F481462

General Info

Members Datasets Scaffolds Average Seq Length
802 314 1604 92

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10684826|Ga0157370_106848262
Length 97
Sequence MREEQNMRTIAIAFVAALFVGPALAEQEISLKQGPGLDKVESNCGACHTLAYIPMNSFLKPAQWDAEVTKMIKALGAPIEDADAKAIAEYLKAHYGG

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.62
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 5.24
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 15.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10684826 3300013104 Unclassified 936
2 JGI24737J22298_10012617 3300001990 Bacteria 2754
3 JGI25406J46586_10024907 3300003203 Bacteria 2333
4 JGI26129J50193_1004572 3300003349 Bacteria 980
5 Ga0058862_12345862 3300004803 Bacteria 760
6 Ga0065712_10004833 3300005290 Bacteria 3604
7 Ga0065715_10000599 3300005293 Bacteria 9975
8 Ga0070658_10013065 3300005327 Bacteria 6662
9 Ga0070658_10024039 3300005327 Bacteria 4890
10 Ga0070658_10035038 3300005327 Bacteria 4041
11 Ga0070658_11944937 3300005327 Bacteria 508
12 Ga0070676_10715999 3300005328 Bacteria 732
13 Ga0070683_100032239 3300005329 Bacteria 4771
14 Ga0070683_100416188 3300005329 Bacteria 1282
15 Ga0070683_100418100 3300005329 Bacteria 1279
16 Ga0070690_100049918 3300005330 Bacteria 2668
17 Ga0070680_100039083 3300005336 Bacteria 3839
18 Ga0070680_100088679 3300005336 Bacteria 2559
19 Ga0070680_100090384 3300005336 Bacteria 2535
20 Ga0070680_100202220 3300005336 Bacteria 1675
21 Ga0070680_100795782 3300005336 Bacteria 815
22 Ga0070680_101115928 3300005336 Bacteria 682
23 Ga0070680_101820842 3300005336 Bacteria 528
24 Ga0070680_101874430 3300005336 Bacteria 520
25 Ga0070682_100089449 3300005337 Bacteria 2011
26 Ga0070682_100158178 3300005337 Bacteria 1562
27 Ga0070660_100054971 3300005339 Bacteria 3075
28 Ga0070660_100214057 3300005339 Bacteria 1565
29 Ga0070660_100294924 3300005339 Bacteria 1328
30 Ga0070660_100548774 3300005339 Bacteria 964
31 Ga0070660_100825518 3300005339 Unclassified 780
32 Ga0070660_101176594 3300005339 Bacteria 650
33 Ga0070689_100023874 3300005340 Bacteria 4583
34 Ga0070691_10484329 3300005341 Bacteria 712
35 Ga0070661_100175692 3300005344 Bacteria 1628
36 Ga0070661_100657846 3300005344 Bacteria 851
37 Ga0070661_101514878 3300005344 Unclassified 566
38 Ga0070692_10103081 3300005345 Unclassified 1567
39 Ga0070692_11383763 3300005345 Unclassified 507
40 Ga0070668_100823115 3300005347 Unclassified 826
41 Ga0070669_100122694 3300005353 Bacteria 1984
42 Ga0070675_100263836 3300005354 Bacteria 1510
43 Ga0070688_100005463 3300005365 Bacteria 6696
44 Ga0070659_100032222 3300005366 Bacteria 4064
45 Ga0070659_100116410 3300005366 Bacteria 2161
46 Ga0070659_101341665 3300005366 Bacteria 635
47 Ga0070659_101616200 3300005366 Bacteria 579
48 Ga0070667_100109105 3300005367 Bacteria 2398
49 Ga0070709_10089951 3300005434 Bacteria 2022
50 Ga0070709_10207343 3300005434 Bacteria 1391
51 Ga0070709_11025350 3300005434 Unclassified 657
52 Ga0070709_11656891 3300005434 Unclassified 522
53 Ga0070714_100146923 3300005435 Bacteria 2122
54 Ga0070714_100390384 3300005435 Bacteria 1314
55 Ga0070714_100438726 3300005435 Bacteria 1239
56 Ga0070714_100471326 3300005435 Bacteria 1195
57 Ga0070714_100972250 3300005435 Bacteria 825
58 Ga0070714_101950780 3300005435 Bacteria 573
59 Ga0070713_100076661 3300005436 Bacteria 2840
60 Ga0070713_100093597 3300005436 Bacteria 2589
61 Ga0070713_100225974 3300005436 Bacteria 1700
62 Ga0070713_100867662 3300005436 Bacteria 867
63 Ga0070710_10294650 3300005437 Bacteria 1057
64 Ga0070710_11037587 3300005437 Unclassified 599
65 Ga0070711_100053369 3300005439 Bacteria 2785
66 Ga0070711_100066719 3300005439 Unclassified 2522
67 Ga0070711_100148771 3300005439 Bacteria 1764
68 Ga0070711_100190491 3300005439 Bacteria 1576
69 Ga0070711_100622947 3300005439 Bacteria 902
70 Ga0070711_101516516 3300005439 Unclassified 585
71 Ga0070705_100011491 3300005440 Bacteria 4468
72 Ga0070705_100285888 3300005440 Bacteria 1175
73 Ga0070705_100612518 3300005440 Bacteria 844
74 Ga0070694_100016644 3300005444 Bacteria 4630
75 Ga0070694_101089911 3300005444 Unclassified 666
76 Ga0070708_100230944 3300005445 Bacteria 1736
77 Ga0070663_100454600 3300005455 Unclassified 1056
78 Ga0070663_100779962 3300005455 Bacteria 818
79 Ga0070663_101669735 3300005455 Bacteria 569
80 Ga0070662_100085855 3300005457 Bacteria 2353
81 Ga0070681_10049722 3300005458 Bacteria 4186
82 Ga0070681_10057595 3300005458 Bacteria 3866
83 Ga0070681_10080814 3300005458 Bacteria 3206
84 Ga0070681_10130035 3300005458 Bacteria 2450
85 Ga0070681_10423055 3300005458 Bacteria 1244
86 Ga0070681_10536080 3300005458 Unclassified 1084
87 Ga0070681_10760706 3300005458 Bacteria 885
88 Ga0070681_10882600 3300005458 Bacteria 812
89 Ga0070681_11040707 3300005458 Unclassified 739
90 Ga0070706_100280002 3300005467 Bacteria 1556
91 Ga0070706_101425085 3300005467 Bacteria 634
92 Ga0070707_100041517 3300005468 Bacteria 4403
93 Ga0070707_100412457 3300005468 Bacteria 1311
94 Ga0070698_100254410 3300005471 Bacteria 1689
95 Ga0070698_100826383 3300005471 Bacteria 871
96 Ga0070698_100904926 3300005471 Bacteria 828
97 Ga0070699_101180884 3300005518 Bacteria 702
98 Ga0070679_100053269 3300005530 Bacteria 4028
99 Ga0070679_100123763 3300005530 Bacteria 2569
100 Ga0070679_100174191 3300005530 Bacteria 2124
101 Ga0070679_100197136 3300005530 Bacteria 1981
102 Ga0070679_100308368 3300005530 Bacteria 1533
103 Ga0070679_100481115 3300005530 Bacteria 1186
104 Ga0070679_101526965 3300005530 Bacteria 615
105 Ga0070684_100011798 3300005535 Bacteria 6972
106 Ga0070684_100076336 3300005535 Bacteria 2957
107 Ga0070684_100466003 3300005535 Unclassified 1168
108 Ga0070684_100569265 3300005535 Bacteria 1052
109 Ga0070684_100666465 3300005535 Unclassified 969
110 Ga0070684_101258669 3300005535 Unclassified 696
111 Ga0070697_100130012 3300005536 Bacteria 2111
112 Ga0070697_100455783 3300005536 Bacteria 1114
113 Ga0068853_100500330 3300005539 Bacteria 1147
114 Ga0068853_100511201 3300005539 Bacteria 1135
115 Ga0068853_100729109 3300005539 Bacteria 947
116 Ga0068853_100972762 3300005539 Bacteria 817
117 Ga0070695_100008417 3300005545 Bacteria 6124
118 Ga0070695_100058186 3300005545 Bacteria 2499
119 Ga0070695_100998929 3300005545 Unclassified 680
120 Ga0070696_100223735 3300005546 Bacteria 1413
121 Ga0070693_100137844 3300005547 Bacteria 1532
122 Ga0070693_100300069 3300005547 Bacteria 1082
123 Ga0070693_101189448 3300005547 Bacteria 585
124 Ga0070665_100864733 3300005548 Bacteria 917
125 Ga0070704_100597471 3300005549 Bacteria 969
126 Ga0070704_100617929 3300005549 Bacteria 954
127 Ga0068855_100388380 3300005563 Unclassified 1531
128 Ga0068855_100425052 3300005563 Bacteria 1453
129 Ga0068855_100881408 3300005563 Unclassified 946
130 Ga0068855_101550194 3300005563 Bacteria 679
131 Ga0068855_101643974 3300005563 Unclassified 656
132 Ga0068855_101749623 3300005563 Unclassified 633
133 Ga0070664_100040912 3300005564 Bacteria 3910
134 Ga0070664_100081092 3300005564 Bacteria 2795
135 Ga0070664_100580847 3300005564 Bacteria 1038
136 Ga0070664_100892977 3300005564 Bacteria 833
137 Ga0068857_101084042 3300005577 Bacteria 773
138 Ga0068857_101527769 3300005577 Bacteria 651
139 Ga0068854_100120056 3300005578 Unclassified 1994
140 Ga0068854_100284874 3300005578 Bacteria 1332
141 Ga0068856_100480771 3300005614 Bacteria 1263
142 Ga0068856_100625545 3300005614 Bacteria 1097
143 Ga0068856_100687586 3300005614 Bacteria 1043
144 Ga0068856_100773034 3300005614 Unclassified 980
