F481456
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 802 | 438 | 687 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300006163|Ga0070715_10265100|Ga0070715_102651001 |
| Length | 248 |
| Sequence | MQWEIDSSILELYGNKRQGERFGFRLRNMTHARQESPVANPLKVEFQFDFGSPNAYLAEYLIPSIERRTGVKFDYVPVLLGGIYKATGNMSPSDSLRGIKNKPEYQALETQRFLRRHNVTKFRQNPFFPVNTLMLMRGVVAAQLEGLFESYFRAAYHHMWEEPKKMDDVEVFRAAFKSSGIDIDHLIARAQQDDVKKRLIELTNDAVARGAFGSPTFFVGEEMFFGKDQLRDVEEEIMEQKGRIAKAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 6 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 7 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 8 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 9 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 10 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 11 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 12 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 13 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 14 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 15 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 16 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 17 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 18 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 19 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 20 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 21 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 22 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 23 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 24 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 25 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 26 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 27 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 28 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 29 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 30 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 31 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 32 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 33 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 34 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 35 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 36 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 37 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 38 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 39 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 40 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 41 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 42 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 43 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 44 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 45 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 46 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 47 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 48 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 49 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 50 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 51 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 52 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 53 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 54 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 55 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 56 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 57 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 58 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 59 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 60 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 61 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 62 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 63 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 64 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 65 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 66 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 67 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 68 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 69 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 70 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 71 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 72 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 73 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 74 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 75 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 76 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 80 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 82 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 84 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 87 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 116 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 123 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 124 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 125 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 126 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 127 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 128 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 129 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 130 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 131 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 132 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 133 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 134 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 136 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 137 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 138 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 139 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 140 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 141 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 143 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 144 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 145 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 146 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 148 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 149 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 150 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 151 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 152 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 154 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 155 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 156 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 157 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 158 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 170 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 185 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 186 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 187 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 188 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 249 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 250 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 256 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 257 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 258 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 259 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 262 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 263 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 264 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 265 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 266 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 269 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 278 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 279 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 280 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 281 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 282 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 283 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 284 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 285 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 286 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 287 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 290 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 291 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 345 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 346 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 347 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 348 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 351 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 354 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 355 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 356 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 357 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 358 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 361 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 362 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 380 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 381 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 382 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 390 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 391 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 392 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 393 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 394 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 396 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 397 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 398 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 399 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 400 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 401 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 403 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 404 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 405 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 407 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 410 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 411 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 412 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 413 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 414 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 415 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 416 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 417 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 418 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 419 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 420 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 421 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 422 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 423 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 424 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 425 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 426 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 427 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 428 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 429 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 430 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 431 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 432 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 433 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 434 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 435 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 436 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 437 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 438 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.54 |
| Metatranscriptomes | 0.12 |
| Isolates | 14.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.46 |
| Nodule | 11.6 |
| Rhizoplane | 3.87 |
| Rhizosphere | 61.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10081553 | 3300001989 | Bacteria | 993 |
| 2 | JGI25165J46597_1002506 | 3300003214 | Bacteria | 5820 |
| 3 | JGI25153J46596_10000116 | 3300003215 | Bacteria | 90318 |
| 4 | rootH2_10200493 | 3300003320 | Bacteria | 2321 |
| 5 | rootH1_10265149 | 3300003323 | Bacteria | 1386 |
| 6 | JGI25404J52841_10000495 | 3300003659 | Bacteria | 5706 |
| 7 | JGI25404J52841_10001459 | 3300003659 | Bacteria | 4165 |
| 8 | JGI25404J52841_10001668 | 3300003659 | Bacteria | 3990 |
| 9 | Ga0055531_10008838 | 3300003794 | Bacteria | 5239 |
| 10 | Ga0055543_1020287 | 3300004625 | Bacteria | 1222 |
| 11 | Ga0065165_1000183 | 3300005262 | Bacteria | 109988 |
| 12 | Ga0065165_1050476 | 3300005262 | Bacteria | 1184 |
| 13 | Ga0070683_100000135 | 3300005329 | Bacteria | 47783 |
| 14 | Ga0070683_100385312 | 3300005329 | Bacteria | 1336 |
| 15 | Ga0070690_100644885 | 3300005330 | Bacteria | 808 |
| 16 | Ga0070670_100357222 | 3300005331 | Bacteria | 1284 |
| 17 | Ga0070670_100700259 | 3300005331 | Bacteria | 911 |
| 18 | Ga0068869_100002313 | 3300005334 | Bacteria | 11463 |
| 19 | Ga0068869_100236175 | 3300005334 | Bacteria | 1454 |
| 20 | Ga0070666_10068587 | 3300005335 | Bacteria | 2410 |
| 21 | Ga0070682_100532377 | 3300005337 | Bacteria | 916 |
| 22 | Ga0068868_100001022 | 3300005338 | Bacteria | 19117 |
| 23 | Ga0068868_100069556 | 3300005338 | Bacteria | 2805 |
| 24 | Ga0070689_100159468 | 3300005340 | Bacteria | 1823 |
| 25 | Ga0070689_100182922 | 3300005340 | Bacteria | 1703 |
| 26 | Ga0070661_100501004 | 3300005344 | Bacteria | 972 |
| 27 | Ga0070668_100006628 | 3300005347 | Bacteria | 8582 |
| 28 | Ga0070668_100015257 | 3300005347 | Bacteria | 5740 |
| 29 | Ga0070668_100032556 | 3300005347 | Bacteria | 3967 |
| 30 | Ga0070668_100116658 | 3300005347 | Bacteria | 2129 |
| 31 | Ga0070668_100246549 | 3300005347 | Bacteria | 1481 |
| 32 | Ga0070669_100255471 | 3300005353 | Bacteria | 1397 |
| 33 | Ga0070675_100203658 | 3300005354 | Bacteria | 1718 |
