F481498
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 803 | 305 | 803 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100952075|Ga0068864_1009520751 |
| Length | 168 |
| Sequence | MPFGPLCLWPRRAEQWCSRGLSHAVKTFVATPSDRQRDWLIVDATGQTLGRLATQIADALRGKRKPTYTPHIDTGDFVVVINAEKIAVTGNKRADKLYHRHSGYPGGLKTRTLNDMLERRPEEVIRLAVKGMLPRNRLARKQITKLKVYAGPDHPHAAQKPQPMETHS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 73 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 89 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 146 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 166 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 167 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 171 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 180 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 181 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 182 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 183 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 184 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 188 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 189 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 192 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 193 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 292 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 295 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 296 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 305 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.76 |
| Metatranscriptomes | 3.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 0 |
| Rhizoplane | 8.72 |
| Rhizosphere | 84.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10002561 | 3300003203 | Bacteria | 8584 |
| 2 | JGI25407J50210_10085676 | 3300003373 | Bacteria | 781 |
| 3 | Ga0058861_12004293 | 3300004800 | Bacteria | 750 |
| 4 | Ga0070683_100016302 | 3300005329 | Bacteria | 6551 |
| 5 | Ga0070683_100489595 | 3300005329 | Bacteria | 1174 |
| 6 | Ga0070683_100499048 | 3300005329 | Bacteria | 1163 |
| 7 | Ga0070670_100893914 | 3300005331 | Bacteria | 805 |
| 8 | Ga0070680_100001187 | 3300005336 | Bacteria | 18758 |
| 9 | Ga0070682_100018480 | 3300005337 | Bacteria | 4077 |
| 10 | Ga0070682_100357653 | 3300005337 | Bacteria | 1091 |
| 11 | Ga0068868_100386029 | 3300005338 | Bacteria | 1206 |
| 12 | Ga0070660_100082250 | 3300005339 | Bacteria | 2528 |
| 13 | Ga0070660_100661699 | 3300005339 | Bacteria | 875 |
| 14 | Ga0070661_100018973 | 3300005344 | Bacteria | 4897 |
| 15 | Ga0070692_10072955 | 3300005345 | Bacteria | 1833 |
| 16 | Ga0070692_10123232 | 3300005345 | Bacteria | 1448 |
| 17 | Ga0070692_10559306 | 3300005345 | Bacteria | 751 |
| 18 | Ga0070668_100311482 | 3300005347 | Bacteria | 1323 |
| 19 | Ga0070669_101482361 | 3300005353 | Bacteria | 590 |
| 20 | Ga0070671_100922039 | 3300005355 | Bacteria | 764 |
| 21 | Ga0070688_100560484 | 3300005365 | Bacteria | 870 |
| 22 | Ga0070659_100031342 | 3300005366 | Bacteria | 4117 |
| 23 | Ga0070659_100350301 | 3300005366 | Bacteria | 1239 |
| 24 | Ga0070659_100792790 | 3300005366 | Bacteria | 824 |
| 25 | Ga0070714_100020853 | 3300005435 | Bacteria | 5356 |
| 26 | Ga0070714_100164862 | 3300005435 | Bacteria | 2007 |
| 27 | Ga0070714_100245552 | 3300005435 | Bacteria | 1654 |
| 28 | Ga0070714_100514681 | 3300005435 | Bacteria | 1142 |
| 29 | Ga0070714_100838808 | 3300005435 | Bacteria | 891 |
| 30 | Ga0070713_100065622 | 3300005436 | Bacteria | 3050 |
| 31 | Ga0070713_100500159 | 3300005436 | Bacteria | 1147 |
| 32 | Ga0070701_10200377 | 3300005438 | Bacteria | 1180 |
| 33 | Ga0070701_10449642 | 3300005438 | Bacteria | 827 |
| 34 | Ga0070701_10647880 | 3300005438 | Bacteria | 705 |
| 35 | Ga0070700_100259415 | 3300005441 | Bacteria | 1251 |
| 36 | Ga0070700_100556894 | 3300005441 | Bacteria | 892 |
| 37 | Ga0070663_100229924 | 3300005455 | Bacteria | 1460 |
| 38 | Ga0070663_100395474 | 3300005455 | Bacteria | 1128 |
| 39 | Ga0070663_100855566 | 3300005455 | Bacteria | 783 |
| 40 | Ga0070662_100003455 | 3300005457 | Bacteria | 9853 |
| 41 | Ga0070662_100793372 | 3300005457 | Bacteria | 805 |
| 42 | Ga0070681_10316943 | 3300005458 | Bacteria | 1469 |
| 43 | Ga0070681_10431836 | 3300005458 | Bacteria | 1229 |
| 44 | Ga0070681_10821752 | 3300005458 | Bacteria | 847 |
| 45 | Ga0070685_10376867 | 3300005466 | Bacteria | 977 |
| 46 | Ga0070699_100498188 | 3300005518 | Bacteria | 1106 |
| 47 | Ga0070679_100122043 | 3300005530 | Bacteria | 2590 |
| 48 | Ga0070679_100180153 | 3300005530 | Bacteria | 2086 |
| 49 | Ga0070679_100357278 | 3300005530 | Bacteria | 1408 |
| 50 | Ga0070684_100009562 | 3300005535 | Bacteria | 7639 |
| 51 | Ga0070684_100035389 | 3300005535 | Bacteria | 4274 |
| 52 | Ga0068853_100185745 | 3300005539 | Bacteria | 1887 |
| 53 | Ga0068853_100569853 | 3300005539 | Bacteria | 1074 |
| 54 | Ga0068853_100993200 | 3300005539 | Bacteria | 808 |
| 55 | Ga0070695_100493412 | 3300005545 | Bacteria | 946 |
| 56 | Ga0070695_100882835 | 3300005545 | Bacteria | 721 |
| 57 | Ga0070696_100139810 | 3300005546 | Bacteria | 1769 |
| 58 | Ga0070665_100001216 | 3300005548 | Bacteria | 31377 |
| 59 | Ga0070664_101073810 | 3300005564 | Bacteria | 758 |
| 60 | Ga0068854_100126809 | 3300005578 | Bacteria | 1945 |
| 61 | Ga0068854_100192698 | 3300005578 | Bacteria | 1598 |
| 62 | Ga0068856_100006897 | 3300005614 | Bacteria | 11109 |
| 63 | Ga0068856_100195443 | 3300005614 | Bacteria | 2037 |
| 64 | Ga0070702_100057860 | 3300005615 | Bacteria | 2243 |
| 65 | Ga0068852_100009403 | 3300005616 | Bacteria | 7260 |
| 66 | Ga0068852_100192369 | 3300005616 | Bacteria | 1926 |
| 67 | Ga0068852_101873349 | 3300005616 | Bacteria | 622 |
| 68 | Ga0068859_100479965 | 3300005617 | Bacteria | 1339 |
| 69 | Ga0068864_100204497 | 3300005618 | Bacteria | 1815 |
| 70 | Ga0068864_100952075 | 3300005618 | Bacteria | 850 |
| 71 | Ga0068864_101208342 | 3300005618 | Bacteria | 755 |
| 72 | Ga0068866_10204449 | 3300005718 | Bacteria | 1182 |
| 73 | Ga0068861_100014162 | 3300005719 | Bacteria | 5593 |
| 74 | Ga0068861_100511264 | 3300005719 | Bacteria | 1088 |
| 75 | Ga0068863_100986656 | 3300005841 | Bacteria | 845 |
| 76 | Ga0068863_101562070 | 3300005841 | Bacteria | 669 |
| 77 | Ga0068858_100238167 | 3300005842 | Bacteria | 1726 |
| 78 | Ga0068862_101150507 | 3300005844 | Bacteria | 773 |
| 79 | Ga0081455_10099870 | 3300005937 | Bacteria | 2333 |
| 80 | Ga0081455_10171225 | 3300005937 | Bacteria | 1654 |
| 81 | Ga0081538_10000609 | 3300005981 | Bacteria | 39610 |
| 82 | Ga0081538_10002557 | 3300005981 | Bacteria | 17683 |
| 83 | Ga0081538_10022872 | 3300005981 | Bacteria | 4511 |
| 84 | Ga0081538_10172463 | 3300005981 | Bacteria | 941 |
| 85 | Ga0081538_10202953 | 3300005981 | Bacteria | 811 |
| 86 | Ga0081540_1001376 | 3300005983 | Bacteria | 21079 |
| 87 | Ga0081540_1033321 | 3300005983 | Bacteria | 2799 |
| 88 | Ga0081539_10000855 | 3300005985 | Bacteria | 58253 |
| 89 | Ga0081539_10005617 | 3300005985 | Bacteria | 12624 |
| 90 | Ga0081539_10012636 | 3300005985 | Bacteria | 6475 |
| 91 | Ga0081539_10044377 | 3300005985 | Bacteria | 2567 |
| 92 | Ga0081539_10314162 | 3300005985 | Bacteria | 669 |
| 93 | Ga0070717_10122002 | 3300006028 | Bacteria | 2233 |
| 94 | Ga0070717_10552407 | 3300006028 | Bacteria | 1043 |
| 95 | Ga0075365_10595340 | 3300006038 | Bacteria | 782 |
| 96 | Ga0075432_10028964 | 3300006058 | Bacteria | 1911 |
| 97 | Ga0075432_10061273 | 3300006058 | Bacteria | 1340 |
| 98 | Ga0075428_100016116 | 3300006844 | Bacteria | 8261 |
| 99 | Ga0075428_100022509 | 3300006844 | Bacteria | 6978 |
| 100 | Ga0075428_100597740 | 3300006844 | Bacteria | 1179 |
| 101 | Ga0075428_101360316 | 3300006844 | Bacteria | 746 |
| 102 | Ga0075428_102036170 | 3300006844 | Bacteria | 595 |
| 103 | Ga0075430_100082707 | 3300006846 | Bacteria | 2690 |
| 104 | Ga0075431_100103948 | 3300006847 | Bacteria | 2931 |
| 105 | Ga0075431_100137029 | 3300006847 | Bacteria | 2524 |
| 106 | Ga0075431_100335634 | 3300006847 | Bacteria | 1522 |
| 107 | Ga0075433_10186100 | 3300006852 | Bacteria | 1848 |
| 108 | Ga0075433_10634960 | 3300006852 | Bacteria | 937 |
| 109 | Ga0075434_100603220 | 3300006871 | Bacteria | 1117 |
| 110 | Ga0075429_100026641 | 3300006880 | Bacteria | 5020 |
| 111 | Ga0097620_100479975 | 3300006931 | Bacteria | 1339 |
| 112 | Ga0099795_10157658 | 3300007788 | Bacteria | 934 |
| 113 | Ga0105240_10173545 | 3300009093 | Bacteria | 2551 |
| 114 | Ga0105240_11167292 | 3300009093 | Bacteria | 817 |
| 115 | Ga0111539_10100528 | 3300009094 | Bacteria | 3395 |
| 116 | Ga0111539_10143602 | 3300009094 | Bacteria | 2794 |
| 117 | Ga0111539_10713949 | 3300009094 | Bacteria | 1167 |
| 118 | Ga0111539_10931528 | 3300009094 | Bacteria | 1010 |
| 119 | Ga0111539_11149772 | 3300009094 | Bacteria | 902 |
| 120 | Ga0111539_11500027 | 3300009094 | Bacteria | 782 |
| 121 | Ga0111539_13528572 | 3300009094 | Bacteria | 502 |
| 122 | Ga0105245_10011999 | 3300009098 | Bacteria | 7533 |
| 123 | Ga0105245_10035645 | 3300009098 | Bacteria | 4417 |
| 124 | Ga0105245_10187372 | 3300009098 | Bacteria | 1980 |
| 125 | Ga0105245_11015018 | 3300009098 | Bacteria | 874 |
| 126 | Ga0105245_11056895 | 3300009098 | Bacteria | 857 |
| 127 | Ga0105245_11197293 | 3300009098 | Bacteria | 808 |
| 128 | Ga0114129_10000969 | 3300009147 | Bacteria | 37546 |
| 129 | Ga0114129_10393711 | 3300009147 | Bacteria | 1827 |
| 130 | Ga0114129_10581080 | 3300009147 | Bacteria | 1454 |
| 131 | Ga0114129_10911879 | 3300009147 | Bacteria | 1113 |
| 132 | Ga0105243_10878688 | 3300009148 | Bacteria | 890 |
| 133 | Ga0105243_11513013 | 3300009148 | Bacteria | 695 |
| 134 | Ga0105241_10791027 | 3300009174 | Bacteria | 873 |
| 135 | Ga0105241_10994159 | 3300009174 | Bacteria | 784 |
| 136 | Ga0105241_11614759 | 3300009174 | Bacteria | 627 |
| 137 | Ga0105242_10383300 | 3300009176 | Bacteria | 1307 |
| 138 | Ga0105242_10776519 | 3300009176 | Bacteria | 946 |
| 139 | Ga0105242_11136904 | 3300009176 | Bacteria | 797 |
| 140 | Ga0105248_10354448 | 3300009177 | Bacteria | 1652 |
| 141 | Ga0105237_10039876 | 3300009545 | Bacteria | 4738 |
| 142 | Ga0105237_12291746 | 3300009545 | Bacteria | 550 |
| 143 | Ga0105238_10005680 | 3300009551 | Bacteria | 12331 |
| 144 | Ga0105238_11438209 | 3300009551 | Bacteria | 717 |
| 145 | Ga0105238_11675084 | 3300009551 | Bacteria | 667 |
| 146 | Ga0105249_10029745 | 3300009553 | Bacteria | 4934 |
| 147 | Ga0105239_10225089 | 3300010375 | Bacteria | 2104 |
| 148 | Ga0105239_10548475 | 3300010375 | Bacteria | 1316 |
| 149 | Ga0105239_10658856 | 3300010375 | Bacteria | 1196 |
| 150 | Ga0105246_10304065 | 3300011119 | Bacteria | 1289 |
| 151 | Ga0105246_11043792 | 3300011119 | Bacteria | 743 |
| 152 | Ga0105246_12021804 | 3300011119 | Bacteria | 556 |
| 153 | Ga0157318_1004370 | 3300012482 | Bacteria | 859 |
| 154 | Ga0157326_1067527 | 3300012513 | Bacteria | 560 |
| 155 | Ga0157371_10944850 | 3300013102 | Bacteria | 655 |
| 156 | Ga0157370_10102279 | 3300013104 | Bacteria | 2683 |
| 157 | Ga0157369_10053608 | 3300013105 | Bacteria | 4357 |
| 158 | Ga0157369_11177688 | 3300013105 | Bacteria | 782 |
| 159 | Ga0157374_12391395 | 3300013296 | Bacteria | 556 |
| 160 | Ga0163162_10574923 | 3300013306 | Bacteria | 1254 |
| 161 | Ga0157372_10082070 | 3300013307 | Bacteria | 3649 |
| 162 | Ga0157372_10636804 | 3300013307 | Bacteria | 1242 |
| 163 | Ga0157375_10374218 | 3300013308 | Bacteria | 1591 |
| 164 | Ga0163163_10066202 | 3300014325 | Bacteria | 3588 |
| 165 | Ga0163163_10354935 | 3300014325 | Bacteria | 1522 |
| 166 | Ga0163163_12069435 | 3300014325 | Bacteria | 629 |
| 167 | Ga0182008_10149866 | 3300014497 | Bacteria | 1170 |
| 168 | Ga0182008_10386045 | 3300014497 | Bacteria | 749 |
| 169 | Ga0157377_10041436 | 3300014745 | Bacteria | 2555 |
| 170 | Ga0157377_10206077 | 3300014745 | Bacteria | 1251 |
| 171 | Ga0157379_10733829 | 3300014968 | Bacteria | 929 |
| 172 | Ga0157376_11019280 | 3300014969 | Bacteria | 851 |
| 173 | Ga0163161_10073443 | 3300017792 | Bacteria | 2506 |
| 174 | Ga0163161_10863699 | 3300017792 | Bacteria | 764 |
| 175 | Ga0163161_11436343 | 3300017792 | Bacteria | 604 |
| 176 | Ga0206356_10680965 | 3300020070 | Bacteria | 1478 |
| 177 | Ga0206356_11810994 | 3300020070 | Bacteria | 993 |
| 178 | Ga0206355_1004939 | 3300020076 | Bacteria | 757 |
| 179 | Ga0206355_1170366 | 3300020076 | Bacteria | 788 |
| 180 | Ga0206351_10527688 | 3300020077 | Bacteria | 1134 |
| 181 | Ga0206352_10494801 | 3300020078 | Bacteria | 1256 |
| 182 | Ga0206350_10035847 | 3300020080 | Bacteria | 1058 |
| 183 | Ga0206350_10779252 | 3300020080 | Bacteria | 639 |
| 184 | Ga0206354_10027879 | 3300020081 | Bacteria | 1002 |
| 185 | Ga0206354_11445525 | 3300020081 | Bacteria | 2333 |
| 186 | Ga0206353_10344325 | 3300020082 | Bacteria | 3651 |
| 187 | Ga0154015_1195879 | 3300020610 | Bacteria | 750 |
| 188 | Ga0213873_10033504 | 3300021358 | Bacteria | 1289 |
| 189 | Ga0213874_10026474 | 3300021377 | Bacteria | 1643 |
| 190 | Ga0213876_10018927 | 3300021384 | Bacteria | 3637 |
| 191 | Ga0213876_10025380 | 3300021384 | Bacteria | 3127 |
| 192 | Ga0213876_10029606 | 3300021384 | Bacteria | 2885 |
| 193 | Ga0213876_10066784 | 3300021384 | Bacteria | 1899 |
| 194 | Ga0213876_10082342 | 3300021384 | Bacteria | 1702 |
| 195 | Ga0213875_10029897 | 3300021388 | Bacteria | 2582 |
| 196 | Ga0213875_10165622 | 3300021388 | Bacteria | 1037 |
| 197 | Ga0213875_10188388 | 3300021388 | Bacteria | 970 |
| 198 | Ga0213875_10381447 | 3300021388 | Bacteria | 671 |
| 199 | Ga0224712_10035564 | 3300022467 | Bacteria | 1839 |
| 200 | Ga0207656_10399932 | 3300025321 | Bacteria | 690 |
| 201 | Ga0207642_10217019 | 3300025899 | Bacteria | 1067 |
| 202 | Ga0207688_10020155 | 3300025901 | Bacteria | 3639 |
| 203 | Ga0207688_10176460 | 3300025901 | Bacteria | 1273 |