145 Ga0068856_100982721 3300005614 Bacteria 863
146 Ga0068856_102096413 3300005614 Bacteria 575
147 Ga0070702_100210230 3300005615 Bacteria 1294
148 Ga0068852_100139846 3300005616 Bacteria 2239
149 Ga0068852_100209924 3300005616 Bacteria 1847
150 Ga0068852_101055929 3300005616 Bacteria 832
151 Ga0068859_100018246 3300005617 Bacteria 7055
152 Ga0068864_101311369 3300005618 Bacteria 724
153 Ga0068864_102221581 3300005618 Unclassified 555
154 Ga0068866_10883210 3300005718 Unclassified 627
155 Ga0068861_100036856 3300005719 Bacteria 3632
156 Ga0068861_101980183 3300005719 Unclassified 581
157 Ga0068858_100520821 3300005842 Bacteria 1150
158 Ga0068860_100766423 3300005843 Bacteria 977
159 Ga0068862_100803067 3300005844 Bacteria 919
160 Ga0081455_10039235 3300005937 Bacteria 4187
161 Ga0081455_10123124 3300005937 Bacteria 2041
162 Ga0081455_10310658 3300005937 Bacteria 1127
163 Ga0081540_1001983 3300005983 Bacteria 17082
164 Ga0081540_1209152 3300005983 Bacteria 703
165 Ga0081539_10001619 3300005985 Bacteria 36946
166 Ga0081539_10210234 3300005985 Bacteria 892
167 Ga0070717_10136710 3300006028 Bacteria 2111
168 Ga0070717_10372259 3300006028 Bacteria 1280
169 Ga0070717_10405268 3300006028 Bacteria 1225
170 Ga0070717_11441443 3300006028 Bacteria 625
171 Ga0075365_10176274 3300006038 Bacteria 1493
172 Ga0075365_11194438 3300006038 Bacteria 535
173 Ga0075432_10040919 3300006058 Bacteria 1618
174 Ga0070715_10036675 3300006163 Bacteria 2024
175 Ga0070715_10045001 3300006163 Bacteria 1869
176 Ga0070716_101164615 3300006173 Bacteria 618
177 Ga0070716_101370811 3300006173 Unclassified 574
178 Ga0070712_100096732 3300006175 Bacteria 2174
179 Ga0070712_100169362 3300006175 Bacteria 1693
180 Ga0070712_100314937 3300006175 Bacteria 1271
181 Ga0070712_100668327 3300006175 Bacteria 884
182 Ga0070712_101575972 3300006175 Unclassified 574
183 Ga0075427_10005597 3300006194 Bacteria 1795
184 Ga0097621_100119577 3300006237 Bacteria 2233
185 Ga0097621_101966892 3300006237 Unclassified 558
186 Ga0068871_100067574 3300006358 Bacteria 2933
187 Ga0075428_100015867 3300006844 Bacteria 8337
188 Ga0075428_100251925 3300006844 Unclassified 1903
189 Ga0075428_100259938 3300006844 Bacteria 1870
190 Ga0075428_101379851 3300006844 Bacteria 740
191 Ga0075430_100002456 3300006846 Bacteria 15426
192 Ga0075431_100004056 3300006847 Bacteria 14270
193 Ga0075431_100946817 3300006847 Bacteria 830
194 Ga0075433_10219263 3300006852 Bacteria 1690
195 Ga0075433_11027899 3300006852 Bacteria 717
196 Ga0075433_11210384 3300006852 Bacteria 655
197 Ga0075433_11875592 3300006852 Unclassified 514
198 Ga0075434_100020582 3300006871 Bacteria 6401
199 Ga0075434_100073455 3300006871 Bacteria 3412
200 Ga0075434_101061984 3300006871 Bacteria 823
201 Ga0075434_101410357 3300006871 Bacteria 706
202 Ga0075434_102549805 3300006871 Unclassified 512
203 Ga0075429_100006674 3300006880 Bacteria 10006
204 Ga0075436_100008024 3300006914 Bacteria 7228
205 Ga0075436_100122872 3300006914 Bacteria 1818
206 Ga0075436_100467605 3300006914 Bacteria 920
207 Ga0075436_100518138 3300006914 Bacteria 873
208 Ga0097620_100018245 3300006931 Bacteria 7055
209 Ga0075435_100072142 3300007076 Bacteria 2821
210 Ga0075435_100154491 3300007076 Bacteria 1930
211 Ga0075435_100366023 3300007076 Bacteria 1237
212 Ga0075435_100580614 3300007076 Unclassified 971
213 Ga0075435_101320094 3300007076 Bacteria 632
214 Ga0099795_10434591 3300007788 Bacteria 602
215 Ga0099795_10441142 3300007788 Bacteria 598
216 Ga0105240_10041606 3300009093 Bacteria 5863
217 Ga0105240_10123373 3300009093 Bacteria 3117
218 Ga0105240_10339359 3300009093 Bacteria 1707
219 Ga0105240_10380081 3300009093 Bacteria 1595
220 Ga0111539_10005521 3300009094 Bacteria 16354
221 Ga0111539_10251981 3300009094 Bacteria 2056
222 Ga0111539_10698987 3300009094 Bacteria 1180
223 Ga0111539_12054099 3300009094 Unclassified 663
224 Ga0114129_10079289 3300009147 Bacteria 4566
225 Ga0114129_10174577 3300009147 Bacteria 2927
226 Ga0114129_10628500 3300009147 Bacteria 1388
227 Ga0114129_11313304 3300009147 Bacteria 896
228 Ga0114129_11450708 3300009147 Bacteria 845
229 Ga0105243_10148730 3300009148 Bacteria 2007
230 Ga0105241_10085058 3300009174 Bacteria 2485
231 Ga0105241_10576892 3300009174 Unclassified 1013
232 Ga0105241_10792204 3300009174 Bacteria 872
233 Ga0105237_10273408 3300009545 Bacteria 1692
234 Ga0105238_10017974 3300009551 Bacteria 7187
235 Ga0105238_10221196 3300009551 Bacteria 1870
236 Ga0105238_10647067 3300009551 Bacteria 1067
237 Ga0105249_10038373 3300009553 Bacteria 4346
238 Ga0105249_10862395 3300009553 Unclassified 971
239 Ga0105239_10083748 3300010375 Bacteria 3512
240 Ga0105239_10278783 3300010375 Bacteria 1882
241 Ga0105246_10185111 3300011119 Bacteria 1607
242 Ga0105246_11031831 3300011119 Bacteria 746
243 Ga0157373_10069097 3300013100 Unclassified 2497
244 Ga0157373_10345852 3300013100 Archaea 1060
245 Ga0157373_10690390 3300013100 Bacteria 747
246 Ga0157373_10869023 3300013100 Bacteria 668
247 Ga0157373_11061511 3300013100 Bacteria 606
248 Ga0157371_10182792 3300013102 Bacteria 1500
249 Ga0157371_10296993 3300013102 Bacteria 1169
250 Ga0157371_10538772 3300013102 Bacteria 864
251 Ga0157371_10578250 3300013102 Bacteria 834
252 Ga0157370_10062900 3300013104 Bacteria 3518
253 Ga0157370_10201205 3300013104 Bacteria 1848
254 Ga0157370_10354236 3300013104 Bacteria 1353
255 Ga0157370_11418739 3300013104 Bacteria 625
256 Ga0157370_11589033 3300013104 Unclassified 588
257 Ga0157369_10118697 3300013105 Unclassified 2807
258 Ga0157369_10194652 3300013105 Bacteria 2129
259 Ga0157369_10441685 3300013105 Bacteria 1348
260 Ga0163162_10975188 3300013306 Bacteria 958
261 Ga0157372_10476162 3300013307 Bacteria 1456
262 Ga0157372_11155406 3300013307 Bacteria 895
263 Ga0157372_11729105 3300013307 Bacteria 719
264 Ga0157372_12789543 3300013307 Bacteria 560
265 Ga0157375_11678258 3300013308 Bacteria 752
266 Ga0157375_11896653 3300013308 Bacteria 707
267 Ga0157375_12726596 3300013308 Unclassified 591
268 Ga0157376_10076756 3300014969 Bacteria 2855
269 Ga0206356_10500132 3300020070 Bacteria 1274
270 Ga0207666_1000446 3300025271 Bacteria 5349
271 Ga0207697_10005503 3300025315 Bacteria 5878
272 Ga0207692_10177263 3300025898 Bacteria 1239
273 Ga0207692_10486946 3300025898 Bacteria 781
274 Ga0207647_10006970 3300025904 Bacteria 8190
275 Ga0207685_10025705 3300025905 Bacteria 2036
276 Ga0207685_10225460 3300025905 Unclassified 894
277 Ga0207699_10128357 3300025906 Bacteria 1650
278 Ga0207699_10423616 3300025906 Bacteria 951
279 Ga0207699_11037588 3300025906 Unclassified 606
280 Ga0207699_11107227 3300025906 Bacteria 586
281 Ga0207645_10277553 3300025907 Bacteria 1112
282 Ga0207705_10038583 3300025909 Bacteria 3420
283 Ga0207705_10160961 3300025909 Bacteria 1686
284 Ga0207705_10746262 3300025909 Bacteria 760
285 Ga0207684_10046219 3300025910 Bacteria 3693
286 Ga0207684_10174536 3300025910 Bacteria 1853
287 Ga0207684_11145143 3300025910 Unclassified 646
288 Ga0207654_10150115 3300025911 Bacteria 1495
289 Ga0207707_10128100 3300025912 Bacteria 2220
290 Ga0207707_10133955 3300025912 Bacteria 2167
291 Ga0207707_10268430 3300025912 Bacteria 1479
292 Ga0207707_10323857 3300025912 Bacteria 1330
293 Ga0207707_11382585 3300025912 Bacteria 562
294 Ga0207695_10250308 3300025913 Bacteria 1671
295 Ga0207695_10627232 3300025913 Bacteria 956
296 Ga0207695_11333462 3300025913 Bacteria 598
297 Ga0207693_10001328 3300025915 Bacteria 21900
298 Ga0207693_10003033 3300025915 Bacteria 14514