| 34 | Ga0070671_100011334 | 3300005355 | Bacteria | 7166 |
| 35 | Ga0070671_100051419 | 3300005355 | Bacteria | 3427 |
| 36 | Ga0070674_100002565 | 3300005356 | Bacteria | 10051 |
| 37 | Ga0070673_100625353 | 3300005364 | Bacteria | 984 |
| 38 | Ga0070688_100176367 | 3300005365 | Bacteria | 1479 |
| 39 | Ga0070659_100300463 | 3300005366 | Bacteria | 1339 |
| 40 | Ga0070667_100029578 | 3300005367 | Bacteria | 4566 |
| 41 | Ga0070667_100440256 | 3300005367 | Bacteria | 1190 |
| 42 | Ga0070667_100679321 | 3300005367 | Bacteria | 952 |
| 43 | Ga0070667_100869199 | 3300005367 | Bacteria | 839 |
| 44 | Ga0070709_10034328 | 3300005434 | Bacteria | 3075 |
| 45 | Ga0070709_10201075 | 3300005434 | Bacteria | 1411 |
| 46 | Ga0070714_100174474 | 3300005435 | Bacteria | 1953 |
| 47 | Ga0070713_100021937 | 3300005436 | Bacteria | 4925 |
| 48 | Ga0070713_100242188 | 3300005436 | Bacteria | 1643 |
| 49 | Ga0070713_100264739 | 3300005436 | Bacteria | 1572 |
| 50 | Ga0070713_100267254 | 3300005436 | Bacteria | 1565 |
| 51 | Ga0070710_10000540 | 3300005437 | Bacteria | 17925 |
| 52 | Ga0070710_10008491 | 3300005437 | Bacteria | 5000 |
| 53 | Ga0070701_10169703 | 3300005438 | Bacteria | 1270 |
| 54 | Ga0070711_100011179 | 3300005439 | Bacteria | 5566 |
| 55 | Ga0070711_100017044 | 3300005439 | Bacteria | 4620 |
| 56 | Ga0070711_100056918 | 3300005439 | Bacteria | 2705 |
| 57 | Ga0070700_100178951 | 3300005441 | Bacteria | 1474 |
| 58 | Ga0070700_100351772 | 3300005441 | Bacteria | 1092 |
| 59 | Ga0070708_100360744 | 3300005445 | Bacteria | 1370 |
| 60 | Ga0070708_100758164 | 3300005445 | Bacteria | 913 |
| 61 | Ga0070663_100043697 | 3300005455 | Bacteria | 3154 |
| 62 | Ga0070663_100075185 | 3300005455 | Bacteria | 2468 |
| 63 | Ga0070663_100448780 | 3300005455 | Bacteria | 1063 |
| 64 | Ga0070663_100516832 | 3300005455 | Bacteria | 994 |
| 65 | Ga0070678_100034853 | 3300005456 | Bacteria | 3508 |
| 66 | Ga0070678_100110244 | 3300005456 | Bacteria | 2152 |
| 67 | Ga0070678_100149160 | 3300005456 | Bacteria | 1882 |
| 68 | Ga0070662_100169806 | 3300005457 | Bacteria | 1712 |
| 69 | Ga0070685_10146953 | 3300005466 | Bacteria | 1490 |
| 70 | Ga0070706_100072284 | 3300005467 | Bacteria | 3192 |
| 71 | Ga0070698_100293750 | 3300005471 | Bacteria | 1556 |
| 72 | Ga0070679_100190420 | 3300005530 | Bacteria | 2021 |
| 73 | Ga0070684_100000809 | 3300005535 | Bacteria | 21816 |
| 74 | Ga0070697_100005807 | 3300005536 | Bacteria | 9521 |
| 75 | Ga0068853_100021495 | 3300005539 | Bacteria | 5382 |
| 76 | Ga0068853_100993177 | 3300005539 | Bacteria | 808 |
| 77 | Ga0070672_100074384 | 3300005543 | Bacteria | 2710 |
| 78 | Ga0070672_100222273 | 3300005543 | Bacteria | 1584 |
| 79 | Ga0070686_100321303 | 3300005544 | Bacteria | 1154 |
| 80 | Ga0070686_100424709 | 3300005544 | Bacteria | 1016 |
| 81 | Ga0070695_100222725 | 3300005545 | Bacteria | 1360 |
| 82 | Ga0070665_100017437 | 3300005548 | Bacteria | 7210 |
| 83 | Ga0070665_100039336 | 3300005548 | Bacteria | 4755 |
| 84 | Ga0070665_100132531 | 3300005548 | Bacteria | 2494 |
| 85 | Ga0070665_100397117 | 3300005548 | Bacteria | 1387 |
| 86 | Ga0068855_100120298 | 3300005563 | Bacteria | 3005 |
| 87 | Ga0068855_100135082 | 3300005563 | Bacteria | 2814 |
| 88 | Ga0068855_100357127 | 3300005563 | Bacteria | 1608 |
| 89 | Ga0068857_100067731 | 3300005577 | Bacteria | 3177 |
| 90 | Ga0068852_100146928 | 3300005616 | Bacteria | 2188 |
| 91 | Ga0068859_100036039 | 3300005617 | Bacteria | 4965 |
| 92 | Ga0068859_100154154 | 3300005617 | Bacteria | 2374 |
| 93 | Ga0068864_100004413 | 3300005618 | Bacteria | 11555 |
| 94 | Ga0068864_100308477 | 3300005618 | Bacteria | 1483 |
| 95 | Ga0068861_100004996 | 3300005719 | Bacteria | 8939 |
| 96 | Ga0068861_100020936 | 3300005719 | Bacteria | 4694 |
| 97 | Ga0068861_100279927 | 3300005719 | Bacteria | 1436 |
| 98 | Ga0068861_100301305 | 3300005719 | Bacteria | 1388 |
| 99 | Ga0068861_100519540 | 3300005719 | Bacteria | 1080 |
| 100 | Ga0068870_10219196 | 3300005840 | Bacteria | 1163 |
| 101 | Ga0068863_100221147 | 3300005841 | Bacteria | 1825 |
| 102 | Ga0068863_100371491 | 3300005841 | Bacteria | 1396 |
| 103 | Ga0068858_100053344 | 3300005842 | Bacteria | 3740 |
| 104 | Ga0068858_100747351 | 3300005842 | Bacteria | 953 |
| 105 | Ga0068860_100146791 | 3300005843 | Bacteria | 2270 |
| 106 | Ga0068860_100157892 | 3300005843 | Bacteria | 2186 |
| 107 | Ga0068860_100608472 | 3300005843 | Bacteria | 1099 |
| 108 | Ga0068862_100061991 | 3300005844 | Bacteria | 3215 |
| 109 | Ga0068862_100132335 | 3300005844 | Bacteria | 2207 |
| 110 | Ga0068862_100662759 | 3300005844 | Bacteria | 1007 |
| 111 | Ga0081455_10041142 | 3300005937 | Bacteria | 4068 |
| 112 | Ga0081455_10365477 | 3300005937 | Bacteria | 1013 |
| 113 | Ga0081538_10055599 | 3300005981 | Bacteria | 2328 |
| 114 | Ga0081540_1000894 | 3300005983 | Bacteria | 26949 |
| 115 | Ga0081540_1001610 | 3300005983 | Bacteria | 19242 |
| 116 | Ga0081540_1006149 | 3300005983 | Bacteria | 8811 |
| 117 | Ga0081540_1008584 | 3300005983 | Bacteria | 7120 |
| 118 | Ga0081540_1023511 | 3300005983 | Bacteria | 3602 |
| 119 | Ga0081540_1039346 | 3300005983 | Bacteria | 2479 |
| 120 | Ga0081540_1045401 | 3300005983 | Bacteria | 2232 |
| 121 | Ga0081540_1096368 | 3300005983 | Bacteria | 1287 |
| 122 | Ga0070717_10001959 | 3300006028 | Bacteria | 14386 |
| 123 | Ga0070717_10004782 | 3300006028 | Bacteria | 9848 |
| 124 | Ga0070717_10030744 | 3300006028 | Bacteria | 4315 |
| 125 | Ga0070717_10191936 | 3300006028 | Bacteria | 1785 |
| 126 | Ga0070717_10570963 | 3300006028 | Bacteria | 1025 |
| 127 | Ga0075365_10000653 | 3300006038 | Bacteria | 13817 |
| 128 | Ga0075365_10036579 | 3300006038 | Bacteria | 3181 |
| 129 | Ga0075365_10301834 | 3300006038 | Bacteria | 1127 |
| 130 | Ga0075368_10000870 | 3300006042 | Bacteria | 9346 |
| 131 | Ga0075368_10206050 | 3300006042 | Bacteria | 833 |
| 132 | Ga0075363_100017711 | 3300006048 | Bacteria | 3538 |
| 133 | Ga0075363_100104174 | 3300006048 | Bacteria | 1572 |
| 134 | Ga0075363_100127119 | 3300006048 | Bacteria | 1428 |
| 135 | Ga0075364_10017317 | 3300006051 | Bacteria | 4500 |
| 136 | Ga0075364_10036514 | 3300006051 | Bacteria | 3177 |
| 137 | Ga0075364_10051311 | 3300006051 | Bacteria | 2693 |
| 138 | Ga0075364_10080053 | 3300006051 | Bacteria | 2159 |
| 139 | Ga0070715_10265100 | 3300006163 | Bacteria | 904 |
| 140 | Ga0070716_100051617 | 3300006173 | Bacteria | 2338 |
| 141 | Ga0070716_100136642 | 3300006173 | Bacteria | 1558 |
| 142 | Ga0070716_100266578 | 3300006173 | Bacteria | 1174 |
| 143 | Ga0070712_100062070 | 3300006175 | Bacteria | 2642 |
| 144 | Ga0070712_100062786 | 3300006175 | Bacteria | 2628 |
| 145 | Ga0070712_100199569 | 3300006175 | Bacteria | 1571 |
| 146 | Ga0075362_10035534 | 3300006177 | Bacteria | 2176 |
| 147 | Ga0075367_10000173 | 3300006178 | Bacteria | 20803 |
| 148 | Ga0075367_10036488 | 3300006178 | Bacteria | 2851 |
| 149 | Ga0075367_10037095 | 3300006178 | Bacteria | 2830 |
| 150 | Ga0075367_10202358 | 3300006178 | Bacteria | 1241 |
| 151 | Ga0075367_10227470 | 3300006178 | Bacteria | 1168 |
| 152 | Ga0075367_10251278 | 3300006178 | Bacteria | 1109 |
| 153 | Ga0075369_10000799 | 3300006186 | Bacteria | 10316 |
| 154 | Ga0075369_10011937 | 3300006186 | Bacteria | 3424 |
| 155 | Ga0075369_10013540 | 3300006186 | Bacteria | 3240 |
| 156 | Ga0075369_10025955 | 3300006186 | Bacteria | 2440 |
| 157 | Ga0075366_10045504 | 3300006195 | Bacteria | 2601 |
| 158 | Ga0075366_10082506 | 3300006195 | Bacteria | 1921 |
| 159 | Ga0097621_100438647 | 3300006237 | Bacteria | 1175 |
| 160 | Ga0075370_10005051 | 3300006353 | Bacteria | 6500 |
| 161 | Ga0075370_10005793 | 3300006353 | Bacteria | 6176 |
| 162 | Ga0075370_10012738 | 3300006353 | Bacteria | 4452 |
| 163 | Ga0075370_10035274 | 3300006353 | Bacteria | 2807 |
| 164 | Ga0075370_10159909 | 3300006353 | Bacteria | 1322 |
| 165 | Ga0075370_10479273 | 3300006353 | Bacteria | 750 |
| 166 | Ga0068871_100075758 | 3300006358 | Bacteria | 2778 |
| 167 | Ga0068871_100216276 | 3300006358 | Bacteria | 1659 |
| 168 | Ga0075434_100009856 | 3300006871 | Bacteria | 8936 |
| 169 | Ga0075434_100263245 | 3300006871 | Bacteria | 1743 |
| 170 | Ga0068865_100028548 | 3300006881 | Bacteria | 3695 |
| 171 | Ga0075436_100369611 | 3300006914 | Bacteria | 1036 |
| 172 | Ga0097620_100036039 | 3300006931 | Bacteria | 4965 |
| 173 | Ga0097620_100154143 | 3300006931 | Bacteria | 2374 |
| 174 | Ga0099825_1022361 | 3300006941 | Bacteria | 4100 |
| 175 | Ga0099823_1080415 | 3300006944 | Bacteria | 1269 |
| 176 | Ga0075435_100015609 | 3300007076 | Bacteria | 5714 |
| 177 | Ga0099794_10069610 | 3300007265 | Bacteria | 1722 |
| 178 | Ga0099795_10012008 | 3300007788 | Bacteria | 2612 |
| 179 | Ga0099795_10061664 | 3300007788 | Bacteria | 1393 |
| 180 | Ga0099795_10088700 | 3300007788 | Bacteria | 1196 |
| 181 | Ga0105240_10001503 | 3300009093 | Bacteria | 39730 |
| 182 | Ga0105240_10090685 | 3300009093 | Bacteria | 3735 |
| 183 | Ga0105240_10105804 | 3300009093 | Bacteria | 3414 |
| 184 | Ga0105240_10419251 | 3300009093 | Bacteria | 1504 |
| 185 | Ga0105240_10900356 | 3300009093 | Bacteria | 952 |
| 186 | Ga0111539_10455596 | 3300009094 | Bacteria | 1490 |
| 187 | Ga0105245_10025260 | 3300009098 | Bacteria | 5223 |
| 188 | Ga0105245_10091963 | 3300009098 | Bacteria | 2793 |
| 189 | Ga0105245_10099327 | 3300009098 | Bacteria | 2691 |
| 190 | Ga0105247_10026598 | 3300009101 | Bacteria | 3495 |
| 191 | Ga0105247_10164585 | 3300009101 | Bacteria | 1471 |
| 192 | Ga0105243_10013638 | 3300009148 | Bacteria | 6147 |
| 193 | Ga0105243_11020869 | 3300009148 | Bacteria | 831 |
| 194 | Ga0105241_10002502 | 3300009174 | Bacteria | 13813 |
| 195 | Ga0105241_10005358 | 3300009174 | Bacteria | 9480 |
| 196 | Ga0105241_10092032 | 3300009174 | Bacteria | 2394 |
| 197 | Ga0105241_10386341 | 3300009174 | Bacteria | 1224 |
| 198 | Ga0105242_10049733 | 3300009176 | Bacteria | 3412 |
| 199 | Ga0105242_10195074 | 3300009176 | Bacteria | 1795 |
| 200 | Ga0105242_10396017 | 3300009176 | Bacteria | 1287 |
| 201 | Ga0105242_10867610 | 3300009176 | Bacteria | 900 |
| 202 | Ga0105248_10018891 | 3300009177 | Bacteria | 7622 |
| 203 | Ga0105248_10042235 | 3300009177 | Bacteria | 5113 |
| 204 | Ga0105248_10158484 | 3300009177 | Bacteria | 2554 |
| 205 | Ga0105248_10745654 | 3300009177 | Bacteria | 1105 |
| 206 | Ga0105237_10000992 | 3300009545 | Bacteria | 38167 |
| 207 | Ga0105237_10006968 | 3300009545 | Bacteria | 12459 |
| 208 | Ga0105237_10016105 | 3300009545 | Bacteria | 7775 |
| 209 | Ga0105237_10137721 | 3300009545 | Bacteria | 2436 |
| 210 | Ga0105237_10314702 | 3300009545 | Bacteria | 1569 |
| 211 | Ga0105237_10465519 | 3300009545 | Bacteria | 1270 |
| 212 | Ga0105237_10503344 | 3300009545 | Bacteria | 1218 |
| 213 | Ga0105238_10269645 | 3300009551 | Bacteria | 1683 |
| 214 | Ga0105238_10291567 | 3300009551 | Bacteria | 1614 |
| 215 | Ga0105238_10515424 | 3300009551 | Bacteria | 1198 |
| 216 | Ga0105249_10014442 | 3300009553 | Bacteria | 6980 |
| 217 | Ga0099796_10012867 | 3300010159 | Bacteria | 2375 |
| 218 | Ga0105239_10013385 | 3300010375 | Bacteria | 9114 |
| 219 | Ga0105239_10020360 | 3300010375 | Bacteria | 7318 |
| 220 | Ga0105239_10021875 | 3300010375 | Bacteria | 7050 |
| 221 | Ga0105239_10062055 | 3300010375 | Bacteria | 4103 |
| 222 | Ga0105239_10062551 | 3300010375 | Bacteria | 4085 |
| 223 | Ga0105239_10076460 | 3300010375 | Bacteria | 3682 |
| 224 | Ga0105239_10090987 | 3300010375 | Bacteria | 3367 |
| 225 | Ga0105239_10143484 | 3300010375 | Bacteria | 2662 |
| 226 | Ga0105239_10278101 | 3300010375 | Bacteria | 1884 |
| 227 | Ga0105239_10750760 | 3300010375 | Bacteria | 1117 |
| 228 | Ga0105246_10166513 | 3300011119 | Bacteria | 1684 |
| 229 | Ga0105246_10353901 | 3300011119 | Bacteria | 1204 |
| 230 | Ga0157369_10008235 | 3300013105 | Bacteria | 11955 |
| 231 | Ga0157374_10091824 | 3300013296 | Bacteria | 2896 |
| 232 | Ga0157374_10203812 | 3300013296 | Bacteria | 1938 |
| 233 | Ga0157374_10423280 | 3300013296 | Bacteria | 1331 |
| 234 | Ga0157378_10020588 | 3300013297 | Bacteria | 5801 |
| 235 | Ga0157378_10054093 | 3300013297 | Bacteria | 3575 |
| 236 | Ga0157378_10384167 | 3300013297 | Bacteria | 1380 |
| 237 | Ga0163162_10097876 | 3300013306 | Bacteria | 3023 |
| 238 | Ga0163162_10253652 | 3300013306 | Bacteria | 1891 |
| 239 | Ga0163162_10443546 | 3300013306 | Bacteria | 1430 |
| 240 | Ga0157372_10095801 | 3300013307 | Bacteria | 3382 |
| 241 | Ga0157372_10346156 | 3300013307 | Bacteria | 1732 |
| 242 | Ga0157372_10393697 | 3300013307 | Bacteria | 1614 |
| 243 | Ga0157375_10110192 | 3300013308 | Bacteria | 2850 |
| 244 | Ga0157375_10114963 | 3300013308 | Bacteria | 2793 |
| 245 | Ga0157375_10162155 | 3300013308 | Bacteria | 2378 |
| 246 | Ga0163163_10017382 | 3300014325 | Bacteria | 6706 |
| 247 | Ga0163163_10087542 | 3300014325 | Bacteria | 3125 |
| 248 | Ga0163163_10104941 | 3300014325 | Bacteria | 2852 |
| 249 | Ga0163163_10255560 | 3300014325 | Bacteria | 1803 |
| 250 | Ga0157380_10016897 | 3300014326 | Bacteria | 5387 |
| 251 | Ga0157377_10109856 | 3300014745 | Bacteria | 1656 |
| 252 | Ga0157379_10023227 | 3300014968 | Bacteria | 5501 |
| 253 | Ga0157379_10206144 | 3300014968 | Bacteria | 1778 |
| 254 | Ga0157379_10290540 | 3300014968 | Bacteria | 1489 |
| 255 | Ga0157379_10873020 | 3300014968 | Bacteria | 852 |
| 256 | Ga0157376_10055754 | 3300014969 | Bacteria | 3299 |
| 257 | Ga0157376_10419063 | 3300014969 | Bacteria | 1299 |
| 258 | Ga0163161_10027902 | 3300017792 | Bacteria | 4006 |
| 259 | Ga0163161_10388759 | 3300017792 | Bacteria | 1116 |
| 260 | Ga0214544_1011461 | 3300021320 | Bacteria | 12220 |
| 261 | Ga0213872_10213172 | 3300021361 | Bacteria | 824 |
| 262 | Ga0213874_10010033 | 3300021377 | Bacteria | 2360 |
| 263 | Ga0213874_10145890 | 3300021377 | Bacteria | 822 |
| 264 | Ga0224712_10064542 | 3300022467 | Bacteria | 1469 |
| 265 | Ga0209677_102995 | 3300025253 | Bacteria | 5845 |
| 266 | Ga0209233_1003938 | 3300025261 | Bacteria | 5151 |