| 204 | Ga0207645_10032906 | 3300025907 | Bacteria | 3333 |
| 205 | Ga0207707_10028789 | 3300025912 | Bacteria | 4854 |
| 206 | Ga0207707_10076450 | 3300025912 | Bacteria | 2922 |
| 207 | Ga0207707_10608894 | 3300025912 | Bacteria | 924 |
| 208 | Ga0207707_10684323 | 3300025912 | Bacteria | 862 |
| 209 | Ga0207671_10097690 | 3300025914 | Bacteria | 2221 |
| 210 | Ga0207660_10003979 | 3300025917 | Bacteria | 9630 |
| 211 | Ga0207662_10132703 | 3300025918 | Bacteria | 1571 |
| 212 | Ga0207657_10054080 | 3300025919 | Bacteria | 3474 |
| 213 | Ga0207657_10123216 | 3300025919 | Bacteria | 2131 |
| 214 | Ga0207657_10569618 | 3300025919 | Bacteria | 885 |
| 215 | Ga0207649_10009548 | 3300025920 | Bacteria | 5312 |
| 216 | Ga0207652_10040922 | 3300025921 | Bacteria | 3937 |
| 217 | Ga0207652_10071355 | 3300025921 | Bacteria | 3018 |
| 218 | Ga0207652_10406215 | 3300025921 | Bacteria | 1229 |
| 219 | Ga0207681_10258694 | 3300025923 | Bacteria | 1362 |
| 220 | Ga0207694_10120174 | 3300025924 | Bacteria | 2097 |
| 221 | Ga0207694_11226551 | 3300025924 | Bacteria | 634 |
| 222 | Ga0207650_10823575 | 3300025925 | Bacteria | 787 |
| 223 | Ga0207687_10142632 | 3300025927 | Bacteria | 1819 |
| 224 | Ga0207687_10247670 | 3300025927 | Bacteria | 1415 |
| 225 | Ga0207687_11526366 | 3300025927 | Bacteria | 574 |
| 226 | Ga0207700_10509953 | 3300025928 | Bacteria | 1065 |
| 227 | Ga0207664_10002085 | 3300025929 | Bacteria | 13152 |
| 228 | Ga0207664_10045569 | 3300025929 | Bacteria | 3440 |
| 229 | Ga0207664_10106114 | 3300025929 | Bacteria | 2329 |
| 230 | Ga0207664_10394068 | 3300025929 | Bacteria | 1231 |
| 231 | Ga0207644_10402593 | 3300025931 | Bacteria | 1119 |
| 232 | Ga0207690_10060160 | 3300025932 | Bacteria | 2577 |
| 233 | Ga0207690_11020039 | 3300025932 | Bacteria | 689 |
| 234 | Ga0207706_10002888 | 3300025933 | Bacteria | 16643 |
| 235 | Ga0207706_11424780 | 3300025933 | Bacteria | 568 |
| 236 | Ga0207669_10506454 | 3300025937 | Bacteria | 967 |
| 237 | Ga0207704_10082187 | 3300025938 | Bacteria | 2086 |
| 238 | Ga0207704_11162371 | 3300025938 | Bacteria | 657 |
| 239 | Ga0207665_11096546 | 3300025939 | Bacteria | 634 |
| 240 | Ga0207711_10883635 | 3300025941 | Bacteria | 831 |
| 241 | Ga0207661_10000288 | 3300025944 | Bacteria | 31795 |
| 242 | Ga0207661_10038642 | 3300025944 | Bacteria | 3742 |
| 243 | Ga0207661_10375702 | 3300025944 | Bacteria | 1286 |
| 244 | Ga0207679_10105839 | 3300025945 | Bacteria | 2210 |
| 245 | Ga0207667_10708763 | 3300025949 | Bacteria | 1008 |
| 246 | Ga0207712_10003500 | 3300025961 | Bacteria | 9906 |
| 247 | Ga0207668_10075148 | 3300025972 | Bacteria | 2429 |
| 248 | Ga0207640_10103829 | 3300025981 | Bacteria | 1999 |
| 249 | Ga0207640_10559374 | 3300025981 | Bacteria | 962 |
| 250 | Ga0207640_10697903 | 3300025981 | Bacteria | 870 |
| 251 | Ga0207703_10185950 | 3300026035 | Bacteria | 1836 |
| 252 | Ga0207703_10793620 | 3300026035 | Bacteria | 904 |
| 253 | Ga0207703_10936907 | 3300026035 | Bacteria | 830 |
| 254 | Ga0207639_10083671 | 3300026041 | Bacteria | 2533 |
| 255 | Ga0207639_10474219 | 3300026041 | Bacteria | 1140 |
| 256 | Ga0207639_11075956 | 3300026041 | Bacteria | 754 |
| 257 | Ga0207678_10108572 | 3300026067 | Bacteria | 2367 |
| 258 | Ga0207678_10320789 | 3300026067 | Bacteria | 1333 |
| 259 | Ga0207678_10523714 | 3300026067 | Bacteria | 1035 |
| 260 | Ga0207708_10266909 | 3300026075 | Bacteria | 1383 |
| 261 | Ga0207708_11014035 | 3300026075 | Bacteria | 722 |
| 262 | Ga0207708_11056978 | 3300026075 | Bacteria | 707 |
| 263 | Ga0207702_10199328 | 3300026078 | Bacteria | 1854 |
| 264 | Ga0207702_11140681 | 3300026078 | Bacteria | 774 |
| 265 | Ga0207641_10948738 | 3300026088 | Bacteria | 856 |
| 266 | Ga0207648_10971498 | 3300026089 | Bacteria | 795 |
| 267 | Ga0207676_10068992 | 3300026095 | Bacteria | 2830 |
| 268 | Ga0207676_10303918 | 3300026095 | Bacteria | 1458 |
| 269 | Ga0207676_10614898 | 3300026095 | Bacteria | 1045 |
| 270 | Ga0207674_10798510 | 3300026116 | Bacteria | 911 |
| 271 | Ga0207675_100051759 | 3300026118 | Bacteria | 3832 |
| 272 | Ga0207675_100063891 | 3300026118 | Bacteria | 3439 |
| 273 | Ga0207675_101479991 | 3300026118 | Bacteria | 700 |
| 274 | Ga0207675_102147281 | 3300026118 | Bacteria | 574 |
| 275 | Ga0207683_10270017 | 3300026121 | Bacteria | 1554 |
| 276 | Ga0207698_10010680 | 3300026142 | Bacteria | 5920 |
| 277 | Ga0207698_10588334 | 3300026142 | Bacteria | 1096 |
| 278 | Ga0207698_10716120 | 3300026142 | Bacteria | 997 |
| 279 | Ga0207428_10007695 | 3300027907 | Bacteria | 9804 |
| 280 | Ga0207428_10009667 | 3300027907 | Bacteria | 8642 |
| 281 | Ga0207428_10140109 | 3300027907 | Bacteria | 1846 |
| 282 | Ga0268266_10009612 | 3300028379 | Bacteria | 8502 |
| 283 | Ga0268265_10399004 | 3300028380 | Bacteria | 1271 |
| 284 | Ga0265319_1000097 | 3300028563 | Bacteria | 67491 |
| 285 | Ga0265334_10100208 | 3300028573 | Bacteria | 1049 |
| 286 | Ga0265338_10008957 | 3300028800 | Bacteria | 12038 |
| 287 | Ga0265330_10168436 | 3300031235 | Unclassified | 929 |
| 288 | Ga0265320_10026669 | 3300031240 | Bacteria | 3021 |
| 289 | Ga0265320_10036874 | 3300031240 | Bacteria | 2468 |
| 290 | Ga0265339_10155864 | 3300031249 | Bacteria | 1152 |
| 291 | Ga0265331_10035613 | 3300031250 | Bacteria | 2448 |
| 292 | Ga0265316_10010445 | 3300031344 | Bacteria | 8458 |
| 293 | Ga0307408_102250947 | 3300031548 | Bacteria | 527 |
| 294 | Ga0307405_10321368 | 3300031731 | Bacteria | 1182 |
| 295 | Ga0307405_10777308 | 3300031731 | Bacteria | 800 |
| 296 | Ga0307413_10110642 | 3300031824 | Bacteria | 1838 |
| 297 | Ga0307413_10698490 | 3300031824 | Bacteria | 842 |
| 298 | Ga0307410_10393225 | 3300031852 | Bacteria | 1118 |
| 299 | Ga0307410_11617515 | 3300031852 | Bacteria | 573 |
| 300 | Ga0307406_10182790 | 3300031901 | Bacteria | 1528 |
| 301 | Ga0307406_10311237 | 3300031901 | Bacteria | 1214 |
| 302 | Ga0307407_10065365 | 3300031903 | Bacteria | 2141 |
| 303 | Ga0307412_10248490 | 3300031911 | Bacteria | 1380 |
| 304 | Ga0307412_10457644 | 3300031911 | Bacteria | 1053 |
| 305 | Ga0307409_100004882 | 3300031995 | Bacteria | 7624 |
| 306 | Ga0307409_100329332 | 3300031995 | Bacteria | 1433 |
| 307 | Ga0307409_100399676 | 3300031995 | Bacteria | 1312 |
| 308 | Ga0307409_100990518 | 3300031995 | Bacteria | 858 |
| 309 | Ga0307416_100087720 | 3300032002 | Bacteria | 2657 |
| 310 | Ga0307416_100123099 | 3300032002 | Bacteria | 2317 |
| 311 | Ga0307416_100504378 | 3300032002 | Bacteria | 1275 |
| 312 | Ga0307416_100646132 | 3300032002 | Bacteria | 1142 |
| 313 | Ga0307414_10483905 | 3300032004 | Bacteria | 1092 |
| 314 | Ga0307411_10041242 | 3300032005 | Bacteria | 2935 |
| 315 | Ga0307411_10348548 | 3300032005 | Bacteria | 1206 |
| 316 | Ga0307411_10547220 | 3300032005 | Bacteria | 987 |
| 317 | Ga0307411_11078640 | 3300032005 | Bacteria | 723 |
| 318 | Ga0307415_100001467 | 3300032126 | Bacteria | 11289 |
| 319 | Ga0307415_100051622 | 3300032126 | Bacteria | 2792 |
| 320 | Ga0307415_100079264 | 3300032126 | Bacteria | 2339 |
| 321 | Ga0307415_100111304 | 3300032126 | Bacteria | 2032 |
| 322 | Ga0307415_100228450 | 3300032126 | Bacteria | 1497 |
| 323 | Ga0373930_0216654 | 3300034816 | Bacteria | 503 |
| 324 | Ga0373929_0157502 | 3300035085 | Bacteria | 613 |
| 325 | Ga0373932_0057361 | 3300035112 | Bacteria | 1174 |
| 326 | Ga0373939_0027083 | 3300035114 | Bacteria | 1621 |
| 327 | Ga0373960_0026941 | 3300035121 | Bacteria | 1574 |
| 328 | Ga0373962_0073604 | 3300035242 | Bacteria | 1025 |
| 329 | Ga0373931_0133676 | 3300035691 | Bacteria | 1430 |
| 330 | Ga0373925_0409513 | 3300037068 | Bacteria | 1107 |
| 331 | Ga0373925_0909188 | 3300037068 | Bacteria | 725 |
| 332 | Ga0395899_0454778 | 3300037312 | Bacteria | 838 |
| 333 | Ga0395900_0004774 | 3300037418 | Bacteria | 14282 |
| 334 | Ga0395900_0063841 | 3300037418 | Bacteria | 3785 |
| 335 | Ga0395900_0269360 | 3300037418 | Bacteria | 1698 |
| 336 | Ga0395900_0348447 | 3300037418 | Bacteria | 1455 |
| 337 | Ga0395898_0010298 | 3300037466 | Bacteria | 9785 |
| 338 | Ga0395898_0024260 | 3300037466 | Bacteria | 6117 |
| 339 | Ga0395898_0134416 | 3300037466 | Bacteria | 2368 |
| 340 | Ga0395898_0272422 | 3300037466 | Bacteria | 1614 |
| 341 | Ga0395898_0571184 | 3300037466 | Bacteria | 1073 |
| 342 | Ga0395898_1279656 | 3300037466 | Bacteria | 663 |
| 343 | Ga0395905_0021339 | 3300037471 | Bacteria | 6127 |
| 344 | Ga0395905_0135978 | 3300037471 | Bacteria | 2312 |
| 345 | Ga0395905_0154752 | 3300037471 | Bacteria | 2156 |
| 346 | Ga0395905_0337434 | 3300037471 | Bacteria | 1398 |
| 347 | Ga0395905_1141356 | 3300037471 | Bacteria | 683 |
| 348 | Ga0395905_1333057 | 3300037471 | Bacteria | 622 |
| 349 | Ga0436364_0004771 | 3300037853 | Bacteria | 795 |
| 350 | Ga0436364_0030377 | 3300037853 | Bacteria | 2234 |
| 351 | Ga0436364_0080723 | 3300037853 | Bacteria | 513 |
| 352 | Ga0436364_0396681 | 3300037853 | Bacteria | 1622 |
| 353 | Ga0436364_0741604 | 3300037853 | Bacteria | 1512 |
| 354 | Ga0436364_0871788 | 3300037853 | Bacteria | 1426 |
| 355 | Ga0436364_0901605 | 3300037853 | Bacteria | 4171 |
| 356 | Ga0436364_1115546 | 3300037853 | Unclassified | 645 |
| 357 | Ga0436364_1172909 | 3300037853 | Bacteria | 768 |
| 358 | Ga0436364_1215096 | 3300037853 | Bacteria | 1050 |
| 359 | Ga0436364_1243845 | 3300037853 | Bacteria | 41855 |
| 360 | Ga0436364_1341460 | 3300037853 | Bacteria | 2030 |
| 361 | Ga0395901_0011234 | 3300038443 | Bacteria | 9071 |
| 362 | Ga0395901_0018758 | 3300038443 | Bacteria | 7067 |
| 363 | Ga0395901_0046349 | 3300038443 | Bacteria | 4515 |
| 364 | Ga0395901_0076345 | 3300038443 | Bacteria | 3495 |
| 365 | Ga0395901_0382259 | 3300038443 | Bacteria | 1449 |
| 366 | Ga0395901_0507504 | 3300038443 | Bacteria | 1227 |
| 367 | Ga0395901_0970955 | 3300038443 | Bacteria | 827 |
| 368 | Ga0395901_1218065 | 3300038443 | Bacteria | 718 |
| 369 | Ga0395901_2145430 | 3300038443 | Bacteria | 503 |
| 370 | Ga0436365_0056826 | 3300039437 | Bacteria | 1826 |
| 371 | Ga0436365_0246988 | 3300039437 | Unclassified | 686 |
| 372 | Ga0436365_0377309 | 3300039437 | Bacteria | 26799 |
| 373 | Ga0436365_0629338 | 3300039437 | Bacteria | 12277 |
| 374 | Ga0436365_0686509 | 3300039437 | Bacteria | 4330 |
| 375 | Ga0436365_0925381 | 3300039437 | Bacteria | 20601 |
| 376 | Ga0436365_0979777 | 3300039437 | Bacteria | 653 |
| 377 | Ga0436365_1362716 | 3300039437 | Bacteria | 3981 |
| 378 | Ga0436365_1426124 | 3300039437 | Bacteria | 1015 |
| 379 | Ga0436365_1749779 | 3300039437 | Bacteria | 801 |
| 380 | Ga0436360_0783578 | 3300039438 | Bacteria | 2194 |
| 381 | Ga0436361_0135380 | 3300039447 | Bacteria | 691 |
| 382 | Ga0436363_0048403 | 3300039450 | Bacteria | 23056 |
| 383 | Ga0436363_0116001 | 3300039450 | Bacteria | 48959 |
| 384 | Ga0436363_0522014 | 3300039450 | Bacteria | 502 |
| 385 | Ga0436363_0889944 | 3300039450 | Bacteria | 608 |
| 386 | Ga0436363_1138467 | 3300039450 | Bacteria | 7131 |
| 387 | Ga0436363_1237855 | 3300039450 | Bacteria | 828 |
| 388 | Ga0436363_1357623 | 3300039450 | Bacteria | 755 |
| 389 | Ga0436363_1492506 | 3300039450 | Bacteria | 7016 |
| 390 | Ga0436362_0457422 | 3300039453 | Bacteria | 3762 |
| 391 | Ga0436362_0584602 | 3300039453 | Bacteria | 766 |
| 392 | Ga0436362_0701279 | 3300039453 | Bacteria | 599 |
| 393 | Ga0436362_0981668 | 3300039453 | Bacteria | 3311 |
| 394 | Ga0436362_1113699 | 3300039453 | Bacteria | 1412 |
| 395 | Ga0451789_0140835 | 3300041443 | Bacteria | 570 |
| 396 | Ga0451789_0556213 | 3300041443 | Bacteria | 683 |
| 397 | Ga0451793_0641740 | 3300041452 | Bacteria | 872 |
| 398 | Ga0451802_0239322 | 3300041460 | Bacteria | 576 |
| 399 | Ga0451833_0530491 | 3300041491 | Bacteria | 607 |
| 400 | Ga0451839_0688520 | 3300041496 | Bacteria | 627 |
| 401 | Ga0451839_1509325 | 3300041496 | Bacteria | 699 |
| 402 | Ga0451847_0823104 | 3300041503 | Bacteria | 713 |
| 403 | Ga0451853_0405189 | 3300041512 | Bacteria | 634 |
| 404 | Ga0451853_2806980 | 3300041512 | Bacteria | 1186 |
| 405 | Ga0439456_044439 | 3300042013 | Bacteria | 966 |
| 406 | Ga0466969_0022458 | 3300044656 | Bacteria | 3256 |
| 407 | Ga0466972_0374120 | 3300044658 | Bacteria | 667 |
| 408 | Ga0466965_0182485 | 3300044683 | Bacteria | 1107 |
| 409 | Ga0466965_0530780 | 3300044683 | Bacteria | 663 |
| 410 | Ga0466966_0072552 | 3300044684 | Bacteria | 2155 |
| 411 | Ga0466966_0119859 | 3300044684 | Bacteria | 1617 |
| 412 | Ga0466961_0100396 | 3300044693 | Bacteria | 1823 |
| 413 | Ga0466961_0271386 | 3300044693 | Bacteria | 1039 |
| 414 | Ga0466961_0356705 | 3300044693 | Bacteria | 890 |
| 415 | Ga0466963_0025323 | 3300044694 | Bacteria | 3783 |
| 416 | Ga0466963_0038967 | 3300044694 | Bacteria | 3110 |
| 417 | Ga0466963_0163567 | 3300044694 | Bacteria | 1550 |
| 418 | Ga0466964_0328872 | 3300044706 | Bacteria | 779 |
| 419 | Ga0466964_0353920 | 3300044706 | Bacteria | 755 |
| 420 | Ga0466971_0007903 | 3300044719 | Bacteria | 4633 |
| 421 | Ga0466971_0502270 | 3300044719 | Bacteria | 599 |
| 422 | Ga0466968_0075108 | 3300044735 | Bacteria | 1477 |
| 423 | Ga0466970_0108101 | 3300044765 | Bacteria | 1518 |
| 424 | Ga0466957_0031049 | 3300044842 | Bacteria | 3192 |
| 425 | Ga0466957_0041883 | 3300044842 | Bacteria | 2769 |
| 426 | Ga0466960_0292997 | 3300044901 | Bacteria | 915 |
| 427 | Ga0466959_0002562 | 3300045049 | Bacteria | 11666 |
| 428 | Ga0466959_0056212 | 3300045049 | Bacteria | 2872 |
| 429 | Ga0466959_0192572 | 3300045049 | Bacteria | 1422 |
| 430 | Ga0466959_0252885 | 3300045049 | Bacteria | 1215 |
| 431 | Ga0466959_0554167 | 3300045049 | Bacteria | 775 |
| 432 | Ga0466958_0000390 | 3300045836 | Bacteria | 17922 |
| 433 | Ga0466958_0008361 | 3300045836 | Bacteria | 5736 |
| 434 | Ga0466958_0016389 | 3300045836 | Bacteria | 4267 |
| 435 | Ga0466958_0017509 | 3300045836 | Bacteria | 4144 |
| 436 | Ga0466958_0073362 | 3300045836 | Bacteria | 2096 |