299 Ga0207693_10040031 3300025915 Bacteria 3691
300 Ga0207693_10132479 3300025915 Bacteria 1959
301 Ga0207693_10175837 3300025915 Bacteria 1685
302 Ga0207693_10815560 3300025915 Bacteria 719
303 Ga0207663_10026756 3300025916 Bacteria 3352
304 Ga0207663_10053000 3300025916 Unclassified 2532
305 Ga0207663_10215853 3300025916 Bacteria 1393
306 Ga0207663_10444311 3300025916 Bacteria 999
307 Ga0207663_10539356 3300025916 Bacteria 911
308 Ga0207660_10233061 3300025917 Bacteria 1448
309 Ga0207660_10579777 3300025917 Bacteria 913
310 Ga0207660_10608570 3300025917 Bacteria 890
311 Ga0207660_10617600 3300025917 Bacteria 883
312 Ga0207660_11108630 3300025917 Bacteria 645
313 Ga0207660_11210695 3300025917 Bacteria 614
314 Ga0207657_10051934 3300025919 Bacteria 3561
315 Ga0207657_10823600 3300025919 Unclassified 717
316 Ga0207657_11255705 3300025919 Bacteria 561
317 Ga0207649_10105279 3300025920 Bacteria 1875
318 Ga0207649_11564640 3300025920 Bacteria 522
319 Ga0207652_10056587 3300025921 Bacteria 3376
320 Ga0207652_10159577 3300025921 Bacteria 2021
321 Ga0207652_10325238 3300025921 Bacteria 1388
322 Ga0207652_10335680 3300025921 Bacteria 1365
323 Ga0207652_10352293 3300025921 Bacteria 1329
324 Ga0207652_10426423 3300025921 Unclassified 1196
325 Ga0207652_10570527 3300025921 Bacteria 1016
326 Ga0207652_11615192 3300025921 Unclassified 553
327 Ga0207646_10326026 3300025922 Bacteria 1387
328 Ga0207646_10382282 3300025922 Bacteria 1272
329 Ga0207681_10034168 3300025923 Bacteria 3341
330 Ga0207694_10230338 3300025924 Bacteria 1513
331 Ga0207694_10296573 3300025924 Bacteria 1330
332 Ga0207694_10469632 3300025924 Unclassified 1051
333 Ga0207659_10278610 3300025926 Bacteria 1366
334 Ga0207700_10054993 3300025928 Bacteria 2990
335 Ga0207700_10102486 3300025928 Bacteria 2286
336 Ga0207700_10374414 3300025928 Bacteria 1244
337 Ga0207700_10382445 3300025928 Bacteria 1231
338 Ga0207700_10972736 3300025928 Bacteria 760
339 Ga0207664_10062298 3300025929 Bacteria 2978
340 Ga0207664_10194285 3300025929 Bacteria 1748
341 Ga0207664_10371920 3300025929 Bacteria 1268
342 Ga0207664_10819250 3300025929 Unclassified 837
343 Ga0207664_10848271 3300025929 Bacteria 821
344 Ga0207664_10861618 3300025929 Bacteria 814
345 Ga0207664_10938068 3300025929 Bacteria 776
346 Ga0207690_10140413 3300025932 Bacteria 1779
347 Ga0207690_10297763 3300025932 Bacteria 1261
348 Ga0207690_10385390 3300025932 Bacteria 1115
349 Ga0207706_10008176 3300025933 Bacteria 9650
350 Ga0207670_10027587 3300025936 Bacteria 3592
351 Ga0207665_10004704 3300025939 Bacteria 9066
352 Ga0207665_10040097 3300025939 Bacteria 3123
353 Ga0207665_11209261 3300025939 Bacteria 603
354 Ga0207665_11407815 3300025939 Unclassified 555
355 Ga0207665_11503251 3300025939 Bacteria 535
356 Ga0207661_10155364 3300025944 Bacteria 1981
357 Ga0207661_10534683 3300025944 Bacteria 1073
358 Ga0207679_10155557 3300025945 Bacteria 1866
359 Ga0207679_10273685 3300025945 Bacteria 1445
360 Ga0207667_10009069 3300025949 Bacteria 11761
361 Ga0207667_10043533 3300025949 Bacteria 4764
362 Ga0207667_10117517 3300025949 Bacteria 2740
363 Ga0207667_10546135 3300025949 Bacteria 1172
364 Ga0207667_11023639 3300025949 Bacteria 812
365 Ga0207667_11393381 3300025949 Unclassified 675
366 Ga0207667_11413379 3300025949 Unclassified 669
367 Ga0207667_11977003 3300025949 Bacteria 544
368 Ga0207667_12011546 3300025949 Bacteria 538
369 Ga0207712_10381531 3300025961 Bacteria 1180
370 Ga0207668_11653775 3300025972 Unclassified 578
371 Ga0207640_10172693 3300025981 Bacteria 1612
372 Ga0207658_10087677 3300025986 Bacteria 2404
373 Ga0207703_10484087 3300026035 Bacteria 1160
374 Ga0207639_10110527 3300026041 Bacteria 2239
375 Ga0207639_10374965 3300026041 Unclassified 1276
376 Ga0207639_10518089 3300026041 Bacteria 1092
377 Ga0207639_10628357 3300026041 Unclassified 992
378 Ga0207678_10151728 3300026067 Bacteria 1978
379 Ga0207678_11012392 3300026067 Bacteria 735
380 Ga0207708_10006143 3300026075 Bacteria 8905
381 Ga0207702_10263582 3300026078 Bacteria 1623
382 Ga0207702_10520157 3300026078 Bacteria 1162
383 Ga0207702_10560684 3300026078 Unclassified 1118
384 Ga0207674_10358087 3300026116 Bacteria 1410
385 Ga0207674_10748731 3300026116 Bacteria 943
386 Ga0207675_101531382 3300026118 Bacteria 687
387 Ga0207675_102386932 3300026118 Unclassified 541
388 Ga0207683_11779748 3300026121 Unclassified 565
389 Ga0207698_10032090 3300026142 Bacteria 3801
390 Ga0207698_10169177 3300026142 Bacteria 1922
391 Ga0209967_1014829 3300027364 Bacteria 1113
392 Ga0209984_1004834 3300027424 Bacteria 1599
393 Ga0209971_1030116 3300027682 Bacteria 1300
394 Ga0209966_1001562 3300027695 Bacteria 3973
395 Ga0209998_10001751 3300027717 Bacteria 5170
396 Ga0209974_10007536 3300027876 Bacteria 3746
397 Ga0209974_10135293 3300027876 Bacteria 881
398 Ga0207428_10001775 3300027907 Bacteria 22087
399 Ga0207428_10135509 3300027907 Bacteria 1883
400 Ga0265357_1001984 3300028023 Bacteria 1606
401 Ga0268265_10852735 3300028380 Bacteria 891
402 Ga0268264_10715878 3300028381 Bacteria 995
403 Ga0265337_1000392 3300028556 Bacteria 23495
404 Ga0265334_10158943 3300028573 Unclassified 795
405 Ga0265318_10160361 3300028577 Bacteria 825
406 Ga0265336_10023243 3300028666 Bacteria 1968
407 Ga0265336_10070153 3300028666 Bacteria 1048
408 Ga0265338_10019605 3300028800 Bacteria 7161
409 Ga0265338_10055484 3300028800 Unclassified 3523
410 Ga0265338_10180192 3300028800 Bacteria 1611
411 Ga0265338_10386624 3300028800 Bacteria 1000
412 Ga0265338_10424048 3300028800 Bacteria 945
413 Ga0265762_1008462 3300030760 Bacteria 1831
414 Ga0265763_1006955 3300030763 Bacteria 983
415 Ga0265773_1009487 3300031018 Bacteria 803
416 Ga0265320_10031235 3300031240 Bacteria 2738
417 Ga0265325_10027622 3300031241 Bacteria 3066
418 Ga0265325_10127860 3300031241 Bacteria 1219
419 Ga0265325_10219074 3300031241 Bacteria 871
420 Ga0265329_10068488 3300031242 Bacteria 1123
421 Ga0265340_10046017 3300031247 Bacteria 2129
422 Ga0265339_10000067 3300031249 Bacteria 91730
423 Ga0265339_10028158 3300031249 Bacteria 3197
424 Ga0265331_10165224 3300031250 Bacteria 1002
425 Ga0265313_10000008 3300031595 Bacteria 173405
426 Ga0265313_10000054 3300031595 Bacteria 110199
427 Ga0265313_10001334 3300031595 Bacteria 23230
428 Ga0265313_10098470 3300031595 Bacteria 1301
429 Ga0265313_10191661 3300031595 Unclassified 854
430 Ga0265314_10053303 3300031711 Bacteria 2806
431 Ga0265314_10364109 3300031711 Bacteria 792
432 Ga0265342_10000149 3300031712 Bacteria 79177
433 Ga0265342_10007224 3300031712 Bacteria 8166
434 Ga0265342_10067985 3300031712 Bacteria 2083
435 Ga0373930_0186184 3300034816 Unclassified 535
436 Ga0373950_0011373 3300034818 Bacteria 1453
437 Ga0373958_0022249 3300034819 Bacteria 1183
438 Ga0373958_0027128 3300034819 Bacteria 1101
439 Ga0373958_0116799 3300034819 Bacteria 641
440 Ga0373959_0088080 3300034820 Unclassified 724
441 Ga0373938_0003952 3300034957 Bacteria 2453
442 Ga0373926_0394473 3300035083 Unclassified 546
443 Ga0373929_0053004 3300035085 Bacteria 931
444 Ga0373934_0109203 3300035086 Bacteria 1121
445 Ga0373934_0276501 3300035086 Bacteria 695
446 Ga0373940_0014218 3300035088 Unclassified 1938
447 Ga0373940_0021877 3300035088 Bacteria 1639
448 Ga0373940_0089878 3300035088 Bacteria 918
449 Ga0373940_0092088 3300035088 Bacteria 909
450 Ga0373944_0157031 3300035089 Bacteria 805
451 Ga0373949_0003732 3300035090 Bacteria 3558
452 Ga0373949_0073931 3300035090 Bacteria 897
453 Ga0373949_0128509 3300035090 Unclassified 717
454 Ga0373952_0004671 3300035092 Bacteria 2489
455 Ga0373923_0112170 3300035111 Bacteria 1212
456 Ga0373932_0004720 3300035112 Plasmid 3215
457 Ga0373932_0136645 3300035112 Bacteria 830
458 Ga0373936_0086935 3300035113 Bacteria 1307
459 Ga0373936_0169550 3300035113 Bacteria 954
460 Ga0373936_0210188 3300035113 Bacteria 861
461 Ga0373936_0379133 3300035113 Unclassified 647
462 Ga0373939_0008600 3300035114 Bacteria 2506
463 Ga0373939_0014713 3300035114 Bacteria 2035
464 Ga0373939_0172527 3300035114 Bacteria 801
465 Ga0373939_0303057 3300035114 Bacteria 638
466 Ga0373941_0046420 3300035115 Bacteria 1364
467 Ga0373941_0047460 3300035115 Bacteria 1353
468 Ga0373953_0116741 3300035117 Bacteria 1132
469 Ga0373954_0037304 3300035118 Bacteria 2259
470 Ga0373954_0191933 3300035118 Bacteria 1003
471 Ga0373956_0015245 3300035119 Bacteria 3216
472 Ga0373956_0017759 3300035119 Bacteria 3004
473 Ga0373956_0056809 3300035119 Bacteria 1768
474 Ga0373957_0092046 3300035120 Bacteria 1206
475 Ga0373960_0015719 3300035121 Bacteria 1936
476 Ga0373960_0174811 3300035121 Bacteria 746
477 Ga0373943_0504811 3300035170 Unclassified 707
478 Ga0373943_0897704 3300035170 Unclassified 529
479 Ga0373955_0018454 3300035172 Bacteria 3469
480 Ga0373955_0021196 3300035172 Bacteria 3277
481 Ga0373961_0052445 3300035241 Bacteria 1214
482 Ga0373961_0105830 3300035241 Bacteria 916
483 Ga0373962_0109960 3300035242 Bacteria 868
484 Ga0373931_0001195 3300035691 Bacteria 11097
485 Ga0373931_0007996 3300035691 Bacteria 5003
486 Ga0373931_0017638 3300035691 Bacteria 3534
487 Ga0373935_0066595 3300035692 Bacteria 2314
488 Ga0373935_1137906 3300035692 Unclassified 581
489 Ga0373927_0195561 3300035695 Unclassified 1327
490 Ga0373927_0998581 3300035695 Bacteria 552
491 Ga0373927_1040583 3300035695 Bacteria 540
492 Ga0373933_0001753 3300035724 Bacteria 12585
493 Ga0373933_0010958 3300035724 Bacteria 4980
494 Ga0373933_0304089 3300035724 Unclassified 1033
495 Ga0373933_0410025 3300035724 Unclassified 884
496 Ga0373933_0778961 3300035724 Bacteria 629
497 Ga0373933_0782317 3300035724 Bacteria 628
498 Ga0373947_0026548 3300035725 Bacteria 3387
499 Ga0373937_0001600 3300036401 Bacteria 19030
500 Ga0373937_0030498 3300036401 Bacteria 4883
501 Ga0373937_0140632 3300036401 Bacteria 2258
502 Ga0373937_0319559 3300036401 Bacteria 1469
503 Ga0373937_0749815 3300036401 Bacteria 924
504 Ga0373937_0967545 3300036401 Bacteria 800
505 Ga0373925_0174120 3300037068 Bacteria 1700
506 Ga0373925_1137665 3300037068 Unclassified 642
507 Ga0373925_1228867 3300037068 Unclassified 615
508 Ga0395899_0019462 3300037312 Bacteria 5156
509 Ga0395899_0037595 3300037312 Bacteria 3629
510 Ga0395899_0503535 3300037312 Bacteria 785
511 Ga0395900_0002835 3300037418 Bacteria 18922
512 Ga0395900_0060937 3300037418 Bacteria 3881
513 Ga0395898_0020711 3300037466 Bacteria 6676
514 Ga0395898_0039797 3300037466 Bacteria 4651
515 Ga0395905_1090615 3300037471 Bacteria 702
516 Ga0436364_0157208 3300037853 Bacteria 1442
517 Ga0395901_0060479 3300038443 Bacteria 3942
518 Ga0395901_1004450 3300038443 Bacteria 810
519 Ga0395901_1021732 3300038443 Bacteria 801
520 Ga0436363_0605949 3300039450 Unclassified 1212
521 Ga0436363_1269226 3300039450 Bacteria 624
522 Ga0436363_1520884 3300039450 Bacteria 507
523 Ga0451807_1460004 3300041486 Bacteria 778
524 Ga0466965_0231866 3300044683 Bacteria 986
525 Ga0466966_0035349 3300044684 Bacteria 3228
526 Ga0466963_0069563 3300044694 Bacteria 2366
527 Ga0466963_0205574 3300044694 Bacteria 1377
528 Ga0466963_0471552 3300044694 Unclassified 886
529 Ga0466957_0045980 3300044842 Bacteria 2648
530 Ga0466957_0082996 3300044842 Bacteria 1998
531 Ga0466957_0394145 3300044842 Unclassified 946
532 Ga0466957_0428042 3300044842 Bacteria 909
533 Ga0466959_0060604 3300045049 Bacteria 2753
534 Ga0466958_0116745 3300045836 Bacteria 1668
535 Ga0466958_0282568 3300045836 Unclassified 1064
536 Ga0466958_0516013 3300045836 Bacteria 776
537 Ga0466967_0286624 3300045976 Bacteria 1581
538 Ga0466967_0377574 3300045976 Bacteria 1376
539 Ga0466967_0430156 3300045976 Unclassified 1288
540 Ga0495603_0250944 3300046455 Unclassified 1019
541 Ga0495603_0865113 3300046455 Bacteria 514
542 Ga0495629_0217427 3300046459 Unclassified 1319
543 Ga0495651_0136753 3300046462 Bacteria 1781
544 Ga0495653_0223923 3300046463 Bacteria 1263
545 Ga0495639_0725362 3300046475 Bacteria 514
546 Ga0495662_0229984 3300046476 Bacteria 914
547 Ga0495585_0245013 3300046492 Unclassified 896
548 Ga0495594_0175887 3300046499 Bacteria 1218
549 Ga0495594_0871658 3300046499 Unclassified 506
550 Ga0495608_0069467 3300046511 Unclassified 2301
551 Ga0495628_0871868 3300046516 Bacteria 626
552 Ga0495630_0139035 3300046517 Bacteria 1846
553 Ga0495630_0754044 3300046517 Bacteria 744
554 Ga0495637_0287697 3300046520 Bacteria 585
555 Ga0495644_0401258 3300046523 Unclassified 543
556 Ga0495652_0312102 3300046529 Bacteria 1139
557 Ga0495652_0436462 3300046529 Unclassified 920
558 Ga0495652_0886949 3300046529 Bacteria 589
559 Ga0495640_0097145 3300046533 Bacteria 1937
560 Ga0495640_0924913 3300046533 Bacteria 516
561 Ga0495587_0019401 3300046536 Bacteria 4208
562 Ga0495667_0307461 3300046559 Bacteria 1004
563 Ga0495656_0173726 3300046615 Unclassified 1055
564 Ga0495634_0100867 3300046642 Bacteria 1865
565 Ga0495635_0241061 3300046663 Bacteria 1220
566 Ga0495657_0111305 3300046675 Bacteria 1734
567 Ga0495657_0216384 3300046675 Bacteria 1163
568 Ga0495657_0217849 3300046675 Bacteria 1158
569 Ga0495623_0288377 3300046679 Bacteria 911
570 Ga0495623_0327420 3300046679 Unclassified 840
571 Ga0495624_0276676 3300046690 Bacteria 1014
572 Ga0495600_0029434 3300046809 Bacteria 3556
573 Ga0495581_0343708 3300047315 Bacteria 871
574 Ga0495674_0060198 3300047319 Bacteria 3314
575 Ga0495674_0280904 3300047319 Unclassified 1364
576 Ga0495680_0050559 3300047322 Bacteria 3249
577 Ga0495675_0037501 3300047444 Bacteria 3087
578 Ga0495684_0364942 3300047471 Bacteria 1022
579 Ga0495684_0495241 3300047471 Bacteria 841
580 Ga0495602_0501164 3300048088 Bacteria 849
581 Ga0495602_0624187 3300048088 Bacteria 739
582 Ga0495602_1017825 3300048088 Bacteria 546
583 Ga0496100_0023241 3300048903 Bacteria 3764
584 Ga0496100_1337572 3300048903 Unclassified 565
585 Ga0496101_0089006 3300048904 Bacteria 2294
586 Ga0496101_0368700 3300048904 Bacteria 1129
587 Ga0496101_0605926 3300048904 Unclassified 866
588 Ga0496104_0000067 3300048907 Bacteria 108556
589 Ga0496104_0004008 3300048907 Bacteria 12765
590 Ga0496104_0250429 3300048907 Bacteria 1684
591 Ga0496104_1801698 3300048907 Bacteria 514
592 Ga0496105_0002048 3300048908 Bacteria 14575
593 Ga0496105_0013372 3300048908 Bacteria 6513
594 Ga0496105_0540877 3300048908 Bacteria 910
595 Ga0496106_0260318 3300048909 Bacteria 1388
596 Ga0496106_0545494 3300048909 Bacteria 930
597 Ga0496106_1156827 3300048909 Unclassified 605
598 Ga0496107_0381596 3300048910 Bacteria 1048
599 Ga0496107_0582204 3300048910 Bacteria 828
600 Ga0496107_0604260 3300048910 Bacteria 810
601 Ga0496108_0133014 3300048911 Bacteria 2138
602 Ga0496108_0841764 3300048911 Bacteria 790
603 Ga0496109_0178669 3300048912 Bacteria 1993
604 Ga0496109_0565810 3300048912 Bacteria 1072
605 Ga0496109_0862769 3300048912 Bacteria 843
606 Ga0496109_1626554 3300048912 Unclassified 580
607 Ga0496110_0341651 3300048913 Bacteria 1364
608 Ga0496110_0668502 3300048913 Bacteria 939
609 Ga0496110_1475413 3300048913 Unclassified 590
610 Ga0496111_0235155 3300048914 Bacteria 1361
611 Ga0496112_0535024 3300048915 Bacteria 1106
612 Ga0496112_0752160 3300048915 Bacteria 901
613 Ga0496112_1021326 3300048915 Bacteria 746
614 Ga0496112_1406033 3300048915 Unclassified 612
615 Ga0496113_0142775 3300048916 Bacteria 1885
616 Ga0496114_0154482 3300048917 Bacteria 1992
617 Ga0496114_0416169 3300048917 Bacteria 1190
618 Ga0496114_1139759 3300048917 Bacteria 665
619 Ga0496115_0006239 3300048918 Bacteria 8720
620 Ga0496115_0022708 3300048918 Bacteria 4865
621 Ga0496115_0241662 3300048918 Bacteria 1488
622 Ga0496115_0316133 3300048918 Bacteria 1278
623 Ga0496115_1411616 3300048918 Bacteria 514
624 Ga0496126_0260861 3300048929 Bacteria 1441
625 Ga0501031_0072115 3300049568 Bacteria 2249
626 Ga0501031_0443439 3300049568 Bacteria 839
627 Ga0501032_0096853 3300049569 Bacteria 1955
628 Ga0501032_0171123 3300049569 Bacteria 1424
629 Ga0501032_0256876 3300049569 Bacteria 1133
630 Ga0501032_0281068 3300049569 Unclassified 1077
631 Ga0501032_0324906 3300049569 Unclassified 992
632 Ga0501032_0538174 3300049569 Bacteria 745
633 Ga0501033_0046916 3300049570 Bacteria 3212
634 Ga0501033_0123747 3300049570 Bacteria 1875
635 Ga0501034_0049762 3300049571 Bacteria 4228
636 Ga0501034_0072395 3300049571 Bacteria 3455
637 Ga0501034_0072904 3300049571 Bacteria 3442
638 Ga0501034_0351557 3300049571 Bacteria 1402
639 Ga0501034_0467909 3300049571 Bacteria 1177
640 Ga0501034_0901287 3300049571 Bacteria 772
641 Ga0501036_0010084 3300049572 Bacteria 7785
642 Ga0501036_0088329 3300049572 Bacteria 2619
643 Ga0501036_1550053 3300049572 Unclassified 535
644 Ga0501037_0013231 3300049573 Bacteria 6079
645 Ga0501037_0017588 3300049573 Bacteria 5262
646 Ga0501037_0176618 3300049573 Bacteria 1516
647 Ga0501037_0177894 3300049573 Bacteria 1510
648 Ga0501038_0035296 3300049574 Bacteria 4391
649 Ga0501038_0037630 3300049574 Bacteria 4241
650 Ga0501038_0199109 3300049574 Bacteria 1608
651 Ga0501038_0279882 3300049574 Bacteria 1313
652 Ga0501039_0054944 3300049575 Bacteria 3083
653 Ga0501039_0173885 3300049575 Bacteria 1693
654 Ga0501039_0383304 3300049575 Bacteria 1104
655 Ga0501039_1258788 3300049575 Unclassified 571
656 Ga0501040_0085756 3300049576 Bacteria 2186
657 Ga0501042_0071066 3300049578 Bacteria 2490
658 Ga0501042_0099382 3300049578 Bacteria 2092
659 Ga0501043_0008560 3300049579 Bacteria 8064
660 Ga0501043_0085007 3300049579 Bacteria 2486
661 Ga0501043_0196826 3300049579 Unclassified 1565
662 Ga0501046_0011383 3300049580 Bacteria 7611
663 Ga0501047_0013184 3300049581 Bacteria 7828
664 Ga0501047_0044522 3300049581 Bacteria 4288
665 Ga0501047_0051905 3300049581 Bacteria 3963
666 Ga0501047_0246332 3300049581 Bacteria 1636
667 Ga0501047_0323891 3300049581 Bacteria 1380
668 Ga0501047_0354245 3300049581 Bacteria 1304
669 Ga0501047_0536008 3300049581 Bacteria 996
670 Ga0501048_0408040 3300049582 Bacteria 971
671 Ga0501067_0078669 3300049583 Bacteria 1827
672 Ga0501067_0336234 3300049583 Unclassified 841
673 Ga0501068_0100542 3300049584 Bacteria 1792
674 Ga0501068_0168231 3300049584 Bacteria 1382
675 Ga0501068_0270145 3300049584 Bacteria 1085
676 Ga0501068_0303379 3300049584 Bacteria 1022
677 Ga0501068_0713080 3300049584 Bacteria 656
678 Ga0501069_0156407 3300049585 Bacteria 1311
679 Ga0501069_0221156 3300049585 Bacteria 1100
680 Ga0501069_0541381 3300049585 Unclassified 696
681 Ga0501069_1021030 3300049585 Bacteria 505
682 Ga0501070_0002707 3300049586 Bacteria 15475
683 Ga0501070_0044379 3300049586 Bacteria 3699
684 Ga0501070_0070348 3300049586 Bacteria 2897
685 Ga0501070_0210130 3300049586 Unclassified 1597
686 Ga0501070_0268200 3300049586 Unclassified 1394
687 Ga0501070_0280522 3300049586 Bacteria 1359
688 Ga0501070_0447573 3300049586 Bacteria 1041
689 Ga0501070_1501202 3300049586 Bacteria 510
690 Ga0501071_0098785 3300049587 Bacteria 2151
691 Ga0501071_0913602 3300049587 Unclassified 677
692 Ga0501071_1331588 3300049587 Bacteria 555
693 Ga0501072_0000782 3300049588 Bacteria 23297
694 Ga0501072_0219705 3300049588 Bacteria 1514
695 Ga0501072_0386538 3300049588 Bacteria 1110
696 Ga0501072_0548562 3300049588 Bacteria 913
697 Ga0501072_1552922 3300049588 Bacteria 510
698 Ga0501073_0038202 3300049589 Bacteria 3407
699 Ga0501073_0043243 3300049589 Bacteria 3176
700 Ga0501073_0057373 3300049589 Bacteria 2722
701 Ga0501073_0690086 3300049589 Bacteria 704
702 Ga0501074_0050404 3300049590 Bacteria 3005
703 Ga0501074_0062414 3300049590 Bacteria 2683
704 Ga0501074_0140105 3300049590 Bacteria 1730
705 Ga0501074_0280044 3300049590 Bacteria 1186
706 Ga0501074_0961409 3300049590 Unclassified 601
707 Ga0501075_1009477 3300049591 Bacteria 632
708 Ga0501076_0135914 3300049592 Bacteria 1996
709 Ga0501076_1159256 3300049592 Bacteria 636
710 Ga0501079_0229689 3300049741 Bacteria 1449
711 Ga0501079_0319864 3300049741 Bacteria 1215
712 Ga0501079_0645766 3300049741 Bacteria 833
713 Ga0501079_1289278 3300049741 Unclassified 575
714 Ga0501080_0009903 3300049742 Bacteria 8709
715 Ga0501080_0077636 3300049742 Bacteria 3088
716 Ga0501080_0404702 3300049742 Bacteria 1227
717 Ga0501080_0571838 3300049742 Bacteria 1005
718 Ga0501080_0612835 3300049742 Unclassified 965
719 Ga0501080_0978867 3300049742 Bacteria 734
720 Ga0501080_1450033 3300049742 Bacteria 584
721 Ga0501080_1742723 3300049742 Bacteria 524
722 Ga0501083_0005799 3300049744 Bacteria 8748
723 Ga0501083_0058027 3300049744 Bacteria 2591
724 Ga0501083_0090154 3300049744 Bacteria 2025
725 Ga0501083_0297073 3300049744 Bacteria 1050
726 Ga0501083_0325444 3300049744 Bacteria 999
727 Ga0501083_0371283 3300049744 Bacteria 930
728 Ga0501083_0416186 3300049744 Bacteria 874
729 Ga0501083_0923593 3300049744 Bacteria 568
730 Ga0501035_0005974 3300049822 Bacteria 11461
731 Ga0501035_0025688 3300049822 Bacteria 5399
732 Ga0501035_0041168 3300049822 Bacteria 4172
733 Ga0501035_0359788 3300049822 Unclassified 1216
734 Ga0501035_0494322 3300049822 Bacteria 1007
735 Ga0501044_0027637 3300049823 Bacteria 5992
736 Ga0501044_0043089 3300049823 Bacteria 4690
737 Ga0501044_0045871 3300049823 Bacteria 4527
738 Ga0501044_0400900 3300049823 Bacteria 1284
739 Ga0501044_0579593 3300049823 Bacteria 1016
740 Ga0501044_0974324 3300049823 Bacteria 720
741 Ga0501044_1064815 3300049823 Bacteria 679
742 Ga0501044_1294392 3300049823 Bacteria 595
743 Ga0501045_0179876 3300049824 Bacteria 1576
744 nmdc:mga05p37_1114794_c1 3300050507 Bacteria 825
745 nmdc:mga05p37_1321979_c1 3300050507 Bacteria 733
746 nmdc:mga05p37_16545_c1 3300050507 Bacteria 8886
747 nmdc:mga05p37_175553_c1 3300050507 Bacteria 2610
748 nmdc:mga05p37_5568_c1 3300050507 Bacteria 14809
749 nmdc:mga05p37_66271_c1 3300050507 Bacteria 4442
750 nmdc:mga09592_107351_c1 3300050508 Unclassified 2394
751 nmdc:mga09592_3379_c1 3300050508 Bacteria 12889
752 nmdc:mga0qj67_1113_c1 3300050509 Bacteria 18647
753 nmdc:mga06r32_152157_c1 3300050510 Bacteria 2293
754 nmdc:mga06r32_533707_c1 3300050510 Bacteria 1148
755 nmdc:mga08y16_1084629_c1 3300050511 Unclassified 776
756 nmdc:mga08y16_113734_c1 3300050511 Bacteria 2818
757 nmdc:mga08y16_207456_c1 3300050511 Bacteria 2030
758 nmdc:mga08y16_338303_c1 3300050511 Unclassified 1547
759 nmdc:mga0n895_1334170_c1 3300050512 Bacteria 687
760 nmdc:mga0n895_25858_c1 3300050512 Bacteria 5552
761 nmdc:mga0n895_28151_c1 3300050512 Bacteria 5345
762 nmdc:mga0n895_486830_c1 3300050512 Bacteria 1244
763 nmdc:mga0n895_607_c1 3300050512 Bacteria 24823
764 nmdc:mga0n895_78358_c1 3300050512 Bacteria 3289
765 nmdc:mga0n895_894737_c1 3300050512 Bacteria 873
766 nmdc:mga0rr50_1041881_c1 3300050513 Unclassified 697
767 nmdc:mga0rr50_117824_c1 3300050513 Bacteria 2109
768 nmdc:mga0rr50_1197754_c1 3300050513 Bacteria 645
769 nmdc:mga0rr50_19060_c1 3300050513 Bacteria 4622
770 nmdc:mga0rr50_443901_c1 3300050513 Bacteria 1099
771 nmdc:mga0rr50_55144_c1 3300050513 Bacteria 2964
772 nmdc:mga0rr50_866238_c1 3300050513 Bacteria 770
773 nmdc:mga08x19_139076_c1 3300050514 Bacteria 1639
774 nmdc:mga08x19_202077_c1 3300050514 Bacteria 1362
775 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
776 nmdc:mga08x19_386841_c1 3300050514 Bacteria 980
777 nmdc:mga08x19_763801_c1 3300050514 Bacteria 686
778 nmdc:mga0a205_10764_c1 3300050515 Bacteria 8411
779 nmdc:mga0a205_282241_c1 3300050515 Bacteria 1536
780 Ga0495601_0030006 3300053077 Bacteria 3375
781 Ga0495601_0378120 3300053077 Unclassified 919
782 Ga0495612_0145136 3300053078 Bacteria 1031
783 Ga0495595_0106696 3300053084 Bacteria 1355
784 Ga0495595_0147550 3300053084 Unclassified 1156
785 Ga0495595_0664744 3300053084 Bacteria 533
786 Ga0495619_0052832 3300053085 Bacteria 2687
787 Ga0495619_0073278 3300053085 Unclassified 2294
788 Ga0495619_0451291 3300053085 Bacteria 886
789 Ga0495619_0713210 3300053085 Unclassified 682
790 Ga0500566_0226707 3300053094 Bacteria 925
791 Ga0501084_0093215 3300054114 Bacteria 2529
792 Ga0501084_0168362 3300054114 Bacteria 1849
793 Ga0501082_0049803 3300060353 Bacteria 3612
794 Ga0501082_0070160 3300060353 Bacteria 3017
795 Ga0501082_0341385 3300060353 Unclassified 1305
796 Ga0501082_0688983 3300060353 Bacteria 894
797 Ga0501082_0785474 3300060353 Bacteria 833
798 Ga0501082_1011303 3300060353 Unclassified 727
799 Ga0501082_1620392 3300060353 Bacteria 565
800 Ga0466962_0107654 3300061719 Unclassified 1341
801 Ga0466962_0196211 3300061719 Bacteria 986
802 2885414855 2885409591 Bacteria 9235467
803 Ga0157370_10684826
804 JGI24737J22298_10012617
805 JGI25406J46586_10024907
806 JGI26129J50193_1004572
807 Ga0058862_12345862
808 Ga0065712_10004833
809 Ga0065715_10000599
810 Ga0070658_10013065
811 Ga0070658_10024039
812 Ga0070658_10035038
813 Ga0070658_11944937
814 Ga0070676_10715999
815 Ga0070683_100032239
816 Ga0070683_100416188
817 Ga0070683_100418100
818 Ga0070690_100049918
819 Ga0070680_100039083
820 Ga0070680_100088679
821 Ga0070680_100090384
822 Ga0070680_100202220
823 Ga0070680_100795782
824 Ga0070680_101115928
825 Ga0070680_101820842
826 Ga0070680_101874430
827 Ga0070682_100089449
828 Ga0070682_100158178
829 Ga0070660_100054971
830 Ga0070660_100214057
831 Ga0070660_100294924
832 Ga0070660_100548774
833 Ga0070660_100825518
834 Ga0070660_101176594
835 Ga0070689_100023874
836 Ga0070691_10484329
837 Ga0070661_100175692
838 Ga0070661_100657846
839 Ga0070661_101514878
840 Ga0070692_10103081
841 Ga0070692_11383763
842 Ga0070668_100823115
843 Ga0070669_100122694
844 Ga0070675_100263836
845 Ga0070688_100005463
846 Ga0070659_100032222
847 Ga0070659_100116410
848 Ga0070659_101341665
849 Ga0070659_101616200
850 Ga0070667_100109105
851 Ga0070709_10089951
852 Ga0070709_10207343
853 Ga0070709_11025350
854 Ga0070709_11656891
855 Ga0070714_100146923
856 Ga0070714_100390384
857 Ga0070714_100438726
858 Ga0070714_100471326
859 Ga0070714_100972250
860 Ga0070714_101950780
861 Ga0070713_100076661
862 Ga0070713_100093597
863 Ga0070713_100225974
864 Ga0070713_100867662
865 Ga0070710_10294650
866 Ga0070710_11037587
867 Ga0070711_100053369
868 Ga0070711_100066719
869 Ga0070711_100148771
870 Ga0070711_100190491
871 Ga0070711_100622947
872 Ga0070711_101516516
873 Ga0070705_100011491
874 Ga0070705_100285888
875 Ga0070705_100612518
876 Ga0070694_100016644
877 Ga0070694_101089911
878 Ga0070708_100230944
879 Ga0070663_100454600
880 Ga0070663_100779962
881 Ga0070663_101669735
882 Ga0070662_100085855
883 Ga0070681_10049722
884 Ga0070681_10057595
885 Ga0070681_10080814
886 Ga0070681_10130035
887 Ga0070681_10423055
888 Ga0070681_10536080
889 Ga0070681_10760706
890 Ga0070681_10882600
891 Ga0070681_11040707
892 Ga0070706_100280002
893 Ga0070706_101425085
894 Ga0070707_100041517
895 Ga0070707_100412457
896 Ga0070698_100254410
897 Ga0070698_100826383
898 Ga0070698_100904926
899 Ga0070699_101180884
900 Ga0070679_100053269
901 Ga0070679_100123763
902 Ga0070679_100174191
903 Ga0070679_100197136
904 Ga0070679_100308368
905 Ga0070679_100481115
906 Ga0070679_101526965
907 Ga0070684_100011798
908 Ga0070684_100076336
909 Ga0070684_100466003
910 Ga0070684_100569265
911 Ga0070684_100666465
912 Ga0070684_101258669
913 Ga0070697_100130012
914 Ga0070697_100455783
915 Ga0068853_100500330
916 Ga0068853_100511201
917 Ga0068853_100729109
918 Ga0068853_100972762
919 Ga0070695_100008417
920 Ga0070695_100058186
921 Ga0070695_100998929
922 Ga0070696_100223735
923 Ga0070693_100137844
924 Ga0070693_100300069
925 Ga0070693_101189448
926 Ga0070665_100864733
927 Ga0070704_100597471
928 Ga0070704_100617929
929 Ga0068855_100388380
930 Ga0068855_100425052
931 Ga0068855_100881408
932 Ga0068855_101550194
933 Ga0068855_101643974
934 Ga0068855_101749623
935 Ga0070664_100040912
936 Ga0070664_100081092
937 Ga0070664_100580847
938 Ga0070664_100892977
939 Ga0068857_101084042
940 Ga0068857_101527769
941 Ga0068854_100120056
942 Ga0068854_100284874
943 Ga0068856_100480771
944 Ga0068856_100625545
945 Ga0068856_100687586
946 Ga0068856_100773034
947 Ga0068856_100982721
948 Ga0068856_102096413
949 Ga0070702_100210230
950 Ga0068852_100139846
951 Ga0068852_100209924
952 Ga0068852_101055929
953 Ga0068859_100018246
954 Ga0068864_101311369
955 Ga0068864_102221581
956 Ga0068866_10883210
957 Ga0068861_100036856
958 Ga0068861_101980183
959 Ga0068858_100520821
960 Ga0068860_100766423
961 Ga0068862_100803067
962 Ga0081455_10039235
963 Ga0081455_10123124
964 Ga0081455_10310658
965 Ga0081540_1001983
966 Ga0081540_1209152
967 Ga0081539_10001619
968 Ga0081539_10210234
969 Ga0070717_10136710
970 Ga0070717_10372259
971 Ga0070717_10405268
972 Ga0070717_11441443
973 Ga0075365_10176274
974 Ga0075365_11194438
975 Ga0075432_10040919
976 Ga0070715_10036675
977 Ga0070715_10045001
978 Ga0070716_101164615
979 Ga0070716_101370811
980 Ga0070712_100096732
981 Ga0070712_100169362
982 Ga0070712_100314937
983 Ga0070712_100668327
984 Ga0070712_101575972
985 Ga0075427_10005597
986 Ga0097621_100119577
987 Ga0097621_101966892
988 Ga0068871_100067574
989 Ga0075428_100015867
990 Ga0075428_100251925
991 Ga0075428_100259938
992 Ga0075428_101379851
993 Ga0075430_100002456
994 Ga0075431_100004056
995 Ga0075431_100946817
996 Ga0075433_10219263
997 Ga0075433_11027899
998 Ga0075433_11210384
999 Ga0075433_11875592
1000 Ga0075434_100020582
1001 Ga0075434_100073455
1002 Ga0075434_101061984
1003 Ga0075434_101410357
1004 Ga0075434_102549805
1005 Ga0075429_100006674
1006 Ga0075436_100008024
1007 Ga0075436_100122872
1008 Ga0075436_100467605
1009 Ga0075436_100518138
1010 Ga0097620_100018245
1011 Ga0075435_100072142
1012 Ga0075435_100154491
1013 Ga0075435_100366023
1014 Ga0075435_100580614
1015 Ga0075435_101320094
1016 Ga0099795_10434591
1017 Ga0099795_10441142
1018 Ga0105240_10041606
1019 Ga0105240_10123373
1020 Ga0105240_10339359
1021 Ga0105240_10380081
1022 Ga0111539_10005521
1023 Ga0111539_10251981
1024 Ga0111539_10698987
1025 Ga0111539_12054099
1026 Ga0114129_10079289
1027 Ga0114129_10174577
1028 Ga0114129_10628500
1029 Ga0114129_11313304
1030 Ga0114129_11450708
1031 Ga0105243_10148730
1032 Ga0105241_10085058
1033 Ga0105241_10576892
1034 Ga0105241_10792204
1035 Ga0105237_10273408
1036 Ga0105238_10017974
1037 Ga0105238_10221196
1038 Ga0105238_10647067
1039 Ga0105249_10038373
1040 Ga0105249_10862395
1041 Ga0105239_10083748
1042 Ga0105239_10278783
1043 Ga0105246_10185111
1044 Ga0105246_11031831
1045 Ga0157373_10069097
1046 Ga0157373_10345852
1047 Ga0157373_10690390
1048 Ga0157373_10869023
1049 Ga0157373_11061511
1050 Ga0157371_10182792
1051 Ga0157371_10296993
1052 Ga0157371_10538772
1053 Ga0157371_10578250
1054 Ga0157370_10062900
1055 Ga0157370_10201205
1056 Ga0157370_10354236
1057 Ga0157370_11418739
1058 Ga0157370_11589033
1059 Ga0157369_10118697
1060 Ga0157369_10194652
1061 Ga0157369_10441685
1062 Ga0163162_10975188
1063 Ga0157372_10476162
1064 Ga0157372_11155406
1065 Ga0157372_11729105
1066 Ga0157372_12789543
1067 Ga0157375_11678258
1068 Ga0157375_11896653
1069 Ga0157375_12726596
1070 Ga0157376_10076756
1071 Ga0206356_10500132
1072 Ga0207666_1000446
1073 Ga0207697_10005503
1074 Ga0207692_10177263
1075 Ga0207692_10486946
1076 Ga0207647_10006970
1077 Ga0207685_10025705
1078 Ga0207685_10225460
1079 Ga0207699_10128357
1080 Ga0207699_10423616
1081 Ga0207699_11037588
1082 Ga0207699_11107227
1083 Ga0207645_10277553
1084 Ga0207705_10038583
1085 Ga0207705_10160961
1086 Ga0207705_10746262
1087 Ga0207684_10046219
1088 Ga0207684_10174536
1089 Ga0207684_11145143
1090 Ga0207654_10150115
1091 Ga0207707_10128100
1092 Ga0207707_10133955
1093 Ga0207707_10268430
1094 Ga0207707_10323857
1095 Ga0207707_11382585
1096 Ga0207695_10250308
1097 Ga0207695_10627232
1098 Ga0207695_11333462
1099 Ga0207693_10001328
1100 Ga0207693_10003033
1101 Ga0207693_10040031
1102 Ga0207693_10132479
1103 Ga0207693_10175837
1104 Ga0207693_10815560
1105 Ga0207663_10026756
1106 Ga0207663_10053000
1107 Ga0207663_10215853
1108 Ga0207663_10444311
1109 Ga0207663_10539356
1110 Ga0207660_10233061
1111 Ga0207660_10579777
1112 Ga0207660_10608570
1113 Ga0207660_10617600
1114 Ga0207660_11108630
1115 Ga0207660_11210695
1116 Ga0207657_10051934
1117 Ga0207657_10823600
1118 Ga0207657_11255705
1119 Ga0207649_10105279
1120 Ga0207649_11564640
1121 Ga0207652_10056587
1122 Ga0207652_10159577
1123 Ga0207652_10325238
1124 Ga0207652_10335680
1125 Ga0207652_10352293
1126 Ga0207652_10426423
1127 Ga0207652_10570527
1128 Ga0207652_11615192
1129 Ga0207646_10326026
1130 Ga0207646_10382282
1131 Ga0207681_10034168
1132 Ga0207694_10230338
1133 Ga0207694_10296573
1134 Ga0207694_10469632
1135 Ga0207659_10278610
1136 Ga0207700_10054993
1137 Ga0207700_10102486
1138 Ga0207700_10374414
1139 Ga0207700_10382445
1140 Ga0207700_10972736
1141 Ga0207664_10062298
1142 Ga0207664_10194285
1143 Ga0207664_10371920
1144 Ga0207664_10819250
1145 Ga0207664_10848271
1146 Ga0207664_10861618
1147 Ga0207664_10938068
1148 Ga0207690_10140413
1149 Ga0207690_10297763
1150 Ga0207690_10385390
1151 Ga0207706_10008176
1152 Ga0207670_10027587
1153 Ga0207665_10004704
1154 Ga0207665_10040097
1155 Ga0207665_11209261
1156 Ga0207665_11407815
1157 Ga0207665_11503251
1158 Ga0207661_10155364
1159 Ga0207661_10534683
1160 Ga0207679_10155557
1161 Ga0207679_10273685
1162 Ga0207667_10009069
1163 Ga0207667_10043533
1164 Ga0207667_10117517
1165 Ga0207667_10546135
1166 Ga0207667_11023639
1167 Ga0207667_11393381
1168 Ga0207667_11413379
1169 Ga0207667_11977003
1170 Ga0207667_12011546
1171 Ga0207712_10381531
1172 Ga0207668_11653775
1173 Ga0207640_10172693
1174 Ga0207658_10087677
1175 Ga0207703_10484087
1176 Ga0207639_10110527
1177 Ga0207639_10374965
1178 Ga0207639_10518089
1179 Ga0207639_10628357
1180 Ga0207678_10151728
1181 Ga0207678_11012392
1182 Ga0207708_10006143
1183 Ga0207702_10263582
1184 Ga0207702_10520157
1185 Ga0207702_10560684
1186 Ga0207674_10358087
1187 Ga0207674_10748731
1188 Ga0207675_101531382
1189 Ga0207675_102386932
1190 Ga0207683_11779748
1191 Ga0207698_10032090
1192 Ga0207698_10169177
1193 Ga0209967_1014829
1194 Ga0209984_1004834
1195 Ga0209971_1030116
1196 Ga0209966_1001562
1197 Ga0209998_10001751
1198 Ga0209974_10007536
1199 Ga0209974_10135293
1200 Ga0207428_10001775
1201 Ga0207428_10135509
1202 Ga0265357_1001984
1203 Ga0268265_10852735
1204 Ga0268264_10715878
1205 Ga0265337_1000392
1206 Ga0265334_10158943
1207 Ga0265318_10160361
1208 Ga0265336_10023243
1209 Ga0265336_10070153
1210 Ga0265338_10019605
1211 Ga0265338_10055484
1212 Ga0265338_10180192
1213 Ga0265338_10386624
1214 Ga0265338_10424048
1215 Ga0265762_1008462
1216 Ga0265763_1006955
1217 Ga0265773_1009487
1218 Ga0265320_10031235
1219 Ga0265325_10027622
1220 Ga0265325_10127860
1221 Ga0265325_10219074
1222 Ga0265329_10068488
1223 Ga0265340_10046017
1224 Ga0265339_10000067
1225 Ga0265339_10028158
1226 Ga0265331_10165224
1227 Ga0265313_10000008
1228 Ga0265313_10000054
1229 Ga0265313_10001334
1230 Ga0265313_10098470
1231 Ga0265313_10191661
1232 Ga0265314_10053303
1233 Ga0265314_10364109
1234 Ga0265342_10000149
1235 Ga0265342_10007224
1236 Ga0265342_10067985
1237 Ga0373930_0186184
1238 Ga0373950_0011373
1239 Ga0373958_0022249
1240 Ga0373958_0027128
1241 Ga0373958_0116799
1242 Ga0373959_0088080
1243 Ga0373938_0003952
1244 Ga0373926_0394473
1245 Ga0373929_0053004
1246 Ga0373934_0109203
1247 Ga0373934_0276501
1248 Ga0373940_0014218
1249 Ga0373940_0021877
1250 Ga0373940_0089878
1251 Ga0373940_0092088
1252 Ga0373944_0157031
1253 Ga0373949_0003732
1254 Ga0373949_0073931
1255 Ga0373949_0128509
1256 Ga0373952_0004671
1257 Ga0373923_0112170
1258 Ga0373932_0004720
1259 Ga0373932_0136645
1260 Ga0373936_0086935
1261 Ga0373936_0169550
1262 Ga0373936_0210188
1263 Ga0373936_0379133
1264 Ga0373939_0008600
1265 Ga0373939_0014713
1266 Ga0373939_0172527
1267 Ga0373939_0303057
1268 Ga0373941_0046420
1269 Ga0373941_0047460
1270 Ga0373953_0116741
1271 Ga0373954_0037304
1272 Ga0373954_0191933
1273 Ga0373956_0015245
1274 Ga0373956_0017759
1275 Ga0373956_0056809
1276 Ga0373957_0092046
1277 Ga0373960_0015719
1278 Ga0373960_0174811
1279 Ga0373943_0504811
1280 Ga0373943_0897704
1281 Ga0373955_0018454
1282 Ga0373955_0021196
1283 Ga0373961_0052445
1284 Ga0373961_0105830
1285 Ga0373962_0109960
1286 Ga0373931_0001195
1287 Ga0373931_0007996
1288 Ga0373931_0017638
1289 Ga0373935_0066595
1290 Ga0373935_1137906
1291 Ga0373927_0195561
1292 Ga0373927_0998581
1293 Ga0373927_1040583
1294 Ga0373933_0001753
1295 Ga0373933_0010958
1296 Ga0373933_0304089
1297 Ga0373933_0410025
1298 Ga0373933_0778961
1299 Ga0373933_0782317
1300 Ga0373947_0026548
1301 Ga0373937_0001600
1302 Ga0373937_0030498
1303 Ga0373937_0140632
1304 Ga0373937_0319559
1305 Ga0373937_0749815
1306 Ga0373937_0967545
1307 Ga0373925_0174120
1308 Ga0373925_1137665
1309 Ga0373925_1228867
1310 Ga0395899_0019462
1311 Ga0395899_0037595
1312 Ga0395899_0503535
1313 Ga0395900_0002835
1314 Ga0395900_0060937
1315 Ga0395898_0020711
1316 Ga0395898_0039797
1317 Ga0395905_1090615
1318 Ga0436364_0157208
1319 Ga0395901_0060479
1320 Ga0395901_1004450
1321 Ga0395901_1021732
1322 Ga0436363_0605949
1323 Ga0436363_1269226
1324 Ga0436363_1520884
1325 Ga0451807_1460004
1326 Ga0466965_0231866
1327 Ga0466966_0035349
1328 Ga0466963_0069563
1329 Ga0466963_0205574
1330 Ga0466963_0471552
1331 Ga0466957_0045980
1332 Ga0466957_0082996
1333 Ga0466957_0394145
1334 Ga0466957_0428042
1335 Ga0466959_0060604
1336 Ga0466958_0116745
1337 Ga0466958_0282568
1338 Ga0466958_0516013
1339 Ga0466967_0286624
1340 Ga0466967_0377574
1341 Ga0466967_0430156
1342 Ga0495603_0250944
1343 Ga0495603_0865113
1344 Ga0495629_0217427
1345 Ga0495651_0136753
1346 Ga0495653_0223923
1347 Ga0495639_0725362
1348 Ga0495662_0229984
1349 Ga0495585_0245013
1350 Ga0495594_0175887
1351 Ga0495594_0871658
1352 Ga0495608_0069467
1353 Ga0495628_0871868
1354 Ga0495630_0139035
1355 Ga0495630_0754044
1356 Ga0495637_0287697
1357 Ga0495644_0401258
1358 Ga0495652_0312102
1359 Ga0495652_0436462
1360 Ga0495652_0886949
1361 Ga0495640_0097145
1362 Ga0495640_0924913
1363 Ga0495587_0019401
1364 Ga0495667_0307461
1365 Ga0495656_0173726
1366 Ga0495634_0100867
1367 Ga0495635_0241061
1368 Ga0495657_0111305
1369 Ga0495657_0216384
1370 Ga0495657_0217849
1371 Ga0495623_0288377
1372 Ga0495623_0327420
1373 Ga0495624_0276676
1374 Ga0495600_0029434
1375 Ga0495581_0343708
1376 Ga0495674_0060198
1377 Ga0495674_0280904
1378 Ga0495680_0050559
1379 Ga0495675_0037501
1380 Ga0495684_0364942
1381 Ga0495684_0495241
1382 Ga0495602_0501164
1383 Ga0495602_0624187
1384 Ga0495602_1017825
1385 Ga0496100_0023241
1386 Ga0496100_1337572
1387 Ga0496101_0089006
1388 Ga0496101_0368700
1389 Ga0496101_0605926
1390 Ga0496104_0000067
1391 Ga0496104_0004008
1392 Ga0496104_0250429
1393 Ga0496104_1801698
1394 Ga0496105_0002048
1395 Ga0496105_0013372
1396 Ga0496105_0540877
1397 Ga0496106_0260318
1398 Ga0496106_0545494
1399 Ga0496106_1156827
1400 Ga0496107_0381596
1401 Ga0496107_0582204
1402 Ga0496107_0604260
1403 Ga0496108_0133014
1404 Ga0496108_0841764
1405 Ga0496109_0178669
1406 Ga0496109_0565810
1407 Ga0496109_0862769
1408 Ga0496109_1626554
1409 Ga0496110_0341651
1410 Ga0496110_0668502
1411 Ga0496110_1475413
1412 Ga0496111_0235155
1413 Ga0496112_0535024
1414 Ga0496112_0752160
1415 Ga0496112_1021326
1416 Ga0496112_1406033
1417 Ga0496113_0142775
1418 Ga0496114_0154482
1419 Ga0496114_0416169
1420 Ga0496114_1139759
1421 Ga0496115_0006239
1422 Ga0496115_0022708
1423 Ga0496115_0241662
1424 Ga0496115_0316133
1425 Ga0496115_1411616
1426 Ga0496126_0260861
1427 Ga0501031_0072115
1428 Ga0501031_0443439
1429 Ga0501032_0096853
1430 Ga0501032_0171123
1431 Ga0501032_0256876
1432 Ga0501032_0281068
1433 Ga0501032_0324906
1434 Ga0501032_0538174
1435 Ga0501033_0046916
1436 Ga0501033_0123747
1437 Ga0501034_0049762
1438 Ga0501034_0072395
1439 Ga0501034_0072904
1440 Ga0501034_0351557
1441 Ga0501034_0467909
1442 Ga0501034_0901287
1443 Ga0501036_0010084
1444 Ga0501036_0088329
1445 Ga0501036_1550053
1446 Ga0501037_0013231
1447 Ga0501037_0017588
1448 Ga0501037_0176618
1449 Ga0501037_0177894
1450 Ga0501038_0035296
1451 Ga0501038_0037630
1452 Ga0501038_0199109
1453 Ga0501038_0279882
1454 Ga0501039_0054944
1455 Ga0501039_0173885
1456 Ga0501039_0383304
1457 Ga0501039_1258788
1458 Ga0501040_0085756
1459 Ga0501042_0071066
1460 Ga0501042_0099382
1461 Ga0501043_0008560
1462 Ga0501043_0085007
1463 Ga0501043_0196826
1464 Ga0501046_0011383
1465 Ga0501047_0013184
1466 Ga0501047_0044522
1467 Ga0501047_0051905
1468 Ga0501047_0246332
1469 Ga0501047_0323891
1470 Ga0501047_0354245
1471 Ga0501047_0536008
1472 Ga0501048_0408040
1473 Ga0501067_0078669
1474 Ga0501067_0336234
1475 Ga0501068_0100542
1476 Ga0501068_0168231
1477 Ga0501068_0270145
1478 Ga0501068_0303379
1479 Ga0501068_0713080
1480 Ga0501069_0156407
1481 Ga0501069_0221156
1482 Ga0501069_0541381
1483 Ga0501069_1021030
1484 Ga0501070_0002707
1485 Ga0501070_0044379
1486 Ga0501070_0070348
1487 Ga0501070_0210130
1488 Ga0501070_0268200
1489 Ga0501070_0280522
1490 Ga0501070_0447573
1491 Ga0501070_1501202
1492 Ga0501071_0098785
1493 Ga0501071_0913602
1494 Ga0501071_1331588
1495 Ga0501072_0000782
1496 Ga0501072_0219705
1497 Ga0501072_0386538
1498 Ga0501072_0548562
1499 Ga0501072_1552922
1500 Ga0501073_0038202
1501 Ga0501073_0043243
1502 Ga0501073_0057373
1503 Ga0501073_0690086
1504 Ga0501074_0050404
1505 Ga0501074_0062414
1506 Ga0501074_0140105
1507 Ga0501074_0280044
1508 Ga0501074_0961409
1509 Ga0501075_1009477
1510 Ga0501076_0135914
1511 Ga0501076_1159256
1512 Ga0501079_0229689
1513 Ga0501079_0319864
1514 Ga0501079_0645766
1515 Ga0501079_1289278
1516 Ga0501080_0009903
1517 Ga0501080_0077636
1518 Ga0501080_0404702
1519 Ga0501080_0571838
1520 Ga0501080_0612835
1521 Ga0501080_0978867
1522 Ga0501080_1450033
1523 Ga0501080_1742723
1524 Ga0501083_0005799
1525 Ga0501083_0058027
1526 Ga0501083_0090154
1527 Ga0501083_0297073
1528 Ga0501083_0325444
1529 Ga0501083_0371283
1530 Ga0501083_0416186
1531 Ga0501083_0923593
1532 Ga0501035_0005974
1533 Ga0501035_0025688
1534 Ga0501035_0041168
1535 Ga0501035_0359788
1536 Ga0501035_0494322
1537 Ga0501044_0027637
1538 Ga0501044_0043089
1539 Ga0501044_0045871
1540 Ga0501044_0400900
1541 Ga0501044_0579593
1542 Ga0501044_0974324
1543 Ga0501044_1064815
1544 Ga0501044_1294392
1545 Ga0501045_0179876
1546 nmdc:mga05p37_1114794_c1
1547 nmdc:mga05p37_1321979_c1
1548 nmdc:mga05p37_16545_c1
1549 nmdc:mga05p37_175553_c1
1550 nmdc:mga05p37_5568_c1
1551 nmdc:mga05p37_66271_c1
1552 nmdc:mga09592_107351_c1
1553 nmdc:mga09592_3379_c1
1554 nmdc:mga0qj67_1113_c1
1555 nmdc:mga06r32_152157_c1
1556 nmdc:mga06r32_533707_c1
1557 nmdc:mga08y16_1084629_c1
1558 nmdc:mga08y16_113734_c1
1559 nmdc:mga08y16_207456_c1
1560 nmdc:mga08y16_338303_c1
1561 nmdc:mga0n895_1334170_c1
1562 nmdc:mga0n895_25858_c1
1563 nmdc:mga0n895_28151_c1
1564 nmdc:mga0n895_486830_c1
1565 nmdc:mga0n895_607_c1
1566 nmdc:mga0n895_78358_c1
1567 nmdc:mga0n895_894737_c1
1568 nmdc:mga0rr50_1041881_c1
1569 nmdc:mga0rr50_117824_c1
1570 nmdc:mga0rr50_1197754_c1
1571 nmdc:mga0rr50_19060_c1
1572 nmdc:mga0rr50_443901_c1
1573 nmdc:mga0rr50_55144_c1
1574 nmdc:mga0rr50_866238_c1
1575 nmdc:mga08x19_139076_c1
1576 nmdc:mga08x19_202077_c1
1577 nmdc:mga08x19_35_c1
1578 nmdc:mga08x19_386841_c1
1579 nmdc:mga08x19_763801_c1
1580 nmdc:mga0a205_10764_c1
1581 nmdc:mga0a205_282241_c1
1582 Ga0495601_0030006
1583 Ga0495601_0378120
1584 Ga0495612_0145136
1585 Ga0495595_0106696
1586 Ga0495595_0147550
1587 Ga0495595_0664744
1588 Ga0495619_0052832
1589 Ga0495619_0073278
1590 Ga0495619_0451291
1591 Ga0495619_0713210
1592 Ga0500566_0226707
1593 Ga0501084_0093215
1594 Ga0501084_0168362
1595 Ga0501082_0049803
1596 Ga0501082_0070160
1597 Ga0501082_0341385
1598 Ga0501082_0688983
1599 Ga0501082_0785474
1600 Ga0501082_1011303
1601 Ga0501082_1620392
1602 Ga0466962_0107654
1603 Ga0466962_0196211
1604 2885414855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ca4-assembly1.cif.gz_B sulfite dehydrogenase from starkeya novella mutant 0.9118 21 91
3a9f-assembly2.cif.gz_B crystal structure of the c-terminal domain of cytochrome cz from chlorobium tepidum 0.8458 31 91
2ca4-assembly1.cif.gz_B sulfite dehydrogenase from starkeya novella mutant 0.7967 21 91
1pby-assembly1.cif.gz_A structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from paracoccus denitrificans at 1.7 a resolution 0.7507 29 87
3a9f-assembly2.cif.gz_B crystal structure of the c-terminal domain of cytochrome cz from chlorobium tepidum 0.6787 31 91
ID Description Score Start End Superfamily
2blfB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9194 29 91 1.10.760.10
2blfB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9059 29 91 1.10.760.10
3a9fB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8457 31 91 1.10.760.10
3a9fA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8246 31 91 1.10.760.10
3a9fB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.758 31 91 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A537NDA0-F1-model_v4 Cytochrome c domain-containing protein 0.9791 36 93 GO:0009055
GO:0020037
AF-A0A1F9C114-F1-model_v4 Sulfide dehydrogenase 0.9645 24 93 GO:0009055
GO:0020037
AF-A0A1F9A7A9-F1-model_v4 Sulfite:cytochrome C oxidoreductase subunit B 0.9508 24 93 GO:0009055
GO:0020037
AF-A0A537NDA0-F1-model_v4 Cytochrome c domain-containing protein 0.9472 36 93 GO:0009055
GO:0020037
AF-A0A7X6G105-F1-model_v4 deleted 0.9466 24 92

Map