| 267 | Ga0209564_1057965 | 3300025295 | Bacteria | 888 |
| 268 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 269 | Ga0209758_1000719 | 3300025297 | Bacteria | 48865 |
| 270 | Ga0209758_1000761 | 3300025297 | Bacteria | 46617 |
| 271 | Ga0209256_1000838 | 3300025299 | Bacteria | 38642 |
| 272 | Ga0207426_1042271 | 3300025302 | Bacteria | 1407 |
| 273 | Ga0209051_1043995 | 3300025303 | Bacteria | 1561 |
| 274 | Ga0209257_1000201 | 3300025304 | Bacteria | 147272 |
| 275 | Ga0209257_1012740 | 3300025304 | Bacteria | 3841 |
| 276 | Ga0207688_10031950 | 3300025901 | Bacteria | 2908 |
| 277 | Ga0207688_10231707 | 3300025901 | Bacteria | 1115 |
| 278 | Ga0207647_10037170 | 3300025904 | Bacteria | 3089 |
| 279 | Ga0207647_10062207 | 3300025904 | Bacteria | 2275 |
| 280 | Ga0207647_10077076 | 3300025904 | Bacteria | 2004 |
| 281 | Ga0207647_10135293 | 3300025904 | Bacteria | 1447 |
| 282 | Ga0207699_10038889 | 3300025906 | Bacteria | 2730 |
| 283 | Ga0207699_10102314 | 3300025906 | Bacteria | 1820 |
| 284 | Ga0207699_10113734 | 3300025906 | Bacteria | 1739 |
| 285 | Ga0207699_10177730 | 3300025906 | Bacteria | 1429 |
| 286 | Ga0207643_10031720 | 3300025908 | Bacteria | 2947 |
| 287 | Ga0207643_10109823 | 3300025908 | Bacteria | 1624 |
| 288 | Ga0207705_10001314 | 3300025909 | Bacteria | 19928 |
| 289 | Ga0207654_10034644 | 3300025911 | Bacteria | 2807 |
| 290 | Ga0207654_10169450 | 3300025911 | Bacteria | 1417 |
| 291 | Ga0207654_10206450 | 3300025911 | Bacteria | 1296 |
| 292 | Ga0207707_10049105 | 3300025912 | Bacteria | 3676 |
| 293 | Ga0207695_10000159 | 3300025913 | Bacteria | 201367 |
| 294 | Ga0207695_10123220 | 3300025913 | Bacteria | 2558 |
| 295 | Ga0207695_10139450 | 3300025913 | Bacteria | 2375 |
| 296 | Ga0207671_10004461 | 3300025914 | Bacteria | 13369 |
| 297 | Ga0207671_10054331 | 3300025914 | Bacteria | 2968 |
| 298 | Ga0207671_10304142 | 3300025914 | Bacteria | 1260 |
| 299 | Ga0207671_10758005 | 3300025914 | Bacteria | 771 |
| 300 | Ga0207693_10003094 | 3300025915 | Bacteria | 14333 |
| 301 | Ga0207693_10008912 | 3300025915 | Bacteria | 8193 |
| 302 | Ga0207693_10015668 | 3300025915 | Bacteria | 6076 |
| 303 | Ga0207693_10045900 | 3300025915 | Bacteria | 3433 |
| 304 | Ga0207693_10129874 | 3300025915 | Bacteria | 1981 |
| 305 | Ga0207663_10009233 | 3300025916 | Bacteria | 5202 |
| 306 | Ga0207663_10012316 | 3300025916 | Bacteria | 4622 |
| 307 | Ga0207663_10073865 | 3300025916 | Bacteria | 2208 |
| 308 | Ga0207663_10185537 | 3300025916 | Bacteria | 1489 |
| 309 | Ga0207660_10019147 | 3300025917 | Bacteria | 4572 |
| 310 | Ga0207657_10052519 | 3300025919 | Bacteria | 3537 |
| 311 | Ga0207657_10398938 | 3300025919 | Bacteria | 1082 |
| 312 | Ga0207652_10062007 | 3300025921 | Bacteria | 3230 |
| 313 | Ga0207652_10208558 | 3300025921 | Bacteria | 1759 |
| 314 | Ga0207650_10314594 | 3300025925 | Bacteria | 1281 |
| 315 | Ga0207650_10348298 | 3300025925 | Bacteria | 1218 |
| 316 | Ga0207659_10173700 | 3300025926 | Bacteria | 1702 |
| 317 | Ga0207687_10043470 | 3300025927 | Bacteria | 3096 |
| 318 | Ga0207687_10044937 | 3300025927 | Bacteria | 3051 |
| 319 | Ga0207700_10060556 | 3300025928 | Bacteria | 2868 |
| 320 | Ga0207700_10133072 | 3300025928 | Bacteria | 2033 |
| 321 | Ga0207700_10648646 | 3300025928 | Bacteria | 941 |
| 322 | Ga0207664_10084347 | 3300025929 | Bacteria | 2591 |
| 323 | Ga0207664_10575123 | 3300025929 | Bacteria | 1011 |
| 324 | Ga0207664_10579204 | 3300025929 | Bacteria | 1008 |
| 325 | Ga0207644_10023331 | 3300025931 | Bacteria | 4237 |
| 326 | Ga0207690_10078093 | 3300025932 | Bacteria | 2303 |
| 327 | Ga0207706_10070593 | 3300025933 | Bacteria | 3072 |
| 328 | Ga0207686_10325416 | 3300025934 | Bacteria | 1150 |
| 329 | Ga0207709_10604521 | 3300025935 | Bacteria | 869 |
| 330 | Ga0207670_10225577 | 3300025936 | Bacteria | 1436 |
| 331 | Ga0207669_10003823 | 3300025937 | Bacteria | 6561 |
| 332 | Ga0207669_10598488 | 3300025937 | Bacteria | 896 |
| 333 | Ga0207704_10183141 | 3300025938 | Bacteria | 1516 |
| 334 | Ga0207665_10016844 | 3300025939 | Bacteria | 4800 |
| 335 | Ga0207665_10037242 | 3300025939 | Bacteria | 3238 |
| 336 | Ga0207665_10044121 | 3300025939 | Bacteria | 2983 |
| 337 | Ga0207691_10165977 | 3300025940 | Bacteria | 1935 |
| 338 | Ga0207711_10015806 | 3300025941 | Bacteria | 6261 |
| 339 | Ga0207711_10096512 | 3300025941 | Bacteria | 2609 |
| 340 | Ga0207711_10300187 | 3300025941 | Bacteria | 1481 |
| 341 | Ga0207711_10584823 | 3300025941 | Bacteria | 1042 |
| 342 | Ga0207689_10002279 | 3300025942 | Bacteria | 17956 |
| 343 | Ga0207689_10245095 | 3300025942 | Bacteria | 1482 |
| 344 | Ga0207661_10000041 | 3300025944 | Bacteria | 122817 |
| 345 | Ga0207661_10544096 | 3300025944 | Bacteria | 1063 |
| 346 | Ga0207667_10192977 | 3300025949 | Bacteria | 2090 |
| 347 | Ga0207651_10119747 | 3300025960 | Bacteria | 1994 |
| 348 | Ga0207712_10121513 | 3300025961 | Bacteria | 1977 |
| 349 | Ga0207712_10516391 | 3300025961 | Bacteria | 1023 |
| 350 | Ga0207668_10004695 | 3300025972 | Bacteria | 8039 |
| 351 | Ga0207668_10008317 | 3300025972 | Bacteria | 6179 |
| 352 | Ga0207668_10019241 | 3300025972 | Bacteria | 4312 |
| 353 | Ga0207668_10080147 | 3300025972 | Bacteria | 2364 |
| 354 | Ga0207640_10167833 | 3300025981 | Bacteria | 1632 |
| 355 | Ga0207640_11032810 | 3300025981 | Bacteria | 724 |
| 356 | Ga0207658_10369960 | 3300025986 | Bacteria | 1253 |
| 357 | Ga0207658_10670907 | 3300025986 | Bacteria | 935 |
| 358 | Ga0207677_10061644 | 3300026023 | Bacteria | 2598 |
| 359 | Ga0207677_10350795 | 3300026023 | Bacteria | 1236 |
| 360 | Ga0207677_10717735 | 3300026023 | Bacteria | 888 |
| 361 | Ga0207703_10669006 | 3300026035 | Bacteria | 986 |
| 362 | Ga0207639_10253398 | 3300026041 | Bacteria | 1536 |
| 363 | Ga0207678_10006820 | 3300026067 | Bacteria | 10128 |
| 364 | Ga0207678_10018762 | 3300026067 | Bacteria | 6076 |
| 365 | Ga0207678_10079287 | 3300026067 | Bacteria | 2812 |
| 366 | Ga0207678_10148814 | 3300026067 | Bacteria | 1999 |
| 367 | Ga0207678_10531058 | 3300026067 | Bacteria | 1027 |
| 368 | Ga0207708_10051352 | 3300026075 | Bacteria | 3138 |
| 369 | Ga0207708_10197615 | 3300026075 | Bacteria | 1603 |
| 370 | Ga0207708_10430747 | 3300026075 | Bacteria | 1095 |
| 371 | Ga0207702_10157155 | 3300026078 | Bacteria | 2073 |
| 372 | Ga0207641_10174887 | 3300026088 | Bacteria | 1963 |
| 373 | Ga0207641_10369896 | 3300026088 | Bacteria | 1370 |
| 374 | Ga0207648_10041401 | 3300026089 | Bacteria | 4045 |
| 375 | Ga0207648_10098215 | 3300026089 | Bacteria | 2564 |
| 376 | Ga0207648_10183313 | 3300026089 | Bacteria | 1853 |
| 377 | Ga0207676_10017961 | 3300026095 | Bacteria | 5133 |
| 378 | Ga0207674_10163807 | 3300026116 | Bacteria | 2178 |
| 379 | Ga0207674_10300568 | 3300026116 | Bacteria | 1554 |
| 380 | Ga0207674_10584052 | 3300026116 | Bacteria | 1079 |
| 381 | Ga0207675_100008611 | 3300026118 | Bacteria | 9592 |
| 382 | Ga0207675_100108766 | 3300026118 | Bacteria | 2615 |
| 383 | Ga0207675_100255166 | 3300026118 | Bacteria | 1698 |
| 384 | Ga0207675_100465581 | 3300026118 | Bacteria | 1254 |
| 385 | Ga0207675_100473684 | 3300026118 | Bacteria | 1243 |
| 386 | Ga0207683_10003329 | 3300026121 | Bacteria | 14006 |
| 387 | Ga0207683_10026804 | 3300026121 | Bacteria | 4978 |
| 388 | Ga0207683_10035061 | 3300026121 | Bacteria | 4364 |
| 389 | Ga0207698_10214723 | 3300026142 | Bacteria | 1733 |
| 390 | Ga0207698_11074890 | 3300026142 | Bacteria | 817 |
| 391 | Ga0209389_1000162 | 3300027296 | Bacteria | 55061 |
| 392 | Ga0209489_112699 | 3300027361 | Bacteria | 7416 |
| 393 | Ga0209489_112709 | 3300027361 | Bacteria | 7410 |
| 394 | Ga0209700_100509 | 3300027363 | Bacteria | 73459 |
| 395 | Ga0209179_1013684 | 3300027512 | Bacteria | 1478 |
| 396 | Ga0209179_1035980 | 3300027512 | Bacteria | 1030 |
| 397 | Ga0209813_10000621 | 3300027866 | Bacteria | 8236 |
| 398 | Ga0209813_10024965 | 3300027866 | Bacteria | 1714 |
| 399 | Ga0268266_10006068 | 3300028379 | Bacteria | 11133 |
| 400 | Ga0268265_10040684 | 3300028380 | Bacteria | 3434 |
| 401 | Ga0268265_10040702 | 3300028380 | Bacteria | 3434 |
| 402 | Ga0268265_10054929 | 3300028380 | Bacteria | 3024 |
| 403 | Ga0268265_11081228 | 3300028380 | Bacteria | 795 |
| 404 | Ga0268264_10517712 | 3300028381 | Bacteria | 1166 |
| 405 | Ga0268264_11404290 | 3300028381 | Bacteria | 709 |
| 406 | Ga0307517_10333033 | 3300028786 | Bacteria | 833 |
| 407 | Ga0265340_10000984 | 3300031247 | Bacteria | 16277 |
| 408 | Ga0265340_10193533 | 3300031247 | Bacteria | 916 |
| 409 | Ga0265339_10004913 | 3300031249 | Bacteria | 9012 |
| 410 | Ga0307513_10139103 | 3300031456 | Bacteria | 2358 |
| 411 | Ga0307408_100364805 | 3300031548 | Bacteria | 1230 |
| 412 | Ga0307408_100455223 | 3300031548 | Bacteria | 1111 |
| 413 | Ga0265314_10069030 | 3300031711 | Bacteria | 2373 |
| 414 | Ga0307516_10093721 | 3300031730 | Bacteria | 2828 |
| 415 | Ga0307410_10319148 | 3300031852 | Bacteria | 1232 |
| 416 | Ga0307411_10507022 | 3300032005 | Bacteria | 1021 |
| 417 | Ga0307415_100294420 | 3300032126 | Bacteria | 1341 |
| 418 | Ga0307415_100518101 | 3300032126 | Bacteria | 1046 |
| 419 | Ga0307510_10043108 | 3300033180 | Bacteria | 4908 |
| 420 | Ga0373943_0165877 | 3300035170 | Bacteria | 1205 |
| 421 | Ga0373935_0337822 | 3300035692 | Bacteria | 1072 |
| 422 | Ga0373927_0080832 | 3300035695 | Bacteria | 2106 |
| 423 | Ga0373927_0207333 | 3300035695 | Bacteria | 1287 |
| 424 | Ga0373933_0002036 | 3300035724 | Bacteria | 11624 |
| 425 | Ga0373947_0004894 | 3300035725 | Bacteria | 7839 |
| 426 | Ga0373925_0105652 | 3300037068 | Bacteria | 2170 |
| 427 | Ga0395900_0174904 | 3300037418 | Bacteria | 2184 |
| 428 | Ga0395900_0302304 | 3300037418 | Bacteria | 1586 |
| 429 | Ga0395900_0670466 | 3300037418 | Bacteria | 972 |
| 430 | Ga0395898_0054005 | 3300037466 | Bacteria | 3922 |
| 431 | Ga0395905_0007905 | 3300037471 | Bacteria | 10520 |
| 432 | Ga0395905_0071731 | 3300037471 | Bacteria | 3247 |
| 433 | Ga0395905_0304380 | 3300037471 | Bacteria | 1482 |
| 434 | Ga0395901_0030366 | 3300038443 | Bacteria | 5568 |
| 435 | Ga0395901_0652854 | 3300038443 | Bacteria | 1055 |
| 436 | Ga0436365_1232859 | 3300039437 | Bacteria | 5663 |
| 437 | Ga0436360_0228572 | 3300039438 | Bacteria | 1797 |
| 438 | Ga0436360_1248138 | 3300039438 | Bacteria | 1598 |
| 439 | Ga0436361_0027838 | 3300039447 | Bacteria | 2356 |
| 440 | Ga0436361_0251392 | 3300039447 | Bacteria | 1503 |
| 441 | Ga0436361_0395654 | 3300039447 | Bacteria | 875 |
| 442 | Ga0436363_0248112 | 3300039450 | Bacteria | 6713 |
| 443 | Ga0436363_0659157 | 3300039450 | Bacteria | 8421 |
| 444 | Ga0439461_0070203 | 3300041410 | Bacteria | 811 |
| 445 | Ga0439465_0021691 | 3300041413 | Bacteria | 2016 |
| 446 | Ga0439465_0056987 | 3300041413 | Bacteria | 1289 |
| 447 | Ga0439465_0087771 | 3300041413 | Bacteria | 1061 |
| 448 | Ga0439458_0060223 | 3300042157 | Bacteria | 947 |
| 449 | Ga0439459_0065424 | 3300042438 | Bacteria | 830 |
| 450 | Ga0466972_0000246 | 3300044658 | Bacteria | 36849 |
| 451 | Ga0466965_0167211 | 3300044683 | Bacteria | 1155 |
| 452 | Ga0466963_0072736 | 3300044694 | Bacteria | 2316 |
| 453 | Ga0466957_0057337 | 3300044842 | Bacteria | 2384 |
| 454 | Ga0466957_0221598 | 3300044842 | Bacteria | 1249 |
| 455 | Ga0466959_0012229 | 3300045049 | Bacteria | 6194 |
| 456 | Ga0466958_0073741 | 3300045836 | Bacteria | 2091 |
| 457 | Ga0466967_0020322 | 3300045976 | Bacteria | 5364 |
| 458 | Ga0495617_004868 | 3300046452 | Bacteria | 4833 |
| 459 | Ga0495627_011674 | 3300046453 | Bacteria | 3144 |
| 460 | Ga0495603_0056254 | 3300046455 | Bacteria | 2329 |
| 461 | Ga0495638_0005602 | 3300046460 | Bacteria | 9278 |
| 462 | Ga0495638_0063527 | 3300046460 | Bacteria | 2276 |
| 463 | Ga0495638_0171916 | 3300046460 | Bacteria | 1242 |
| 464 | Ga0495638_0384836 | 3300046460 | Bacteria | 732 |
| 465 | Ga0495641_0080421 | 3300046461 | Bacteria | 1460 |
| 466 | Ga0495650_0009492 | 3300046471 | Bacteria | 5525 |
| 467 | Ga0495580_0199252 | 3300046472 | Bacteria | 1380 |
| 468 | Ga0495605_0000007 | 3300046474 | Bacteria | 358289 |
| 469 | Ga0495605_0060138 | 3300046474 | Bacteria | 1822 |
| 470 | Ga0495585_0018902 | 3300046492 | Bacteria | 3975 |
| 471 | Ga0495594_0005176 | 3300046499 | Bacteria | 6704 |
| 472 | Ga0495596_0017144 | 3300046500 | Bacteria | 3003 |
| 473 | Ga0495596_0063139 | 3300046500 | Bacteria | 1441 |
| 474 | Ga0495607_0111107 | 3300046501 | Bacteria | 1453 |
| 475 | Ga0495583_0000007 | 3300046506 | Bacteria | 434661 |
| 476 | Ga0495606_0285259 | 3300046507 | Bacteria | 901 |
| 477 | Ga0495610_0101036 | 3300046512 | Bacteria | 1292 |
| 478 | Ga0495616_0028100 | 3300046513 | Bacteria | 2980 |
| 479 | Ga0495620_0000014 | 3300046515 | Bacteria | 157890 |
| 480 | Ga0495631_0017773 | 3300046518 | Bacteria | 3357 |
| 481 | Ga0495631_0018469 | 3300046518 | Bacteria | 3281 |
| 482 | Ga0495632_0057635 | 3300046519 | Bacteria | 1895 |
| 483 | Ga0495632_0119702 | 3300046519 | Bacteria | 1231 |
| 484 | Ga0495637_0071298 | 3300046520 | Bacteria | 1401 |
| 485 | Ga0495637_0097801 | 3300046520 | Bacteria | 1151 |
| 486 | Ga0495637_0124573 | 3300046520 | Bacteria | 989 |
| 487 | Ga0495643_0006585 | 3300046522 | Bacteria | 7639 |
| 488 | Ga0495648_0014862 | 3300046524 | Bacteria | 5672 |
| 489 | Ga0495648_0020609 | 3300046524 | Bacteria | 4591 |
| 490 | Ga0495666_0164804 | 3300046526 | Bacteria | 1027 |
| 491 | Ga0495642_0139294 | 3300046528 | Bacteria | 1047 |
| 492 | Ga0495654_0002301 | 3300046530 | Bacteria | 12355 |
| 493 | Ga0495598_0014188 | 3300046537 | Bacteria | 1988 |
| 494 | Ga0495598_0017371 | 3300046537 | Bacteria | 1853 |
| 495 | Ga0495609_0000004 | 3300046538 | Bacteria | 697346 |
| 496 | Ga0495609_0031446 | 3300046538 | Bacteria | 2412 |
| 497 | Ga0495597_0007584 | 3300046542 | Bacteria | 5497 |
| 498 | Ga0495622_0079314 | 3300046557 | Bacteria | 1511 |
| 499 | Ga0495633_0000135 | 3300046558 | Bacteria | 97871 |
| 500 | Ga0495633_0076351 | 3300046558 | Bacteria | 1560 |
| 501 | Ga0495656_0002081 | 3300046615 | Bacteria | 6604 |
| 502 | Ga0495656_0024725 | 3300046615 | Bacteria | 2375 |
| 503 | Ga0495656_0316215 | 3300046615 | Bacteria | 803 |
| 504 | Ga0495668_0049854 | 3300046616 | Bacteria | 2322 |
| 505 | Ga0495668_0140301 | 3300046616 | Bacteria | 1322 |
| 506 | Ga0495611_0010631 | 3300046648 | Bacteria | 3894 |
| 507 | Ga0495611_0089105 | 3300046648 | Bacteria | 1425 |
| 508 | Ga0495659_0006792 | 3300046664 | Bacteria | 3616 |
| 509 | Ga0495659_0194226 | 3300046664 | Bacteria | 830 |
| 510 | Ga0495661_0000009 | 3300046665 | Bacteria | 291327 |
| 511 | Ga0495661_0059288 | 3300046665 | Bacteria | 2279 |
| 512 | Ga0495661_0090799 | 3300046665 | Bacteria | 1738 |
| 513 | Ga0495658_0400843 | 3300046683 | Bacteria | 874 |
| 514 | Ga0495658_0557118 | 3300046683 | Bacteria | 734 |
| 515 | Ga0495624_0069240 | 3300046690 | Bacteria | 2198 |
| 516 | Ga0495624_0309658 | 3300046690 | Bacteria | 952 |
| 517 | Ga0495670_0071292 | 3300046691 | Bacteria | 1759 |
| 518 | Ga0495670_0108318 | 3300046691 | Bacteria | 1436 |
| 519 | Ga0495670_0120583 | 3300046691 | Bacteria | 1362 |
| 520 | Ga0495671_0003133 | 3300046692 | Bacteria | 10279 |
| 521 | Ga0495671_0039938 | 3300046692 | Bacteria | 2367 |
| 522 | Ga0495671_0059501 | 3300046692 | Bacteria | 1888 |
| 523 | Ga0495589_0010436 | 3300046794 | Bacteria | 4826 |
| 524 | Ga0495589_0068257 | 3300046794 | Bacteria | 1739 |
| 525 | Ga0495589_0248773 | 3300046794 | Bacteria | 831 |
| 526 | Ga0495660_0000782 | 3300046810 | Bacteria | 23813 |
| 527 | Ga0495581_0347947 | 3300047315 | Bacteria | 865 |
| 528 | Ga0495672_0046429 | 3300047320 | Bacteria | 2590 |
| 529 | Ga0495672_0060308 | 3300047320 | Bacteria | 2192 |
| 530 | Ga0495672_0197700 | 3300047320 | Bacteria | 1007 |
| 531 | Ga0495676_0049778 | 3300047321 | Bacteria | 3365 |
| 532 | Ga0495676_0064029 | 3300047321 | Bacteria | 2863 |
| 533 | Ga0495683_0000004 | 3300047323 | Bacteria | 321136 |
| 534 | Ga0495683_0072582 | 3300047323 | Bacteria | 1688 |
| 535 | Ga0495687_082586 | 3300047443 | Bacteria | 1254 |
| 536 | Ga0495679_005551 | 3300047446 | Bacteria | 5572 |
| 537 | Ga0495679_090380 | 3300047446 | Bacteria | 860 |
| 538 | Ga0495673_0067525 | 3300047469 | Bacteria | 1513 |
| 539 | Ga0495681_0012940 | 3300047470 | Bacteria | 4877 |
| 540 | Ga0495686_0037675 | 3300047472 | Bacteria | 3097 |
| 541 | Ga0495686_0041047 | 3300047472 | Bacteria | 2948 |
| 542 | Ga0495686_0314571 | 3300047472 | Bacteria | 860 |
| 543 | Ga0496100_0336411 | 3300048903 | Bacteria | 1137 |
| 544 | Ga0496101_0252569 | 3300048904 | Bacteria | 1374 |
| 545 | Ga0496101_0272681 | 3300048904 | Bacteria | 1321 |
| 546 | Ga0496102_0001105 | 3300048905 | Bacteria | 24771 |
| 547 | Ga0496102_0033702 | 3300048905 | Bacteria | 4604 |
| 548 | Ga0496104_0120526 | 3300048907 | Bacteria | 2518 |
| 549 | Ga0496104_0122652 | 3300048907 | Bacteria | 2495 |
| 550 | Ga0496104_0149479 | 3300048907 | Bacteria | 2243 |
| 551 | Ga0496104_0324438 | 3300048907 | Bacteria | 1453 |
| 552 | Ga0496105_0010795 | 3300048908 | Bacteria | 7192 |
| 553 | Ga0496105_0027811 | 3300048908 | Bacteria | 4623 |
| 554 | Ga0496106_0070323 | 3300048909 | Bacteria | 2673 |
| 555 | Ga0496106_0109139 | 3300048909 | Bacteria | 2153 |
| 556 | Ga0496107_0522405 | 3300048910 | Bacteria | 880 |
| 557 | Ga0496108_0013055 | 3300048911 | Bacteria | 6770 |
| 558 | Ga0496108_0044587 | 3300048911 | Bacteria | 3701 |
| 559 | Ga0496108_0224331 | 3300048911 | Bacteria | 1633 |
| 560 | Ga0496109_0025083 | 3300048912 | Bacteria | 5308 |
| 561 | Ga0496109_0692897 | 3300048912 | Bacteria | 956 |
| 562 | Ga0496110_0222508 | 3300048913 | Bacteria | 1716 |
| 563 | Ga0496110_0384618 | 3300048913 | Bacteria | 1279 |
| 564 | Ga0496111_0020383 | 3300048914 | Bacteria | 4615 |
| 565 | Ga0496112_0010770 | 3300048915 | Bacteria | 8317 |
| 566 | Ga0496112_0022589 | 3300048915 | Bacteria | 5996 |
| 567 | Ga0496112_0030908 | 3300048915 | Bacteria | 5188 |
| 568 | Ga0496113_0327457 | 3300048916 | Bacteria | 1228 |
| 569 | Ga0496113_0481416 | 3300048916 | Bacteria | 997 |
| 570 | Ga0496113_0825778 | 3300048916 | Bacteria | 735 |
| 571 | Ga0496114_0756415 | 3300048917 | Bacteria | 849 |
| 572 | Ga0496115_0034144 | 3300048918 | Bacteria | 4020 |
| 573 | Ga0496115_0457946 | 3300048918 | Bacteria | 1029 |
| 574 | Ga0496116_0169727 | 3300048919 | Bacteria | 1184 |
| 575 | Ga0496118_0062240 | 3300048921 | Bacteria | 2757 |
| 576 | Ga0496119_0186456 | 3300048922 | Bacteria | 1084 |
| 577 | Ga0496119_0264408 | 3300048922 | Bacteria | 862 |
| 578 | Ga0496119_0283022 | 3300048922 | Bacteria | 824 |
| 579 | Ga0496121_0000178 | 3300048924 | Bacteria | 141429 |
| 580 | Ga0496121_0037534 | 3300048924 | Bacteria | 4302 |
| 581 | Ga0496121_0114904 | 3300048924 | Bacteria | 2045 |
| 582 | Ga0496121_0118274 | 3300048924 | Bacteria | 2006 |
| 583 | Ga0496121_0144264 | 3300048924 | Bacteria | 1761 |
| 584 | Ga0496121_0204560 | 3300048924 | Bacteria | 1404 |
| 585 | Ga0496121_0288835 | 3300048924 | Bacteria | 1118 |
| 586 | Ga0496122_0042046 | 3300048925 | Bacteria | 3601 |
| 587 | Ga0496123_0013584 | 3300048926 | Bacteria | 6818 |
| 588 | Ga0496123_0140069 | 3300048926 | Bacteria | 1324 |
| 589 | Ga0496124_0229223 | 3300048927 | Bacteria | 1390 |
| 590 | Ga0496124_0236832 | 3300048927 | Bacteria | 1360 |
| 591 | Ga0496126_0004249 | 3300048929 | Bacteria | 17244 |
| 592 | Ga0496126_0004533 | 3300048929 | Bacteria | 16530 |
| 593 | Ga0496126_0006868 | 3300048929 | Bacteria | 12616 |
| 594 | Ga0496126_0063211 | 3300048929 | Bacteria | 3319 |
| 595 | Ga0496126_0260347 | 3300048929 | Bacteria | 1443 |
| 596 | Ga0496126_0329074 | 3300048929 | Bacteria | 1254 |
| 597 | Ga0496126_0333408 | 3300048929 | Bacteria | 1244 |
| 598 | Ga0496126_0551354 | 3300048929 | Bacteria | 915 |
| 599 | Ga0495678_000014 | 3300049459 | Bacteria | 313755 |
| 600 | Ga0495678_062769 | 3300049459 | Bacteria | 1390 |
| 601 | Ga0501037_0470148 | 3300049573 | Bacteria | 856 |
| 602 | Ga0501038_0065626 | 3300049574 | Bacteria | 3092 |
| 603 | Ga0501038_0285897 | 3300049574 | Bacteria | 1297 |
| 604 | Ga0501043_0744410 | 3300049579 | Unclassified | 713 |
| 605 | Ga0501047_0049407 | 3300049581 | Bacteria | 4062 |
| 606 | Ga0501047_0289675 | 3300049581 | Bacteria | 1481 |
| 607 | Ga0501047_0292767 | 3300049581 | Bacteria | 1472 |
| 608 | Ga0501047_0569511 | 3300049581 | Bacteria | 956 |
| 609 | Ga0501073_0053478 | 3300049589 | Bacteria | 2827 |
| 610 | Ga0501074_0541356 | 3300049590 | Bacteria | 824 |
| 611 | Ga0501079_0687459 | 3300049741 | Bacteria | 805 |
| 612 | Ga0501080_0076626 | 3300049742 | Bacteria | 3110 |
| 613 | Ga0501081_0739987 | 3300049743 | Bacteria | 739 |
| 614 | Ga0501044_0126613 | 3300049823 | Bacteria | 2551 |
| 615 | Ga0501044_0187862 | 3300049823 | Bacteria | 2030 |
| 616 | Ga0501044_0211580 | 3300049823 | Bacteria | 1893 |
| 617 | Ga0501044_0470272 | 3300049823 | Bacteria | 1161 |
| 618 | nmdc:mga03683_32425_c1 | 3300050489 | Bacteria | 2101 |
| 619 | nmdc:mga03n38_143406_c1 | 3300050490 | Bacteria | 1195 |
| 620 | nmdc:mga03n38_5257_c1 | 3300050490 | Bacteria | 4389 |
| 621 | nmdc:mga03n38_5368_c1 | 3300050490 | Bacteria | 4356 |
| 622 | nmdc:mga00v17_73791_c1 | 3300050491 | Bacteria | 2119 |
| 623 | nmdc:mga0yw44_147_c1 | 3300050492 | Bacteria | 24337 |
| 624 | nmdc:mga0yw44_163522_c1 | 3300050492 | Bacteria | 1458 |
| 625 | nmdc:mga0yw44_4603_c1 | 3300050492 | Bacteria | 6361 |
| 626 | nmdc:mga0yw44_543660_c1 | 3300050492 | Bacteria | 789 |
| 627 | nmdc:mga0k408_12352_c1 | 3300050493 | Bacteria | 4667 |
| 628 | nmdc:mga0k408_216585_c1 | 3300050493 | Bacteria | 1143 |
| 629 | nmdc:mga0k408_28300_c1 | 3300050493 | Bacteria | 3186 |
| 630 | nmdc:mga0k408_3305_c1 | 3300050493 | Bacteria | 8532 |
| 631 | nmdc:mga06z11_1144_c1 | 3300050494 | Bacteria | 9683 |
| 632 | nmdc:mga06z11_12226_c1 | 3300050494 | Bacteria | 3728 |
| 633 | nmdc:mga06z11_1222_c1 | 3300050494 | Bacteria | 9490 |
| 634 | nmdc:mga06z11_34442_c1 | 3300050494 | Bacteria | 2486 |
| 635 | nmdc:mga06z11_399038_c1 | 3300050494 | Bacteria | 828 |
| 636 | nmdc:mga04h51_12668_c1 | 3300050495 | Bacteria | 2373 |
| 637 | nmdc:mga04h51_20329_c1 | 3300050495 | Bacteria | 1980 |
| 638 | nmdc:mga04h51_21280_c1 | 3300050495 | Bacteria | 1949 |
| 639 | nmdc:mga07m45_10176_c1 | 3300050496 | Bacteria | 4904 |
| 640 | nmdc:mga07m45_11203_c1 | 3300050496 | Bacteria | 4707 |
| 641 | nmdc:mga07m45_18918_c1 | 3300050496 | Bacteria | 3726 |
| 642 | nmdc:mga07m45_2945_c1 | 3300050496 | Bacteria | 8088 |
| 643 | nmdc:mga07m45_319534_c1 | 3300050496 | Bacteria | 902 |
| 644 | nmdc:mga07m45_419756_c1 | 3300050496 | Bacteria | 776 |
| 645 | nmdc:mga07m45_436956_c1 | 3300050496 | Bacteria | 759 |
| 646 | nmdc:mga07m45_5771_c1 | 3300050496 | Bacteria | 6199 |
| 647 | nmdc:mga0n895_393580_c1 | 3300050512 | Bacteria | 1402 |
| 648 | nmdc:mga0rr50_48031_c1 | 3300050513 | Bacteria | 3153 |
| 649 | nmdc:mga08x19_107219_c1 | 3300050514 | Bacteria | 1859 |
| 650 | nmdc:mga0sz30_146_c1 | 3300050516 | Bacteria | 26463 |
| 651 | nmdc:mga0sz30_1566_c1 | 3300050516 | Bacteria | 8157 |
| 652 | nmdc:mga0sz30_24654_c1 | 3300050516 | Bacteria | 2456 |
| 653 | nmdc:mga0sz30_81875_c1 | 3300050516 | Bacteria | 1397 |
| 654 | nmdc:mga0sz30_84302_c1 | 3300050516 | Bacteria | 1378 |
| 655 | Ga0500610_0041200 | 3300053079 | Bacteria | 2388 |
| 656 | Ga0495655_0056284 | 3300053083 | Bacteria | 1058 |
| 657 | Ga0500578_0032053 | 3300053086 | Bacteria | 3379 |
| 658 | Ga0500578_0043234 | 3300053086 | Bacteria | 2892 |
| 659 | Ga0500646_0082878 | 3300053090 | Bacteria | 981 |
| 660 | Ga0500651_0004173 | 3300053093 | Bacteria | 8056 |
| 661 | Ga0500650_0033838 | 3300053098 | Bacteria | 2333 |
| 662 | Ga0500555_029966 | 3300053103 | Bacteria | 1546 |
| 663 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 664 | Ga0500557_000013 | 3300053105 | Bacteria | 108649 |
| 665 | Ga0500557_130391 | 3300053105 | Bacteria | 833 |
| 666 | Ga0500562_001306 | 3300053108 | Bacteria | 6146 |
| 667 | Ga0500595_001800 | 3300053119 | Bacteria | 11111 |
| 668 | Ga0500595_003825 | 3300053119 | Bacteria | 6918 |
| 669 | Ga0500597_134190 | 3300053120 | Bacteria | 1069 |
| 670 | Ga0500642_0000021 | 3300053130 | Bacteria | 146938 |
| 671 | Ga0500642_0135278 | 3300053130 | Bacteria | 1155 |
| 672 | Ga0500642_0170905 | 3300053130 | Bacteria | 1017 |
| 673 | Ga0500655_003131 | 3300053133 | Bacteria | 3003 |
| 674 | Ga0500655_010034 | 3300053133 | Bacteria | 1708 |
| 675 | Ga0500658_0150595 | 3300053134 | Bacteria | 1048 |
| 676 | Ga0500658_0305600 | 3300053134 | Bacteria | 731 |
| 677 | Ga0500561_0051494 | 3300053137 | Bacteria | 1125 |
| 678 | Ga0500577_0020738 | 3300053142 | Bacteria | 2155 |
| 679 | Ga0500577_0036271 | 3300053142 | Bacteria | 1765 |
| 680 | Ga0500588_0088714 | 3300053146 | Bacteria | 1048 |
| 681 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 682 | Ga0500616_0015708 | 3300053153 | Bacteria | 4323 |
| 683 | Ga0500616_0166968 | 3300053153 | Bacteria | 1003 |
| 684 | Ga0500625_084496 | 3300053729 | Bacteria | 1375 |
| 685 | Ga0500645_017019 | 3300053730 | Bacteria | 2283 |
| 686 | Ga0500609_000618 | 3300053731 | Bacteria | 5406 |
| 687 | Ga0500599_006345 | 3300053736 | Bacteria | 1507 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8016613128 | 8016620294 | 189 |
| 2 | iso_pu_bacteria | 8016530956 | 8016537739 | 197 |
| 3 | 3300005548 | Ga0070665_100132531 | Ga0070665_1001325312 | 198 |
| 4 | iso_pu_bacteria | 8016530956 | 8016533394 | 199 |
| 5 | 3300031247 | Ga0265340_10193533 | Ga0265340_101935332 | 200 |
| 6 | 3300032005 | Ga0307411_10507022 | Ga0307411_105070221 | 200 |
| 7 | 3300005436 | Ga0070713_100021937 | Ga0070713_1000219373 | 201 |
| 8 | 3300005437 | Ga0070710_10008491 | Ga0070710_100084915 | 201 |
| 9 | 3300005439 | Ga0070711_100056918 | Ga0070711_1000569183 | 201 |
| 10 | 3300005445 | Ga0070708_100758164 | Ga0070708_1007581641 | 201 |
| 11 | 3300005467 | Ga0070706_100072284 | Ga0070706_1000722844 | 201 |
| 12 | 3300006028 | Ga0070717_10030744 | Ga0070717_100307443 | 201 |
| 13 | 3300006914 | Ga0075436_100369611 | Ga0075436_1003696111 | 201 |
| 14 | 3300025906 | Ga0207699_10102314 | Ga0207699_101023143 | 201 |
| 15 | 3300025915 | Ga0207693_10003094 | Ga0207693_1000309414 | 201 |
| 16 | 3300025928 | Ga0207700_10133072 | Ga0207700_101330723 | 201 |
| 17 | 3300025929 | Ga0207664_10084347 | Ga0207664_100843473 | 201 |
| 18 | 3300025937 | Ga0207669_10598488 | Ga0207669_105984882 | 201 |
| 19 | iso_pu_bacteria | 2508501128 | 2509149459 | 201 |
| 20 | 3300005439 | Ga0070711_100017044 | Ga0070711_1000170443 | 202 |
| 21 | 3300025916 | Ga0207663_10009233 | Ga0207663_100092334 | 202 |
| 22 | 3300025925 | Ga0207650_10348298 | Ga0207650_103482982 | 202 |
| 23 | 3300031247 | Ga0265340_10000984 | Ga0265340_100009845 | 202 |
| 24 | 3300046683 | Ga0495658_0400843 | Ga0495658_0400843_197_817 | 202 |
| 25 | 3300046453 | Ga0495627_011674 | Ga0495627_011674_1089_1700 | 203 |
| 26 | 3300046471 | Ga0495650_0009492 | Ga0495650_0009492_2472_3083 | 203 |
| 27 | 3300046474 | Ga0495605_0000007 | Ga0495605_0000007_219404_220015 | 203 |
| 28 | 3300046499 | Ga0495594_0005176 | Ga0495594_0005176_2623_3234 | 203 |
| 29 | 3300046506 | Ga0495583_0000007 | Ga0495583_0000007_177865_178476 | 203 |
| 30 | 3300046515 | Ga0495620_0000014 | Ga0495620_0000014_13228_13839 | 203 |
| 31 | 3300046518 | Ga0495631_0017773 | Ga0495631_0017773_260_871 | 203 |
| 32 | 3300046520 | Ga0495637_0071298 | Ga0495637_0071298_35_646 | 203 |
| 33 | 3300046524 | Ga0495648_0020609 | Ga0495648_0020609_1436_2047 | 203 |
| 34 | 3300046530 | Ga0495654_0002301 | Ga0495654_0002301_10879_11490 | 203 |
| 35 | 3300046538 | Ga0495609_0000004 | Ga0495609_0000004_221637_222248 | 203 |
| 36 | 3300046542 | Ga0495597_0007584 | Ga0495597_0007584_2432_3043 | 203 |
| 37 | 3300046558 | Ga0495633_0000135 | Ga0495633_0000135_94145_94756 | 203 |
| 38 | 3300046648 | Ga0495611_0010631 | Ga0495611_0010631_2503_3114 | 203 |
| 39 | 3300046665 | Ga0495661_0000009 | Ga0495661_0000009_185695_186306 | 203 |
| 40 | 3300046692 | Ga0495671_0003133 | Ga0495671_0003133_6961_7572 | 203 |
| 41 | 3300046794 | Ga0495589_0010436 | Ga0495589_0010436_2502_3113 | 203 |
| 42 | 3300046810 | Ga0495660_0000782 | Ga0495660_0000782_2081_2692 | 203 |
| 43 | 3300047323 | Ga0495683_0000004 | Ga0495683_0000004_3113_3724 | 203 |
| 44 | 3300047446 | Ga0495679_005551 | Ga0495679_005551_2464_3075 | 203 |
| 45 | 3300047470 | Ga0495681_0012940 | Ga0495681_0012940_2082_2693 | 203 |
| 46 | 3300047472 | Ga0495686_0314571 | Ga0495686_0314571_208_819 | 203 |
| 47 | 3300048925 | Ga0496122_0042046 | Ga0496122_0042046_1375_1986 | 203 |
| 48 | 3300048926 | Ga0496123_0013584 | Ga0496123_0013584_2475_3086 | 203 |
| 49 | 3300049459 | Ga0495678_000014 | Ga0495678_000014_310672_311283 | 203 |
| 50 | iso_pu_bacteria | 2903768456 | 2903777942 | 203 |
| 51 | 3300039438 | Ga0436360_1248138 | Ga0436360_1248138_45_689 | 204 |
| 52 | 3300039447 | Ga0436361_0027838 | Ga0436361_0027838_794_1417 | 204 |
| 53 | 3300049573 | Ga0501037_0470148 | Ga0501037_0470148_104_718 | 204 |
| 54 | 3300049574 | Ga0501038_0065626 | Ga0501038_0065626_2405_3019 | 204 |
| 55 | 3300049574 | Ga0501038_0285897 | Ga0501038_0285897_619_1233 | 204 |
| 56 | 3300049579 | Ga0501043_0744410 | Ga0501043_0744410_71_685 | 204 |
| 57 | 3300049581 | Ga0501047_0292767 | Ga0501047_0292767_325_945 | 204 |
| 58 | 3300049581 | Ga0501047_0569511 | Ga0501047_0569511_321_935 | 204 |
| 59 | 3300049823 | Ga0501044_0126613 | Ga0501044_0126613_1771_2385 | 204 |
| 60 | 3300049823 | Ga0501044_0187862 | Ga0501044_0187862_169_783 | 204 |
| 61 | 3300049823 | Ga0501044_0470272 | Ga0501044_0470272_353_967 | 204 |
| 62 | 3300005337 | Ga0070682_100532377 | Ga0070682_1005323772 | 205 |
| 63 | 3300005563 | Ga0068855_100135082 | Ga0068855_1001350823 | 205 |
| 64 | 3300025909 | Ga0207705_10001314 | Ga0207705_100013146 | 205 |
| 65 | 3300025912 | Ga0207707_10049105 | Ga0207707_100491054 | 205 |
| 66 | 3300025917 | Ga0207660_10019147 | Ga0207660_100191472 | 205 |
| 67 | 3300025919 | Ga0207657_10052519 | Ga0207657_100525193 | 205 |
| 68 | 3300025921 | Ga0207652_10062007 | Ga0207652_100620074 | 205 |
| 69 | 3300031711 | Ga0265314_10069030 | Ga0265314_100690303 | 205 |
| 70 | 3300039447 | Ga0436361_0251392 | Ga0436361_0251392_843_1460 | 205 |
| 71 | iso_pu_bacteria | 2513237139 | 2513878922 | 205 |
| 72 | iso_pu_bacteria | 2513237161 | 2514009884 | 205 |
| 73 | iso_pu_bacteria | 2617270735 | 2617346281 | 205 |
| 74 | iso_pu_bacteria | 2802429603 | 2805918220 | 205 |
| 75 | iso_pu_bacteria | 2824671348 | 2824672120 | 205 |
| 76 | iso_pu_bacteria | 2824687955 | 2824688719 | 205 |
| 77 | iso_pu_bacteria | 2824696289 | 2824697555 | 205 |
| 78 | iso_pu_bacteria | 2824773399 | 2824774327 | 205 |
| 79 | iso_pu_bacteria | 2838122688 | 2838123117 | 205 |
| 80 | iso_pu_bacteria | 2841941048 | 2841948200 | 205 |
| 81 | iso_pu_bacteria | 2841949485 | 2841954365 | 205 |
| 82 | iso_pu_bacteria | 2841966195 | 2841969736 | 205 |
| 83 | iso_pu_bacteria | 2841974524 | 2841978827 | 205 |
| 84 | iso_pu_bacteria | 2841983080 | 2841984058 | 205 |
| 85 | iso_pu_bacteria | 2847939898 | 2847947253 | 205 |
| 86 | iso_pu_bacteria | 3005506211 | 3005507598 | 205 |
| 87 | 3300006048 | Ga0075363_100127119 | Ga0075363_1001271192 | 206 |
| 88 | 3300006178 | Ga0075367_10227470 | Ga0075367_102274702 | 206 |
| 89 | 3300006178 | Ga0075367_10251278 | Ga0075367_102512781 | 206 |
| 90 | 3300006353 | Ga0075370_10479273 | Ga0075370_104792731 | 206 |
| 91 | 3300006871 | Ga0075434_100009856 | Ga0075434_1000098561 | 206 |
| 92 | 3300007076 | Ga0075435_100015609 | Ga0075435_1000156094 | 206 |
| 93 | 3300009177 | Ga0105248_10158484 | Ga0105248_101584842 | 206 |
| 94 | 3300009545 | Ga0105237_10016105 | Ga0105237_100161055 | 206 |
| 95 | 3300014968 | Ga0157379_10290540 | Ga0157379_102905401 | 206 |
| 96 | 3300025981 | Ga0207640_11032810 | Ga0207640_110328101 | 206 |
| 97 | 3300035695 | Ga0373927_0080832 | Ga0373927_0080832_1146_1766 | 206 |
| 98 | 3300041413 | Ga0439465_0087771 | Ga0439465_0087771_51_671 | 206 |
| 99 | 3300046452 | Ga0495617_004868 | Ga0495617_004868_1739_2359 | 206 |
| 100 | 3300046455 | Ga0495603_0056254 | Ga0495603_0056254_402_1022 | 206 |
| 101 | 3300046460 | Ga0495638_0171916 | Ga0495638_0171916_552_1172 | 206 |
| 102 | 3300046460 | Ga0495638_0384836 | Ga0495638_0384836_14_634 | 206 |
| 103 | 3300046461 | Ga0495641_0080421 | Ga0495641_0080421_780_1400 | 206 |
| 104 | 3300046492 | Ga0495585_0018902 | Ga0495585_0018902_939_1559 | 206 |
| 105 | 3300046500 | Ga0495596_0017144 | Ga0495596_0017144_483_1103 | 206 |
| 106 | 3300046513 | Ga0495616_0028100 | Ga0495616_0028100_258_878 | 206 |
| 107 | 3300046518 | Ga0495631_0018469 | Ga0495631_0018469_861_1481 | 206 |
| 108 | 3300046519 | Ga0495632_0057635 | Ga0495632_0057635_294_914 | 206 |
| 109 | 3300046520 | Ga0495637_0097801 | Ga0495637_0097801_252_872 | 206 |
| 110 | 3300046528 | Ga0495642_0139294 | Ga0495642_0139294_142_762 | 206 |
| 111 | 3300046538 | Ga0495609_0031446 | Ga0495609_0031446_245_865 | 206 |
| 112 | 3300046557 | Ga0495622_0079314 | Ga0495622_0079314_659_1279 | 206 |
| 113 | 3300046616 | Ga0495668_0140301 | Ga0495668_0140301_560_1180 | 206 |
| 114 | 3300046648 | Ga0495611_0089105 | Ga0495611_0089105_431_1051 | 206 |
| 115 | 3300046665 | Ga0495661_0059288 | Ga0495661_0059288_330_950 | 206 |
| 116 | 3300046691 | Ga0495670_0071292 | Ga0495670_0071292_72_692 | 206 |
| 117 | 3300046692 | Ga0495671_0039938 | Ga0495671_0039938_462_1082 | 206 |
| 118 | 3300046794 | Ga0495589_0068257 | Ga0495589_0068257_365_985 | 206 |
| 119 | 3300047320 | Ga0495672_0197700 | Ga0495672_0197700_349_969 | 206 |
| 120 | 3300047323 | Ga0495683_0072582 | Ga0495683_0072582_168_788 | 206 |
| 121 | 3300047469 | Ga0495673_0067525 | Ga0495673_0067525_824_1444 | 206 |
| 122 | 3300047472 | Ga0495686_0037675 | Ga0495686_0037675_2218_2838 | 206 |
| 123 | 3300048916 | Ga0496113_0327457 | Ga0496113_0327457_494_1114 | 206 |
| 124 | 3300048922 | Ga0496119_0264408 | Ga0496119_0264408_196_816 | 206 |
| 125 | 3300048924 | Ga0496121_0118274 | Ga0496121_0118274_508_1128 | 206 |
| 126 | 3300048929 | Ga0496126_0004249 | Ga0496126_0004249_15746_16366 | 206 |
| 127 | 3300048929 | Ga0496126_0333408 | Ga0496126_0333408_285_905 | 206 |
| 128 | 3300049459 | Ga0495678_062769 | Ga0495678_062769_691_1311 | 206 |
| 129 | 3300050490 | nmdc:mga03n38_5257_c1 | nmdc:mga03n38_5257_c1_971_1591 | 206 |
| 130 | 3300050494 | nmdc:mga06z11_1144_c1 | nmdc:mga06z11_1144_c1_804_1424 | 206 |
| 131 | 3300050496 | nmdc:mga07m45_10176_c1 | nmdc:mga07m45_10176_c1_59_679 | 206 |
| 132 | 3300050496 | nmdc:mga07m45_436956_c1 | nmdc:mga07m45_436956_c1_65_685 | 206 |
| 133 | 3300050513 | nmdc:mga0rr50_48031_c1 | nmdc:mga0rr50_48031_c1_764_1411 | 206 |
| 134 | 3300053103 | Ga0500555_029966 | Ga0500555_029966_196_816 | 206 |
| 135 | 3300053105 | Ga0500557_130391 | Ga0500557_130391_185_805 | 206 |
| 136 | 3300053130 | Ga0500642_0135278 | Ga0500642_0135278_479_1099 | 206 |
| 137 | 3300053130 | Ga0500642_0170905 | Ga0500642_0170905_357_977 | 206 |
| 138 | 3300053134 | Ga0500658_0150595 | Ga0500658_0150595_71_691 | 206 |
| 139 | 3300053137 | Ga0500561_0051494 | Ga0500561_0051494_152_772 | 206 |
| 140 | 3300053146 | Ga0500588_0088714 | Ga0500588_0088714_358_978 | 206 |
| 141 | iso_pu_bacteria | 2513237092 | 2513621556 | 206 |
| 142 | iso_pu_bacteria | 2513237101 | 2513693855 | 206 |
| 143 | iso_pu_bacteria | 2513237102 | 2513703327 | 206 |
| 144 | iso_pu_bacteria | 2513237141 | 2513887638 | 206 |
| 145 | iso_pu_bacteria | 2513237161 | 2514011604 | 206 |
| 146 | iso_pu_bacteria | 2515154112 | 2515626978 | 206 |
| 147 | iso_pu_bacteria | 2617270741 | 2617375233 | 206 |
| 148 | iso_pu_bacteria | 2721755755 | 2723843342 | 206 |
| 149 | iso_pu_bacteria | 2824617872 | 2824619059 | 206 |
| 150 | iso_pu_bacteria | 2824626560 | 2824627421 | 206 |
| 151 | iso_pu_bacteria | 2824635225 | 2824637642 | 206 |
| 152 | iso_pu_bacteria | 2824644064 | 2824644585 | 206 |
| 153 | iso_pu_bacteria | 2824714736 | 2824722260 | 206 |
| 154 | iso_pu_bacteria | 2824723954 | 2824724273 | 206 |
| 155 | iso_pu_bacteria | 2842038055 | 2842040931 | 206 |
| 156 | iso_pu_bacteria | 2842045827 | 2842046124 | 206 |
| 157 | iso_pu_bacteria | 2847930680 | 2847933799 | 206 |
| 158 | iso_pu_bacteria | 2847939898 | 2847947079 | 206 |
| 159 | iso_pu_bacteria | 2857509624 | 2857511276 | 206 |
| 160 | iso_pu_bacteria | 2874590934 | 2874592992 | 206 |
| 161 | iso_pu_bacteria | 2874604998 | 2874611743 | 206 |
| 162 | iso_pu_bacteria | 2874612657 | 2874619880 | 206 |
| 163 | iso_pu_bacteria | 2874645413 | 2874647608 | 206 |
| 164 | iso_pu_bacteria | 2876771140 | 2876779225 | 206 |
| 165 | iso_pu_bacteria | 2876808645 | 2876815301 | 206 |
| 166 | iso_pu_bacteria | 2876818435 | 2876820144 | 206 |
| 167 | iso_pu_bacteria | 2879074833 | 2879076648 | 206 |
| 168 | iso_pu_bacteria | 2879083081 | 2879087326 | 206 |
| 169 | iso_pu_bacteria | 2879110137 | 2879117212 | 206 |
| 170 | iso_pu_bacteria | 2879127579 | 2879129422 | 206 |
| 171 | iso_pu_bacteria | 2879142872 | 2879145355 | 206 |
| 172 | iso_pu_bacteria | 2889033259 | 2889036770 | 206 |
| 173 | iso_pu_bacteria | 2906626472 | 2906634371 | 206 |
| 174 | iso_pu_bacteria | 2906643746 | 2906644319 | 206 |
| 175 | iso_pu_bacteria | 2906643746 | 2906651625 | 206 |
| 176 | iso_pu_bacteria | 2906660503 | 2906664917 | 206 |
| 177 | iso_pu_bacteria | 2922386360 | 2922387133 | 206 |
| 178 | iso_pu_bacteria | 2935608549 | 2935609106 | 206 |
| 179 | iso_pu_bacteria | 2935703347 | 2935708170 | 206 |
| 180 | iso_pu_bacteria | 2935769743 | 2935770094 | 206 |
| 181 | iso_pu_bacteria | 2935769743 | 2935774536 | 206 |
| 182 | iso_pu_bacteria | 2935777560 | 2935781827 | 206 |
| 183 | iso_pu_bacteria | 2935785616 | 2935785665 | 206 |
| 184 | iso_pu_bacteria | 2935785616 | 2935789449 | 206 |
| 185 | iso_pu_bacteria | 2935793552 | 2935794407 | 206 |
| 186 | iso_pu_bacteria | 2935793552 | 2935797508 | 206 |
| 187 | iso_pu_bacteria | 2935819856 | 2935822266 | 206 |
| 188 | iso_pu_bacteria | 2935847175 | 2935847848 | 206 |
| 189 | iso_pu_bacteria | 2935916978 | 2935923683 | 206 |
| 190 | iso_pu_bacteria | 2936002035 | 2936009406 | 206 |
| 191 | iso_pu_bacteria | 2941531003 | 2941536172 | 206 |
| 192 | iso_pu_bacteria | 3005506211 | 3005512810 | 206 |
| 193 | iso_pu_bacteria | 8006964411 | 8006968510 | 206 |
| 194 | iso_pu_bacteria | 8006984368 | 8006984830 | 206 |
| 195 | iso_pu_bacteria | 8006984368 | 8006987223 | 206 |
| 196 | iso_pu_bacteria | 8006994254 | 8006994753 | 206 |
| 197 | iso_pu_bacteria | 8016522445 | 8016524194 | 206 |
| 198 | iso_pu_bacteria | 8016522445 | 8016528251 | 206 |
| 199 | iso_pu_bacteria | 8016539877 | 8016546632 | 206 |
| 200 | iso_pu_bacteria | 8016548790 | 8016551263 | 206 |
| 201 | iso_pu_bacteria | 8016548790 | 8016555497 | 206 |
| 202 | iso_pu_bacteria | 8016557553 | 8016559655 | 206 |
| 203 | iso_pu_bacteria | 8016557553 | 8016563854 | 206 |
| 204 | iso_pu_bacteria | 8016566248 | 8016567397 | 206 |
| 205 | iso_pu_bacteria | 8016566248 | 8016571728 | 206 |
| 206 | iso_pu_bacteria | 8016575299 | 8016575949 | 206 |
| 207 | iso_pu_bacteria | 8016575299 | 8016580104 | 206 |
| 208 | iso_pu_bacteria | 8016583857 | 8016594680 | 206 |
| 209 | iso_pu_bacteria | 8016595262 | 8016597594 | 206 |
| 210 | iso_pu_bacteria | 8016595262 | 8016601575 | 206 |
| 211 | iso_pu_bacteria | 8016603502 | 8016604719 | 206 |
| 212 | iso_pu_bacteria | 8016622563 | 8016629684 | 206 |
| 213 | iso_pu_bacteria | 8019530166 | 8019533190 | 206 |
| 214 | iso_pu_bacteria | 8019530166 | 8019537414 | 206 |
| 215 | iso_pu_bacteria | 8019538911 | 8019539127 | 206 |
| 216 | iso_pu_bacteria | 8019547302 | 8019548623 | 206 |
| 217 | iso_pu_bacteria | 8019555841 | 8019556350 | 206 |
| 218 | iso_pu_bacteria | 8019565922 | 8019568964 | 206 |
| 219 | iso_pu_bacteria | 8019648815 | 8019656888 | 206 |
| 220 | iso_pu_bacteria | 8019668869 | 8019671172 | 206 |
| 221 | iso_pu_bacteria | 8019678201 | 8019685016 | 206 |
| 222 | iso_pu_bacteria | 8056673599 | 8056680745 | 206 |
| 223 | 3300005436 | Ga0070713_100264739 | Ga0070713_1002647393 | 207 |
| 224 | 3300005618 | Ga0068864_100308477 | Ga0068864_1003084771 | 207 |
| 225 | 3300014325 | Ga0163163_10017382 | Ga0163163_100173824 | 207 |
| 226 | 3300021361 | Ga0213872_10213172 | Ga0213872_102131721 | 207 |
| 227 | 3300037471 | Ga0395905_0304380 | Ga0395905_0304380_269_892 | 207 |
| 228 | 3300039447 | Ga0436361_0395654 | Ga0436361_0395654_91_744 | 207 |
| 229 | 3300047320 | Ga0495672_0046429 | Ga0495672_0046429_1545_2168 | 207 |
| 230 | 3300048904 | Ga0496101_0272681 | Ga0496101_0272681_201_830 | 207 |
| 231 | 3300048907 | Ga0496104_0120526 | Ga0496104_0120526_171_800 | 207 |
| 232 | 3300048908 | Ga0496105_0010795 | Ga0496105_0010795_4426_5055 | 207 |
| 233 | 3300048911 | Ga0496108_0013055 | Ga0496108_0013055_4413_5042 | 207 |
| 234 | 3300048912 | Ga0496109_0025083 | Ga0496109_0025083_260_889 | 207 |
| 235 | 3300048914 | Ga0496111_0020383 | Ga0496111_0020383_1612_2241 | 207 |
| 236 | 3300048915 | Ga0496112_0030908 | Ga0496112_0030908_148_777 | 207 |
| 237 | 3300048916 | Ga0496113_0825778 | Ga0496113_0825778_33_662 | 207 |
| 238 | 3300048918 | Ga0496115_0034144 | Ga0496115_0034144_1667_2296 | 207 |
| 239 | iso_pu_bacteria | 2513237098 | 2513679210 | 207 |
| 240 | iso_pu_bacteria | 2524023210 | 2524463641 | 207 |
| 241 | iso_pu_bacteria | 2885383462 | 2885383623 | 207 |
| 242 | iso_pu_bacteria | 2922361189 | 2922362461 | 207 |
| 243 | iso_pu_bacteria | 8056681323 | 8056685789 | 207 |
| 244 | 3300035170 | Ga0373943_0165877 | Ga0373943_0165877_266_892 | 208 |
| 245 | 3300035692 | Ga0373935_0337822 | Ga0373935_0337822_225_851 | 208 |
| 246 | 3300035695 | Ga0373927_0207333 | Ga0373927_0207333_574_1200 | 208 |
| 247 | 3300035725 | Ga0373947_0004894 | Ga0373947_0004894_5807_6433 | 208 |
| 248 | 3300037068 | Ga0373925_0105652 | Ga0373925_0105652_1330_1956 | 208 |
| 249 | 3300046690 | Ga0495624_0069240 | Ga0495624_0069240_1175_1801 | 208 |
| 250 | 3300047321 | Ga0495676_0064029 | Ga0495676_0064029_819_1445 | 208 |
| 251 | 3300047472 | Ga0495686_0041047 | Ga0495686_0041047_770_1396 | 208 |
| 252 | iso_pu_bacteria | 2643221651 | 2644288894 | 208 |
| 253 | 3300003320 | rootH2_10200493 | rootH2_102004933 | 209 |
| 254 | 3300003659 | JGI25404J52841_10000495 | JGI25404J52841_100004953 | 209 |
| 255 | 3300003659 | JGI25404J52841_10001459 | JGI25404J52841_100014592 | 209 |
| 256 | 3300005329 | Ga0070683_100385312 | Ga0070683_1003853122 | 209 |
| 257 | 3300005330 | Ga0070690_100644885 | Ga0070690_1006448851 | 209 |
| 258 | 3300005334 | Ga0068869_100002313 | Ga0068869_1000023132 | 209 |
| 259 | 3300005335 | Ga0070666_10068587 | Ga0070666_100685872 | 209 |
| 260 | 3300005338 | Ga0068868_100001022 | Ga0068868_10000102216 | 209 |
| 261 | 3300005340 | Ga0070689_100159468 | Ga0070689_1001594682 | 209 |
| 262 | 3300005347 | Ga0070668_100015257 | Ga0070668_1000152573 | 209 |
| 263 | 3300005355 | Ga0070671_100011334 | Ga0070671_1000113342 | 209 |
| 264 | 3300005365 | Ga0070688_100176367 | Ga0070688_1001763671 | 209 |
| 265 | 3300005366 | Ga0070659_100300463 | Ga0070659_1003004631 | 209 |
| 266 | 3300005367 | Ga0070667_100029578 | Ga0070667_1000295783 | 209 |
| 267 | 3300005434 | Ga0070709_10034328 | Ga0070709_100343282 | 209 |
| 268 | 3300005434 | Ga0070709_10201075 | Ga0070709_102010752 | 209 |
| 269 | 3300005435 | Ga0070714_100174474 | Ga0070714_1001744742 | 209 |
| 270 | 3300005436 | Ga0070713_100242188 | Ga0070713_1002421881 | 209 |
| 271 | 3300005437 | Ga0070710_10000540 | Ga0070710_100005405 | 209 |
| 272 | 3300005439 | Ga0070711_100011179 | Ga0070711_1000111794 | 209 |
| 273 | 3300005455 | Ga0070663_100516832 | Ga0070663_1005168321 | 209 |
| 274 | 3300005456 | Ga0070678_100034853 | Ga0070678_1000348532 | 209 |
| 275 | 3300005530 | Ga0070679_100190420 | Ga0070679_1001904202 | 209 |
| 276 | 3300005539 | Ga0068853_100021495 | Ga0068853_1000214954 | 209 |
| 277 | 3300005539 | Ga0068853_100993177 | Ga0068853_1009931771 | 209 |
| 278 | 3300005543 | Ga0070672_100222273 | Ga0070672_1002222732 | 209 |
| 279 | 3300005544 | Ga0070686_100321303 | Ga0070686_1003213032 | 209 |
| 280 | 3300005548 | Ga0070665_100039336 | Ga0070665_1000393365 | 209 |
| 281 | 3300005563 | Ga0068855_100120298 | Ga0068855_1001202983 | 209 |
| 282 | 3300005577 | Ga0068857_100067731 | Ga0068857_1000677311 | 209 |
| 283 | 3300005616 | Ga0068852_100146928 | Ga0068852_1001469282 | 209 |
| 284 | 3300005617 | Ga0068859_100154154 | Ga0068859_1001541542 | 209 |
| 285 | 3300005618 | Ga0068864_100004413 | Ga0068864_1000044133 | 209 |
| 286 | 3300005719 | Ga0068861_100279927 | Ga0068861_1002799272 | 209 |
| 287 | 3300005841 | Ga0068863_100371491 | Ga0068863_1003714911 | 209 |
| 288 | 3300005842 | Ga0068858_100053344 | Ga0068858_1000533443 | 209 |
| 289 | 3300005937 | Ga0081455_10365477 | Ga0081455_103654772 | 209 |
| 290 | 3300005983 | Ga0081540_1000894 | Ga0081540_100089414 | 209 |
| 291 | 3300005983 | Ga0081540_1001610 | Ga0081540_100161011 | 209 |
| 292 | 3300005983 | Ga0081540_1023511 | Ga0081540_10235113 | 209 |
| 293 | 3300006028 | Ga0070717_10004782 | Ga0070717_100047826 | 209 |
| 294 | 3300006028 | Ga0070717_10191936 | Ga0070717_101919361 | 209 |
| 295 | 3300006048 | Ga0075363_100017711 | Ga0075363_1000177112 | 209 |
| 296 | 3300006051 | Ga0075364_10017317 | Ga0075364_100173174 | 209 |
| 297 | 3300006163 | Ga0070715_10265100 | Ga0070715_102651001 | 209 |
| 298 | 3300006173 | Ga0070716_100266578 | Ga0070716_1002665781 | 209 |
| 299 | 3300006175 | Ga0070712_100062070 | Ga0070712_1000620702 | 209 |
| 300 | 3300006175 | Ga0070712_100062786 | Ga0070712_1000627863 | 209 |
| 301 | 3300006186 | Ga0075369_10011937 | Ga0075369_100119373 | 209 |
| 302 | 3300006237 | Ga0097621_100438647 | Ga0097621_1004386472 | 209 |
| 303 | 3300006353 | Ga0075370_10035274 | Ga0075370_100352743 | 209 |
| 304 | 3300006358 | Ga0068871_100075758 | Ga0068871_1000757582 | 209 |
| 305 | 3300006871 | Ga0075434_100263245 | Ga0075434_1002632452 | 209 |
| 306 | 3300006931 | Ga0097620_100154143 | Ga0097620_1001541432 | 209 |
| 307 | 3300007788 | Ga0099795_10088700 | Ga0099795_100887002 | 209 |
| 308 | 3300009093 | Ga0105240_10001503 | Ga0105240_1000150342 | 209 |
| 309 | 3300009093 | Ga0105240_10090685 | Ga0105240_100906853 | 209 |
| 310 | 3300009093 | Ga0105240_10105804 | Ga0105240_101058043 | 209 |
| 311 | 3300009098 | Ga0105245_10025260 | Ga0105245_100252605 | 209 |
| 312 | 3300009098 | Ga0105245_10099327 | Ga0105245_100993273 | 209 |
| 313 | 3300009101 | Ga0105247_10026598 | Ga0105247_100265983 | 209 |
| 314 | 3300009174 | Ga0105241_10002502 | Ga0105241_1000250210 | 209 |
| 315 | 3300009174 | Ga0105241_10005358 | Ga0105241_1000535810 | 209 |
| 316 | 3300009176 | Ga0105242_10195074 | Ga0105242_101950742 | 209 |
| 317 | 3300009177 | Ga0105248_10018891 | Ga0105248_100188917 | 209 |
| 318 | 3300009545 | Ga0105237_10000992 | Ga0105237_1000099235 | 209 |
| 319 | 3300009545 | Ga0105237_10006968 | Ga0105237_100069684 | 209 |
| 320 | 3300009545 | Ga0105237_10137721 | Ga0105237_101377212 | 209 |
| 321 | 3300009551 | Ga0105238_10515424 | Ga0105238_105154242 | 209 |
| 322 | 3300010375 | Ga0105239_10013385 | Ga0105239_100133852 | 209 |
| 323 | 3300010375 | Ga0105239_10020360 | Ga0105239_100203604 | 209 |
| 324 | 3300013105 | Ga0157369_10008235 | Ga0157369_100082352 | 209 |
| 325 | 3300013296 | Ga0157374_10091824 | Ga0157374_100918243 | 209 |
| 326 | 3300013297 | Ga0157378_10054093 | Ga0157378_100540933 | 209 |
| 327 | 3300013297 | Ga0157378_10384167 | Ga0157378_103841671 | 209 |
| 328 | 3300013306 | Ga0163162_10443546 | Ga0163162_104435461 | 209 |
| 329 | 3300013307 | Ga0157372_10095801 | Ga0157372_100958013 | 209 |
| 330 | 3300013307 | Ga0157372_10346156 | Ga0157372_103461562 | 209 |
| 331 | 3300013307 | Ga0157372_10393697 | Ga0157372_103936972 | 209 |
| 332 | 3300013308 | Ga0157375_10114963 | Ga0157375_101149632 | 209 |
| 333 | 3300014325 | Ga0163163_10104941 | Ga0163163_101049413 | 209 |
| 334 | 3300014325 | Ga0163163_10255560 | Ga0163163_102555602 | 209 |
| 335 | 3300014968 | Ga0157379_10023227 | Ga0157379_100232274 | 209 |
| 336 | 3300014969 | Ga0157376_10055754 | Ga0157376_100557542 | 209 |
| 337 | 3300014969 | Ga0157376_10419063 | Ga0157376_104190633 | 209 |
| 338 | 3300021377 | Ga0213874_10010033 | Ga0213874_100100332 | 209 |
| 339 | 3300022467 | Ga0224712_10064542 | Ga0224712_100645421 | 209 |
| 340 | 3300025904 | Ga0207647_10062207 | Ga0207647_100622072 | 209 |
| 341 | 3300025906 | Ga0207699_10038889 | Ga0207699_100388893 | 209 |
| 342 | 3300025908 | Ga0207643_10109823 | Ga0207643_101098231 | 209 |
| 343 | 3300025913 | Ga0207695_10000159 | Ga0207695_1000015985 | 209 |
| 344 | 3300025913 | Ga0207695_10123220 | Ga0207695_101232202 | 209 |
| 345 | 3300025913 | Ga0207695_10139450 | Ga0207695_101394503 | 209 |
| 346 | 3300025914 | Ga0207671_10004461 | Ga0207671_100044615 | 209 |
| 347 | 3300025914 | Ga0207671_10054331 | Ga0207671_100543314 | 209 |
| 348 | 3300025915 | Ga0207693_10008912 | Ga0207693_100089128 | 209 |
| 349 | 3300025915 | Ga0207693_10015668 | Ga0207693_100156684 | 209 |
| 350 | 3300025916 | Ga0207663_10073865 | Ga0207663_100738652 | 209 |
| 351 | 3300025916 | Ga0207663_10185537 | Ga0207663_101855371 | 209 |
| 352 | 3300025921 | Ga0207652_10208558 | Ga0207652_102085582 | 209 |
| 353 | 3300025925 | Ga0207650_10314594 | Ga0207650_103145941 | 209 |
| 354 | 3300025926 | Ga0207659_10173700 | Ga0207659_101737002 | 209 |
| 355 | 3300025927 | Ga0207687_10043470 | Ga0207687_100434704 | 209 |
| 356 | 3300025928 | Ga0207700_10060556 | Ga0207700_100605563 | 209 |
| 357 | 3300025928 | Ga0207700_10648646 | Ga0207700_106486462 | 209 |
| 358 | 3300025929 | Ga0207664_10575123 | Ga0207664_105751232 | 209 |
| 359 | 3300025932 | Ga0207690_10078093 | Ga0207690_100780931 | 209 |
| 360 | 3300025935 | Ga0207709_10604521 | Ga0207709_106045211 | 209 |
| 361 | 3300025936 | Ga0207670_10225577 | Ga0207670_102255771 | 209 |
| 362 | 3300025939 | Ga0207665_10016844 | Ga0207665_100168445 | 209 |
| 363 | 3300025941 | Ga0207711_10300187 | Ga0207711_103001871 | 209 |
| 364 | 3300025942 | Ga0207689_10002279 | Ga0207689_1000227912 | 209 |
| 365 | 3300025944 | Ga0207661_10544096 | Ga0207661_105440961 | 209 |
| 366 | 3300025949 | Ga0207667_10192977 | Ga0207667_101929771 | 209 |
| 367 | 3300025960 | Ga0207651_10119747 | Ga0207651_101197473 | 209 |
| 368 | 3300025972 | Ga0207668_10008317 | Ga0207668_100083172 | 209 |
| 369 | 3300026023 | Ga0207677_10061644 | Ga0207677_100616443 | 209 |
| 370 | 3300026067 | Ga0207678_10006820 | Ga0207678_1000682010 | 209 |
| 371 | 3300026067 | Ga0207678_10079287 | Ga0207678_100792872 | 209 |
| 372 | 3300026078 | Ga0207702_10157155 | Ga0207702_101571551 | 209 |
| 373 | 3300026088 | Ga0207641_10369896 | Ga0207641_103698962 | 209 |
| 374 | 3300026089 | Ga0207648_10183313 | Ga0207648_101833132 | 209 |
| 375 | 3300026095 | Ga0207676_10017961 | Ga0207676_100179614 | 209 |
| 376 | 3300026116 | Ga0207674_10163807 | Ga0207674_101638072 | 209 |
| 377 | 3300026118 | Ga0207675_100255166 | Ga0207675_1002551662 | 209 |
| 378 | 3300026121 | Ga0207683_10003329 | Ga0207683_100033294 | 209 |
| 379 | 3300026142 | Ga0207698_10214723 | Ga0207698_102147232 | 209 |
| 380 | 3300027512 | Ga0209179_1035980 | Ga0209179_10359801 | 209 |
| 381 | 3300028380 | Ga0268265_10040702 | Ga0268265_100407023 | 209 |
| 382 | 3300031249 | Ga0265339_10004913 | Ga0265339_100049137 | 209 |
| 383 | 3300037418 | Ga0395900_0670466 | Ga0395900_0670466_47_709 | 209 |
| 384 | 3300037466 | Ga0395898_0054005 | Ga0395898_0054005_807_1469 | 209 |
| 385 | 3300038443 | Ga0395901_0030366 | Ga0395901_0030366_1609_2271 | 209 |
| 386 | 3300039437 | Ga0436365_1232859 | Ga0436365_1232859_596_1282 | 209 |
| 387 | 3300039438 | Ga0436360_0228572 | Ga0436360_0228572_238_873 | 209 |
| 388 | 3300039450 | Ga0436363_0659157 | Ga0436363_0659157_2546_3193 | 209 |
| 389 | 3300041413 | Ga0439465_0021691 | Ga0439465_0021691_385_1026 | 209 |
| 390 | 3300046474 | Ga0495605_0060138 | Ga0495605_0060138_188_817 | 209 |
| 391 | 3300046691 | Ga0495670_0120583 | Ga0495670_0120583_132_761 | 209 |
| 392 | 3300048905 | Ga0496102_0033702 | Ga0496102_0033702_3060_3716 | 209 |
| 393 | 3300048907 | Ga0496104_0324438 | Ga0496104_0324438_68_724 | 209 |
| 394 | 3300048909 | Ga0496106_0070323 | Ga0496106_0070323_1801_2436 | 209 |
| 395 | 3300048909 | Ga0496106_0109139 | Ga0496106_0109139_18_674 | 209 |
| 396 | 3300048910 | Ga0496107_0522405 | Ga0496107_0522405_110_766 | 209 |
| 397 | 3300048911 | Ga0496108_0044587 | Ga0496108_0044587_2274_2930 | 209 |
| 398 | 3300048912 | Ga0496109_0692897 | Ga0496109_0692897_32_688 | 209 |
| 399 | 3300048913 | Ga0496110_0384618 | Ga0496110_0384618_112_768 | 209 |
| 400 | 3300048916 | Ga0496113_0481416 | Ga0496113_0481416_96_752 | 209 |
| 401 | 3300048917 | Ga0496114_0756415 | Ga0496114_0756415_88_723 | 209 |
| 402 | 3300048929 | Ga0496126_0004533 | Ga0496126_0004533_264_899 | 209 |
| 403 | 3300048929 | Ga0496126_0006868 | Ga0496126_0006868_10826_11524 | 209 |
| 404 | 3300048929 | Ga0496126_0063211 | Ga0496126_0063211_1122_1784 | 209 |
| 405 | 3300048929 | Ga0496126_0260347 | Ga0496126_0260347_363_1103 | 209 |
| 406 | 3300048929 | Ga0496126_0551354 | Ga0496126_0551354_27_662 | 209 |
| 407 | 3300049581 | Ga0501047_0049407 | Ga0501047_0049407_3194_3829 | 209 |
| 408 | 3300049581 | Ga0501047_0289675 | Ga0501047_0289675_711_1373 | 209 |
| 409 | 3300049589 | Ga0501073_0053478 | Ga0501073_0053478_2146_2808 | 209 |
| 410 | 3300049590 | Ga0501074_0541356 | Ga0501074_0541356_17_679 | 209 |
| 411 | 3300049741 | Ga0501079_0687459 | Ga0501079_0687459_21_656 | 209 |
| 412 | 3300049742 | Ga0501080_0076626 | Ga0501080_0076626_1563_2225 | 209 |
| 413 | 3300049823 | Ga0501044_0211580 | Ga0501044_0211580_833_1495 | 209 |
| 414 | 3300050492 | nmdc:mga0yw44_543660_c1 | nmdc:mga0yw44_543660_c1_46_702 | 209 |
| 415 | 3300050493 | nmdc:mga0k408_28300_c1 | nmdc:mga0k408_28300_c1_1889_2545 | 209 |
| 416 | 3300050494 | nmdc:mga06z11_399038_c1 | nmdc:mga06z11_399038_c1_105_761 | 209 |
| 417 | 3300050495 | nmdc:mga04h51_20329_c1 | nmdc:mga04h51_20329_c1_1209_1865 | 209 |
| 418 | 3300050496 | nmdc:mga07m45_419756_c1 | nmdc:mga07m45_419756_c1_70_699 | 209 |
| 419 | 3300050512 | nmdc:mga0n895_393580_c1 | nmdc:mga0n895_393580_c1_240_896 | 209 |
| 420 | 3300050514 | nmdc:mga08x19_107219_c1 | nmdc:mga08x19_107219_c1_643_1299 | 209 |
| 421 | 3300050516 | nmdc:mga0sz30_24654_c1 | nmdc:mga0sz30_24654_c1_1583_2239 | 209 |
| 422 | 3300053083 | Ga0495655_0056284 | Ga0495655_0056284_52_750 | 209 |
| 423 | 3300053130 | Ga0500642_0000021 | Ga0500642_0000021_76727_77356 | 209 |
| 424 | 3300001989 | JGI24739J22299_10081553 | JGI24739J22299_100815531 | 210 |
| 425 | 3300003214 | JGI25165J46597_1002506 | JGI25165J46597_10025067 | 210 |
| 426 | 3300003215 | JGI25153J46596_10000116 | JGI25153J46596_1000011646 | 210 |
| 427 | 3300003323 | rootH1_10265149 | rootH1_102651492 | 210 |
| 428 | 3300003659 | JGI25404J52841_10001668 | JGI25404J52841_100016684 | 210 |
| 429 | 3300003794 | Ga0055531_10008838 | Ga0055531_100088383 | 210 |
| 430 | 3300004625 | Ga0055543_1020287 | Ga0055543_10202872 | 210 |
| 431 | 3300005262 | Ga0065165_1000183 | Ga0065165_100018360 | 210 |
| 432 | 3300005262 | Ga0065165_1050476 | Ga0065165_10504762 | 210 |
| 433 | 3300005329 | Ga0070683_100000135 | Ga0070683_10000013542 | 210 |
| 434 | 3300005331 | Ga0070670_100357222 | Ga0070670_1003572221 | 210 |
| 435 | 3300005331 | Ga0070670_100700259 | Ga0070670_1007002591 | 210 |
| 436 | 3300005334 | Ga0068869_100236175 | Ga0068869_1002361752 | 210 |
| 437 | 3300005338 | Ga0068868_100069556 | Ga0068868_1000695563 | 210 |
| 438 | 3300005340 | Ga0070689_100182922 | Ga0070689_1001829222 | 210 |
| 439 | 3300005344 | Ga0070661_100501004 | Ga0070661_1005010041 | 210 |
| 440 | 3300005347 | Ga0070668_100006628 | Ga0070668_1000066284 | 210 |
| 441 | 3300005347 | Ga0070668_100032556 | Ga0070668_1000325562 | 210 |
| 442 | 3300005347 | Ga0070668_100116658 | Ga0070668_1001166581 | 210 |
| 443 | 3300005347 | Ga0070668_100246549 | Ga0070668_1002465492 | 210 |
| 444 | 3300005353 | Ga0070669_100255471 | Ga0070669_1002554712 | 210 |
| 445 | 3300005354 | Ga0070675_100203658 | Ga0070675_1002036581 | 210 |
| 446 | 3300005355 | Ga0070671_100051419 | Ga0070671_1000514191 | 210 |
| 447 | 3300005356 | Ga0070674_100002565 | Ga0070674_1000025652 | 210 |
| 448 | 3300005364 | Ga0070673_100625353 | Ga0070673_1006253531 | 210 |
| 449 | 3300005367 | Ga0070667_100440256 | Ga0070667_1004402561 | 210 |
| 450 | 3300005367 | Ga0070667_100679321 | Ga0070667_1006793211 | 210 |
| 451 | 3300005367 | Ga0070667_100869199 | Ga0070667_1008691991 | 210 |
| 452 | 3300005436 | Ga0070713_100267254 | Ga0070713_1002672541 | 210 |
| 453 | 3300005438 | Ga0070701_10169703 | Ga0070701_101697031 | 210 |
| 454 | 3300005441 | Ga0070700_100178951 | Ga0070700_1001789512 | 210 |
| 455 | 3300005441 | Ga0070700_100351772 | Ga0070700_1003517721 | 210 |
| 456 | 3300005445 | Ga0070708_100360744 | Ga0070708_1003607441 | 210 |
| 457 | 3300005455 | Ga0070663_100043697 | Ga0070663_1000436973 | 210 |
| 458 | 3300005455 | Ga0070663_100075185 | Ga0070663_1000751853 | 210 |
| 459 | 3300005455 | Ga0070663_100448780 | Ga0070663_1004487802 | 210 |
| 460 | 3300005456 | Ga0070678_100110244 | Ga0070678_1001102442 | 210 |
| 461 | 3300005456 | Ga0070678_100149160 | Ga0070678_1001491601 | 210 |
| 462 | 3300005457 | Ga0070662_100169806 | Ga0070662_1001698061 | 210 |
| 463 | 3300005466 | Ga0070685_10146953 | Ga0070685_101469532 | 210 |
| 464 | 3300005471 | Ga0070698_100293750 | Ga0070698_1002937501 | 210 |
| 465 | 3300005535 | Ga0070684_100000809 | Ga0070684_10000080917 | 210 |
| 466 | 3300005536 | Ga0070697_100005807 | Ga0070697_1000058079 | 210 |
| 467 | 3300005543 | Ga0070672_100074384 | Ga0070672_1000743842 | 210 |
| 468 | 3300005544 | Ga0070686_100424709 | Ga0070686_1004247092 | 210 |
| 469 | 3300005545 | Ga0070695_100222725 | Ga0070695_1002227252 | 210 |
| 470 | 3300005548 | Ga0070665_100017437 | Ga0070665_1000174377 | 210 |
| 471 | 3300005548 | Ga0070665_100397117 | Ga0070665_1003971172 | 210 |
| 472 | 3300005563 | Ga0068855_100357127 | Ga0068855_1003571271 | 210 |
| 473 | 3300005617 | Ga0068859_100036039 | Ga0068859_1000360395 | 210 |
| 474 | 3300005719 | Ga0068861_100004996 | Ga0068861_1000049962 | 210 |
| 475 | 3300005719 | Ga0068861_100020936 | Ga0068861_1000209364 | 210 |
| 476 | 3300005719 | Ga0068861_100301305 | Ga0068861_1003013052 | 210 |
| 477 | 3300005719 | Ga0068861_100519540 | Ga0068861_1005195401 | 210 |
| 478 | 3300005840 | Ga0068870_10219196 | Ga0068870_102191962 | 210 |
| 479 | 3300005841 | Ga0068863_100221147 | Ga0068863_1002211472 | 210 |
| 480 | 3300005842 | Ga0068858_100747351 | Ga0068858_1007473511 | 210 |
| 481 | 3300005843 | Ga0068860_100146791 | Ga0068860_1001467912 | 210 |
| 482 | 3300005843 | Ga0068860_100157892 | Ga0068860_1001578924 | 210 |
| 483 | 3300005843 | Ga0068860_100608472 | Ga0068860_1006084721 | 210 |
| 484 | 3300005844 | Ga0068862_100061991 | Ga0068862_1000619912 | 210 |
| 485 | 3300005844 | Ga0068862_100132335 | Ga0068862_1001323352 | 210 |
| 486 | 3300005844 | Ga0068862_100662759 | Ga0068862_1006627592 | 210 |
| 487 | 3300005937 | Ga0081455_10041142 | Ga0081455_100411424 | 210 |
| 488 | 3300005981 | Ga0081538_10055599 | Ga0081538_100555992 | 210 |
| 489 | 3300005983 | Ga0081540_1006149 | Ga0081540_10061492 | 210 |
| 490 | 3300005983 | Ga0081540_1008584 | Ga0081540_10085843 | 210 |
| 491 | 3300005983 | Ga0081540_1039346 | Ga0081540_10393461 | 210 |
| 492 | 3300005983 | Ga0081540_1045401 | Ga0081540_10454012 | 210 |
| 493 | 3300005983 | Ga0081540_1096368 | Ga0081540_10963682 | 210 |
| 494 | 3300006028 | Ga0070717_10001959 | Ga0070717_1000195910 | 210 |
| 495 | 3300006028 | Ga0070717_10570963 | Ga0070717_105709631 | 210 |
| 496 | 3300006038 | Ga0075365_10000653 | Ga0075365_100006539 | 210 |
| 497 | 3300006038 | Ga0075365_10036579 | Ga0075365_100365792 | 210 |
| 498 | 3300006038 | Ga0075365_10301834 | Ga0075365_103018342 | 210 |
| 499 | 3300006042 | Ga0075368_10000870 | Ga0075368_100008702 | 210 |
| 500 | 3300006042 | Ga0075368_10206050 | Ga0075368_102060501 | 210 |
| 501 | 3300006048 | Ga0075363_100104174 | Ga0075363_1001041742 | 210 |
| 502 | 3300006051 | Ga0075364_10036514 | Ga0075364_100365143 | 210 |
| 503 | 3300006051 | Ga0075364_10051311 | Ga0075364_100513112 | 210 |
| 504 | 3300006051 | Ga0075364_10080053 | Ga0075364_100800532 | 210 |
| 505 | 3300006173 | Ga0070716_100051617 | Ga0070716_1000516172 | 210 |
| 506 | 3300006173 | Ga0070716_100136642 | Ga0070716_1001366422 | 210 |
| 507 | 3300006175 | Ga0070712_100199569 | Ga0070712_1001995692 | 210 |
| 508 | 3300006177 | Ga0075362_10035534 | Ga0075362_100355342 | 210 |
| 509 | 3300006178 | Ga0075367_10000173 | Ga0075367_1000017310 | 210 |
| 510 | 3300006178 | Ga0075367_10036488 | Ga0075367_100364883 | 210 |
| 511 | 3300006178 | Ga0075367_10037095 | Ga0075367_100370952 | 210 |
| 512 | 3300006178 | Ga0075367_10202358 | Ga0075367_102023582 | 210 |
| 513 | 3300006186 | Ga0075369_10000799 | Ga0075369_100007994 | 210 |
| 514 | 3300006186 | Ga0075369_10013540 | Ga0075369_100135403 | 210 |
| 515 | 3300006186 | Ga0075369_10025955 | Ga0075369_100259553 | 210 |
| 516 | 3300006195 | Ga0075366_10045504 | Ga0075366_100455042 | 210 |
| 517 | 3300006195 | Ga0075366_10082506 | Ga0075366_100825062 | 210 |
| 518 | 3300006353 | Ga0075370_10005051 | Ga0075370_100050512 | 210 |
| 519 | 3300006353 | Ga0075370_10005793 | Ga0075370_100057932 | 210 |
| 520 | 3300006353 | Ga0075370_10012738 | Ga0075370_100127383 | 210 |
| 521 | 3300006353 | Ga0075370_10159909 | Ga0075370_101599091 | 210 |
| 522 | 3300006358 | Ga0068871_100216276 | Ga0068871_1002162762 | 210 |
| 523 | 3300006881 | Ga0068865_100028548 | Ga0068865_1000285482 | 210 |
| 524 | 3300006931 | Ga0097620_100036039 | Ga0097620_1000360392 | 210 |
| 525 | 3300006941 | Ga0099825_1022361 | Ga0099825_10223613 | 210 |
| 526 | 3300006944 | Ga0099823_1080415 | Ga0099823_10804152 | 210 |
| 527 | 3300007265 | Ga0099794_10069610 | Ga0099794_100696101 | 210 |
| 528 | 3300007788 | Ga0099795_10012008 | Ga0099795_100120082 | 210 |
| 529 | 3300007788 | Ga0099795_10061664 | Ga0099795_100616642 | 210 |
| 530 | 3300009093 | Ga0105240_10419251 | Ga0105240_104192512 | 210 |
| 531 | 3300009093 | Ga0105240_10900356 | Ga0105240_109003561 | 210 |
| 532 | 3300009094 | Ga0111539_10455596 | Ga0111539_104555962 | 210 |
| 533 | 3300009098 | Ga0105245_10091963 | Ga0105245_100919632 | 210 |
| 534 | 3300009101 | Ga0105247_10164585 | Ga0105247_101645852 | 210 |
| 535 | 3300009148 | Ga0105243_10013638 | Ga0105243_100136385 | 210 |
| 536 | 3300009148 | Ga0105243_11020869 | Ga0105243_110208691 | 210 |
| 537 | 3300009174 | Ga0105241_10092032 | Ga0105241_100920323 | 210 |
| 538 | 3300009174 | Ga0105241_10386341 | Ga0105241_103863411 | 210 |
| 539 | 3300009176 | Ga0105242_10049733 | Ga0105242_100497333 | 210 |
| 540 | 3300009176 | Ga0105242_10396017 | Ga0105242_103960172 | 210 |
| 541 | 3300009176 | Ga0105242_10867610 | Ga0105242_108676101 | 210 |
| 542 | 3300009177 | Ga0105248_10042235 | Ga0105248_100422353 | 210 |
| 543 | 3300009177 | Ga0105248_10745654 | Ga0105248_107456541 | 210 |
| 544 | 3300009545 | Ga0105237_10314702 | Ga0105237_103147022 | 210 |
| 545 | 3300009545 | Ga0105237_10465519 | Ga0105237_104655192 | 210 |
| 546 | 3300009545 | Ga0105237_10503344 | Ga0105237_105033442 | 210 |
| 547 | 3300009551 | Ga0105238_10269645 | Ga0105238_102696452 | 210 |
| 548 | 3300009551 | Ga0105238_10291567 | Ga0105238_102915672 | 210 |
| 549 | 3300009553 | Ga0105249_10014442 | Ga0105249_100144423 | 210 |
| 550 | 3300010159 | Ga0099796_10012867 | Ga0099796_100128673 | 210 |
| 551 | 3300010375 | Ga0105239_10021875 | Ga0105239_100218752 | 210 |
| 552 | 3300010375 | Ga0105239_10062055 | Ga0105239_100620554 | 210 |
| 553 | 3300010375 | Ga0105239_10062551 | Ga0105239_100625512 | 210 |
| 554 | 3300010375 | Ga0105239_10076460 | Ga0105239_100764603 | 210 |
| 555 | 3300010375 | Ga0105239_10090987 | Ga0105239_100909873 | 210 |
| 556 | 3300010375 | Ga0105239_10143484 | Ga0105239_101434845 | 210 |
| 557 | 3300010375 | Ga0105239_10278101 | Ga0105239_102781013 | 210 |
| 558 | 3300010375 | Ga0105239_10750760 | Ga0105239_107507601 | 210 |
| 559 | 3300011119 | Ga0105246_10166513 | Ga0105246_101665132 | 210 |
| 560 | 3300011119 | Ga0105246_10353901 | Ga0105246_103539012 | 210 |
| 561 | 3300013296 | Ga0157374_10203812 | Ga0157374_102038121 | 210 |
| 562 | 3300013296 | Ga0157374_10423280 | Ga0157374_104232801 | 210 |
| 563 | 3300013297 | Ga0157378_10020588 | Ga0157378_100205884 | 210 |
| 564 | 3300013306 | Ga0163162_10097876 | Ga0163162_100978763 | 210 |
| 565 | 3300013306 | Ga0163162_10253652 | Ga0163162_102536522 | 210 |
| 566 | 3300013308 | Ga0157375_10110192 | Ga0157375_101101922 | 210 |
| 567 | 3300013308 | Ga0157375_10162155 | Ga0157375_101621553 | 210 |
| 568 | 3300014325 | Ga0163163_10087542 | Ga0163163_100875421 | 210 |
| 569 | 3300014326 | Ga0157380_10016897 | Ga0157380_100168974 | 210 |
| 570 | 3300014745 | Ga0157377_10109856 | Ga0157377_101098562 | 210 |
| 571 | 3300014968 | Ga0157379_10206144 | Ga0157379_102061441 | 210 |
| 572 | 3300014968 | Ga0157379_10873020 | Ga0157379_108730202 | 210 |
| 573 | 3300017792 | Ga0163161_10027902 | Ga0163161_100279022 | 210 |
| 574 | 3300017792 | Ga0163161_10388759 | Ga0163161_103887591 | 210 |
| 575 | 3300021320 | Ga0214544_1011461 | Ga0214544_101146111 | 210 |
| 576 | 3300021377 | Ga0213874_10145890 | Ga0213874_101458901 | 210 |
| 577 | 3300025253 | Ga0209677_102995 | Ga0209677_1029954 | 210 |
| 578 | 3300025261 | Ga0209233_1003938 | Ga0209233_10039382 | 210 |
| 579 | 3300025295 | Ga0209564_1057965 | Ga0209564_10579651 | 210 |
| 580 | 3300025297 | Ga0209758_1000026 | Ga0209758_1000026443 | 210 |
| 581 | 3300025297 | Ga0209758_1000719 | Ga0209758_100071917 | 210 |
| 582 | 3300025297 | Ga0209758_1000761 | Ga0209758_100076124 | 210 |
| 583 | 3300025299 | Ga0209256_1000838 | Ga0209256_100083813 | 210 |
| 584 | 3300025302 | Ga0207426_1042271 | Ga0207426_10422711 | 210 |
| 585 | 3300025303 | Ga0209051_1043995 | Ga0209051_10439952 | 210 |
| 586 | 3300025304 | Ga0209257_1000201 | Ga0209257_100020112 | 210 |
| 587 | 3300025304 | Ga0209257_1012740 | Ga0209257_10127403 | 210 |
| 588 | 3300025901 | Ga0207688_10031950 | Ga0207688_100319501 | 210 |
| 589 | 3300025901 | Ga0207688_10231707 | Ga0207688_102317072 | 210 |
| 590 | 3300025904 | Ga0207647_10037170 | Ga0207647_100371702 | 210 |
| 591 | 3300025904 | Ga0207647_10077076 | Ga0207647_100770762 | 210 |
| 592 | 3300025904 | Ga0207647_10135293 | Ga0207647_101352931 | 210 |
| 593 | 3300025906 | Ga0207699_10113734 | Ga0207699_101137343 | 210 |
| 594 | 3300025906 | Ga0207699_10177730 | Ga0207699_101777301 | 210 |
| 595 | 3300025908 | Ga0207643_10031720 | Ga0207643_100317201 | 210 |
| 596 | 3300025911 | Ga0207654_10034644 | Ga0207654_100346442 | 210 |
| 597 | 3300025911 | Ga0207654_10169450 | Ga0207654_101694502 | 210 |
| 598 | 3300025911 | Ga0207654_10206450 | Ga0207654_102064502 | 210 |
| 599 | 3300025914 | Ga0207671_10304142 | Ga0207671_103041422 | 210 |
| 600 | 3300025914 | Ga0207671_10758005 | Ga0207671_107580051 | 210 |
| 601 | 3300025915 | Ga0207693_10045900 | Ga0207693_100459003 | 210 |
| 602 | 3300025915 | Ga0207693_10129874 | Ga0207693_101298742 | 210 |
| 603 | 3300025916 | Ga0207663_10012316 | Ga0207663_100123165 | 210 |
| 604 | 3300025919 | Ga0207657_10398938 | Ga0207657_103989381 | 210 |
| 605 | 3300025927 | Ga0207687_10044937 | Ga0207687_100449372 | 210 |
| 606 | 3300025929 | Ga0207664_10579204 | Ga0207664_105792042 | 210 |
| 607 | 3300025931 | Ga0207644_10023331 | Ga0207644_100233311 | 210 |
| 608 | 3300025933 | Ga0207706_10070593 | Ga0207706_100705932 | 210 |
| 609 | 3300025934 | Ga0207686_10325416 | Ga0207686_103254162 | 210 |
| 610 | 3300025937 | Ga0207669_10003823 | Ga0207669_100038232 | 210 |
| 611 | 3300025938 | Ga0207704_10183141 | Ga0207704_101831412 | 210 |
| 612 | 3300025939 | Ga0207665_10037242 | Ga0207665_100372423 | 210 |
| 613 | 3300025939 | Ga0207665_10044121 | Ga0207665_100441213 | 210 |
| 614 | 3300025940 | Ga0207691_10165977 | Ga0207691_101659772 | 210 |
| 615 | 3300025941 | Ga0207711_10015806 | Ga0207711_100158063 | 210 |
| 616 | 3300025941 | Ga0207711_10096512 | Ga0207711_100965122 | 210 |
| 617 | 3300025941 | Ga0207711_10584823 | Ga0207711_105848231 | 210 |
| 618 | 3300025942 | Ga0207689_10245095 | Ga0207689_102450951 | 210 |
| 619 | 3300025944 | Ga0207661_10000041 | Ga0207661_1000004126 | 210 |
| 620 | 3300025961 | Ga0207712_10121513 | Ga0207712_101215132 | 210 |
| 621 | 3300025961 | Ga0207712_10516391 | Ga0207712_105163911 | 210 |
| 622 | 3300025972 | Ga0207668_10004695 | Ga0207668_100046958 | 210 |
| 623 | 3300025972 | Ga0207668_10019241 | Ga0207668_100192413 | 210 |
| 624 | 3300025972 | Ga0207668_10080147 | Ga0207668_100801471 | 210 |
| 625 | 3300025981 | Ga0207640_10167833 | Ga0207640_101678332 | 210 |
| 626 | 3300025986 | Ga0207658_10369960 | Ga0207658_103699602 | 210 |
| 627 | 3300025986 | Ga0207658_10670907 | Ga0207658_106709071 | 210 |
| 628 | 3300026023 | Ga0207677_10350795 | Ga0207677_103507951 | 210 |
| 629 | 3300026023 | Ga0207677_10717735 | Ga0207677_107177352 | 210 |
| 630 | 3300026035 | Ga0207703_10669006 | Ga0207703_106690061 | 210 |
| 631 | 3300026041 | Ga0207639_10253398 | Ga0207639_102533982 | 210 |
| 632 | 3300026067 | Ga0207678_10018762 | Ga0207678_100187622 | 210 |
| 633 | 3300026067 | Ga0207678_10148814 | Ga0207678_101488141 | 210 |
| 634 | 3300026067 | Ga0207678_10531058 | Ga0207678_105310581 | 210 |
| 635 | 3300026075 | Ga0207708_10051352 | Ga0207708_100513523 | 210 |
| 636 | 3300026075 | Ga0207708_10197615 | Ga0207708_101976152 | 210 |
| 637 | 3300026075 | Ga0207708_10430747 | Ga0207708_104307471 | 210 |
| 638 | 3300026088 | Ga0207641_10174887 | Ga0207641_101748872 | 210 |
| 639 | 3300026089 | Ga0207648_10041401 | Ga0207648_100414014 | 210 |
| 640 | 3300026089 | Ga0207648_10098215 | Ga0207648_100982153 | 210 |
| 641 | 3300026116 | Ga0207674_10300568 | Ga0207674_103005682 | 210 |
| 642 | 3300026116 | Ga0207674_10584052 | Ga0207674_105840521 | 210 |
| 643 | 3300026118 | Ga0207675_100008611 | Ga0207675_1000086118 | 210 |
| 644 | 3300026118 | Ga0207675_100108766 | Ga0207675_1001087662 | 210 |
| 645 | 3300026118 | Ga0207675_100465581 | Ga0207675_1004655812 | 210 |
| 646 | 3300026118 | Ga0207675_100473684 | Ga0207675_1004736842 | 210 |
| 647 | 3300026121 | Ga0207683_10026804 | Ga0207683_100268045 | 210 |
| 648 | 3300026121 | Ga0207683_10035061 | Ga0207683_100350615 | 210 |
| 649 | 3300026142 | Ga0207698_11074890 | Ga0207698_110748901 | 210 |
| 650 | 3300027296 | Ga0209389_1000162 | Ga0209389_100016215 | 210 |
| 651 | 3300027361 | Ga0209489_112699 | Ga0209489_1126992 | 210 |
| 652 | 3300027361 | Ga0209489_112709 | Ga0209489_1127092 | 210 |
| 653 | 3300027363 | Ga0209700_100509 | Ga0209700_10050957 | 210 |
| 654 | 3300027512 | Ga0209179_1013684 | Ga0209179_10136842 | 210 |
| 655 | 3300027866 | Ga0209813_10000621 | Ga0209813_100006211 | 210 |
| 656 | 3300027866 | Ga0209813_10024965 | Ga0209813_100249651 | 210 |
| 657 | 3300028379 | Ga0268266_10006068 | Ga0268266_1000606810 | 210 |
| 658 | 3300028380 | Ga0268265_10040684 | Ga0268265_100406843 | 210 |
| 659 | 3300028380 | Ga0268265_10054929 | Ga0268265_100549293 | 210 |
| 660 | 3300028380 | Ga0268265_11081228 | Ga0268265_110812281 | 210 |
| 661 | 3300028381 | Ga0268264_10517712 | Ga0268264_105177122 | 210 |
| 662 | 3300028381 | Ga0268264_11404290 | Ga0268264_114042901 | 210 |
| 663 | 3300028786 | Ga0307517_10333033 | Ga0307517_103330331 | 210 |
| 664 | 3300031456 | Ga0307513_10139103 | Ga0307513_101391033 | 210 |
| 665 | 3300031548 | Ga0307408_100364805 | Ga0307408_1003648052 | 210 |
| 666 | 3300031548 | Ga0307408_100455223 | Ga0307408_1004552231 | 210 |
| 667 | 3300031730 | Ga0307516_10093721 | Ga0307516_100937212 | 210 |
| 668 | 3300031852 | Ga0307410_10319148 | Ga0307410_103191482 | 210 |
| 669 | 3300032126 | Ga0307415_100294420 | Ga0307415_1002944201 | 210 |
| 670 | 3300032126 | Ga0307415_100518101 | Ga0307415_1005181012 | 210 |
| 671 | 3300033180 | Ga0307510_10043108 | Ga0307510_100431083 | 210 |
| 672 | 3300035724 | Ga0373933_0002036 | Ga0373933_0002036_8761_9399 | 210 |
| 673 | 3300037418 | Ga0395900_0174904 | Ga0395900_0174904_1464_2099 | 210 |
| 674 | 3300037418 | Ga0395900_0302304 | Ga0395900_0302304_232_864 | 210 |
| 675 | 3300037471 | Ga0395905_0007905 | Ga0395905_0007905_6636_7268 | 210 |
| 676 | 3300037471 | Ga0395905_0071731 | Ga0395905_0071731_1029_1664 | 210 |
| 677 | 3300038443 | Ga0395901_0652854 | Ga0395901_0652854_78_710 | 210 |
| 678 | 3300039450 | Ga0436363_0248112 | Ga0436363_0248112_5081_5719 | 210 |
| 679 | 3300041410 | Ga0439461_0070203 | Ga0439461_0070203_87_731 | 210 |
| 680 | 3300041413 | Ga0439465_0056987 | Ga0439465_0056987_566_1198 | 210 |
| 681 | 3300042157 | Ga0439458_0060223 | Ga0439458_0060223_266_898 | 210 |
| 682 | 3300042438 | Ga0439459_0065424 | Ga0439459_0065424_158_790 | 210 |
| 683 | 3300044658 | Ga0466972_0000246 | Ga0466972_0000246_29343_29975 | 210 |
| 684 | 3300044683 | Ga0466965_0167211 | Ga0466965_0167211_181_813 | 210 |
| 685 | 3300044694 | Ga0466963_0072736 | Ga0466963_0072736_307_939 | 210 |
| 686 | 3300044842 | Ga0466957_0057337 | Ga0466957_0057337_496_1128 | 210 |
| 687 | 3300044842 | Ga0466957_0221598 | Ga0466957_0221598_28_723 | 210 |
| 688 | 3300045049 | Ga0466959_0012229 | Ga0466959_0012229_3135_3830 | 210 |
| 689 | 3300045836 | Ga0466958_0073741 | Ga0466958_0073741_651_1346 | 210 |
| 690 | 3300045976 | Ga0466967_0020322 | Ga0466967_0020322_801_1433 | 210 |
| 691 | 3300046460 | Ga0495638_0005602 | Ga0495638_0005602_6038_6670 | 210 |
| 692 | 3300046460 | Ga0495638_0063527 | Ga0495638_0063527_765_1397 | 210 |
| 693 | 3300046472 | Ga0495580_0199252 | Ga0495580_0199252_38_670 | 210 |
| 694 | 3300046500 | Ga0495596_0063139 | Ga0495596_0063139_790_1422 | 210 |
| 695 | 3300046501 | Ga0495607_0111107 | Ga0495607_0111107_756_1388 | 210 |
| 696 | 3300046507 | Ga0495606_0285259 | Ga0495606_0285259_253_885 | 210 |
| 697 | 3300046512 | Ga0495610_0101036 | Ga0495610_0101036_43_675 | 210 |
| 698 | 3300046519 | Ga0495632_0119702 | Ga0495632_0119702_440_1072 | 210 |
| 699 | 3300046520 | Ga0495637_0124573 | Ga0495637_0124573_139_771 | 210 |
| 700 | 3300046522 | Ga0495643_0006585 | Ga0495643_0006585_5557_6189 | 210 |
| 701 | 3300046524 | Ga0495648_0014862 | Ga0495648_0014862_3628_4260 | 210 |
| 702 | 3300046526 | Ga0495666_0164804 | Ga0495666_0164804_371_1003 | 210 |
| 703 | 3300046537 | Ga0495598_0014188 | Ga0495598_0014188_683_1315 | 210 |
| 704 | 3300046537 | Ga0495598_0017371 | Ga0495598_0017371_1154_1786 | 210 |
| 705 | 3300046558 | Ga0495633_0076351 | Ga0495633_0076351_334_966 | 210 |
| 706 | 3300046615 | Ga0495656_0002081 | Ga0495656_0002081_5463_6095 | 210 |
| 707 | 3300046615 | Ga0495656_0024725 | Ga0495656_0024725_1312_1950 | 210 |
| 708 | 3300046615 | Ga0495656_0316215 | Ga0495656_0316215_13_651 | 210 |
| 709 | 3300046616 | Ga0495668_0049854 | Ga0495668_0049854_1597_2229 | 210 |
| 710 | 3300046664 | Ga0495659_0006792 | Ga0495659_0006792_1700_2332 | 210 |
| 711 | 3300046664 | Ga0495659_0194226 | Ga0495659_0194226_125_817 | 210 |
| 712 | 3300046665 | Ga0495661_0090799 | Ga0495661_0090799_388_1020 | 210 |
| 713 | 3300046683 | Ga0495658_0557118 | Ga0495658_0557118_28_666 | 210 |
| 714 | 3300046690 | Ga0495624_0309658 | Ga0495624_0309658_26_670 | 210 |
| 715 | 3300046691 | Ga0495670_0108318 | Ga0495670_0108318_153_785 | 210 |
| 716 | 3300046692 | Ga0495671_0059501 | Ga0495671_0059501_829_1461 | 210 |
| 717 | 3300046794 | Ga0495589_0248773 | Ga0495589_0248773_30_668 | 210 |
| 718 | 3300047315 | Ga0495581_0347947 | Ga0495581_0347947_54_686 | 210 |
| 719 | 3300047320 | Ga0495672_0060308 | Ga0495672_0060308_129_770 | 210 |
| 720 | 3300047321 | Ga0495676_0049778 | Ga0495676_0049778_2295_2927 | 210 |
| 721 | 3300047443 | Ga0495687_082586 | Ga0495687_082586_524_1156 | 210 |
| 722 | 3300047446 | Ga0495679_090380 | Ga0495679_090380_34_666 | 210 |
| 723 | 3300048903 | Ga0496100_0336411 | Ga0496100_0336411_158_796 | 210 |
| 724 | 3300048904 | Ga0496101_0252569 | Ga0496101_0252569_653_1291 | 210 |
| 725 | 3300048905 | Ga0496102_0001105 | Ga0496102_0001105_7575_8207 | 210 |
| 726 | 3300048907 | Ga0496104_0122652 | Ga0496104_0122652_879_1562 | 210 |
| 727 | 3300048907 | Ga0496104_0149479 | Ga0496104_0149479_607_1245 | 210 |
| 728 | 3300048908 | Ga0496105_0027811 | Ga0496105_0027811_1110_1742 | 210 |
| 729 | 3300048911 | Ga0496108_0224331 | Ga0496108_0224331_480_1136 | 210 |
| 730 | 3300048913 | Ga0496110_0222508 | Ga0496110_0222508_171_809 | 210 |
| 731 | 3300048915 | Ga0496112_0010770 | Ga0496112_0010770_1163_1795 | 210 |
| 732 | 3300048915 | Ga0496112_0022589 | Ga0496112_0022589_2950_3639 | 210 |
| 733 | 3300048918 | Ga0496115_0457946 | Ga0496115_0457946_285_1007 | 210 |
| 734 | 3300048919 | Ga0496116_0169727 | Ga0496116_0169727_260_892 | 210 |
| 735 | 3300048921 | Ga0496118_0062240 | Ga0496118_0062240_1402_2034 | 210 |
| 736 | 3300048922 | Ga0496119_0186456 | Ga0496119_0186456_54_743 | 210 |
| 737 | 3300048922 | Ga0496119_0283022 | Ga0496119_0283022_126_758 | 210 |
| 738 | 3300048924 | Ga0496121_0000178 | Ga0496121_0000178_62663_63304 | 210 |
| 739 | 3300048924 | Ga0496121_0037534 | Ga0496121_0037534_3418_4050 | 210 |
| 740 | 3300048924 | Ga0496121_0114904 | Ga0496121_0114904_1236_1874 | 210 |
| 741 | 3300048924 | Ga0496121_0144264 | Ga0496121_0144264_309_941 | 210 |
| 742 | 3300048924 | Ga0496121_0204560 | Ga0496121_0204560_64_696 | 210 |
| 743 | 3300048924 | Ga0496121_0288835 | Ga0496121_0288835_398_1030 | 210 |
| 744 | 3300048926 | Ga0496123_0140069 | Ga0496123_0140069_133_777 | 210 |
| 745 | 3300048927 | Ga0496124_0229223 | Ga0496124_0229223_630_1262 | 210 |
| 746 | 3300048927 | Ga0496124_0236832 | Ga0496124_0236832_21_659 | 210 |
| 747 | 3300048929 | Ga0496126_0329074 | Ga0496126_0329074_166_804 | 210 |
| 748 | 3300049743 | Ga0501081_0739987 | Ga0501081_0739987_55_699 | 210 |
| 749 | 3300050489 | nmdc:mga03683_32425_c1 | nmdc:mga03683_32425_c1_484_1116 | 210 |
| 750 | 3300050490 | nmdc:mga03n38_143406_c1 | nmdc:mga03n38_143406_c1_16_648 | 210 |
| 751 | 3300050490 | nmdc:mga03n38_5368_c1 | nmdc:mga03n38_5368_c1_3060_3698 | 210 |
| 752 | 3300050491 | nmdc:mga00v17_73791_c1 | nmdc:mga00v17_73791_c1_200_889 | 210 |
| 753 | 3300050492 | nmdc:mga0yw44_147_c1 | nmdc:mga0yw44_147_c1_7483_8172 | 210 |
| 754 | 3300050492 | nmdc:mga0yw44_163522_c1 | nmdc:mga0yw44_163522_c1_567_1199 | 210 |
| 755 | 3300050492 | nmdc:mga0yw44_4603_c1 | nmdc:mga0yw44_4603_c1_127_828 | 210 |
| 756 | 3300050493 | nmdc:mga0k408_12352_c1 | nmdc:mga0k408_12352_c1_283_915 | 210 |
| 757 | 3300050493 | nmdc:mga0k408_216585_c1 | nmdc:mga0k408_216585_c1_29_661 | 210 |
| 758 | 3300050493 | nmdc:mga0k408_3305_c1 | nmdc:mga0k408_3305_c1_2689_3378 | 210 |
| 759 | 3300050494 | nmdc:mga06z11_12226_c1 | nmdc:mga06z11_12226_c1_619_1251 | 210 |
| 760 | 3300050494 | nmdc:mga06z11_1222_c1 | nmdc:mga06z11_1222_c1_7114_7803 | 210 |
| 761 | 3300050494 | nmdc:mga06z11_34442_c1 | nmdc:mga06z11_34442_c1_405_1043 | 210 |
| 762 | 3300050495 | nmdc:mga04h51_12668_c1 | nmdc:mga04h51_12668_c1_94_783 | 210 |
| 763 | 3300050495 | nmdc:mga04h51_21280_c1 | nmdc:mga04h51_21280_c1_872_1504 | 210 |
| 764 | 3300050496 | nmdc:mga07m45_11203_c1 | nmdc:mga07m45_11203_c1_3865_4518 | 210 |
| 765 | 3300050496 | nmdc:mga07m45_18918_c1 | nmdc:mga07m45_18918_c1_3023_3661 | 210 |
| 766 | 3300050496 | nmdc:mga07m45_2945_c1 | nmdc:mga07m45_2945_c1_2349_2987 | 210 |
| 767 | 3300050496 | nmdc:mga07m45_319534_c1 | nmdc:mga07m45_319534_c1_153_785 | 210 |
| 768 | 3300050496 | nmdc:mga07m45_5771_c1 | nmdc:mga07m45_5771_c1_2327_3016 | 210 |
| 769 | 3300050516 | nmdc:mga0sz30_146_c1 | nmdc:mga0sz30_146_c1_20166_20819 | 210 |
| 770 | 3300050516 | nmdc:mga0sz30_1566_c1 | nmdc:mga0sz30_1566_c1_735_1424 | 210 |
| 771 | 3300050516 | nmdc:mga0sz30_81875_c1 | nmdc:mga0sz30_81875_c1_395_1078 | 210 |
| 772 | 3300050516 | nmdc:mga0sz30_84302_c1 | nmdc:mga0sz30_84302_c1_223_855 | 210 |
| 773 | 3300053079 | Ga0500610_0041200 | Ga0500610_0041200_902_1534 | 210 |
| 774 | 3300053086 | Ga0500578_0032053 | Ga0500578_0032053_1241_1873 | 210 |
| 775 | 3300053086 | Ga0500578_0043234 | Ga0500578_0043234_1212_1844 | 210 |
| 776 | 3300053090 | Ga0500646_0082878 | Ga0500646_0082878_189_821 | 210 |
| 777 | 3300053093 | Ga0500651_0004173 | Ga0500651_0004173_7132_7764 | 210 |
| 778 | 3300053098 | Ga0500650_0033838 | Ga0500650_0033838_965_1597 | 210 |
| 779 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_112302_112940 | 210 |
| 780 | 3300053105 | Ga0500557_000013 | Ga0500557_000013_38894_39583 | 210 |
| 781 | 3300053108 | Ga0500562_001306 | Ga0500562_001306_4600_5232 | 210 |
| 782 | 3300053119 | Ga0500595_001800 | Ga0500595_001800_4785_5426 | 210 |
| 783 | 3300053119 | Ga0500595_003825 | Ga0500595_003825_4480_5118 | 210 |
| 784 | 3300053120 | Ga0500597_134190 | Ga0500597_134190_244_933 | 210 |
| 785 | 3300053133 | Ga0500655_003131 | Ga0500655_003131_389_1021 | 210 |
| 786 | 3300053133 | Ga0500655_010034 | Ga0500655_010034_871_1503 | 210 |
| 787 | 3300053134 | Ga0500658_0305600 | Ga0500658_0305600_36_668 | 210 |
| 788 | 3300053142 | Ga0500577_0020738 | Ga0500577_0020738_59_691 | 210 |
| 789 | 3300053142 | Ga0500577_0036271 | Ga0500577_0036271_452_1084 | 210 |
| 790 | 3300053153 | Ga0500616_0000034 | Ga0500616_0000034_393109_393747 | 210 |
| 791 | 3300053153 | Ga0500616_0015708 | Ga0500616_0015708_1148_1780 | 210 |
| 792 | 3300053153 | Ga0500616_0166968 | Ga0500616_0166968_112_753 | 210 |
| 793 | 3300053729 | Ga0500625_084496 | Ga0500625_084496_428_1060 | 210 |
| 794 | 3300053730 | Ga0500645_017019 | Ga0500645_017019_407_1039 | 210 |
| 795 | 3300053731 | Ga0500609_000618 | Ga0500609_000618_4492_5124 | 210 |
| 796 | 3300053736 | Ga0500599_006345 | Ga0500599_006345_460_1092 | 210 |
| 797 | iso_pu_bacteria | 2824679649 | 2824683940 | 210 |
| 798 | iso_pu_bacteria | 2935975950 | 2935981161 | 210 |
| 799 | iso_pu_bacteria | 8019619141 | 8019619352 | 210 |
| 800 | iso_pu_bacteria | 8019629233 | 8019633764 | 210 |
| 801 | iso_pu_bacteria | 8019638758 | 8019646141 | 210 |
| 802 | iso_pu_bacteria | 8019659431 | 8019661643 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rpn-assembly3.cif.gz_F | crystal structure of human kappa class glutathione transferase in complex with s-hexylglutathione | 0.8297 | 3 | 193 |
| 2imd-assembly1.cif.gz_A | structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) | 0.8236 | 5 | 197 |
| 3fz5-assembly2.cif.gz_D | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.8128 | 4 | 196 |
| 3gyk-assembly4.cif.gz_D | the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 | 0.8091 | 2 | 200 |
| 3fz5-assembly2.cif.gz_D | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.7941 | 4 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q09652_5_211_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8642 | 4 | 193 | 3.40.30.10 |
| af_Q18973_4_212_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8427 | 3 | 193 | 3.40.30.10 |
| af_A0A2R8QHN7_5_203_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8091 | 3 | 193 | 3.40.30.10 |
| af_Q09652_5_211_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8019 | 4 | 193 | 3.40.30.10 |
| 3rppC01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7952 | 3 | 193 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q8R4M4-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9934 | 1 | 197 |
GO:0004364
GO:0004602 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A1Z9AF78-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9906 | 4 | 196 |
GO:0004364
GO:0004602 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A7C7SAF1-F1-model_v4 | deleted | 0.9832 | 4 | 196 |
|
| AF-A0A2U8PGI6-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9817 | 1 | 205 |
GO:0004364
GO:0004602 GO:0006749 GO:0018845 GO:1901170 |
| AF-J4KRL4-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9815 | 5 | 196 |
GO:0004364
GO:0004602 GO:0006749 GO:0018845 GO:1901170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar