 Ga0207688_100201553 144
389 3300025901 Ga0207688_10176460 Ga0207688_101764602 144
390 3300025907 Ga0207645_10032906 Ga0207645_100329063 144
391 3300025912 Ga0207707_10028789 Ga0207707_100287894 144
392 3300025912 Ga0207707_10076450 Ga0207707_100764502 144
393 3300025912 Ga0207707_10608894 Ga0207707_106088942 144
394 3300025912 Ga0207707_10684323 Ga0207707_106843231 144
395 3300025914 Ga0207671_10097690 Ga0207671_100976902 144
396 3300025917 Ga0207660_10003979 Ga0207660_100039794 144
397 3300025918 Ga0207662_10132703 Ga0207662_101327032 144
398 3300025919 Ga0207657_10054080 Ga0207657_100540802 144
399 3300025919 Ga0207657_10123216 Ga0207657_101232163 144
400 3300025919 Ga0207657_10569618 Ga0207657_105696182 144
401 3300025920 Ga0207649_10009548 Ga0207649_100095484 144
402 3300025921 Ga0207652_10040922 Ga0207652_100409224 144
403 3300025921 Ga0207652_10071355 Ga0207652_100713552 144
404 3300025921 Ga0207652_10406215 Ga0207652_104062152 144
405 3300025923 Ga0207681_10258694 Ga0207681_102586942 144
406 3300025924 Ga0207694_10120174 Ga0207694_101201742 144
407 3300025924 Ga0207694_11226551 Ga0207694_112265512 144
408 3300025925 Ga0207650_10823575 Ga0207650_108235751 144
409 3300025927 Ga0207687_10142632 Ga0207687_101426322 144
410 3300025927 Ga0207687_10247670 Ga0207687_102476702 144
411 3300025927 Ga0207687_11526366 Ga0207687_115263661 144
412 3300025928 Ga0207700_10509953 Ga0207700_105099532 144
413 3300025929 Ga0207664_10002085 Ga0207664_1000208513 144
414 3300025929 Ga0207664_10045569 Ga0207664_100455693 144
415 3300025929 Ga0207664_10106114 Ga0207664_101061143 144
416 3300025929 Ga0207664_10394068 Ga0207664_103940682 144
417 3300025931 Ga0207644_10402593 Ga0207644_104025932 144
418 3300025932 Ga0207690_10060160 Ga0207690_100601602 144
419 3300025932 Ga0207690_11020039 Ga0207690_110200391 144
420 3300025933 Ga0207706_10002888 Ga0207706_100028882 144
421 3300025933 Ga0207706_11424780 Ga0207706_114247802 144
422 3300025937 Ga0207669_10506454 Ga0207669_105064541 144
423 3300025938 Ga0207704_10082187 Ga0207704_100821872 144
424 3300025938 Ga0207704_11162371 Ga0207704_111623712 144
425 3300025939 Ga0207665_11096546 Ga0207665_110965462 144
426 3300025941 Ga0207711_10883635 Ga0207711_108836352 144
427 3300025944 Ga0207661_10000288 Ga0207661_1000028819 144
428 3300025944 Ga0207661_10038642 Ga0207661_100386422 144
429 3300025944 Ga0207661_10375702 Ga0207661_103757022 144
430 3300025945 Ga0207679_10105839 Ga0207679_101058393 144
431 3300025949 Ga0207667_10708763 Ga0207667_107087632 144
432 3300025961 Ga0207712_10003500 Ga0207712_100035002 144
433 3300025972 Ga0207668_10075148 Ga0207668_100751482 144
434 3300025981 Ga0207640_10103829 Ga0207640_101038293 144
435 3300025981 Ga0207640_10559374 Ga0207640_105593742 144
436 3300025981 Ga0207640_10697903 Ga0207640_106979032 144
437 3300026035 Ga0207703_10185950 Ga0207703_101859502 144
438 3300026035 Ga0207703_10793620 Ga0207703_107936201 144
439 3300026041 Ga0207639_10083671 Ga0207639_100836712 144
440 3300026041 Ga0207639_10474219 Ga0207639_104742192 144
441 3300026041 Ga0207639_11075956 Ga0207639_110759561 144
442 3300026067 Ga0207678_10108572 Ga0207678_101085723 144
443 3300026067 Ga0207678_10320789 Ga0207678_103207892 144
444 3300026067 Ga0207678_10523714 Ga0207678_105237142 144
445 3300026075 Ga0207708_10266909 Ga0207708_102669092 144
446 3300026075 Ga0207708_11014035 Ga0207708_110140351 144
447 3300026075 Ga0207708_11056978 Ga0207708_110569781 144
448 3300026078 Ga0207702_10199328 Ga0207702_101993282 144
449 3300026078 Ga0207702_11140681 Ga0207702_111406811 144
450 3300026089 Ga0207648_10971498 Ga0207648_109714981 144
451 3300026095 Ga0207676_10068992 Ga0207676_100689923 144
452 3300026095 Ga0207676_10303918 Ga0207676_103039183 144
453 3300026095 Ga0207676_10614898 Ga0207676_106148982 144
454 3300026116 Ga0207674_10798510 Ga0207674_107985102 144
455 3300026118 Ga0207675_100051759 Ga0207675_1000517594 144
456 3300026118 Ga0207675_100063891 Ga0207675_1000638912 144
457 3300026118 Ga0207675_101479991 Ga0207675_1014799911 144
458 3300026118 Ga0207675_102147281 Ga0207675_1021472811 144
459 3300026121 Ga0207683_10270017 Ga0207683_102700172 144
460 3300026142 Ga0207698_10010680 Ga0207698_100106804 144
461 3300026142 Ga0207698_10588334 Ga0207698_105883342 144
462 3300026142 Ga0207698_10716120 Ga0207698_107161202 144
463 3300027907 Ga0207428_10007695 Ga0207428_100076953 144
464 3300027907 Ga0207428_10009667 Ga0207428_100096674 144
465 3300027907 Ga0207428_10140109 Ga0207428_101401091 144
466 3300028379 Ga0268266_10009612 Ga0268266_100096122 144
467 3300028380 Ga0268265_10399004 Ga0268265_103990041 144
468 3300028563 Ga0265319_1000097 Ga0265319_100009734 144
469 3300028573 Ga0265334_10100208 Ga0265334_101002082 144
470 3300031240 Ga0265320_10026669 Ga0265320_100266692 144
471 3300031548 Ga0307408_102250947 Ga0307408_1022509471 144
472 3300031731 Ga0307405_10321368 Ga0307405_103213682 144
473 3300031731 Ga0307405_10777308 Ga0307405_107773081 144
474 3300031824 Ga0307413_10110642 Ga0307413_101106422 144
475 3300031824 Ga0307413_10698490 Ga0307413_106984902 144
476 3300031852 Ga0307410_10393225 Ga0307410_103932252 144
477 3300031852 Ga0307410_11617515 Ga0307410_116175151 144
478 3300031901 Ga0307406_10182790 Ga0307406_101827902 144
479 3300031901 Ga0307406_10311237 Ga0307406_103112372 144
480 3300031903 Ga0307407_10065365 Ga0307407_100653653 144
481 3300031911 Ga0307412_10248490 Ga0307412_102484902 144
482 3300031911 Ga0307412_10457644 Ga0307412_104576442 144
483 3300031995 Ga0307409_100004882 Ga0307409_1000048822 144
484 3300031995 Ga0307409_100329332 Ga0307409_1003293322 144
485 3300031995 Ga0307409_100399676 Ga0307409_1003996762 144
486 3300031995 Ga0307409_100990518 Ga0307409_1009905182 144
487 3300032002 Ga0307416_100087720 Ga0307416_1000877204 144
488 3300032002 Ga0307416_100123099 Ga0307416_1001230993 144
489 3300032002 Ga0307416_100504378 Ga0307416_1005043782 144
490 3300032002 Ga0307416_100646132 Ga0307416_1006461322 144
491 3300032004 Ga0307414_10483905 Ga0307414_104839052 144
492 3300032005 Ga0307411_10041242 Ga0307411_100412422 144
493 3300032005 Ga0307411_10348548 Ga0307411_103485482 144
494 3300032005 Ga0307411_10547220 Ga0307411_105472201 144
495 3300032005 Ga0307411_11078640 Ga0307411_110786402 144
496 3300032126 Ga0307415_100001467 Ga0307415_1000014678 144
497 3300032126 Ga0307415_100051622 Ga0307415_1000516223 144
498 3300032126 Ga0307415_100079264 Ga0307415_1000792642 144
499 3300032126 Ga0307415_100111304 Ga0307415_1001113042 144
500 3300032126 Ga0307415_100228450 Ga0307415_1002284502 144
501 3300034816 Ga0373930_0216654 Ga0373930_0216654_52_486 144
502 3300035085 Ga0373929_0157502 Ga0373929_0157502_69_503 144
503 3300035112 Ga0373932_0057361 Ga0373932_0057361_89_523 144
504 3300035114 Ga0373939_0027083 Ga0373939_0027083_132_566 144
505 3300035121 Ga0373960_0026941 Ga0373960_0026941_894_1328 144
506 3300035242 Ga0373962_0073604 Ga0373962_0073604_428_862 144
507 3300035691 Ga0373931_0133676 Ga0373931_0133676_884_1318 144
508 3300037068 Ga0373925_0409513 Ga0373925_0409513_591_1025 144
509 3300037068 Ga0373925_0909188 Ga0373925_0909188_142_576 144
510 3300037312 Ga0395899_0454778 Ga0395899_0454778_243_677 144
511 3300037418 Ga0395900_0004774 Ga0395900_0004774_8128_8568 144
512 3300037418 Ga0395900_0063841 Ga0395900_0063841_2267_2707 144
513 3300037418 Ga0395900_0269360 Ga0395900_0269360_708_1142 144
514 3300037418 Ga0395900_0348447 Ga0395900_0348447_1005_1439 144
515 3300037466 Ga0395898_0010298 Ga0395898_0010298_3075_3515 144
516 3300037466 Ga0395898_0024260 Ga0395898_0024260_4524_4958 144
517 3300037466 Ga0395898_0134416 Ga0395898_0134416_49_483 144
518 3300037466 Ga0395898_0272422 Ga0395898_0272422_547_990 144
519 3300037466 Ga0395898_0571184 Ga0395898_0571184_263_697 144
520 3300037466 Ga0395898_1279656 Ga0395898_1279656_129_566 144
521 3300037471 Ga0395905_0021339 Ga0395905_0021339_1591_2031 144
522 3300037471 Ga0395905_0135978 Ga0395905_0135978_339_773 144
523 3300037471 Ga0395905_0154752 Ga0395905_0154752_1365_1808 144
524 3300037471 Ga0395905_0337434 Ga0395905_0337434_464_898 144
525 3300037471 Ga0395905_1141356 Ga0395905_1141356_93_527 144
526 3300037471 Ga0395905_1333057 Ga0395905_1333057_11_445 144
527 3300037853 Ga0436364_0004771 Ga0436364_0004771_142_576 144
528 3300037853 Ga0436364_0030377 Ga0436364_0030377_345_779 144
529 3300037853 Ga0436364_0080723 Ga0436364_0080723_68_502 144
530 3300037853 Ga0436364_0396681 Ga0436364_0396681_889_1323 144
531 3300037853 Ga0436364_0741604 Ga0436364_0741604_860_1294 144
532 3300037853 Ga0436364_0871788 Ga0436364_0871788_260_718 144
533 3300037853 Ga0436364_0901605 Ga0436364_0901605_35_469 144
534 3300037853 Ga0436364_1172909 Ga0436364_1172909_144_578 144
535 3300037853 Ga0436364_1215096 Ga0436364_1215096_178_612 144
536 3300037853 Ga0436364_1243845 Ga0436364_1243845_9988_10431 144
537 3300038443 Ga0395901_0011234 Ga0395901_0011234_1955_2389 144
538 3300038443 Ga0395901_0018758 Ga0395901_0018758_2172_2606 144
539 3300038443 Ga0395901_0046349 Ga0395901_0046349_2283_2723 144
540 3300038443 Ga0395901_0076345 Ga0395901_0076345_2414_2857 144
541 3300038443 Ga0395901_0382259 Ga0395901_0382259_379_813 144
542 3300038443 Ga0395901_0507504 Ga0395901_0507504_503_937 144
543 3300038443 Ga0395901_0970955 Ga0395901_0970955_158_595 144
544 3300038443 Ga0395901_1218065 Ga0395901_1218065_180_614 144
545 3300038443 Ga0395901_2145430 Ga0395901_2145430_21_455 144
546 3300039437 Ga0436365_0056826 Ga0436365_0056826_916_1401 144
547 3300039437 Ga0436365_0246988 Ga0436365_0246988_213_647 144
548 3300039437 Ga0436365_0377309 Ga0436365_0377309_9919_10362 144
549 3300039437 Ga0436365_0686509 Ga0436365_0686509_3689_4123 144
550 3300039437 Ga0436365_0925381 Ga0436365_0925381_384_827 144
551 3300039437 Ga0436365_0979777 Ga0436365_0979777_27_461 144
552 3300039437 Ga0436365_1362716 Ga0436365_1362716_346_780 144
553 3300039437 Ga0436365_1426124 Ga0436365_1426124_213_647 144
554 3300039437 Ga0436365_1749779 Ga0436365_1749779_299_733 144
555 3300039438 Ga0436360_0783578 Ga0436360_0783578_262_738 144
556 3300039447 Ga0436361_0135380 Ga0436361_0135380_16_492 144
557 3300039450 Ga0436363_0048403 Ga0436363_0048403_1088_1522 144
558 3300039450 Ga0436363_0116001 Ga0436363_0116001_13803_14237 144
559 3300039450 Ga0436363_0522014 Ga0436363_0522014_12_446 144
560 3300039450 Ga0436363_0889944 Ga0436363_0889944_59_493 144
561 3300039450 Ga0436363_1138467 Ga0436363_1138467_1270_1713 144
562 3300039450 Ga0436363_1237855 Ga0436363_1237855_97_531 144
563 3300039450 Ga0436363_1357623 Ga0436363_1357623_310_744 144
564 3300039450 Ga0436363_1492506 Ga0436363_1492506_3272_3715 144
565 3300039453 Ga0436362_0457422 Ga0436362_0457422_849_1334 144
566 3300039453 Ga0436362_0584602 Ga0436362_0584602_224_658 144
567 3300039453 Ga0436362_0701279 Ga0436362_0701279_36_470 144
568 3300039453 Ga0436362_0981668 Ga0436362_0981668_2597_3040 144
569 3300039453 Ga0436362_1113699 Ga0436362_1113699_776_1210 144
570 3300041443 Ga0451789_0140835 Ga0451789_0140835_122_556 144
571 3300041443 Ga0451789_0556213 Ga0451789_0556213_40_474 144
572 3300041452 Ga0451793_0641740 Ga0451793_0641740_33_467 144
573 3300041460 Ga0451802_0239322 Ga0451802_0239322_115_549 144
574 3300041496 Ga0451839_1509325 Ga0451839_1509325_153_587 144
575 3300041503 Ga0451847_0823104 Ga0451847_0823104_240_674 144
576 3300041512 Ga0451853_0405189 Ga0451853_0405189_85_519 144
577 3300041512 Ga0451853_2806980 Ga0451853_2806980_455_889 144
578 3300042013 Ga0439456_044439 Ga0439456_044439_170_604 144
579 3300044656 Ga0466969_0022458 Ga0466969_0022458_1586_2020 144
580 3300044658 Ga0466972_0374120 Ga0466972_0374120_75_509 144
581 3300044683 Ga0466965_0182485 Ga0466965_0182485_149_583 144
582 3300044683 Ga0466965_0530780 Ga0466965_0530780_163_597 144
583 3300044684 Ga0466966_0072552 Ga0466966_0072552_64_507 144
584 3300044684 Ga0466966_0119859 Ga0466966_0119859_486_920 144
585 3300044693 Ga0466961_0100396 Ga0466961_0100396_1160_1594 144
586 3300044693 Ga0466961_0271386 Ga0466961_0271386_40_483 144
587 3300044693 Ga0466961_0356705 Ga0466961_0356705_420_854 144
588 3300044694 Ga0466963_0025323 Ga0466963_0025323_2873_3307 144
589 3300044694 Ga0466963_0038967 Ga0466963_0038967_1898_2332 144
590 3300044694 Ga0466963_0163567 Ga0466963_0163567_315_749 144
591 3300044706 Ga0466964_0328872 Ga0466964_0328872_293_727 144
592 3300044706 Ga0466964_0353920 Ga0466964_0353920_236_676 144
593 3300044719 Ga0466971_0007903 Ga0466971_0007903_361_795 144
594 3300044719 Ga0466971_0502270 Ga0466971_0502270_102_536 144
595 3300044735 Ga0466968_0075108 Ga0466968_0075108_453_887 144
596 3300044765 Ga0466970_0108101 Ga0466970_0108101_103_537 144
597 3300044842 Ga0466957_0031049 Ga0466957_0031049_2108_2542 144
598 3300044842 Ga0466957_0041883 Ga0466957_0041883_1507_1941 144
599 3300044901 Ga0466960_0292997 Ga0466960_0292997_416_850 144
600 3300045049 Ga0466959_0002562 Ga0466959_0002562_535_969 144
601 3300045049 Ga0466959_0056212 Ga0466959_0056212_1234_1668 144
602 3300045049 Ga0466959_0192572 Ga0466959_0192572_653_1087 144
603 3300045049 Ga0466959_0252885 Ga0466959_0252885_762_1196 144
604 3300045049 Ga0466959_0554167 Ga0466959_0554167_182_616 144
605 3300045836 Ga0466958_0000390 Ga0466958_0000390_13908_14342 144
606 3300045836 Ga0466958_0016389 Ga0466958_0016389_694_1128 144
607 3300045836 Ga0466958_0017509 Ga0466958_0017509_2899_3333 144
608 3300045836 Ga0466958_0073362 Ga0466958_0073362_1213_1647 144
609 3300045836 Ga0466958_0085389 Ga0466958_0085389_1173_1616 144
610 3300045836 Ga0466958_0570142 Ga0466958_0570142_279_716 144
611 3300045976 Ga0466967_0018136 Ga0466967_0018136_245_679 144
612 3300045976 Ga0466967_0018566 Ga0466967_0018566_3820_4254 144
613 3300045976 Ga0466967_0136661 Ga0466967_0136661_468_902 144
614 3300045976 Ga0466967_0203668 Ga0466967_0203668_584_1018 144
615 3300045976 Ga0466967_0516030 Ga0466967_0516030_481_915 144
616 3300045976 Ga0466967_0520308 Ga0466967_0520308_432_866 144
617 3300045976 Ga0466967_0558035 Ga0466967_0558035_36_476 144
618 3300045976 Ga0466967_1210043 Ga0466967_1210043_229_663 144
619 3300045976 Ga0466967_1973643 Ga0466967_1973643_126_566 144
620 3300045976 Ga0466967_2297668 Ga0466967_2297668_25_459 144
621 3300046458 Ga0495591_126008 Ga0495591_126008_108_542 144
622 3300046471 Ga0495650_0000035 Ga0495650_0000035_183236_183670 144
623 3300046472 Ga0495580_0192297 Ga0495580_0192297_558_992 144
624 3300046477 Ga0495664_0315387 Ga0495664_0315387_401_835 144
625 3300046500 Ga0495596_0051722 Ga0495596_0051722_163_597 144
626 3300046500 Ga0495596_0082243 Ga0495596_0082243_514_948 144
627 3300046500 Ga0495596_0124409 Ga0495596_0124409_14_448 144
628 3300046518 Ga0495631_0238232 Ga0495631_0238232_74_508 144
629 3300046529 Ga0495652_0156606 Ga0495652_0156606_173_607 144
630 3300046535 Ga0495586_0199568 Ga0495586_0199568_59_499 144
631 3300046543 Ga0495645_0467011 Ga0495645_0467011_210_644 144
632 3300046615 Ga0495656_0162620 Ga0495656_0162620_214_648 144
633 3300046648 Ga0495611_0125972 Ga0495611_0125972_694_1131 144
634 3300046674 Ga0495588_0576341 Ga0495588_0576341_144_578 144
635 3300046680 Ga0495646_0208112 Ga0495646_0208112_527_961 144
636 3300046794 Ga0495589_0455424 Ga0495589_0455424_80_514 144
637 3300046794 Ga0495589_0490143 Ga0495589_0490143_50_484 144
638 3300047321 Ga0495676_0434319 Ga0495676_0434319_139_606 144
639 3300047447 Ga0495685_209504 Ga0495685_209504_75_509 144
640 3300048903 Ga0496100_0080961 Ga0496100_0080961_744_1178 144
641 3300048903 Ga0496100_0388679 Ga0496100_0388679_285_719 144
642 3300048903 Ga0496100_0840347 Ga0496100_0840347_119_556 144
643 3300048903 Ga0496100_1094920 Ga0496100_1094920_28_465 144
644 3300048904 Ga0496101_0019094 Ga0496101_0019094_2487_2921 144
645 3300048904 Ga0496101_0750386 Ga0496101_0750386_263_697 144
646 3300048905 Ga0496102_0188959 Ga0496102_0188959_34_468 144
647 3300048905 Ga0496102_0293644 Ga0496102_0293644_111_545 144
648 3300048905 Ga0496102_0314905 Ga0496102_0314905_558_992 144
649 3300048905 Ga0496102_0683732 Ga0496102_0683732_173_607 144
650 3300048905 Ga0496102_0702416 Ga0496102_0702416_339_815 144
651 3300048905 Ga0496102_0958199 Ga0496102_0958199_119_553 144
652 3300048905 Ga0496102_1890432 Ga0496102_1890432_34_474 144
653 3300048906 Ga0496103_0655064 Ga0496103_0655064_109_543 144
654 3300048907 Ga0496104_0073599 Ga0496104_0073599_2411_2845 144
655 3300048907 Ga0496104_0585175 Ga0496104_0585175_264_698 144
656 3300048907 Ga0496104_0620841 Ga0496104_0620841_334_768 144
657 3300048907 Ga0496104_0902804 Ga0496104_0902804_163_600 144
658 3300048908 Ga0496105_0082828 Ga0496105_0082828_1830_2264 144
659 3300048908 Ga0496105_0257842 Ga0496105_0257842_482_916 144
660 3300048908 Ga0496105_0541784 Ga0496105_0541784_446_880 144
661 3300048909 Ga0496106_0377939 Ga0496106_0377939_280_714 144
662 3300048909 Ga0496106_0993567 Ga0496106_0993567_176_616 144
663 3300048910 Ga0496107_0285475 Ga0496107_0285475_246_680 144
664 3300048910 Ga0496107_0359022 Ga0496107_0359022_454_888 144
665 3300048911 Ga0496108_0101040 Ga0496108_0101040_1556_1990 144
666 3300048911 Ga0496108_0266088 Ga0496108_0266088_399_833 144
667 3300048911 Ga0496108_0574922 Ga0496108_0574922_326_760 144
668 3300048911 Ga0496108_0666013 Ga0496108_0666013_12_446 144
669 3300048911 Ga0496108_0770631 Ga0496108_0770631_318_752 144
670 3300048911 Ga0496108_0817843 Ga0496108_0817843_116_550 144
671 3300048912 Ga0496109_0030445 Ga0496109_0030445_4183_4617 144
672 3300048912 Ga0496109_0160082 Ga0496109_0160082_1356_1790 144
673 3300048912 Ga0496109_0285287 Ga0496109_0285287_169_603 144
674 3300048912 Ga0496109_0391092 Ga0496109_0391092_217_651 144
675 3300048912 Ga0496109_0422619 Ga0496109_0422619_640_1074 144
676 3300048912 Ga0496109_0830318 Ga0496109_0830318_43_480 144
677 3300048913 Ga0496110_0049120 Ga0496110_0049120_864_1298 144
678 3300048913 Ga0496110_0239922 Ga0496110_0239922_368_802 144
679 3300048913 Ga0496110_0441955 Ga0496110_0441955_685_1119 144
680 3300048913 Ga0496110_0851979 Ga0496110_0851979_59_499 144
681 3300048913 Ga0496110_1300747 Ga0496110_1300747_174_620 144
682 3300048914 Ga0496111_0123371 Ga0496111_0123371_365_799 144
683 3300048914 Ga0496111_0158792 Ga0496111_0158792_252_686 144
684 3300048914 Ga0496111_0917221 Ga0496111_0917221_130_564 144
685 3300048915 Ga0496112_0098448 Ga0496112_0098448_2419_2853 144
686 3300048915 Ga0496112_0135049 Ga0496112_0135049_336_770 144
687 3300048915 Ga0496112_0170265 Ga0496112_0170265_1174_1608 144
688 3300048915 Ga0496112_0258625 Ga0496112_0258625_425_859 144
689 3300048915 Ga0496112_0304069 Ga0496112_0304069_818_1252 144
690 3300048915 Ga0496112_0465692 Ga0496112_0465692_589_1023 144
691 3300048916 Ga0496113_0177392 Ga0496113_0177392_376_810 144
692 3300048916 Ga0496113_0347887 Ga0496113_0347887_458_892 144
693 3300048916 Ga0496113_1214819 Ga0496113_1214819_128_562 144
694 3300048917 Ga0496114_0030344 Ga0496114_0030344_1687_2121 144
695 3300048917 Ga0496114_0130988 Ga0496114_0130988_279_713 144
696 3300048917 Ga0496114_0812047 Ga0496114_0812047_21_458 144
697 3300048918 Ga0496115_1221897 Ga0496115_1221897_85_519 144
698 3300048920 Ga0496117_0310934 Ga0496117_0310934_373_807 144
699 3300048921 Ga0496118_0289160 Ga0496118_0289160_160_594 144
700 3300048924 Ga0496121_0002418 Ga0496121_0002418_23011_23445 144
701 3300048924 Ga0496121_0096566 Ga0496121_0096566_1741_2181 144
702 3300048929 Ga0496126_0493732 Ga0496126_0493732_452_892 144
703 3300049162 Ga0501307_082546 Ga0501307_082546_31_468 144
704 3300049528 Ga0501312_120312 Ga0501312_120312_50_487 144
705 3300049533 Ga0501317_025142 Ga0501317_025142_42_482 144
706 3300049534 Ga0501318_028572 Ga0501318_028572_22_459 144
707 3300049537 Ga0501321_065047 Ga0501321_065047_31_468 144
708 3300049568 Ga0501031_0301511 Ga0501031_0301511_60_518 144
709 3300049568 Ga0501031_0708328 Ga0501031_0708328_56_514 144
710 3300049569 Ga0501032_0255208 Ga0501032_0255208_475_909 144
711 3300049570 Ga0501033_0446248 Ga0501033_0446248_360_794 144
712 3300049572 Ga0501036_1070728 Ga0501036_1070728_144_581 144
713 3300049573 Ga0501037_0213037 Ga0501037_0213037_472_915 144
714 3300049573 Ga0501037_0684599 Ga0501037_0684599_191_649 144
715 3300049575 Ga0501039_0021617 Ga0501039_0021617_3861_4295 144
716 3300049575 Ga0501039_0139133 Ga0501039_0139133_881_1315 144
717 3300049576 Ga0501040_0010866 Ga0501040_0010866_1424_1858 144
718 3300049576 Ga0501040_0099693 Ga0501040_0099693_470_904 144
719 3300049576 Ga0501040_0208691 Ga0501040_0208691_698_1132 144
720 3300049576 Ga0501040_0767355 Ga0501040_0767355_70_507 144
721 3300049577 Ga0501041_0124234 Ga0501041_0124234_489_923 144
722 3300049577 Ga0501041_0599821 Ga0501041_0599821_228_662 144
723 3300049578 Ga0501042_0008702 Ga0501042_0008702_5227_5661 144
724 3300049578 Ga0501042_0333984 Ga0501042_0333984_398_832 144
725 3300049579 Ga0501043_0255464 Ga0501043_0255464_554_988 144
726 3300049579 Ga0501043_0640510 Ga0501043_0640510_245_679 144
727 3300049580 Ga0501046_0194086 Ga0501046_0194086_502_936 144
728 3300049580 Ga0501046_0345491 Ga0501046_0345491_228_662 144
729 3300049582 Ga0501048_0074928 Ga0501048_0074928_421_879 144
730 3300049582 Ga0501048_0091431 Ga0501048_0091431_1352_1786 144
731 3300049584 Ga0501068_0505631 Ga0501068_0505631_67_501 144
732 3300049585 Ga0501069_0292862 Ga0501069_0292862_252_686 144
733 3300049586 Ga0501070_0265383 Ga0501070_0265383_895_1332 144
734 3300049587 Ga0501071_0093183 Ga0501071_0093183_1084_1518 144
735 3300049587 Ga0501071_0398754 Ga0501071_0398754_460_894 144
736 3300049587 Ga0501071_0463983 Ga0501071_0463983_51_488 144
737 3300049588 Ga0501072_0096619 Ga0501072_0096619_1406_1864 144
738 3300049588 Ga0501072_0117660 Ga0501072_0117660_1099_1533 144
739 3300049590 Ga0501074_0384636 Ga0501074_0384636_405_839 144
740 3300049590 Ga0501074_0423276 Ga0501074_0423276_109_543 144
741 3300049591 Ga0501075_0026654 Ga0501075_0026654_2752_3186 144
742 3300049591 Ga0501075_0151277 Ga0501075_0151277_766_1224 144
743 3300049591 Ga0501075_0915656 Ga0501075_0915656_193_627 144
744 3300049592 Ga0501076_0027659 Ga0501076_0027659_912_1346 144
745 3300049592 Ga0501076_0043421 Ga0501076_0043421_402_860 144
746 3300049592 Ga0501076_0115334 Ga0501076_0115334_279_713 144
747 3300049593 Ga0501077_0190559 Ga0501077_0190559_363_797 144
748 3300049593 Ga0501077_0521449 Ga0501077_0521449_85_519 144
749 3300049741 Ga0501079_0143423 Ga0501079_0143423_1412_1846 144
750 3300049741 Ga0501079_0179684 Ga0501079_0179684_519_977 144
751 3300049741 Ga0501079_0460738 Ga0501079_0460738_228_662 144
752 3300049742 Ga0501080_0102221 Ga0501080_0102221_239_673 144
753 3300049742 Ga0501080_0793233 Ga0501080_0793233_26_460 144
754 3300049743 Ga0501081_0017489 Ga0501081_0017489_1691_2125 144
755 3300049744 Ga0501083_0225394 Ga0501083_0225394_626_1060 144
756 3300049744 Ga0501083_0354404 Ga0501083_0354404_473_907 144
757 3300049779 Ga0501283_084547 Ga0501283_084547_88_522 144
758 3300049822 Ga0501035_0284169 Ga0501035_0284169_598_1032 144
759 3300049823 Ga0501044_0523920 Ga0501044_0523920_557_991 144
760 3300049824 Ga0501045_0071628 Ga0501045_0071628_804_1238 144
761 3300049824 Ga0501045_0197935 Ga0501045_0197935_669_1103 144
762 3300049824 Ga0501045_0357746 Ga0501045_0357746_222_680 144
763 3300050492 nmdc:mga0yw44_1043433_c1 nmdc:mga0yw44_1043433_c1_78_524 144
764 3300050507 nmdc:mga05p37_174736_c1 nmdc:mga05p37_174736_c1_896_1330 144
765 3300050507 nmdc:mga05p37_601_c1 nmdc:mga05p37_601_c1_1009_1443 144
766 3300050508 nmdc:mga09592_494883_c1 nmdc:mga09592_494883_c1_596_1042 144
767 3300050508 nmdc:mga09592_85491_c1 nmdc:mga09592_85491_c1_2091_2525 144
768 3300050509 nmdc:mga0qj67_679236_c1 nmdc:mga0qj67_679236_c1_197_631 144
769 3300050509 nmdc:mga0qj67_80129_c1 nmdc:mga0qj67_80129_c1_1683_2117 144
770 3300050510 nmdc:mga06r32_1039226_c1 nmdc:mga06r32_1039226_c1_127_561 144
771 3300050510 nmdc:mga06r32_112492_c1 nmdc:mga06r32_112492_c1_2002_2448 144
772 3300050510 nmdc:mga06r32_157746_c1 nmdc:mga06r32_157746_c1_1086_1520 144
773 3300050510 nmdc:mga06r32_698689_c1 nmdc:mga06r32_698689_c1_205_639 144
774 3300050511 nmdc:mga08y16_175117_c1 nmdc:mga08y16_175117_c1_1463_1897 144
775 3300050511 nmdc:mga08y16_224746_c1 nmdc:mga08y16_224746_c1_1293_1727 144
776 3300050511 nmdc:mga08y16_368826_c1 nmdc:mga08y16_368826_c1_17_451 144
777 3300050511 nmdc:mga08y16_66597_c1 nmdc:mga08y16_66597_c1_1291_1737 144
778 3300050512 nmdc:mga0n895_1184425_c1 nmdc:mga0n895_1184425_c1_62_496 144
779 3300050515 nmdc:mga0a205_1139612_c1 nmdc:mga0a205_1139612_c1_106_540 144
780 3300050515 nmdc:mga0a205_114467_c1 nmdc:mga0a205_114467_c1_1192_1626 144
781 3300050515 nmdc:mga0a205_583408_c1 nmdc:mga0a205_583408_c1_93_527 144
782 3300053083 Ga0495655_0038525 Ga0495655_0038525_295_732 144
783 3300053083 Ga0495655_0069115 Ga0495655_0069115_362_796 144
784 3300053083 Ga0495655_0194494 Ga0495655_0194494_83_517 144
785 3300053146 Ga0500588_0260216 Ga0500588_0260216_152_592 144
786 3300053153 Ga0500616_0005292 Ga0500616_0005292_4982_5416 144
787 3300054114 Ga0501084_0304376 Ga0501084_0304376_172_630 144
788 3300054114 Ga0501084_0336705 Ga0501084_0336705_579_1013 144
789 3300054114 Ga0501084_0345153 Ga0501084_0345153_767_1201 144
790 3300059421 Ga0590071_050409 Ga0590071_050409_178_612 144
791 3300059426 Ga0590077_097541 Ga0590077_097541_211_645 144
792 3300059491 Ga0587070_170148 Ga0587070_170148_17_451 144
793 3300059504 Ga0587082_102320 Ga0587082_102320_79_513 144
794 3300059505 Ga0587083_0104451 Ga0587083_0104451_183_623 144
795 3300059508 Ga0587088_106084 Ga0587088_106084_117_551 144
796 3300059513 Ga0587094_065064 Ga0587094_065064_117_551 144
797 3300059642 Ga0587069_082382 Ga0587069_082382_32_469 144
798 3300059645 Ga0587076_079530 Ga0587076_079530_199_633 144
799 3300060353 Ga0501082_0063916 Ga0501082_0063916_82_540 144
800 3300060353 Ga0501082_0206490 Ga0501082_0206490_346_780 144
801 3300060353 Ga0501082_0506207 Ga0501082_0506207_131_565 144
802 3300061719 Ga0466962_0000616 Ga0466962_0000616_3062_3496 144
803 3300061734 Ga0530510_0019946 Ga0530510_0019946_257_715 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

37

155

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ppk-assembly1.cif.gz_J rbga+45srbga complex 0.9375 12 143
7jql-assembly2.cif.gz_2N crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution 0.935 1 142
8cvm-assembly1.cif.gz_i cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9341 2 144
7m4w-assembly1.cif.gz_I a. baumannii ribosome-eravacycline complex: empty 70s 0.9308 1 142
7nhn-assembly1.cif.gz_M vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9293 1 142
ID Description Score Start End Superfamily
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9538 12 144 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9508 12 144 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9347 1 142 3.90.1180.10
af_Q554U7_3_170_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9327 8 141 3.90.1180.10
af_Q9VJ38_1_177_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9304 9 142 3.90.1180.10
ID Description Score Start End GO Terms
AF-D8SDP4-F1-model_v4 50S ribosomal protein L13 0.9722 12 142 GO:0003729
GO:0003735
GO:0005840
GO:0006412
GO:0017148
GO:0022625
AF-A0A1F6LAI9-F1-model_v4 Large ribosomal subunit protein uL13 0.9675 12 144 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A3B4X4E0-F1-model_v4 50S ribosomal protein L13 0.967 12 141 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A660VCC6-F1-model_v4 Large ribosomal subunit protein uL13 0.9669 12 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A7J7N2Z6-F1-model_v4 COP9 signalosome complex subunit 3 0.9667 13 144 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0006511
GO:0008180
GO:0016740
GO:1990904

Feature Viewer

pLDDT pTM Quality
91.33 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map