| 437 | Ga0466958_0085389 | 3300045836 | Bacteria | 1947 |
| 438 | Ga0466958_0570142 | 3300045836 | Bacteria | 736 |
| 439 | Ga0466967_0018136 | 3300045976 | Bacteria | 5615 |
| 440 | Ga0466967_0018566 | 3300045976 | Bacteria | 5562 |
| 441 | Ga0466967_0136661 | 3300045976 | Bacteria | 2280 |
| 442 | Ga0466967_0203668 | 3300045976 | Bacteria | 1875 |
| 443 | Ga0466967_0516030 | 3300045976 | Bacteria | 1174 |
| 444 | Ga0466967_0520308 | 3300045976 | Bacteria | 1169 |
| 445 | Ga0466967_0558035 | 3300045976 | Bacteria | 1128 |
| 446 | Ga0466967_1210043 | 3300045976 | Bacteria | 753 |
| 447 | Ga0466967_1973643 | 3300045976 | Bacteria | 580 |
| 448 | Ga0466967_2297668 | 3300045976 | Bacteria | 535 |
| 449 | Ga0495591_126008 | 3300046458 | Bacteria | 623 |
| 450 | Ga0495650_0000035 | 3300046471 | Bacteria | 403799 |
| 451 | Ga0495580_0192297 | 3300046472 | Bacteria | 1407 |
| 452 | Ga0495664_0315387 | 3300046477 | Bacteria | 943 |
| 453 | Ga0495596_0051722 | 3300046500 | Bacteria | 1609 |
| 454 | Ga0495596_0082243 | 3300046500 | Bacteria | 1250 |
| 455 | Ga0495596_0124409 | 3300046500 | Bacteria | 1001 |
| 456 | Ga0495631_0238232 | 3300046518 | Bacteria | 776 |
| 457 | Ga0495652_0156606 | 3300046529 | Bacteria | 1773 |
| 458 | Ga0495586_0199568 | 3300046535 | Bacteria | 1134 |
| 459 | Ga0495645_0000021 | 3300046543 | Bacteria | 137604 |
| 460 | Ga0495645_0467011 | 3300046543 | Bacteria | 794 |
| 461 | Ga0495656_0162620 | 3300046615 | Bacteria | 1086 |
| 462 | Ga0495611_0125972 | 3300046648 | Bacteria | 1195 |
| 463 | Ga0495588_0576341 | 3300046674 | Bacteria | 590 |
| 464 | Ga0495646_0208112 | 3300046680 | Bacteria | 1063 |
| 465 | Ga0495589_0455424 | 3300046794 | Bacteria | 585 |
| 466 | Ga0495589_0490143 | 3300046794 | Bacteria | 561 |
| 467 | Ga0495676_0434319 | 3300047321 | Bacteria | 868 |
| 468 | Ga0495685_209504 | 3300047447 | Bacteria | 624 |
| 469 | Ga0496100_0080961 | 3300048903 | Bacteria | 2193 |
| 470 | Ga0496100_0388679 | 3300048903 | Bacteria | 1061 |
| 471 | Ga0496100_0840347 | 3300048903 | Bacteria | 720 |
| 472 | Ga0496100_1094920 | 3300048903 | Bacteria | 628 |
| 473 | Ga0496101_0019094 | 3300048904 | Bacteria | 4673 |
| 474 | Ga0496101_0750386 | 3300048904 | Bacteria | 770 |
| 475 | Ga0496102_0188959 | 3300048905 | Bacteria | 1941 |
| 476 | Ga0496102_0293644 | 3300048905 | Bacteria | 1532 |
| 477 | Ga0496102_0314905 | 3300048905 | Bacteria | 1474 |
| 478 | Ga0496102_0683732 | 3300048905 | Bacteria | 949 |
| 479 | Ga0496102_0702416 | 3300048905 | Bacteria | 934 |
| 480 | Ga0496102_0771461 | 3300048905 | Bacteria | 884 |
| 481 | Ga0496102_0958199 | 3300048905 | Bacteria | 777 |
| 482 | Ga0496102_1890432 | 3300048905 | Bacteria | 514 |
| 483 | Ga0496103_0655064 | 3300048906 | Bacteria | 667 |
| 484 | Ga0496104_0073599 | 3300048907 | Bacteria | 3250 |
| 485 | Ga0496104_0356471 | 3300048907 | Bacteria | 1375 |
| 486 | Ga0496104_0585175 | 3300048907 | Bacteria | 1026 |
| 487 | Ga0496104_0620841 | 3300048907 | Bacteria | 991 |
| 488 | Ga0496104_0902804 | 3300048907 | Bacteria | 788 |
| 489 | Ga0496105_0082828 | 3300048908 | Bacteria | 2649 |
| 490 | Ga0496105_0257842 | 3300048908 | Bacteria | 1411 |
| 491 | Ga0496105_0541784 | 3300048908 | Bacteria | 909 |
| 492 | Ga0496106_0377939 | 3300048909 | Bacteria | 1138 |
| 493 | Ga0496106_0993567 | 3300048909 | Bacteria | 660 |
| 494 | Ga0496107_0285475 | 3300048910 | Bacteria | 1228 |
| 495 | Ga0496107_0359022 | 3300048910 | Bacteria | 1084 |
| 496 | Ga0496107_0812916 | 3300048910 | Bacteria | 684 |
| 497 | Ga0496108_0101040 | 3300048911 | Bacteria | 2460 |
| 498 | Ga0496108_0266088 | 3300048911 | Bacteria | 1492 |
| 499 | Ga0496108_0574922 | 3300048911 | Bacteria | 982 |
| 500 | Ga0496108_0666013 | 3300048911 | Bacteria | 904 |
| 501 | Ga0496108_0770631 | 3300048911 | Bacteria | 831 |
| 502 | Ga0496108_0817843 | 3300048911 | Bacteria | 803 |
| 503 | Ga0496109_0030445 | 3300048912 | Bacteria | 4837 |
| 504 | Ga0496109_0160082 | 3300048912 | Bacteria | 2109 |
| 505 | Ga0496109_0285287 | 3300048912 | Bacteria | 1556 |
| 506 | Ga0496109_0391092 | 3300048912 | Bacteria | 1314 |
| 507 | Ga0496109_0422619 | 3300048912 | Bacteria | 1259 |
| 508 | Ga0496109_0680175 | 3300048912 | Bacteria | 966 |
| 509 | Ga0496109_0830318 | 3300048912 | Bacteria | 862 |
| 510 | Ga0496110_0049120 | 3300048913 | Bacteria | 3700 |
| 511 | Ga0496110_0239922 | 3300048913 | Bacteria | 1649 |
| 512 | Ga0496110_0241456 | 3300048913 | Bacteria | 1644 |
| 513 | Ga0496110_0441955 | 3300048913 | Bacteria | 1185 |
| 514 | Ga0496110_0851979 | 3300048913 | Bacteria | 817 |
| 515 | Ga0496110_1300747 | 3300048913 | Bacteria | 636 |
| 516 | Ga0496111_0123371 | 3300048914 | Bacteria | 1914 |
| 517 | Ga0496111_0158792 | 3300048914 | Bacteria | 1678 |
| 518 | Ga0496111_0508593 | 3300048914 | Bacteria | 886 |
| 519 | Ga0496111_0917221 | 3300048914 | Bacteria | 630 |
| 520 | Ga0496112_0098448 | 3300048915 | Bacteria | 2894 |
| 521 | Ga0496112_0135049 | 3300048915 | Bacteria | 2437 |
| 522 | Ga0496112_0142067 | 3300048915 | Bacteria | 2370 |
| 523 | Ga0496112_0170265 | 3300048915 | Bacteria | 2143 |
| 524 | Ga0496112_0258625 | 3300048915 | Bacteria | 1691 |
| 525 | Ga0496112_0304069 | 3300048915 | Bacteria | 1540 |
| 526 | Ga0496112_0465692 | 3300048915 | Bacteria | 1201 |
| 527 | Ga0496113_0081128 | 3300048916 | Bacteria | 2486 |
| 528 | Ga0496113_0177392 | 3300048916 | Bacteria | 1688 |
| 529 | Ga0496113_0347887 | 3300048916 | Bacteria | 1189 |
| 530 | Ga0496113_1214819 | 3300048916 | Bacteria | 588 |
| 531 | Ga0496114_0030344 | 3300048917 | Bacteria | 4448 |
| 532 | Ga0496114_0130988 | 3300048917 | Bacteria | 2166 |
| 533 | Ga0496114_0812047 | 3300048917 | Bacteria | 814 |
| 534 | Ga0496115_1221897 | 3300048918 | Bacteria | 564 |
| 535 | Ga0496117_0310934 | 3300048920 | Bacteria | 830 |
| 536 | Ga0496118_0289160 | 3300048921 | Bacteria | 907 |
| 537 | Ga0496121_0002418 | 3300048924 | Bacteria | 28600 |
| 538 | Ga0496121_0096566 | 3300048924 | Bacteria | 2293 |
| 539 | Ga0496126_0493732 | 3300048929 | Bacteria | 979 |
| 540 | Ga0501307_082546 | 3300049162 | Bacteria | 527 |
| 541 | Ga0501312_120312 | 3300049528 | Bacteria | 507 |
| 542 | Ga0501317_025142 | 3300049533 | Bacteria | 832 |
| 543 | Ga0501318_028572 | 3300049534 | Bacteria | 747 |
| 544 | Ga0501321_065047 | 3300049537 | Bacteria | 558 |
| 545 | Ga0501031_0000110 | 3300049568 | Bacteria | 43369 |
| 546 | Ga0501031_0001029 | 3300049568 | Bacteria | 16912 |
| 547 | Ga0501031_0008013 | 3300049568 | Bacteria | 6878 |
| 548 | Ga0501031_0301511 | 3300049568 | Bacteria | 1038 |
| 549 | Ga0501031_0359284 | 3300049568 | Bacteria | 942 |
| 550 | Ga0501031_0708328 | 3300049568 | Bacteria | 646 |
| 551 | Ga0501032_0002593 | 3300049569 | Bacteria | 14144 |
| 552 | Ga0501032_0013542 | 3300049569 | Bacteria | 5797 |
| 553 | Ga0501032_0091631 | 3300049569 | Bacteria | 2016 |
| 554 | Ga0501032_0255208 | 3300049569 | Bacteria | 1138 |
| 555 | Ga0501033_0000920 | 3300049570 | Bacteria | 26908 |
| 556 | Ga0501033_0167440 | 3300049570 | Bacteria | 1579 |
| 557 | Ga0501033_0446248 | 3300049570 | Bacteria | 899 |
| 558 | Ga0501034_0401251 | 3300049571 | Bacteria | 1294 |
| 559 | Ga0501034_0819378 | 3300049571 | Bacteria | 822 |
| 560 | Ga0501034_1569484 | 3300049571 | Bacteria | 531 |
| 561 | Ga0501036_0009055 | 3300049572 | Bacteria | 8187 |
| 562 | Ga0501036_0009848 | 3300049572 | Bacteria | 7867 |
| 563 | Ga0501036_0010718 | 3300049572 | Bacteria | 7576 |
| 564 | Ga0501036_0969446 | 3300049572 | Bacteria | 696 |
| 565 | Ga0501036_1070728 | 3300049572 | Bacteria | 659 |
| 566 | Ga0501037_0000519 | 3300049573 | Bacteria | 30933 |
| 567 | Ga0501037_0077066 | 3300049573 | Bacteria | 2419 |
| 568 | Ga0501037_0163053 | 3300049573 | Bacteria | 1588 |
| 569 | Ga0501037_0213037 | 3300049573 | Bacteria | 1362 |
| 570 | Ga0501037_0225487 | 3300049573 | Bacteria | 1317 |
| 571 | Ga0501037_0684599 | 3300049573 | Bacteria | 683 |
| 572 | Ga0501038_0002971 | 3300049574 | Bacteria | 15803 |
| 573 | Ga0501038_0013567 | 3300049574 | Bacteria | 7425 |
| 574 | Ga0501038_0048444 | 3300049574 | Bacteria | 3677 |
| 575 | Ga0501038_0129622 | 3300049574 | Bacteria | 2072 |
| 576 | Ga0501039_0005307 | 3300049575 | Bacteria | 9744 |
| 577 | Ga0501039_0010620 | 3300049575 | Bacteria | 7016 |
| 578 | Ga0501039_0018960 | 3300049575 | Bacteria | 5280 |
| 579 | Ga0501039_0021617 | 3300049575 | Bacteria | 4936 |
| 580 | Ga0501039_0042160 | 3300049575 | Bacteria | 3526 |
| 581 | Ga0501039_0139133 | 3300049575 | Bacteria | 1907 |
| 582 | Ga0501039_0159891 | 3300049575 | Bacteria | 1770 |
| 583 | Ga0501040_0000149 | 3300049576 | Bacteria | 38433 |
| 584 | Ga0501040_0000605 | 3300049576 | Bacteria | 21929 |
| 585 | Ga0501040_0009383 | 3300049576 | Bacteria | 6375 |
| 586 | Ga0501040_0010866 | 3300049576 | Bacteria | 5952 |
| 587 | Ga0501040_0012892 | 3300049576 | Bacteria | 5491 |
| 588 | Ga0501040_0099693 | 3300049576 | Bacteria | 2025 |
| 589 | Ga0501040_0154634 | 3300049576 | Bacteria | 1619 |
| 590 | Ga0501040_0208691 | 3300049576 | Bacteria | 1388 |
| 591 | Ga0501040_0571149 | 3300049576 | Bacteria | 816 |
| 592 | Ga0501040_0767355 | 3300049576 | Bacteria | 698 |
| 593 | Ga0501041_0000695 | 3300049577 | Bacteria | 17865 |
| 594 | Ga0501041_0006732 | 3300049577 | Bacteria | 6736 |
| 595 | Ga0501041_0054595 | 3300049577 | Bacteria | 2437 |
| 596 | Ga0501041_0097179 | 3300049577 | Bacteria | 1821 |
| 597 | Ga0501041_0124234 | 3300049577 | Bacteria | 1605 |
| 598 | Ga0501041_0127195 | 3300049577 | Bacteria | 1586 |
| 599 | Ga0501041_0599821 | 3300049577 | Bacteria | 703 |
| 600 | Ga0501042_0000013 | 3300049578 | Bacteria | 53996 |
| 601 | Ga0501042_0001965 | 3300049578 | Bacteria | 12373 |
| 602 | Ga0501042_0008702 | 3300049578 | Bacteria | 6731 |
| 603 | Ga0501042_0011094 | 3300049578 | Bacteria | 6069 |
| 604 | Ga0501042_0174346 | 3300049578 | Bacteria | 1551 |
| 605 | Ga0501042_0333984 | 3300049578 | Bacteria | 1095 |
| 606 | Ga0501043_0001920 | 3300049579 | Bacteria | 17801 |
| 607 | Ga0501043_0012580 | 3300049579 | Bacteria | 6617 |
| 608 | Ga0501043_0037712 | 3300049579 | Bacteria | 3800 |
| 609 | Ga0501043_0157759 | 3300049579 | Bacteria | 1774 |
| 610 | Ga0501043_0255464 | 3300049579 | Bacteria | 1349 |
| 611 | Ga0501043_0640510 | 3300049579 | Bacteria | 781 |
| 612 | Ga0501046_0000177 | 3300049580 | Bacteria | 65024 |
| 613 | Ga0501046_0003529 | 3300049580 | Bacteria | 14324 |
| 614 | Ga0501046_0025301 | 3300049580 | Bacteria | 4859 |
| 615 | Ga0501046_0194086 | 3300049580 | Bacteria | 1514 |
| 616 | Ga0501046_0345491 | 3300049580 | Bacteria | 1081 |
| 617 | Ga0501047_0047657 | 3300049581 | Bacteria | 4139 |
| 618 | Ga0501047_0056401 | 3300049581 | Bacteria | 3798 |
| 619 | Ga0501048_0000042 | 3300049582 | Bacteria | 62023 |
| 620 | Ga0501048_0008646 | 3300049582 | Bacteria | 7680 |
| 621 | Ga0501048_0009610 | 3300049582 | Bacteria | 7256 |
| 622 | Ga0501048_0010708 | 3300049582 | Bacteria | 6839 |
| 623 | Ga0501048_0059411 | 3300049582 | Bacteria | 2709 |
| 624 | Ga0501048_0074928 | 3300049582 | Bacteria | 2388 |
| 625 | Ga0501048_0091431 | 3300049582 | Bacteria | 2146 |
| 626 | Ga0501067_0006213 | 3300049583 | Bacteria | 6621 |
| 627 | Ga0501067_0039753 | 3300049583 | Bacteria | 2611 |
| 628 | Ga0501068_0000051 | 3300049584 | Bacteria | 45579 |
| 629 | Ga0501068_0030531 | 3300049584 | Bacteria | 3197 |
| 630 | Ga0501068_0041886 | 3300049584 | Bacteria | 2753 |
| 631 | Ga0501068_0045622 | 3300049584 | Bacteria | 2640 |
| 632 | Ga0501068_0505631 | 3300049584 | Bacteria | 784 |
| 633 | Ga0501069_0006340 | 3300049585 | Bacteria | 6183 |
| 634 | Ga0501069_0009216 | 3300049585 | Bacteria | 5206 |
| 635 | Ga0501069_0011434 | 3300049585 | Bacteria | 4701 |
| 636 | Ga0501069_0058019 | 3300049585 | Bacteria | 2159 |
| 637 | Ga0501069_0292862 | 3300049585 | Bacteria | 954 |
| 638 | Ga0501070_0006578 | 3300049586 | Bacteria | 9892 |
| 639 | Ga0501070_0190159 | 3300049586 | Bacteria | 1688 |
| 640 | Ga0501070_0265383 | 3300049586 | Bacteria | 1403 |
| 641 | Ga0501070_0342970 | 3300049586 | Bacteria | 1213 |
| 642 | Ga0501070_0455950 | 3300049586 | Bacteria | 1030 |
| 643 | Ga0501070_0787616 | 3300049586 | Bacteria | 747 |
| 644 | Ga0501070_0979584 | 3300049586 | Bacteria | 656 |
| 645 | Ga0501071_0000031 | 3300049587 | Bacteria | 47260 |
| 646 | Ga0501071_0001902 | 3300049587 | Bacteria | 12432 |
| 647 | Ga0501071_0028671 | 3300049587 | Bacteria | 3924 |
| 648 | Ga0501071_0061757 | 3300049587 | Bacteria | 2714 |
| 649 | Ga0501071_0093183 | 3300049587 | Bacteria | 2215 |
| 650 | Ga0501071_0190553 | 3300049587 | Bacteria | 1538 |
| 651 | Ga0501071_0273817 | 3300049587 | Bacteria | 1277 |
| 652 | Ga0501071_0398754 | 3300049587 | Bacteria | 1050 |
| 653 | Ga0501071_0463983 | 3300049587 | Bacteria | 970 |
| 654 | Ga0501072_0000260 | 3300049588 | Bacteria | 38663 |
| 655 | Ga0501072_0000465 | 3300049588 | Bacteria | 29220 |
| 656 | Ga0501072_0000950 | 3300049588 | Bacteria | 21351 |
| 657 | Ga0501072_0060605 | 3300049588 | Bacteria | 2983 |
| 658 | Ga0501072_0096619 | 3300049588 | Bacteria | 2347 |
| 659 | Ga0501072_0117660 | 3300049588 | Bacteria | 2117 |
| 660 | Ga0501072_0332742 | 3300049588 | Bacteria | 1206 |
| 661 | Ga0501072_0731973 | 3300049588 | Bacteria | 776 |
| 662 | Ga0501073_0002772 | 3300049589 | Bacteria | 13121 |
| 663 | Ga0501073_0068788 | 3300049589 | Bacteria | 2467 |
| 664 | Ga0501073_0088020 | 3300049589 | Bacteria | 2159 |
| 665 | Ga0501073_0401842 | 3300049589 | Bacteria | 946 |
| 666 | Ga0501074_0005531 | 3300049590 | Bacteria | 9088 |
| 667 | Ga0501074_0015271 | 3300049590 | Bacteria | 5581 |
| 668 | Ga0501074_0024223 | 3300049590 | Bacteria | 4411 |
| 669 | Ga0501074_0042186 | 3300049590 | Bacteria | 3301 |
| 670 | Ga0501074_0055663 | 3300049590 | Bacteria | 2850 |
| 671 | Ga0501074_0384636 | 3300049590 | Bacteria | 995 |
| 672 | Ga0501074_0423276 | 3300049590 | Bacteria | 944 |
| 673 | Ga0501074_0647617 | 3300049590 | Bacteria | 746 |
| 674 | Ga0501075_0000032 | 3300049591 | Bacteria | 56088 |
| 675 | Ga0501075_0000266 | 3300049591 | Bacteria | 28552 |
| 676 | Ga0501075_0026654 | 3300049591 | Bacteria | 4257 |
| 677 | Ga0501075_0030659 | 3300049591 | Bacteria | 3984 |
| 678 | Ga0501075_0100423 | 3300049591 | Bacteria | 2197 |
| 679 | Ga0501075_0151277 | 3300049591 | Bacteria | 1769 |
| 680 | Ga0501075_0174901 | 3300049591 | Bacteria | 1638 |
| 681 | Ga0501075_0915656 | 3300049591 | Bacteria | 666 |
| 682 | Ga0501076_0000195 | 3300049592 | Bacteria | 36390 |
| 683 | Ga0501076_0001745 | 3300049592 | Bacteria | 14699 |
| 684 | Ga0501076_0003830 | 3300049592 | Bacteria | 10594 |
| 685 | Ga0501076_0027659 | 3300049592 | Bacteria | 4398 |
| 686 | Ga0501076_0039015 | 3300049592 | Bacteria | 3728 |
| 687 | Ga0501076_0043421 | 3300049592 | Bacteria | 3542 |
| 688 | Ga0501076_0115334 | 3300049592 | Bacteria | 2174 |
| 689 | Ga0501076_0355667 | 3300049592 | Bacteria | 1203 |
| 690 | Ga0501076_0675481 | 3300049592 | Bacteria | 852 |
| 691 | Ga0501077_0000257 | 3300049593 | Bacteria | 31357 |
| 692 | Ga0501077_0005655 | 3300049593 | Bacteria | 7619 |
| 693 | Ga0501077_0008277 | 3300049593 | Bacteria | 6433 |
| 694 | Ga0501077_0024371 | 3300049593 | Bacteria | 3842 |
| 695 | Ga0501077_0052953 | 3300049593 | Bacteria | 2576 |
| 696 | Ga0501077_0190559 | 3300049593 | Bacteria | 1303 |
| 697 | Ga0501077_0521449 | 3300049593 | Bacteria | 762 |
| 698 | Ga0501077_0589942 | 3300049593 | Bacteria | 713 |
| 699 | Ga0501079_0000749 | 3300049741 | Bacteria | 22070 |
| 700 | Ga0501079_0011634 | 3300049741 | Bacteria | 6719 |
| 701 | Ga0501079_0016893 | 3300049741 | Bacteria | 5573 |
| 702 | Ga0501079_0047508 | 3300049741 | Bacteria | 3311 |
| 703 | Ga0501079_0143423 | 3300049741 | Bacteria | 1861 |
| 704 | Ga0501079_0179684 | 3300049741 | Bacteria | 1651 |
| 705 | Ga0501079_0460738 | 3300049741 | Bacteria | 998 |
| 706 | Ga0501079_0526340 | 3300049741 | Bacteria | 929 |
| 707 | Ga0501079_0586052 | 3300049741 | Bacteria | 877 |
| 708 | Ga0501080_0000105 | 3300049742 | Bacteria | 57665 |
| 709 | Ga0501080_0030475 | 3300049742 | Bacteria | 5025 |
| 710 | Ga0501080_0102221 | 3300049742 | Bacteria | 2659 |
| 711 | Ga0501080_0793233 | 3300049742 | Bacteria | 831 |
| 712 | Ga0501080_1046182 | 3300049742 | Bacteria | 706 |
| 713 | Ga0501081_0000691 | 3300049743 | Bacteria | 19472 |
| 714 | Ga0501081_0001230 | 3300049743 | Bacteria | 15579 |
| 715 | Ga0501081_0008744 | 3300049743 | Bacteria | 6582 |
| 716 | Ga0501081_0017489 | 3300049743 | Bacteria | 4747 |
| 717 | Ga0501081_0036932 | 3300049743 | Bacteria | 3332 |
| 718 | Ga0501083_0000081 | 3300049744 | Bacteria | 64501 |
| 719 | Ga0501083_0060437 | 3300049744 | Bacteria | 2531 |
| 720 | Ga0501083_0060770 | 3300049744 | Bacteria | 2524 |
| 721 | Ga0501083_0225394 | 3300049744 | Bacteria | 1221 |
| 722 | Ga0501083_0354404 | 3300049744 | Bacteria | 954 |
| 723 | Ga0501083_0657783 | 3300049744 | Bacteria | 681 |
| 724 | Ga0501283_084547 | 3300049779 | Bacteria | 601 |
| 725 | Ga0501035_0019615 | 3300049822 | Bacteria | 6213 |
| 726 | Ga0501035_0020439 | 3300049822 | Bacteria | 6080 |
| 727 | Ga0501035_0050590 | 3300049822 | Bacteria | 3723 |
| 728 | Ga0501035_0119800 | 3300049822 | Bacteria | 2301 |
| 729 | Ga0501035_0284169 | 3300049822 | Bacteria | 1398 |
| 730 | Ga0501035_0475416 | 3300049822 | Bacteria | 1031 |
| 731 | Ga0501044_0086637 | 3300049823 | Bacteria | 3163 |
| 732 | Ga0501044_0090376 | 3300049823 | Bacteria | 3089 |
| 733 | Ga0501044_0207151 | 3300049823 | Bacteria | 1917 |
| 734 | Ga0501044_0233557 | 3300049823 | Bacteria | 1785 |
| 735 | Ga0501044_0523920 | 3300049823 | Bacteria | 1085 |
| 736 | Ga0501045_0000251 | 3300049824 | Bacteria | 30848 |
| 737 | Ga0501045_0001160 | 3300049824 | Bacteria | 17470 |
| 738 | Ga0501045_0001843 | 3300049824 | Bacteria | 14321 |
| 739 | Ga0501045_0033780 | 3300049824 | Bacteria | 3710 |
| 740 | Ga0501045_0065496 | 3300049824 | Bacteria | 2667 |
| 741 | Ga0501045_0071628 | 3300049824 | Bacteria | 2551 |
| 742 | Ga0501045_0197935 | 3300049824 | Bacteria | 1497 |
| 743 | Ga0501045_0357746 | 3300049824 | Bacteria | 1086 |
| 744 | nmdc:mga0yw44_1043433_c1 | 3300050492 | Bacteria | 553 |
| 745 | nmdc:mga05p37_174736_c1 | 3300050507 | Bacteria | 2618 |
| 746 | nmdc:mga05p37_601_c1 | 3300050507 | Bacteria | 39708 |
| 747 | nmdc:mga09592_494883_c1 | 3300050508 | Bacteria | 1053 |
| 748 | nmdc:mga09592_85491_c1 | 3300050508 | Bacteria | 2691 |
| 749 | nmdc:mga0qj67_679236_c1 | 3300050509 | Bacteria | 820 |
| 750 | nmdc:mga0qj67_80129_c1 | 3300050509 | Bacteria | 2616 |
| 751 | nmdc:mga06r32_1039226_c1 | 3300050510 | Bacteria | 770 |
| 752 | nmdc:mga06r32_112492_c1 | 3300050510 | Bacteria | 2679 |
| 753 | nmdc:mga06r32_157746_c1 | 3300050510 | Bacteria | 2251 |
| 754 | nmdc:mga06r32_698689_c1 | 3300050510 | Bacteria | 980 |
| 755 | nmdc:mga08y16_175117_c1 | 3300050511 | Bacteria | 2228 |
| 756 | nmdc:mga08y16_224746_c1 | 3300050511 | Bacteria | 1943 |
| 757 | nmdc:mga08y16_368826_c1 | 3300050511 | Bacteria | 1473 |
| 758 | nmdc:mga08y16_66597_c1 | 3300050511 | Bacteria | 3759 |
| 759 | nmdc:mga0n895_1184425_c1 | 3300050512 | Bacteria | 738 |
| 760 | nmdc:mga0a205_1139612_c1 | 3300050515 | Bacteria | 627 |
| 761 | nmdc:mga0a205_114467_c1 | 3300050515 | Bacteria | 2596 |
| 762 | nmdc:mga0a205_583408_c1 | 3300050515 | Bacteria | 972 |
| 763 | Ga0495655_0038525 | 3300053083 | Bacteria | 1207 |
| 764 | Ga0495655_0069115 | 3300053083 | Bacteria | 983 |
| 765 | Ga0495655_0194494 | 3300053083 | Bacteria | 660 |
| 766 | Ga0500588_0260216 | 3300053146 | Bacteria | 653 |
| 767 | Ga0500616_0005292 | 3300053153 | Bacteria | 8809 |
| 768 | Ga0501084_0000995 | 3300054114 | Bacteria | 22022 |
| 769 | Ga0501084_0001035 | 3300054114 | Bacteria | 21607 |
| 770 | Ga0501084_0001602 | 3300054114 | Bacteria | 17929 |
| 771 | Ga0501084_0016686 | 3300054114 | Bacteria | 6099 |
| 772 | Ga0501084_0028523 | 3300054114 | Bacteria | 4666 |
| 773 | Ga0501084_0304376 | 3300054114 | Bacteria | 1346 |
| 774 | Ga0501084_0336705 | 3300054114 | Bacteria | 1275 |
| 775 | Ga0501084_0345153 | 3300054114 | Bacteria | 1257 |
| 776 | Ga0501084_0353888 | 3300054114 | Bacteria | 1240 |
| 777 | Ga0590071_050409 | 3300059421 | Bacteria | 1009 |
| 778 | Ga0590077_097541 | 3300059426 | Bacteria | 686 |
| 779 | Ga0587070_170148 | 3300059491 | Bacteria | 560 |
| 780 | Ga0587082_102320 | 3300059504 | Bacteria | 626 |
| 781 | Ga0587083_0104451 | 3300059505 | Bacteria | 710 |
| 782 | Ga0587088_106084 | 3300059508 | Bacteria | 633 |
| 783 | Ga0587094_065064 | 3300059513 | Bacteria | 646 |
| 784 | Ga0587069_082382 | 3300059642 | Bacteria | 630 |
| 785 | Ga0587076_079530 | 3300059645 | Bacteria | 697 |
| 786 | Ga0501082_0002033 | 3300060353 | Bacteria | 17790 |
| 787 | Ga0501082_0002542 | 3300060353 | Bacteria | 15978 |
| 788 | Ga0501082_0007967 | 3300060353 | Bacteria | 9144 |
| 789 | Ga0501082_0008023 | 3300060353 | Bacteria | 9113 |
| 790 | Ga0501082_0017121 | 3300060353 | Bacteria | 6244 |
| 791 | Ga0501082_0063916 | 3300060353 | Bacteria | 3169 |
| 792 | Ga0501082_0065211 | 3300060353 | Bacteria | 3136 |
| 793 | Ga0501082_0106426 | 3300060353 | Bacteria | 2427 |
| 794 | Ga0501082_0206490 | 3300060353 | Bacteria | 1709 |
| 795 | Ga0501082_0506207 | 3300060353 | Bacteria | 1055 |
| 796 | Ga0501082_0645165 | 3300060353 | Bacteria | 926 |
| 797 | Ga0466962_0000616 | 3300061719 | Bacteria | 15791 |
| 798 | Ga0530510_0000155 | 3300061734 | Bacteria | 40902 |
| 799 | Ga0530510_0000483 | 3300061734 | Bacteria | 25575 |
| 800 | Ga0530510_0006704 | 3300061734 | Bacteria | 8028 |
| 801 | Ga0530510_0019946 | 3300061734 | Bacteria | 4764 |
| 802 | Ga0530510_0069096 | 3300061734 | Bacteria | 2563 |
| 803 | Ga0530510_0372296 | 3300061734 | Bacteria | 1074 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041496 | Ga0451839_0688520 | Ga0451839_0688520_151_579 | 136 |
| 2 | 3300012513 | Ga0157326_1067527 | Ga0157326_10675271 | 137 |
| 3 | 3300013296 | Ga0157374_12391395 | Ga0157374_123913951 | 140 |
| 4 | 3300026088 | Ga0207641_10948738 | Ga0207641_109487381 | 140 |
| 5 | 3300046543 | Ga0495645_0000021 | Ga0495645_0000021_118352_118774 | 140 |
| 6 | 3300005366 | Ga0070659_100792790 | Ga0070659_1007927902 | 142 |
| 7 | 3300009176 | Ga0105242_11136904 | Ga0105242_111369041 | 142 |
| 8 | 3300031235 | Ga0265330_10168436 | Ga0265330_101684362 | 142 |
| 9 | 3300031240 | Ga0265320_10036874 | Ga0265320_100368743 | 142 |
| 10 | 3300031249 | Ga0265339_10155864 | Ga0265339_101558641 | 142 |
| 11 | 3300031250 | Ga0265331_10035613 | Ga0265331_100356133 | 142 |
| 12 | 3300031344 | Ga0265316_10010445 | Ga0265316_100104456 | 142 |
| 13 | 3300049568 | Ga0501031_0000110 | Ga0501031_0000110_104_532 | 142 |
| 14 | 3300049568 | Ga0501031_0359284 | Ga0501031_0359284_386_814 | 142 |
| 15 | 3300049569 | Ga0501032_0002593 | Ga0501032_0002593_7211_7639 | 142 |
| 16 | 3300049570 | Ga0501033_0000920 | Ga0501033_0000920_4741_5169 | 142 |
| 17 | 3300049571 | Ga0501034_0819378 | Ga0501034_0819378_121_549 | 142 |
| 18 | 3300049571 | Ga0501034_1569484 | Ga0501034_1569484_72_500 | 142 |
| 19 | 3300049572 | Ga0501036_0009055 | Ga0501036_0009055_351_779 | 142 |
| 20 | 3300049572 | Ga0501036_0969446 | Ga0501036_0969446_52_480 | 142 |
| 21 | 3300049573 | Ga0501037_0000519 | Ga0501037_0000519_13399_13827 | 142 |
| 22 | 3300049573 | Ga0501037_0163053 | Ga0501037_0163053_402_830 | 142 |
| 23 | 3300049574 | Ga0501038_0002971 | Ga0501038_0002971_3091_3519 | 142 |
| 24 | 3300049574 | Ga0501038_0013567 | Ga0501038_0013567_1208_1636 | 142 |
| 25 | 3300049575 | Ga0501039_0005307 | Ga0501039_0005307_1973_2401 | 142 |
| 26 | 3300049575 | Ga0501039_0010620 | Ga0501039_0010620_5830_6258 | 142 |
| 27 | 3300049576 | Ga0501040_0000605 | Ga0501040_0000605_6987_7415 | 142 |
| 28 | 3300049576 | Ga0501040_0012892 | Ga0501040_0012892_3091_3519 | 142 |
| 29 | 3300049576 | Ga0501040_0154634 | Ga0501040_0154634_168_596 | 142 |
| 30 | 3300049576 | Ga0501040_0571149 | Ga0501040_0571149_188_616 | 142 |
| 31 | 3300049577 | Ga0501041_0000695 | Ga0501041_0000695_14962_15390 | 142 |
| 32 | 3300049577 | Ga0501041_0006732 | Ga0501041_0006732_5958_6386 | 142 |
| 33 | 3300049577 | Ga0501041_0127195 | Ga0501041_0127195_913_1341 | 142 |
| 34 | 3300049578 | Ga0501042_0000013 | Ga0501042_0000013_50690_51118 | 142 |
| 35 | 3300049578 | Ga0501042_0001965 | Ga0501042_0001965_6831_7259 | 142 |
| 36 | 3300049578 | Ga0501042_0174346 | Ga0501042_0174346_211_639 | 142 |
| 37 | 3300049579 | Ga0501043_0001920 | Ga0501043_0001920_14898_15326 | 142 |
| 38 | 3300049579 | Ga0501043_0037712 | Ga0501043_0037712_759_1187 | 142 |
| 39 | 3300049580 | Ga0501046_0000177 | Ga0501046_0000177_49634_50062 | 142 |
| 40 | 3300049580 | Ga0501046_0003529 | Ga0501046_0003529_5194_5622 | 142 |
| 41 | 3300049581 | Ga0501047_0047657 | Ga0501047_0047657_3438_3866 | 142 |
| 42 | 3300049582 | Ga0501048_0000042 | Ga0501048_0000042_58590_59018 | 142 |
| 43 | 3300049582 | Ga0501048_0008646 | Ga0501048_0008646_2852_3280 | 142 |
| 44 | 3300049582 | Ga0501048_0010708 | Ga0501048_0010708_759_1187 | 142 |
| 45 | 3300049583 | Ga0501067_0039753 | Ga0501067_0039753_2082_2510 | 142 |
| 46 | 3300049584 | Ga0501068_0000051 | Ga0501068_0000051_8085_8513 | 142 |
| 47 | 3300049584 | Ga0501068_0045622 | Ga0501068_0045622_1862_2290 | 142 |
| 48 | 3300049585 | Ga0501069_0009216 | Ga0501069_0009216_4377_4805 | 142 |
| 49 | 3300049585 | Ga0501069_0011434 | Ga0501069_0011434_2548_2976 | 142 |
| 50 | 3300049586 | Ga0501070_0006578 | Ga0501070_0006578_9386_9814 | 142 |
| 51 | 3300049586 | Ga0501070_0787616 | Ga0501070_0787616_106_534 | 142 |
| 52 | 3300049586 | Ga0501070_0979584 | Ga0501070_0979584_121_549 | 142 |
| 53 | 3300049587 | Ga0501071_0000031 | Ga0501071_0000031_31871_32299 | 142 |
| 54 | 3300049587 | Ga0501071_0001902 | Ga0501071_0001902_4912_5340 | 142 |
| 55 | 3300049588 | Ga0501072_0000260 | Ga0501072_0000260_117_545 | 142 |
| 56 | 3300049588 | Ga0501072_0000950 | Ga0501072_0000950_6323_6751 | 142 |
| 57 | 3300049588 | Ga0501072_0731973 | Ga0501072_0731973_142_570 | 142 |
| 58 | 3300049589 | Ga0501073_0002772 | Ga0501073_0002772_5251_5679 | 142 |
| 59 | 3300049589 | Ga0501073_0068788 | Ga0501073_0068788_925_1353 | 142 |
| 60 | 3300049589 | Ga0501073_0401842 | Ga0501073_0401842_32_460 | 142 |
| 61 | 3300049590 | Ga0501074_0005531 | Ga0501074_0005531_7225_7653 | 142 |
| 62 | 3300049590 | Ga0501074_0015271 | Ga0501074_0015271_4395_4823 | 142 |
| 63 | 3300049590 | Ga0501074_0647617 | Ga0501074_0647617_188_616 | 142 |
| 64 | 3300049591 | Ga0501075_0000032 | Ga0501075_0000032_55539_55967 | 142 |
| 65 | 3300049591 | Ga0501075_0000266 | Ga0501075_0000266_5790_6218 | 142 |
| 66 | 3300049591 | Ga0501075_0100423 | Ga0501075_0100423_470_898 | 142 |
| 67 | 3300049592 | Ga0501076_0001745 | Ga0501076_0001745_1436_1864 | 142 |
| 68 | 3300049592 | Ga0501076_0003830 | Ga0501076_0003830_5790_6218 | 142 |
| 69 | 3300049592 | Ga0501076_0675481 | Ga0501076_0675481_285_713 | 142 |
| 70 | 3300049593 | Ga0501077_0000257 | Ga0501077_0000257_12281_12709 | 142 |
| 71 | 3300049593 | Ga0501077_0008277 | Ga0501077_0008277_1115_1543 | 142 |
| 72 | 3300049593 | Ga0501077_0052953 | Ga0501077_0052953_486_914 | 142 |
| 73 | 3300049593 | Ga0501077_0589942 | Ga0501077_0589942_126_554 | 142 |
| 74 | 3300049741 | Ga0501079_0000749 | Ga0501079_0000749_10918_11346 | 142 |
| 75 | 3300049741 | Ga0501079_0016893 | Ga0501079_0016893_3197_3625 | 142 |
| 76 | 3300049741 | Ga0501079_0047508 | Ga0501079_0047508_656_1084 | 142 |
| 77 | 3300049742 | Ga0501080_0000105 | Ga0501080_0000105_45550_45978 | 142 |
| 78 | 3300049742 | Ga0501080_1046182 | Ga0501080_1046182_214_642 | 142 |
| 79 | 3300049743 | Ga0501081_0000691 | Ga0501081_0000691_16569_16997 | 142 |
| 80 | 3300049743 | Ga0501081_0001230 | Ga0501081_0001230_5243_5671 | 142 |
| 81 | 3300049743 | Ga0501081_0036932 | Ga0501081_0036932_2596_3024 | 142 |
| 82 | 3300049744 | Ga0501083_0000081 | Ga0501083_0000081_3138_3566 | 142 |
| 83 | 3300049822 | Ga0501035_0019615 | Ga0501035_0019615_1973_2401 | 142 |
| 84 | 3300049822 | Ga0501035_0119800 | Ga0501035_0119800_759_1187 | 142 |
| 85 | 3300049823 | Ga0501044_0086637 | Ga0501044_0086637_122_550 | 142 |
| 86 | 3300049823 | Ga0501044_0090376 | Ga0501044_0090376_2540_2968 | 142 |
| 87 | 3300049824 | Ga0501045_0001160 | Ga0501045_0001160_122_550 | 142 |
| 88 | 3300049824 | Ga0501045_0001843 | Ga0501045_0001843_13772_14200 | 142 |
| 89 | 3300049824 | Ga0501045_0033780 | Ga0501045_0033780_3272_3700 | 142 |
| 90 | 3300054114 | Ga0501084_0000995 | Ga0501084_0000995_11173_11601 | 142 |
| 91 | 3300054114 | Ga0501084_0001035 | Ga0501084_0001035_10007_10435 | 142 |
| 92 | 3300054114 | Ga0501084_0001602 | Ga0501084_0001602_1846_2274 | 142 |
| 93 | 3300054114 | Ga0501084_0353888 | Ga0501084_0353888_26_454 | 142 |
| 94 | 3300060353 | Ga0501082_0002542 | Ga0501082_0002542_10293_10721 | 142 |
| 95 | 3300060353 | Ga0501082_0007967 | Ga0501082_0007967_7281_7709 | 142 |
| 96 | 3300060353 | Ga0501082_0017121 | Ga0501082_0017121_2341_2769 | 142 |
| 97 | 3300060353 | Ga0501082_0645165 | Ga0501082_0645165_28_456 | 142 |
| 98 | 3300061734 | Ga0530510_0000155 | Ga0530510_0000155_38119_38547 | 142 |
| 99 | 3300061734 | Ga0530510_0000483 | Ga0530510_0000483_5790_6218 | 142 |
| 100 | 3300061734 | Ga0530510_0372296 | Ga0530510_0372296_636_1064 | 142 |
| 101 | 3300005545 | Ga0070695_100882835 | Ga0070695_1008828352 | 143 |
| 102 | 3300005981 | Ga0081538_10000609 | Ga0081538_1000060938 | 143 |
| 103 | 3300009176 | Ga0105242_10383300 | Ga0105242_103833002 | 143 |
| 104 | 3300021384 | Ga0213876_10018927 | Ga0213876_100189274 | 143 |
| 105 | 3300026035 | Ga0207703_10936907 | Ga0207703_109369072 | 143 |
| 106 | 3300028800 | Ga0265338_10008957 | Ga0265338_1000895722 | 143 |
| 107 | 3300037853 | Ga0436364_1115546 | Ga0436364_1115546_145_576 | 143 |
| 108 | 3300037853 | Ga0436364_1341460 | Ga0436364_1341460_1084_1515 | 143 |
| 109 | 3300039437 | Ga0436365_0629338 | Ga0436365_0629338_2470_2901 | 143 |
| 110 | 3300041491 | Ga0451833_0530491 | Ga0451833_0530491_90_521 | 143 |
| 111 | 3300045836 | Ga0466958_0008361 | Ga0466958_0008361_1290_1721 | 143 |
| 112 | 3300048905 | Ga0496102_0771461 | Ga0496102_0771461_73_510 | 143 |
| 113 | 3300048907 | Ga0496104_0356471 | Ga0496104_0356471_575_1012 | 143 |
| 114 | 3300048910 | Ga0496107_0812916 | Ga0496107_0812916_62_499 | 143 |
| 115 | 3300048912 | Ga0496109_0680175 | Ga0496109_0680175_13_450 | 143 |
| 116 | 3300048913 | Ga0496110_0241456 | Ga0496110_0241456_138_575 | 143 |
| 117 | 3300048914 | Ga0496111_0508593 | Ga0496111_0508593_342_779 | 143 |
| 118 | 3300048915 | Ga0496112_0142067 | Ga0496112_0142067_1153_1590 | 143 |
| 119 | 3300048916 | Ga0496113_0081128 | Ga0496113_0081128_511_948 | 143 |
| 120 | 3300049568 | Ga0501031_0001029 | Ga0501031_0001029_3776_4225 | 143 |
| 121 | 3300049568 | Ga0501031_0008013 | Ga0501031_0008013_3538_3972 | 143 |
| 122 | 3300049569 | Ga0501032_0013542 | Ga0501032_0013542_4646_5080 | 143 |
| 123 | 3300049569 | Ga0501032_0091631 | Ga0501032_0091631_477_908 | 143 |
| 124 | 3300049570 | Ga0501033_0167440 | Ga0501033_0167440_429_863 | 143 |
| 125 | 3300049571 | Ga0501034_0401251 | Ga0501034_0401251_717_1148 | 143 |
| 126 | 3300049572 | Ga0501036_0009848 | Ga0501036_0009848_5201_5650 | 143 |
| 127 | 3300049572 | Ga0501036_0010718 | Ga0501036_0010718_5375_5809 | 143 |
| 128 | 3300049573 | Ga0501037_0077066 | Ga0501037_0077066_1594_2028 | 143 |
| 129 | 3300049573 | Ga0501037_0225487 | Ga0501037_0225487_768_1199 | 143 |
| 130 | 3300049574 | Ga0501038_0048444 | Ga0501038_0048444_105_554 | 143 |
| 131 | 3300049574 | Ga0501038_0129622 | Ga0501038_0129622_1049_1483 | 143 |
| 132 | 3300049575 | Ga0501039_0018960 | Ga0501039_0018960_2397_2828 | 143 |
| 133 | 3300049575 | Ga0501039_0042160 | Ga0501039_0042160_96_530 | 143 |
| 134 | 3300049575 | Ga0501039_0159891 | Ga0501039_0159891_21_452 | 143 |
| 135 | 3300049576 | Ga0501040_0000149 | Ga0501040_0000149_3691_4140 | 143 |
| 136 | 3300049576 | Ga0501040_0009383 | Ga0501040_0009383_1666_2097 | 143 |
| 137 | 3300049577 | Ga0501041_0054595 | Ga0501041_0054595_1285_1716 | 143 |
| 138 | 3300049577 | Ga0501041_0097179 | Ga0501041_0097179_676_1107 | 143 |
| 139 | 3300049578 | Ga0501042_0011094 | Ga0501042_0011094_3636_4067 | 143 |
| 140 | 3300049579 | Ga0501043_0012580 | Ga0501043_0012580_5740_6174 | 143 |
| 141 | 3300049579 | Ga0501043_0157759 | Ga0501043_0157759_703_1152 | 143 |
| 142 | 3300049580 | Ga0501046_0025301 | Ga0501046_0025301_1594_2028 | 143 |
| 143 | 3300049581 | Ga0501047_0056401 | Ga0501047_0056401_2003_2437 | 143 |
| 144 | 3300049582 | Ga0501048_0009610 | Ga0501048_0009610_3965_4396 | 143 |
| 145 | 3300049582 | Ga0501048_0059411 | Ga0501048_0059411_170_604 | 143 |
| 146 | 3300049583 | Ga0501067_0006213 | Ga0501067_0006213_3283_3717 | 143 |
| 147 | 3300049584 | Ga0501068_0030531 | Ga0501068_0030531_531_965 | 143 |
| 148 | 3300049584 | Ga0501068_0041886 | Ga0501068_0041886_373_822 | 143 |
| 149 | 3300049585 | Ga0501069_0006340 | Ga0501069_0006340_3498_3932 | 143 |
| 150 | 3300049585 | Ga0501069_0058019 | Ga0501069_0058019_315_764 | 143 |
| 151 | 3300049586 | Ga0501070_0190159 | Ga0501070_0190159_77_508 | 143 |
| 152 | 3300049586 | Ga0501070_0342970 | Ga0501070_0342970_644_1093 | 143 |
| 153 | 3300049586 | Ga0501070_0455950 | Ga0501070_0455950_167_601 | 143 |
| 154 | 3300049587 | Ga0501071_0028671 | Ga0501071_0028671_240_671 | 143 |
| 155 | 3300049587 | Ga0501071_0061757 | Ga0501071_0061757_1995_2429 | 143 |
| 156 | 3300049587 | Ga0501071_0190553 | Ga0501071_0190553_1070_1501 | 143 |
| 157 | 3300049587 | Ga0501071_0273817 | Ga0501071_0273817_748_1179 | 143 |
| 158 | 3300049588 | Ga0501072_0000465 | Ga0501072_0000465_28723_29154 | 143 |
| 159 | 3300049588 | Ga0501072_0060605 | Ga0501072_0060605_1889_2320 | 143 |
| 160 | 3300049588 | Ga0501072_0332742 | Ga0501072_0332742_531_965 | 143 |
| 161 | 3300049589 | Ga0501073_0088020 | Ga0501073_0088020_574_1008 | 143 |
| 162 | 3300049590 | Ga0501074_0024223 | Ga0501074_0024223_177_608 | 143 |
| 163 | 3300049590 | Ga0501074_0042186 | Ga0501074_0042186_233_664 | 143 |
| 164 | 3300049590 | Ga0501074_0055663 | Ga0501074_0055663_717_1151 | 143 |
| 165 | 3300049591 | Ga0501075_0030659 | Ga0501075_0030659_178_609 | 143 |
| 166 | 3300049591 | Ga0501075_0174901 | Ga0501075_0174901_399_830 | 143 |
| 167 | 3300049592 | Ga0501076_0000195 | Ga0501076_0000195_5950_6399 | 143 |
| 168 | 3300049592 | Ga0501076_0039015 | Ga0501076_0039015_3281_3712 | 143 |
| 169 | 3300049592 | Ga0501076_0355667 | Ga0501076_0355667_11_445 | 143 |
| 170 | 3300049593 | Ga0501077_0005655 | Ga0501077_0005655_5819_6268 | 143 |
| 171 | 3300049593 | Ga0501077_0024371 | Ga0501077_0024371_2214_2645 | 143 |
| 172 | 3300049741 | Ga0501079_0011634 | Ga0501079_0011634_3979_4410 | 143 |
| 173 | 3300049741 | Ga0501079_0526340 | Ga0501079_0526340_339_773 | 143 |
| 174 | 3300049741 | Ga0501079_0586052 | Ga0501079_0586052_166_597 | 143 |
| 175 | 3300049742 | Ga0501080_0030475 | Ga0501080_0030475_2776_3210 | 143 |
| 176 | 3300049743 | Ga0501081_0008744 | Ga0501081_0008744_3814_4263 | 143 |
| 177 | 3300049744 | Ga0501083_0060437 | Ga0501083_0060437_1325_1759 | 143 |
| 178 | 3300049744 | Ga0501083_0060770 | Ga0501083_0060770_1239_1670 | 143 |
| 179 | 3300049744 | Ga0501083_0657783 | Ga0501083_0657783_74_505 | 143 |
| 180 | 3300049822 | Ga0501035_0020439 | Ga0501035_0020439_595_1044 | 143 |
| 181 | 3300049822 | Ga0501035_0050590 | Ga0501035_0050590_2991_3425 | 143 |
| 182 | 3300049822 | Ga0501035_0475416 | Ga0501035_0475416_540_971 | 143 |
| 183 | 3300049823 | Ga0501044_0207151 | Ga0501044_0207151_1408_1857 | 143 |
| 184 | 3300049823 | Ga0501044_0233557 | Ga0501044_0233557_302_736 | 143 |
| 185 | 3300049824 | Ga0501045_0000251 | Ga0501045_0000251_24459_24890 | 143 |
| 186 | 3300049824 | Ga0501045_0065496 | Ga0501045_0065496_1261_1692 | 143 |
| 187 | 3300054114 | Ga0501084_0016686 | Ga0501084_0016686_2236_2670 | 143 |
| 188 | 3300054114 | Ga0501084_0028523 | Ga0501084_0028523_478_909 | 143 |
| 189 | 3300060353 | Ga0501082_0002033 | Ga0501082_0002033_3608_4057 | 143 |
| 190 | 3300060353 | Ga0501082_0008023 | Ga0501082_0008023_1662_2096 | 143 |
| 191 | 3300060353 | Ga0501082_0065211 | Ga0501082_0065211_2624_3055 | 143 |
| 192 | 3300060353 | Ga0501082_0106426 | Ga0501082_0106426_32_463 | 143 |
| 193 | 3300061734 | Ga0530510_0006704 | Ga0530510_0006704_4289_4720 | 143 |
| 194 | 3300061734 | Ga0530510_0069096 | Ga0530510_0069096_259_690 | 143 |
| 195 | 3300003203 | JGI25406J46586_10002561 | JGI25406J46586_100025618 | 144 |
| 196 | 3300003373 | JGI25407J50210_10085676 | JGI25407J50210_100856761 | 144 |
| 197 | 3300004800 | Ga0058861_12004293 | Ga0058861_120042931 | 144 |
| 198 | 3300005329 | Ga0070683_100016302 | Ga0070683_1000163026 | 144 |
| 199 | 3300005329 | Ga0070683_100489595 | Ga0070683_1004895952 | 144 |
| 200 | 3300005329 | Ga0070683_100499048 | Ga0070683_1004990481 | 144 |
| 201 | 3300005331 | Ga0070670_100893914 | Ga0070670_1008939141 | 144 |
| 202 | 3300005336 | Ga0070680_100001187 | Ga0070680_1000011873 | 144 |
| 203 | 3300005337 | Ga0070682_100018480 | Ga0070682_1000184803 | 144 |
| 204 | 3300005337 | Ga0070682_100357653 | Ga0070682_1003576532 | 144 |
| 205 | 3300005338 | Ga0068868_100386029 | Ga0068868_1003860292 | 144 |
| 206 | 3300005339 | Ga0070660_100082250 | Ga0070660_1000822502 | 144 |
| 207 | 3300005339 | Ga0070660_100661699 | Ga0070660_1006616992 | 144 |
| 208 | 3300005344 | Ga0070661_100018973 | Ga0070661_1000189734 | 144 |
| 209 | 3300005345 | Ga0070692_10072955 | Ga0070692_100729552 | 144 |
| 210 | 3300005345 | Ga0070692_10123232 | Ga0070692_101232321 | 144 |
| 211 | 3300005345 | Ga0070692_10559306 | Ga0070692_105593062 | 144 |
| 212 | 3300005347 | Ga0070668_100311482 | Ga0070668_1003114822 | 144 |
| 213 | 3300005353 | Ga0070669_101482361 | Ga0070669_1014823611 | 144 |
| 214 | 3300005355 | Ga0070671_100922039 | Ga0070671_1009220391 | 144 |
| 215 | 3300005365 | Ga0070688_100560484 | Ga0070688_1005604841 | 144 |
| 216 | 3300005366 | Ga0070659_100031342 | Ga0070659_1000313424 | 144 |
| 217 | 3300005366 | Ga0070659_100350301 | Ga0070659_1003503012 | 144 |
| 218 | 3300005435 | Ga0070714_100020853 | Ga0070714_1000208536 | 144 |
| 219 | 3300005435 | Ga0070714_100164862 | Ga0070714_1001648622 | 144 |
| 220 | 3300005435 | Ga0070714_100245552 | Ga0070714_1002455522 | 144 |
| 221 | 3300005435 | Ga0070714_100514681 | Ga0070714_1005146812 | 144 |
| 222 | 3300005435 | Ga0070714_100838808 | Ga0070714_1008388081 | 144 |
| 223 | 3300005436 | Ga0070713_100065622 | Ga0070713_1000656221 | 144 |
| 224 | 3300005436 | Ga0070713_100500159 | Ga0070713_1005001592 | 144 |
| 225 | 3300005438 | Ga0070701_10200377 | Ga0070701_102003772 | 144 |
| 226 | 3300005438 | Ga0070701_10449642 | Ga0070701_104496422 | 144 |
| 227 | 3300005438 | Ga0070701_10647880 | Ga0070701_106478802 | 144 |
| 228 | 3300005441 | Ga0070700_100259415 | Ga0070700_1002594152 | 144 |
| 229 | 3300005441 | Ga0070700_100556894 | Ga0070700_1005568942 | 144 |
| 230 | 3300005455 | Ga0070663_100229924 | Ga0070663_1002299242 | 144 |
| 231 | 3300005455 | Ga0070663_100395474 | Ga0070663_1003954741 | 144 |
| 232 | 3300005455 | Ga0070663_100855566 | Ga0070663_1008555661 | 144 |
| 233 | 3300005457 | Ga0070662_100003455 | Ga0070662_10000345510 | 144 |
| 234 | 3300005457 | Ga0070662_100793372 | Ga0070662_1007933722 | 144 |
| 235 | 3300005458 | Ga0070681_10316943 | Ga0070681_103169432 | 144 |
| 236 | 3300005458 | Ga0070681_10431836 | Ga0070681_104318361 | 144 |
| 237 | 3300005458 | Ga0070681_10821752 | Ga0070681_108217522 | 144 |
| 238 | 3300005466 | Ga0070685_10376867 | Ga0070685_103768672 | 144 |
| 239 | 3300005518 | Ga0070699_100498188 | Ga0070699_1004981882 | 144 |
| 240 | 3300005530 | Ga0070679_100122043 | Ga0070679_1001220432 | 144 |
| 241 | 3300005530 | Ga0070679_100180153 | Ga0070679_1001801532 | 144 |
| 242 | 3300005530 | Ga0070679_100357278 | Ga0070679_1003572782 | 144 |
| 243 | 3300005535 | Ga0070684_100009562 | Ga0070684_1000095627 | 144 |
| 244 | 3300005535 | Ga0070684_100035389 | Ga0070684_1000353893 | 144 |
| 245 | 3300005539 | Ga0068853_100185745 | Ga0068853_1001857452 | 144 |
| 246 | 3300005539 | Ga0068853_100569853 | Ga0068853_1005698532 | 144 |
| 247 | 3300005539 | Ga0068853_100993200 | Ga0068853_1009932001 | 144 |
| 248 | 3300005545 | Ga0070695_100493412 | Ga0070695_1004934122 | 144 |
| 249 | 3300005546 | Ga0070696_100139810 | Ga0070696_1001398102 | 144 |
| 250 | 3300005548 | Ga0070665_100001216 | Ga0070665_10000121611 | 144 |
| 251 | 3300005564 | Ga0070664_101073810 | Ga0070664_1010738102 | 144 |
| 252 | 3300005578 | Ga0068854_100126809 | Ga0068854_1001268092 | 144 |
| 253 | 3300005578 | Ga0068854_100192698 | Ga0068854_1001926982 | 144 |
| 254 | 3300005614 | Ga0068856_100006897 | Ga0068856_1000068977 | 144 |
| 255 | 3300005614 | Ga0068856_100195443 | Ga0068856_1001954433 | 144 |
| 256 | 3300005615 | Ga0070702_100057860 | Ga0070702_1000578603 | 144 |
| 257 | 3300005616 | Ga0068852_100009403 | Ga0068852_1000094035 | 144 |
| 258 | 3300005616 | Ga0068852_100192369 | Ga0068852_1001923692 | 144 |
| 259 | 3300005616 | Ga0068852_101873349 | Ga0068852_1018733491 | 144 |
| 260 | 3300005617 | Ga0068859_100479965 | Ga0068859_1004799652 | 144 |
| 261 | 3300005618 | Ga0068864_100204497 | Ga0068864_1002044972 | 144 |
| 262 | 3300005618 | Ga0068864_100952075 | Ga0068864_1009520751 | 144 |
| 263 | 3300005618 | Ga0068864_101208342 | Ga0068864_1012083422 | 144 |
| 264 | 3300005718 | Ga0068866_10204449 | Ga0068866_102044492 | 144 |
| 265 | 3300005719 | Ga0068861_100014162 | Ga0068861_1000141625 | 144 |
| 266 | 3300005719 | Ga0068861_100511264 | Ga0068861_1005112642 | 144 |
| 267 | 3300005841 | Ga0068863_100986656 | Ga0068863_1009866562 | 144 |
| 268 | 3300005841 | Ga0068863_101562070 | Ga0068863_1015620701 | 144 |
| 269 | 3300005842 | Ga0068858_100238167 | Ga0068858_1002381672 | 144 |
| 270 | 3300005844 | Ga0068862_101150507 | Ga0068862_1011505071 | 144 |
| 271 | 3300005937 | Ga0081455_10099870 | Ga0081455_100998702 | 144 |
| 272 | 3300005937 | Ga0081455_10171225 | Ga0081455_101712253 | 144 |
| 273 | 3300005981 | Ga0081538_10002557 | Ga0081538_1000255710 | 144 |
| 274 | 3300005981 | Ga0081538_10022872 | Ga0081538_100228724 | 144 |
| 275 | 3300005981 | Ga0081538_10172463 | Ga0081538_101724631 | 144 |
| 276 | 3300005981 | Ga0081538_10202953 | Ga0081538_102029531 | 144 |
| 277 | 3300005983 | Ga0081540_1001376 | Ga0081540_10013764 | 144 |
| 278 | 3300005983 | Ga0081540_1033321 | Ga0081540_10333212 | 144 |
| 279 | 3300005985 | Ga0081539_10000855 | Ga0081539_1000085525 | 144 |
| 280 | 3300005985 | Ga0081539_10005617 | Ga0081539_100056175 | 144 |
| 281 | 3300005985 | Ga0081539_10012636 | Ga0081539_100126366 | 144 |
| 282 | 3300005985 | Ga0081539_10044377 | Ga0081539_100443771 | 144 |
| 283 | 3300005985 | Ga0081539_10314162 | Ga0081539_103141621 | 144 |
| 284 | 3300006028 | Ga0070717_10122002 | Ga0070717_101220021 | 144 |
| 285 | 3300006028 | Ga0070717_10552407 | Ga0070717_105524072 | 144 |
| 286 | 3300006038 | Ga0075365_10595340 | Ga0075365_105953402 | 144 |
| 287 | 3300006058 | Ga0075432_10028964 | Ga0075432_100289642 | 144 |
| 288 | 3300006058 | Ga0075432_10061273 | Ga0075432_100612732 | 144 |
| 289 | 3300006844 | Ga0075428_100016116 | Ga0075428_1000161164 | 144 |
| 290 | 3300006844 | Ga0075428_100022509 | Ga0075428_1000225092 | 144 |
| 291 | 3300006844 | Ga0075428_100597740 | Ga0075428_1005977402 | 144 |
| 292 | 3300006844 | Ga0075428_101360316 | Ga0075428_1013603162 | 144 |
| 293 | 3300006844 | Ga0075428_102036170 | Ga0075428_1020361701 | 144 |
| 294 | 3300006846 | Ga0075430_100082707 | Ga0075430_1000827073 | 144 |
| 295 | 3300006847 | Ga0075431_100103948 | Ga0075431_1001039483 | 144 |
| 296 | 3300006847 | Ga0075431_100137029 | Ga0075431_1001370292 | 144 |
| 297 | 3300006847 | Ga0075431_100335634 | Ga0075431_1003356342 | 144 |
| 298 | 3300006852 | Ga0075433_10186100 | Ga0075433_101861002 | 144 |
| 299 | 3300006852 | Ga0075433_10634960 | Ga0075433_106349601 | 144 |
| 300 | 3300006871 | Ga0075434_100603220 | Ga0075434_1006032202 | 144 |
| 301 | 3300006880 | Ga0075429_100026641 | Ga0075429_1000266413 | 144 |
| 302 | 3300006931 | Ga0097620_100479975 | Ga0097620_1004799752 | 144 |
| 303 | 3300007788 | Ga0099795_10157658 | Ga0099795_101576582 | 144 |
| 304 | 3300009093 | Ga0105240_10173545 | Ga0105240_101735452 | 144 |
| 305 | 3300009093 | Ga0105240_11167292 | Ga0105240_111672921 | 144 |
| 306 | 3300009094 | Ga0111539_10100528 | Ga0111539_101005282 | 144 |
| 307 | 3300009094 | Ga0111539_10143602 | Ga0111539_101436022 | 144 |
| 308 | 3300009094 | Ga0111539_10713949 | Ga0111539_107139491 | 144 |
| 309 | 3300009094 | Ga0111539_10931528 | Ga0111539_109315281 | 144 |
| 310 | 3300009094 | Ga0111539_11149772 | Ga0111539_111497721 | 144 |
| 311 | 3300009094 | Ga0111539_11500027 | Ga0111539_115000271 | 144 |
| 312 | 3300009094 | Ga0111539_13528572 | Ga0111539_135285721 | 144 |
| 313 | 3300009098 | Ga0105245_10011999 | Ga0105245_100119996 | 144 |
| 314 | 3300009098 | Ga0105245_10035645 | Ga0105245_100356453 | 144 |
| 315 | 3300009098 | Ga0105245_10187372 | Ga0105245_101873722 | 144 |
| 316 | 3300009098 | Ga0105245_11015018 | Ga0105245_110150181 | 144 |
| 317 | 3300009098 | Ga0105245_11056895 | Ga0105245_110568951 | 144 |
| 318 | 3300009098 | Ga0105245_11197293 | Ga0105245_111972931 | 144 |
| 319 | 3300009147 | Ga0114129_10000969 | Ga0114129_1000096945 | 144 |
| 320 | 3300009147 | Ga0114129_10393711 | Ga0114129_103937112 | 144 |
| 321 | 3300009147 | Ga0114129_10581080 | Ga0114129_105810802 | 144 |
| 322 | 3300009147 | Ga0114129_10911879 | Ga0114129_109118791 | 144 |
| 323 | 3300009148 | Ga0105243_10878688 | Ga0105243_108786882 | 144 |
| 324 | 3300009148 | Ga0105243_11513013 | Ga0105243_115130131 | 144 |
| 325 | 3300009174 | Ga0105241_10791027 | Ga0105241_107910271 | 144 |
| 326 | 3300009174 | Ga0105241_10994159 | Ga0105241_109941592 | 144 |
| 327 | 3300009174 | Ga0105241_11614759 | Ga0105241_116147591 | 144 |
| 328 | 3300009176 | Ga0105242_10776519 | Ga0105242_107765191 | 144 |
| 329 | 3300009177 | Ga0105248_10354448 | Ga0105248_103544482 | 144 |
| 330 | 3300009545 | Ga0105237_10039876 | Ga0105237_100398762 | 144 |
| 331 | 3300009545 | Ga0105237_12291746 | Ga0105237_122917461 | 144 |
| 332 | 3300009551 | Ga0105238_10005680 | Ga0105238_100056806 | 144 |
| 333 | 3300009551 | Ga0105238_11438209 | Ga0105238_114382092 | 144 |
| 334 | 3300009551 | Ga0105238_11675084 | Ga0105238_116750842 | 144 |
| 335 | 3300009553 | Ga0105249_10029745 | Ga0105249_100297452 | 144 |
| 336 | 3300010375 | Ga0105239_10225089 | Ga0105239_102250893 | 144 |
| 337 | 3300010375 | Ga0105239_10548475 | Ga0105239_105484752 | 144 |
| 338 | 3300010375 | Ga0105239_10658856 | Ga0105239_106588562 | 144 |
| 339 | 3300011119 | Ga0105246_10304065 | Ga0105246_103040652 | 144 |
| 340 | 3300011119 | Ga0105246_11043792 | Ga0105246_110437922 | 144 |
| 341 | 3300011119 | Ga0105246_12021804 | Ga0105246_120218041 | 144 |
| 342 | 3300012482 | Ga0157318_1004370 | Ga0157318_10043702 | 144 |
| 343 | 3300013102 | Ga0157371_10944850 | Ga0157371_109448501 | 144 |
| 344 | 3300013104 | Ga0157370_10102279 | Ga0157370_101022792 | 144 |
| 345 | 3300013105 | Ga0157369_10053608 | Ga0157369_100536084 | 144 |
| 346 | 3300013105 | Ga0157369_11177688 | Ga0157369_111776881 | 144 |
| 347 | 3300013306 | Ga0163162_10574923 | Ga0163162_105749232 | 144 |
| 348 | 3300013307 | Ga0157372_10082070 | Ga0157372_100820704 | 144 |
| 349 | 3300013307 | Ga0157372_10636804 | Ga0157372_106368042 | 144 |
| 350 | 3300013308 | Ga0157375_10374218 | Ga0157375_103742182 | 144 |
| 351 | 3300014325 | Ga0163163_10066202 | Ga0163163_100662024 | 144 |
| 352 | 3300014325 | Ga0163163_10354935 | Ga0163163_103549352 | 144 |
| 353 | 3300014325 | Ga0163163_12069435 | Ga0163163_120694351 | 144 |
| 354 | 3300014497 | Ga0182008_10149866 | Ga0182008_101498662 | 144 |
| 355 | 3300014497 | Ga0182008_10386045 | Ga0182008_103860452 | 144 |
| 356 | 3300014745 | Ga0157377_10041436 | Ga0157377_100414363 | 144 |
| 357 | 3300014745 | Ga0157377_10206077 | Ga0157377_102060771 | 144 |
| 358 | 3300014968 | Ga0157379_10733829 | Ga0157379_107338292 | 144 |
| 359 | 3300014969 | Ga0157376_11019280 | Ga0157376_110192801 | 144 |
| 360 | 3300017792 | Ga0163161_10073443 | Ga0163161_100734432 | 144 |
| 361 | 3300017792 | Ga0163161_10863699 | Ga0163161_108636992 | 144 |
| 362 | 3300017792 | Ga0163161_11436343 | Ga0163161_114363432 | 144 |
| 363 | 3300020070 | Ga0206356_10680965 | Ga0206356_106809651 | 144 |
| 364 | 3300020070 | Ga0206356_11810994 | Ga0206356_118109942 | 144 |
| 365 | 3300020076 | Ga0206355_1004939 | Ga0206355_10049392 | 144 |
| 366 | 3300020076 | Ga0206355_1170366 | Ga0206355_11703662 | 144 |
| 367 | 3300020077 | Ga0206351_10527688 | Ga0206351_105276881 | 144 |
| 368 | 3300020078 | Ga0206352_10494801 | Ga0206352_104948012 | 144 |
| 369 | 3300020080 | Ga0206350_10035847 | Ga0206350_100358472 | 144 |
| 370 | 3300020080 | Ga0206350_10779252 | Ga0206350_107792521 | 144 |
| 371 | 3300020081 | Ga0206354_10027879 | Ga0206354_100278792 | 144 |
| 372 | 3300020081 | Ga0206354_11445525 | Ga0206354_114455252 | 144 |
| 373 | 3300020082 | Ga0206353_10344325 | Ga0206353_103443254 | 144 |
| 374 | 3300020610 | Ga0154015_1195879 | Ga0154015_11958792 | 144 |
| 375 | 3300021358 | Ga0213873_10033504 | Ga0213873_100335042 | 144 |
| 376 | 3300021377 | Ga0213874_10026474 | Ga0213874_100264742 | 144 |
| 377 | 3300021384 | Ga0213876_10025380 | Ga0213876_100253803 | 144 |
| 378 | 3300021384 | Ga0213876_10029606 | Ga0213876_100296063 | 144 |
| 379 | 3300021384 | Ga0213876_10066784 | Ga0213876_100667842 | 144 |
| 380 | 3300021384 | Ga0213876_10082342 | Ga0213876_100823422 | 144 |
| 381 | 3300021388 | Ga0213875_10029897 | Ga0213875_100298971 | 144 |
| 382 | 3300021388 | Ga0213875_10165622 | Ga0213875_101656221 | 144 |
| 383 | 3300021388 | Ga0213875_10188388 | Ga0213875_101883882 | 144 |
| 384 | 3300021388 | Ga0213875_10381447 | Ga0213875_103814472 | 144 |
| 385 | 3300022467 | Ga0224712_10035564 | Ga0224712_100355641 | 144 |
| 386 | 3300025321 | Ga0207656_10399932 | Ga0207656_103999322 | 144 |
| 387 | 3300025899 | Ga0207642_10217019 | Ga0207642_102170192 | 144 |
| 388 | 3300025901 | Ga0207688_10020155 | Ga0207688_100201553 | 144 |
| 389 | 3300025901 | Ga0207688_10176460 | Ga0207688_101764602 | 144 |
| 390 | 3300025907 | Ga0207645_10032906 | Ga0207645_100329063 | 144 |
| 391 | 3300025912 | Ga0207707_10028789 | Ga0207707_100287894 | 144 |
| 392 | 3300025912 | Ga0207707_10076450 | Ga0207707_100764502 | 144 |
| 393 | 3300025912 | Ga0207707_10608894 | Ga0207707_106088942 | 144 |
| 394 | 3300025912 | Ga0207707_10684323 | Ga0207707_106843231 | 144 |
| 395 | 3300025914 | Ga0207671_10097690 | Ga0207671_100976902 | 144 |
| 396 | 3300025917 | Ga0207660_10003979 | Ga0207660_100039794 | 144 |
| 397 | 3300025918 | Ga0207662_10132703 | Ga0207662_101327032 | 144 |
| 398 | 3300025919 | Ga0207657_10054080 | Ga0207657_100540802 | 144 |
| 399 | 3300025919 | Ga0207657_10123216 | Ga0207657_101232163 | 144 |
| 400 | 3300025919 | Ga0207657_10569618 | Ga0207657_105696182 | 144 |
| 401 | 3300025920 | Ga0207649_10009548 | Ga0207649_100095484 | 144 |
| 402 | 3300025921 | Ga0207652_10040922 | Ga0207652_100409224 | 144 |
| 403 | 3300025921 | Ga0207652_10071355 | Ga0207652_100713552 | 144 |
| 404 | 3300025921 | Ga0207652_10406215 | Ga0207652_104062152 | 144 |
| 405 | 3300025923 | Ga0207681_10258694 | Ga0207681_102586942 | 144 |
| 406 | 3300025924 | Ga0207694_10120174 | Ga0207694_101201742 | 144 |
| 407 | 3300025924 | Ga0207694_11226551 | Ga0207694_112265512 | 144 |
| 408 | 3300025925 | Ga0207650_10823575 | Ga0207650_108235751 | 144 |
| 409 | 3300025927 | Ga0207687_10142632 | Ga0207687_101426322 | 144 |
| 410 | 3300025927 | Ga0207687_10247670 | Ga0207687_102476702 | 144 |
| 411 | 3300025927 | Ga0207687_11526366 | Ga0207687_115263661 | 144 |
| 412 | 3300025928 | Ga0207700_10509953 | Ga0207700_105099532 | 144 |
| 413 | 3300025929 | Ga0207664_10002085 | Ga0207664_1000208513 | 144 |
| 414 | 3300025929 | Ga0207664_10045569 | Ga0207664_100455693 | 144 |
| 415 | 3300025929 | Ga0207664_10106114 | Ga0207664_101061143 | 144 |
| 416 | 3300025929 | Ga0207664_10394068 | Ga0207664_103940682 | 144 |
| 417 | 3300025931 | Ga0207644_10402593 | Ga0207644_104025932 | 144 |
| 418 | 3300025932 | Ga0207690_10060160 | Ga0207690_100601602 | 144 |
| 419 | 3300025932 | Ga0207690_11020039 | Ga0207690_110200391 | 144 |
| 420 | 3300025933 | Ga0207706_10002888 | Ga0207706_100028882 | 144 |
| 421 | 3300025933 | Ga0207706_11424780 | Ga0207706_114247802 | 144 |
| 422 | 3300025937 | Ga0207669_10506454 | Ga0207669_105064541 | 144 |
| 423 | 3300025938 | Ga0207704_10082187 | Ga0207704_100821872 | 144 |
| 424 | 3300025938 | Ga0207704_11162371 | Ga0207704_111623712 | 144 |
| 425 | 3300025939 | Ga0207665_11096546 | Ga0207665_110965462 | 144 |
| 426 | 3300025941 | Ga0207711_10883635 | Ga0207711_108836352 | 144 |
| 427 | 3300025944 | Ga0207661_10000288 | Ga0207661_1000028819 | 144 |
| 428 | 3300025944 | Ga0207661_10038642 | Ga0207661_100386422 | 144 |
| 429 | 3300025944 | Ga0207661_10375702 | Ga0207661_103757022 | 144 |
| 430 | 3300025945 | Ga0207679_10105839 | Ga0207679_101058393 | 144 |
| 431 | 3300025949 | Ga0207667_10708763 | Ga0207667_107087632 | 144 |
| 432 | 3300025961 | Ga0207712_10003500 | Ga0207712_100035002 | 144 |
| 433 | 3300025972 | Ga0207668_10075148 | Ga0207668_100751482 | 144 |
| 434 | 3300025981 | Ga0207640_10103829 | Ga0207640_101038293 | 144 |
| 435 | 3300025981 | Ga0207640_10559374 | Ga0207640_105593742 | 144 |
| 436 | 3300025981 | Ga0207640_10697903 | Ga0207640_106979032 | 144 |
| 437 | 3300026035 | Ga0207703_10185950 | Ga0207703_101859502 | 144 |
| 438 | 3300026035 | Ga0207703_10793620 | Ga0207703_107936201 | 144 |
| 439 | 3300026041 | Ga0207639_10083671 | Ga0207639_100836712 | 144 |
| 440 | 3300026041 | Ga0207639_10474219 | Ga0207639_104742192 | 144 |
| 441 | 3300026041 | Ga0207639_11075956 | Ga0207639_110759561 | 144 |
| 442 | 3300026067 | Ga0207678_10108572 | Ga0207678_101085723 | 144 |
| 443 | 3300026067 | Ga0207678_10320789 | Ga0207678_103207892 | 144 |
| 444 | 3300026067 | Ga0207678_10523714 | Ga0207678_105237142 | 144 |
| 445 | 3300026075 | Ga0207708_10266909 | Ga0207708_102669092 | 144 |
| 446 | 3300026075 | Ga0207708_11014035 | Ga0207708_110140351 | 144 |
| 447 | 3300026075 | Ga0207708_11056978 | Ga0207708_110569781 | 144 |
| 448 | 3300026078 | Ga0207702_10199328 | Ga0207702_101993282 | 144 |
| 449 | 3300026078 | Ga0207702_11140681 | Ga0207702_111406811 | 144 |
| 450 | 3300026089 | Ga0207648_10971498 | Ga0207648_109714981 | 144 |
| 451 | 3300026095 | Ga0207676_10068992 | Ga0207676_100689923 | 144 |
| 452 | 3300026095 | Ga0207676_10303918 | Ga0207676_103039183 | 144 |
| 453 | 3300026095 | Ga0207676_10614898 | Ga0207676_106148982 | 144 |
| 454 | 3300026116 | Ga0207674_10798510 | Ga0207674_107985102 | 144 |
| 455 | 3300026118 | Ga0207675_100051759 | Ga0207675_1000517594 | 144 |
| 456 | 3300026118 | Ga0207675_100063891 | Ga0207675_1000638912 | 144 |
| 457 | 3300026118 | Ga0207675_101479991 | Ga0207675_1014799911 | 144 |
| 458 | 3300026118 | Ga0207675_102147281 | Ga0207675_1021472811 | 144 |
| 459 | 3300026121 | Ga0207683_10270017 | Ga0207683_102700172 | 144 |
| 460 | 3300026142 | Ga0207698_10010680 | Ga0207698_100106804 | 144 |
| 461 | 3300026142 | Ga0207698_10588334 | Ga0207698_105883342 | 144 |
| 462 | 3300026142 | Ga0207698_10716120 | Ga0207698_107161202 | 144 |
| 463 | 3300027907 | Ga0207428_10007695 | Ga0207428_100076953 | 144 |
| 464 | 3300027907 | Ga0207428_10009667 | Ga0207428_100096674 | 144 |
| 465 | 3300027907 | Ga0207428_10140109 | Ga0207428_101401091 | 144 |
| 466 | 3300028379 | Ga0268266_10009612 | Ga0268266_100096122 | 144 |
| 467 | 3300028380 | Ga0268265_10399004 | Ga0268265_103990041 | 144 |
| 468 | 3300028563 | Ga0265319_1000097 | Ga0265319_100009734 | 144 |
| 469 | 3300028573 | Ga0265334_10100208 | Ga0265334_101002082 | 144 |
| 470 | 3300031240 | Ga0265320_10026669 | Ga0265320_100266692 | 144 |
| 471 | 3300031548 | Ga0307408_102250947 | Ga0307408_1022509471 | 144 |
| 472 | 3300031731 | Ga0307405_10321368 | Ga0307405_103213682 | 144 |
| 473 | 3300031731 | Ga0307405_10777308 | Ga0307405_107773081 | 144 |
| 474 | 3300031824 | Ga0307413_10110642 | Ga0307413_101106422 | 144 |
| 475 | 3300031824 | Ga0307413_10698490 | Ga0307413_106984902 | 144 |
| 476 | 3300031852 | Ga0307410_10393225 | Ga0307410_103932252 | 144 |
| 477 | 3300031852 | Ga0307410_11617515 | Ga0307410_116175151 | 144 |
| 478 | 3300031901 | Ga0307406_10182790 | Ga0307406_101827902 | 144 |
| 479 | 3300031901 | Ga0307406_10311237 | Ga0307406_103112372 | 144 |
| 480 | 3300031903 | Ga0307407_10065365 | Ga0307407_100653653 | 144 |
| 481 | 3300031911 | Ga0307412_10248490 | Ga0307412_102484902 | 144 |
| 482 | 3300031911 | Ga0307412_10457644 | Ga0307412_104576442 | 144 |
| 483 | 3300031995 | Ga0307409_100004882 | Ga0307409_1000048822 | 144 |
| 484 | 3300031995 | Ga0307409_100329332 | Ga0307409_1003293322 | 144 |
| 485 | 3300031995 | Ga0307409_100399676 | Ga0307409_1003996762 | 144 |
| 486 | 3300031995 | Ga0307409_100990518 | Ga0307409_1009905182 | 144 |
| 487 | 3300032002 | Ga0307416_100087720 | Ga0307416_1000877204 | 144 |
| 488 | 3300032002 | Ga0307416_100123099 | Ga0307416_1001230993 | 144 |
| 489 | 3300032002 | Ga0307416_100504378 | Ga0307416_1005043782 | 144 |
| 490 | 3300032002 | Ga0307416_100646132 | Ga0307416_1006461322 | 144 |
| 491 | 3300032004 | Ga0307414_10483905 | Ga0307414_104839052 | 144 |
| 492 | 3300032005 | Ga0307411_10041242 | Ga0307411_100412422 | 144 |
| 493 | 3300032005 | Ga0307411_10348548 | Ga0307411_103485482 | 144 |
| 494 | 3300032005 | Ga0307411_10547220 | Ga0307411_105472201 | 144 |
| 495 | 3300032005 | Ga0307411_11078640 | Ga0307411_110786402 | 144 |
| 496 | 3300032126 | Ga0307415_100001467 | Ga0307415_1000014678 | 144 |
| 497 | 3300032126 | Ga0307415_100051622 | Ga0307415_1000516223 | 144 |
| 498 | 3300032126 | Ga0307415_100079264 | Ga0307415_1000792642 | 144 |
| 499 | 3300032126 | Ga0307415_100111304 | Ga0307415_1001113042 | 144 |
| 500 | 3300032126 | Ga0307415_100228450 | Ga0307415_1002284502 | 144 |
| 501 | 3300034816 | Ga0373930_0216654 | Ga0373930_0216654_52_486 | 144 |
| 502 | 3300035085 | Ga0373929_0157502 | Ga0373929_0157502_69_503 | 144 |
| 503 | 3300035112 | Ga0373932_0057361 | Ga0373932_0057361_89_523 | 144 |
| 504 | 3300035114 | Ga0373939_0027083 | Ga0373939_0027083_132_566 | 144 |
| 505 | 3300035121 | Ga0373960_0026941 | Ga0373960_0026941_894_1328 | 144 |
| 506 | 3300035242 | Ga0373962_0073604 | Ga0373962_0073604_428_862 | 144 |
| 507 | 3300035691 | Ga0373931_0133676 | Ga0373931_0133676_884_1318 | 144 |
| 508 | 3300037068 | Ga0373925_0409513 | Ga0373925_0409513_591_1025 | 144 |
| 509 | 3300037068 | Ga0373925_0909188 | Ga0373925_0909188_142_576 | 144 |
| 510 | 3300037312 | Ga0395899_0454778 | Ga0395899_0454778_243_677 | 144 |
| 511 | 3300037418 | Ga0395900_0004774 | Ga0395900_0004774_8128_8568 | 144 |
| 512 | 3300037418 | Ga0395900_0063841 | Ga0395900_0063841_2267_2707 | 144 |
| 513 | 3300037418 | Ga0395900_0269360 | Ga0395900_0269360_708_1142 | 144 |
| 514 | 3300037418 | Ga0395900_0348447 | Ga0395900_0348447_1005_1439 | 144 |
| 515 | 3300037466 | Ga0395898_0010298 | Ga0395898_0010298_3075_3515 | 144 |
| 516 | 3300037466 | Ga0395898_0024260 | Ga0395898_0024260_4524_4958 | 144 |
| 517 | 3300037466 | Ga0395898_0134416 | Ga0395898_0134416_49_483 | 144 |
| 518 | 3300037466 | Ga0395898_0272422 | Ga0395898_0272422_547_990 | 144 |
| 519 | 3300037466 | Ga0395898_0571184 | Ga0395898_0571184_263_697 | 144 |
| 520 | 3300037466 | Ga0395898_1279656 | Ga0395898_1279656_129_566 | 144 |
| 521 | 3300037471 | Ga0395905_0021339 | Ga0395905_0021339_1591_2031 | 144 |
| 522 | 3300037471 | Ga0395905_0135978 | Ga0395905_0135978_339_773 | 144 |
| 523 | 3300037471 | Ga0395905_0154752 | Ga0395905_0154752_1365_1808 | 144 |
| 524 | 3300037471 | Ga0395905_0337434 | Ga0395905_0337434_464_898 | 144 |
| 525 | 3300037471 | Ga0395905_1141356 | Ga0395905_1141356_93_527 | 144 |
| 526 | 3300037471 | Ga0395905_1333057 | Ga0395905_1333057_11_445 | 144 |
| 527 | 3300037853 | Ga0436364_0004771 | Ga0436364_0004771_142_576 | 144 |
| 528 | 3300037853 | Ga0436364_0030377 | Ga0436364_0030377_345_779 | 144 |
| 529 | 3300037853 | Ga0436364_0080723 | Ga0436364_0080723_68_502 | 144 |
| 530 | 3300037853 | Ga0436364_0396681 | Ga0436364_0396681_889_1323 | 144 |
| 531 | 3300037853 | Ga0436364_0741604 | Ga0436364_0741604_860_1294 | 144 |
| 532 | 3300037853 | Ga0436364_0871788 | Ga0436364_0871788_260_718 | 144 |
| 533 | 3300037853 | Ga0436364_0901605 | Ga0436364_0901605_35_469 | 144 |
| 534 | 3300037853 | Ga0436364_1172909 | Ga0436364_1172909_144_578 | 144 |
| 535 | 3300037853 | Ga0436364_1215096 | Ga0436364_1215096_178_612 | 144 |
| 536 | 3300037853 | Ga0436364_1243845 | Ga0436364_1243845_9988_10431 | 144 |
| 537 | 3300038443 | Ga0395901_0011234 | Ga0395901_0011234_1955_2389 | 144 |
| 538 | 3300038443 | Ga0395901_0018758 | Ga0395901_0018758_2172_2606 | 144 |
| 539 | 3300038443 | Ga0395901_0046349 | Ga0395901_0046349_2283_2723 | 144 |
| 540 | 3300038443 | Ga0395901_0076345 | Ga0395901_0076345_2414_2857 | 144 |
| 541 | 3300038443 | Ga0395901_0382259 | Ga0395901_0382259_379_813 | 144 |
| 542 | 3300038443 | Ga0395901_0507504 | Ga0395901_0507504_503_937 | 144 |
| 543 | 3300038443 | Ga0395901_0970955 | Ga0395901_0970955_158_595 | 144 |
| 544 | 3300038443 | Ga0395901_1218065 | Ga0395901_1218065_180_614 | 144 |
| 545 | 3300038443 | Ga0395901_2145430 | Ga0395901_2145430_21_455 | 144 |
| 546 | 3300039437 | Ga0436365_0056826 | Ga0436365_0056826_916_1401 | 144 |
| 547 | 3300039437 | Ga0436365_0246988 | Ga0436365_0246988_213_647 | 144 |
| 548 | 3300039437 | Ga0436365_0377309 | Ga0436365_0377309_9919_10362 | 144 |
| 549 | 3300039437 | Ga0436365_0686509 | Ga0436365_0686509_3689_4123 | 144 |
| 550 | 3300039437 | Ga0436365_0925381 | Ga0436365_0925381_384_827 | 144 |
| 551 | 3300039437 | Ga0436365_0979777 | Ga0436365_0979777_27_461 | 144 |
| 552 | 3300039437 | Ga0436365_1362716 | Ga0436365_1362716_346_780 | 144 |
| 553 | 3300039437 | Ga0436365_1426124 | Ga0436365_1426124_213_647 | 144 |
| 554 | 3300039437 | Ga0436365_1749779 | Ga0436365_1749779_299_733 | 144 |
| 555 | 3300039438 | Ga0436360_0783578 | Ga0436360_0783578_262_738 | 144 |
| 556 | 3300039447 | Ga0436361_0135380 | Ga0436361_0135380_16_492 | 144 |
| 557 | 3300039450 | Ga0436363_0048403 | Ga0436363_0048403_1088_1522 | 144 |
| 558 | 3300039450 | Ga0436363_0116001 | Ga0436363_0116001_13803_14237 | 144 |
| 559 | 3300039450 | Ga0436363_0522014 | Ga0436363_0522014_12_446 | 144 |
| 560 | 3300039450 | Ga0436363_0889944 | Ga0436363_0889944_59_493 | 144 |
| 561 | 3300039450 | Ga0436363_1138467 | Ga0436363_1138467_1270_1713 | 144 |
| 562 | 3300039450 | Ga0436363_1237855 | Ga0436363_1237855_97_531 | 144 |
| 563 | 3300039450 | Ga0436363_1357623 | Ga0436363_1357623_310_744 | 144 |
| 564 | 3300039450 | Ga0436363_1492506 | Ga0436363_1492506_3272_3715 | 144 |
| 565 | 3300039453 | Ga0436362_0457422 | Ga0436362_0457422_849_1334 | 144 |
| 566 | 3300039453 | Ga0436362_0584602 | Ga0436362_0584602_224_658 | 144 |
| 567 | 3300039453 | Ga0436362_0701279 | Ga0436362_0701279_36_470 | 144 |
| 568 | 3300039453 | Ga0436362_0981668 | Ga0436362_0981668_2597_3040 | 144 |
| 569 | 3300039453 | Ga0436362_1113699 | Ga0436362_1113699_776_1210 | 144 |
| 570 | 3300041443 | Ga0451789_0140835 | Ga0451789_0140835_122_556 | 144 |
| 571 | 3300041443 | Ga0451789_0556213 | Ga0451789_0556213_40_474 | 144 |
| 572 | 3300041452 | Ga0451793_0641740 | Ga0451793_0641740_33_467 | 144 |
| 573 | 3300041460 | Ga0451802_0239322 | Ga0451802_0239322_115_549 | 144 |
| 574 | 3300041496 | Ga0451839_1509325 | Ga0451839_1509325_153_587 | 144 |
| 575 | 3300041503 | Ga0451847_0823104 | Ga0451847_0823104_240_674 | 144 |
| 576 | 3300041512 | Ga0451853_0405189 | Ga0451853_0405189_85_519 | 144 |
| 577 | 3300041512 | Ga0451853_2806980 | Ga0451853_2806980_455_889 | 144 |
| 578 | 3300042013 | Ga0439456_044439 | Ga0439456_044439_170_604 | 144 |
| 579 | 3300044656 | Ga0466969_0022458 | Ga0466969_0022458_1586_2020 | 144 |
| 580 | 3300044658 | Ga0466972_0374120 | Ga0466972_0374120_75_509 | 144 |
| 581 | 3300044683 | Ga0466965_0182485 | Ga0466965_0182485_149_583 | 144 |
| 582 | 3300044683 | Ga0466965_0530780 | Ga0466965_0530780_163_597 | 144 |
| 583 | 3300044684 | Ga0466966_0072552 | Ga0466966_0072552_64_507 | 144 |
| 584 | 3300044684 | Ga0466966_0119859 | Ga0466966_0119859_486_920 | 144 |
| 585 | 3300044693 | Ga0466961_0100396 | Ga0466961_0100396_1160_1594 | 144 |
| 586 | 3300044693 | Ga0466961_0271386 | Ga0466961_0271386_40_483 | 144 |
| 587 | 3300044693 | Ga0466961_0356705 | Ga0466961_0356705_420_854 | 144 |
| 588 | 3300044694 | Ga0466963_0025323 | Ga0466963_0025323_2873_3307 | 144 |
| 589 | 3300044694 | Ga0466963_0038967 | Ga0466963_0038967_1898_2332 | 144 |
| 590 | 3300044694 | Ga0466963_0163567 | Ga0466963_0163567_315_749 | 144 |
| 591 | 3300044706 | Ga0466964_0328872 | Ga0466964_0328872_293_727 | 144 |
| 592 | 3300044706 | Ga0466964_0353920 | Ga0466964_0353920_236_676 | 144 |
| 593 | 3300044719 | Ga0466971_0007903 | Ga0466971_0007903_361_795 | 144 |
| 594 | 3300044719 | Ga0466971_0502270 | Ga0466971_0502270_102_536 | 144 |
| 595 | 3300044735 | Ga0466968_0075108 | Ga0466968_0075108_453_887 | 144 |
| 596 | 3300044765 | Ga0466970_0108101 | Ga0466970_0108101_103_537 | 144 |
| 597 | 3300044842 | Ga0466957_0031049 | Ga0466957_0031049_2108_2542 | 144 |
| 598 | 3300044842 | Ga0466957_0041883 | Ga0466957_0041883_1507_1941 | 144 |
| 599 | 3300044901 | Ga0466960_0292997 | Ga0466960_0292997_416_850 | 144 |
| 600 | 3300045049 | Ga0466959_0002562 | Ga0466959_0002562_535_969 | 144 |
| 601 | 3300045049 | Ga0466959_0056212 | Ga0466959_0056212_1234_1668 | 144 |
| 602 | 3300045049 | Ga0466959_0192572 | Ga0466959_0192572_653_1087 | 144 |
| 603 | 3300045049 | Ga0466959_0252885 | Ga0466959_0252885_762_1196 | 144 |
| 604 | 3300045049 | Ga0466959_0554167 | Ga0466959_0554167_182_616 | 144 |
| 605 | 3300045836 | Ga0466958_0000390 | Ga0466958_0000390_13908_14342 | 144 |
| 606 | 3300045836 | Ga0466958_0016389 | Ga0466958_0016389_694_1128 | 144 |
| 607 | 3300045836 | Ga0466958_0017509 | Ga0466958_0017509_2899_3333 | 144 |
| 608 | 3300045836 | Ga0466958_0073362 | Ga0466958_0073362_1213_1647 | 144 |
| 609 | 3300045836 | Ga0466958_0085389 | Ga0466958_0085389_1173_1616 | 144 |
| 610 | 3300045836 | Ga0466958_0570142 | Ga0466958_0570142_279_716 | 144 |
| 611 | 3300045976 | Ga0466967_0018136 | Ga0466967_0018136_245_679 | 144 |
| 612 | 3300045976 | Ga0466967_0018566 | Ga0466967_0018566_3820_4254 | 144 |
| 613 | 3300045976 | Ga0466967_0136661 | Ga0466967_0136661_468_902 | 144 |
| 614 | 3300045976 | Ga0466967_0203668 | Ga0466967_0203668_584_1018 | 144 |
| 615 | 3300045976 | Ga0466967_0516030 | Ga0466967_0516030_481_915 | 144 |
| 616 | 3300045976 | Ga0466967_0520308 | Ga0466967_0520308_432_866 | 144 |
| 617 | 3300045976 | Ga0466967_0558035 | Ga0466967_0558035_36_476 | 144 |
| 618 | 3300045976 | Ga0466967_1210043 | Ga0466967_1210043_229_663 | 144 |
| 619 | 3300045976 | Ga0466967_1973643 | Ga0466967_1973643_126_566 | 144 |
| 620 | 3300045976 | Ga0466967_2297668 | Ga0466967_2297668_25_459 | 144 |
| 621 | 3300046458 | Ga0495591_126008 | Ga0495591_126008_108_542 | 144 |
| 622 | 3300046471 | Ga0495650_0000035 | Ga0495650_0000035_183236_183670 | 144 |
| 623 | 3300046472 | Ga0495580_0192297 | Ga0495580_0192297_558_992 | 144 |
| 624 | 3300046477 | Ga0495664_0315387 | Ga0495664_0315387_401_835 | 144 |
| 625 | 3300046500 | Ga0495596_0051722 | Ga0495596_0051722_163_597 | 144 |
| 626 | 3300046500 | Ga0495596_0082243 | Ga0495596_0082243_514_948 | 144 |
| 627 | 3300046500 | Ga0495596_0124409 | Ga0495596_0124409_14_448 | 144 |
| 628 | 3300046518 | Ga0495631_0238232 | Ga0495631_0238232_74_508 | 144 |
| 629 | 3300046529 | Ga0495652_0156606 | Ga0495652_0156606_173_607 | 144 |
| 630 | 3300046535 | Ga0495586_0199568 | Ga0495586_0199568_59_499 | 144 |
| 631 | 3300046543 | Ga0495645_0467011 | Ga0495645_0467011_210_644 | 144 |
| 632 | 3300046615 | Ga0495656_0162620 | Ga0495656_0162620_214_648 | 144 |
| 633 | 3300046648 | Ga0495611_0125972 | Ga0495611_0125972_694_1131 | 144 |
| 634 | 3300046674 | Ga0495588_0576341 | Ga0495588_0576341_144_578 | 144 |
| 635 | 3300046680 | Ga0495646_0208112 | Ga0495646_0208112_527_961 | 144 |
| 636 | 3300046794 | Ga0495589_0455424 | Ga0495589_0455424_80_514 | 144 |
| 637 | 3300046794 | Ga0495589_0490143 | Ga0495589_0490143_50_484 | 144 |
| 638 | 3300047321 | Ga0495676_0434319 | Ga0495676_0434319_139_606 | 144 |
| 639 | 3300047447 | Ga0495685_209504 | Ga0495685_209504_75_509 | 144 |
| 640 | 3300048903 | Ga0496100_0080961 | Ga0496100_0080961_744_1178 | 144 |
| 641 | 3300048903 | Ga0496100_0388679 | Ga0496100_0388679_285_719 | 144 |
| 642 | 3300048903 | Ga0496100_0840347 | Ga0496100_0840347_119_556 | 144 |
| 643 | 3300048903 | Ga0496100_1094920 | Ga0496100_1094920_28_465 | 144 |
| 644 | 3300048904 | Ga0496101_0019094 | Ga0496101_0019094_2487_2921 | 144 |
| 645 | 3300048904 | Ga0496101_0750386 | Ga0496101_0750386_263_697 | 144 |
| 646 | 3300048905 | Ga0496102_0188959 | Ga0496102_0188959_34_468 | 144 |
| 647 | 3300048905 | Ga0496102_0293644 | Ga0496102_0293644_111_545 | 144 |
| 648 | 3300048905 | Ga0496102_0314905 | Ga0496102_0314905_558_992 | 144 |
| 649 | 3300048905 | Ga0496102_0683732 | Ga0496102_0683732_173_607 | 144 |
| 650 | 3300048905 | Ga0496102_0702416 | Ga0496102_0702416_339_815 | 144 |
| 651 | 3300048905 | Ga0496102_0958199 | Ga0496102_0958199_119_553 | 144 |
| 652 | 3300048905 | Ga0496102_1890432 | Ga0496102_1890432_34_474 | 144 |
| 653 | 3300048906 | Ga0496103_0655064 | Ga0496103_0655064_109_543 | 144 |
| 654 | 3300048907 | Ga0496104_0073599 | Ga0496104_0073599_2411_2845 | 144 |
| 655 | 3300048907 | Ga0496104_0585175 | Ga0496104_0585175_264_698 | 144 |
| 656 | 3300048907 | Ga0496104_0620841 | Ga0496104_0620841_334_768 | 144 |
| 657 | 3300048907 | Ga0496104_0902804 | Ga0496104_0902804_163_600 | 144 |
| 658 | 3300048908 | Ga0496105_0082828 | Ga0496105_0082828_1830_2264 | 144 |
| 659 | 3300048908 | Ga0496105_0257842 | Ga0496105_0257842_482_916 | 144 |
| 660 | 3300048908 | Ga0496105_0541784 | Ga0496105_0541784_446_880 | 144 |
| 661 | 3300048909 | Ga0496106_0377939 | Ga0496106_0377939_280_714 | 144 |
| 662 | 3300048909 | Ga0496106_0993567 | Ga0496106_0993567_176_616 | 144 |
| 663 | 3300048910 | Ga0496107_0285475 | Ga0496107_0285475_246_680 | 144 |
| 664 | 3300048910 | Ga0496107_0359022 | Ga0496107_0359022_454_888 | 144 |
| 665 | 3300048911 | Ga0496108_0101040 | Ga0496108_0101040_1556_1990 | 144 |
| 666 | 3300048911 | Ga0496108_0266088 | Ga0496108_0266088_399_833 | 144 |
| 667 | 3300048911 | Ga0496108_0574922 | Ga0496108_0574922_326_760 | 144 |
| 668 | 3300048911 | Ga0496108_0666013 | Ga0496108_0666013_12_446 | 144 |
| 669 | 3300048911 | Ga0496108_0770631 | Ga0496108_0770631_318_752 | 144 |
| 670 | 3300048911 | Ga0496108_0817843 | Ga0496108_0817843_116_550 | 144 |
| 671 | 3300048912 | Ga0496109_0030445 | Ga0496109_0030445_4183_4617 | 144 |
| 672 | 3300048912 | Ga0496109_0160082 | Ga0496109_0160082_1356_1790 | 144 |
| 673 | 3300048912 | Ga0496109_0285287 | Ga0496109_0285287_169_603 | 144 |
| 674 | 3300048912 | Ga0496109_0391092 | Ga0496109_0391092_217_651 | 144 |
| 675 | 3300048912 | Ga0496109_0422619 | Ga0496109_0422619_640_1074 | 144 |
| 676 | 3300048912 | Ga0496109_0830318 | Ga0496109_0830318_43_480 | 144 |
| 677 | 3300048913 | Ga0496110_0049120 | Ga0496110_0049120_864_1298 | 144 |
| 678 | 3300048913 | Ga0496110_0239922 | Ga0496110_0239922_368_802 | 144 |
| 679 | 3300048913 | Ga0496110_0441955 | Ga0496110_0441955_685_1119 | 144 |
| 680 | 3300048913 | Ga0496110_0851979 | Ga0496110_0851979_59_499 | 144 |
| 681 | 3300048913 | Ga0496110_1300747 | Ga0496110_1300747_174_620 | 144 |
| 682 | 3300048914 | Ga0496111_0123371 | Ga0496111_0123371_365_799 | 144 |
| 683 | 3300048914 | Ga0496111_0158792 | Ga0496111_0158792_252_686 | 144 |
| 684 | 3300048914 | Ga0496111_0917221 | Ga0496111_0917221_130_564 | 144 |
| 685 | 3300048915 | Ga0496112_0098448 | Ga0496112_0098448_2419_2853 | 144 |
| 686 | 3300048915 | Ga0496112_0135049 | Ga0496112_0135049_336_770 | 144 |
| 687 | 3300048915 | Ga0496112_0170265 | Ga0496112_0170265_1174_1608 | 144 |
| 688 | 3300048915 | Ga0496112_0258625 | Ga0496112_0258625_425_859 | 144 |
| 689 | 3300048915 | Ga0496112_0304069 | Ga0496112_0304069_818_1252 | 144 |
| 690 | 3300048915 | Ga0496112_0465692 | Ga0496112_0465692_589_1023 | 144 |
| 691 | 3300048916 | Ga0496113_0177392 | Ga0496113_0177392_376_810 | 144 |
| 692 | 3300048916 | Ga0496113_0347887 | Ga0496113_0347887_458_892 | 144 |
| 693 | 3300048916 | Ga0496113_1214819 | Ga0496113_1214819_128_562 | 144 |
| 694 | 3300048917 | Ga0496114_0030344 | Ga0496114_0030344_1687_2121 | 144 |
| 695 | 3300048917 | Ga0496114_0130988 | Ga0496114_0130988_279_713 | 144 |
| 696 | 3300048917 | Ga0496114_0812047 | Ga0496114_0812047_21_458 | 144 |
| 697 | 3300048918 | Ga0496115_1221897 | Ga0496115_1221897_85_519 | 144 |
| 698 | 3300048920 | Ga0496117_0310934 | Ga0496117_0310934_373_807 | 144 |
| 699 | 3300048921 | Ga0496118_0289160 | Ga0496118_0289160_160_594 | 144 |
| 700 | 3300048924 | Ga0496121_0002418 | Ga0496121_0002418_23011_23445 | 144 |
| 701 | 3300048924 | Ga0496121_0096566 | Ga0496121_0096566_1741_2181 | 144 |
| 702 | 3300048929 | Ga0496126_0493732 | Ga0496126_0493732_452_892 | 144 |
| 703 | 3300049162 | Ga0501307_082546 | Ga0501307_082546_31_468 | 144 |
| 704 | 3300049528 | Ga0501312_120312 | Ga0501312_120312_50_487 | 144 |
| 705 | 3300049533 | Ga0501317_025142 | Ga0501317_025142_42_482 | 144 |
| 706 | 3300049534 | Ga0501318_028572 | Ga0501318_028572_22_459 | 144 |
| 707 | 3300049537 | Ga0501321_065047 | Ga0501321_065047_31_468 | 144 |
| 708 | 3300049568 | Ga0501031_0301511 | Ga0501031_0301511_60_518 | 144 |
| 709 | 3300049568 | Ga0501031_0708328 | Ga0501031_0708328_56_514 | 144 |
| 710 | 3300049569 | Ga0501032_0255208 | Ga0501032_0255208_475_909 | 144 |
| 711 | 3300049570 | Ga0501033_0446248 | Ga0501033_0446248_360_794 | 144 |
| 712 | 3300049572 | Ga0501036_1070728 | Ga0501036_1070728_144_581 | 144 |
| 713 | 3300049573 | Ga0501037_0213037 | Ga0501037_0213037_472_915 | 144 |
| 714 | 3300049573 | Ga0501037_0684599 | Ga0501037_0684599_191_649 | 144 |
| 715 | 3300049575 | Ga0501039_0021617 | Ga0501039_0021617_3861_4295 | 144 |
| 716 | 3300049575 | Ga0501039_0139133 | Ga0501039_0139133_881_1315 | 144 |
| 717 | 3300049576 | Ga0501040_0010866 | Ga0501040_0010866_1424_1858 | 144 |
| 718 | 3300049576 | Ga0501040_0099693 | Ga0501040_0099693_470_904 | 144 |
| 719 | 3300049576 | Ga0501040_0208691 | Ga0501040_0208691_698_1132 | 144 |
| 720 | 3300049576 | Ga0501040_0767355 | Ga0501040_0767355_70_507 | 144 |
| 721 | 3300049577 | Ga0501041_0124234 | Ga0501041_0124234_489_923 | 144 |
| 722 | 3300049577 | Ga0501041_0599821 | Ga0501041_0599821_228_662 | 144 |
| 723 | 3300049578 | Ga0501042_0008702 | Ga0501042_0008702_5227_5661 | 144 |
| 724 | 3300049578 | Ga0501042_0333984 | Ga0501042_0333984_398_832 | 144 |
| 725 | 3300049579 | Ga0501043_0255464 | Ga0501043_0255464_554_988 | 144 |
| 726 | 3300049579 | Ga0501043_0640510 | Ga0501043_0640510_245_679 | 144 |
| 727 | 3300049580 | Ga0501046_0194086 | Ga0501046_0194086_502_936 | 144 |
| 728 | 3300049580 | Ga0501046_0345491 | Ga0501046_0345491_228_662 | 144 |
| 729 | 3300049582 | Ga0501048_0074928 | Ga0501048_0074928_421_879 | 144 |
| 730 | 3300049582 | Ga0501048_0091431 | Ga0501048_0091431_1352_1786 | 144 |
| 731 | 3300049584 | Ga0501068_0505631 | Ga0501068_0505631_67_501 | 144 |
| 732 | 3300049585 | Ga0501069_0292862 | Ga0501069_0292862_252_686 | 144 |
| 733 | 3300049586 | Ga0501070_0265383 | Ga0501070_0265383_895_1332 | 144 |
| 734 | 3300049587 | Ga0501071_0093183 | Ga0501071_0093183_1084_1518 | 144 |
| 735 | 3300049587 | Ga0501071_0398754 | Ga0501071_0398754_460_894 | 144 |
| 736 | 3300049587 | Ga0501071_0463983 | Ga0501071_0463983_51_488 | 144 |
| 737 | 3300049588 | Ga0501072_0096619 | Ga0501072_0096619_1406_1864 | 144 |
| 738 | 3300049588 | Ga0501072_0117660 | Ga0501072_0117660_1099_1533 | 144 |
| 739 | 3300049590 | Ga0501074_0384636 | Ga0501074_0384636_405_839 | 144 |
| 740 | 3300049590 | Ga0501074_0423276 | Ga0501074_0423276_109_543 | 144 |
| 741 | 3300049591 | Ga0501075_0026654 | Ga0501075_0026654_2752_3186 | 144 |
| 742 | 3300049591 | Ga0501075_0151277 | Ga0501075_0151277_766_1224 | 144 |
| 743 | 3300049591 | Ga0501075_0915656 | Ga0501075_0915656_193_627 | 144 |
| 744 | 3300049592 | Ga0501076_0027659 | Ga0501076_0027659_912_1346 | 144 |
| 745 | 3300049592 | Ga0501076_0043421 | Ga0501076_0043421_402_860 | 144 |
| 746 | 3300049592 | Ga0501076_0115334 | Ga0501076_0115334_279_713 | 144 |
| 747 | 3300049593 | Ga0501077_0190559 | Ga0501077_0190559_363_797 | 144 |
| 748 | 3300049593 | Ga0501077_0521449 | Ga0501077_0521449_85_519 | 144 |
| 749 | 3300049741 | Ga0501079_0143423 | Ga0501079_0143423_1412_1846 | 144 |
| 750 | 3300049741 | Ga0501079_0179684 | Ga0501079_0179684_519_977 | 144 |
| 751 | 3300049741 | Ga0501079_0460738 | Ga0501079_0460738_228_662 | 144 |
| 752 | 3300049742 | Ga0501080_0102221 | Ga0501080_0102221_239_673 | 144 |
| 753 | 3300049742 | Ga0501080_0793233 | Ga0501080_0793233_26_460 | 144 |
| 754 | 3300049743 | Ga0501081_0017489 | Ga0501081_0017489_1691_2125 | 144 |
| 755 | 3300049744 | Ga0501083_0225394 | Ga0501083_0225394_626_1060 | 144 |
| 756 | 3300049744 | Ga0501083_0354404 | Ga0501083_0354404_473_907 | 144 |
| 757 | 3300049779 | Ga0501283_084547 | Ga0501283_084547_88_522 | 144 |
| 758 | 3300049822 | Ga0501035_0284169 | Ga0501035_0284169_598_1032 | 144 |
| 759 | 3300049823 | Ga0501044_0523920 | Ga0501044_0523920_557_991 | 144 |
| 760 | 3300049824 | Ga0501045_0071628 | Ga0501045_0071628_804_1238 | 144 |
| 761 | 3300049824 | Ga0501045_0197935 | Ga0501045_0197935_669_1103 | 144 |
| 762 | 3300049824 | Ga0501045_0357746 | Ga0501045_0357746_222_680 | 144 |
| 763 | 3300050492 | nmdc:mga0yw44_1043433_c1 | nmdc:mga0yw44_1043433_c1_78_524 | 144 |
| 764 | 3300050507 | nmdc:mga05p37_174736_c1 | nmdc:mga05p37_174736_c1_896_1330 | 144 |
| 765 | 3300050507 | nmdc:mga05p37_601_c1 | nmdc:mga05p37_601_c1_1009_1443 | 144 |
| 766 | 3300050508 | nmdc:mga09592_494883_c1 | nmdc:mga09592_494883_c1_596_1042 | 144 |
| 767 | 3300050508 | nmdc:mga09592_85491_c1 | nmdc:mga09592_85491_c1_2091_2525 | 144 |
| 768 | 3300050509 | nmdc:mga0qj67_679236_c1 | nmdc:mga0qj67_679236_c1_197_631 | 144 |
| 769 | 3300050509 | nmdc:mga0qj67_80129_c1 | nmdc:mga0qj67_80129_c1_1683_2117 | 144 |
| 770 | 3300050510 | nmdc:mga06r32_1039226_c1 | nmdc:mga06r32_1039226_c1_127_561 | 144 |
| 771 | 3300050510 | nmdc:mga06r32_112492_c1 | nmdc:mga06r32_112492_c1_2002_2448 | 144 |
| 772 | 3300050510 | nmdc:mga06r32_157746_c1 | nmdc:mga06r32_157746_c1_1086_1520 | 144 |
| 773 | 3300050510 | nmdc:mga06r32_698689_c1 | nmdc:mga06r32_698689_c1_205_639 | 144 |
| 774 | 3300050511 | nmdc:mga08y16_175117_c1 | nmdc:mga08y16_175117_c1_1463_1897 | 144 |
| 775 | 3300050511 | nmdc:mga08y16_224746_c1 | nmdc:mga08y16_224746_c1_1293_1727 | 144 |
| 776 | 3300050511 | nmdc:mga08y16_368826_c1 | nmdc:mga08y16_368826_c1_17_451 | 144 |
| 777 | 3300050511 | nmdc:mga08y16_66597_c1 | nmdc:mga08y16_66597_c1_1291_1737 | 144 |
| 778 | 3300050512 | nmdc:mga0n895_1184425_c1 | nmdc:mga0n895_1184425_c1_62_496 | 144 |
| 779 | 3300050515 | nmdc:mga0a205_1139612_c1 | nmdc:mga0a205_1139612_c1_106_540 | 144 |
| 780 | 3300050515 | nmdc:mga0a205_114467_c1 | nmdc:mga0a205_114467_c1_1192_1626 | 144 |
| 781 | 3300050515 | nmdc:mga0a205_583408_c1 | nmdc:mga0a205_583408_c1_93_527 | 144 |
| 782 | 3300053083 | Ga0495655_0038525 | Ga0495655_0038525_295_732 | 144 |
| 783 | 3300053083 | Ga0495655_0069115 | Ga0495655_0069115_362_796 | 144 |
| 784 | 3300053083 | Ga0495655_0194494 | Ga0495655_0194494_83_517 | 144 |
| 785 | 3300053146 | Ga0500588_0260216 | Ga0500588_0260216_152_592 | 144 |
| 786 | 3300053153 | Ga0500616_0005292 | Ga0500616_0005292_4982_5416 | 144 |
| 787 | 3300054114 | Ga0501084_0304376 | Ga0501084_0304376_172_630 | 144 |
| 788 | 3300054114 | Ga0501084_0336705 | Ga0501084_0336705_579_1013 | 144 |
| 789 | 3300054114 | Ga0501084_0345153 | Ga0501084_0345153_767_1201 | 144 |
| 790 | 3300059421 | Ga0590071_050409 | Ga0590071_050409_178_612 | 144 |
| 791 | 3300059426 | Ga0590077_097541 | Ga0590077_097541_211_645 | 144 |
| 792 | 3300059491 | Ga0587070_170148 | Ga0587070_170148_17_451 | 144 |
| 793 | 3300059504 | Ga0587082_102320 | Ga0587082_102320_79_513 | 144 |
| 794 | 3300059505 | Ga0587083_0104451 | Ga0587083_0104451_183_623 | 144 |
| 795 | 3300059508 | Ga0587088_106084 | Ga0587088_106084_117_551 | 144 |
| 796 | 3300059513 | Ga0587094_065064 | Ga0587094_065064_117_551 | 144 |
| 797 | 3300059642 | Ga0587069_082382 | Ga0587069_082382_32_469 | 144 |
| 798 | 3300059645 | Ga0587076_079530 | Ga0587076_079530_199_633 | 144 |
| 799 | 3300060353 | Ga0501082_0063916 | Ga0501082_0063916_82_540 | 144 |
| 800 | 3300060353 | Ga0501082_0206490 | Ga0501082_0206490_346_780 | 144 |
| 801 | 3300060353 | Ga0501082_0506207 | Ga0501082_0506207_131_565 | 144 |
| 802 | 3300061719 | Ga0466962_0000616 | Ga0466962_0000616_3062_3496 | 144 |
| 803 | 3300061734 | Ga0530510_0019946 | Ga0530510_0019946_257_715 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ppk-assembly1.cif.gz_J | rbga+45srbga complex | 0.9375 | 12 | 143 |
| 7jql-assembly2.cif.gz_2N | crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution | 0.935 | 1 | 142 |
| 8cvm-assembly1.cif.gz_i | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9341 | 2 | 144 |
| 7m4w-assembly1.cif.gz_I | a. baumannii ribosome-eravacycline complex: empty 70s | 0.9308 | 1 | 142 |
| 7nhn-assembly1.cif.gz_M | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9293 | 1 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9538 | 12 | 144 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9508 | 12 | 144 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9347 | 1 | 142 | 3.90.1180.10 |
| af_Q554U7_3_170_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9327 | 8 | 141 | 3.90.1180.10 |
| af_Q9VJ38_1_177_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9304 | 9 | 142 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D8SDP4-F1-model_v4 | 50S ribosomal protein L13 | 0.9722 | 12 | 142 |
GO:0003729
GO:0003735 GO:0005840 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A1F6LAI9-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9675 | 12 | 144 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A3B4X4E0-F1-model_v4 | 50S ribosomal protein L13 | 0.967 | 12 | 141 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A660VCC6-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9669 | 12 | 142 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A7J7N2Z6-F1-model_v4 | COP9 signalosome complex subunit 3 | 0.9667 | 13 | 144 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0006511 GO:0008180 GO:0016740 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar