F481456

General Info

Members Datasets Scaffolds Average Seq Length
802 438 687 211

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10265100|Ga0070715_102651001
Length 248
Sequence MQWEIDSSILELYGNKRQGERFGFRLRNMTHARQESPVANPLKVEFQFDFGSPNAYLAEYLIPSIERRTGVKFDYVPVLLGGIYKATGNMSPSDSLRGIKNKPEYQALETQRFLRRHNVTKFRQNPFFPVNTLMLMRGVVAAQLEGLFESYFRAAYHHMWEEPKKMDDVEVFRAAFKSSGIDIDHLIARAQQDDVKKRLIELTNDAVARGAFGSPTFFVGEEMFFGKDQLRDVEEEIMEQKGRIAKAG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
9 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
12 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
13 2643221651 Afipia sp. Root123D2 Isolate Unclassified
14 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
15 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
16 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
17 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
18 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
19 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
20 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
21 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
22 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
23 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
24 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
25 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
26 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
27 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
28 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
29 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
30 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
31 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
32 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
33 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
34 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
35 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
36 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
37 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
38 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
39 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
40 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
41 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
42 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
43 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
44 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
45 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
46 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
47 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
48 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
49 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
50 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
51 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
52 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
53 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
54 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
55 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
56 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
57 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
58 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
59 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
60 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
61 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
62 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
63 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
64 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
65 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
66 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
67 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
68 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
69 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
70 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
71 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
72 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
73 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
74 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
75 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
76 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
78 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
81 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
82 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
86 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
87 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
90 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
91 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
94 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
95 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
96 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
97 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
98 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
99 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
100 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
101 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
102 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
103 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
104 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
105 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
106 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
107 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
110 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
111 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
112 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
113 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
114 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
115 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
116 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
117 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
118 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
124 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
125 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
126 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
127 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
128 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
129 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
130 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
133 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
134 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
135 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
136 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
137 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
138 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
139 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
140 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
141 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
142 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
143 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
144 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
145 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
146 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
148 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
149 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
150 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
151 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
152 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
153 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
154 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
155 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
156 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
157 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
158 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
159 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
161 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
164 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
165 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
166 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
167 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
168 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
169 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
170 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
171 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
174 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
179 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
180 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
181 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
182 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
183 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
184 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
185 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
186 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
187 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
248 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
249 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
250 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
256 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
257 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
264 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
265 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
266 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
267 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
281 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
282 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
283 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
284 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
285 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
286 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
287 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
290 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
291 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
292 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
296 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
299 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
300 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
301 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
302 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
303 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
306 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
309 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
310 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
311 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
314 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
315 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
322 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
325 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
330 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
331 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
336 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
337 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
338 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
339 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
379 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
380 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
381 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
382 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
386 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
387 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
388 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
389 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
390 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
391 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
392 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
393 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
394 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
395 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
396 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
397 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
398 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
399 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
400 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
401 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
402 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
403 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
404 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
405 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
406 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
407 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
408 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
409 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
410 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
411 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
412 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
413 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
414 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
415 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
416 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
417 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
418 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
419 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
420 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
421 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
422 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
423 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
424 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
425 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
426 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
427 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
428 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
429 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
430 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
431 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
432 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
433 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
434 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
435 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
436 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
437 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
438 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.54
Metatranscriptomes 0.12
Isolates 14.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.46
Nodule 11.6
Rhizoplane 3.87
Rhizosphere 61.97
Stem 0
Stem Tuber 0
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10081553 3300001989 Bacteria 993
2 JGI25165J46597_1002506 3300003214 Bacteria 5820
3 JGI25153J46596_10000116 3300003215 Bacteria 90318
4 rootH2_10200493 3300003320 Bacteria 2321
5 rootH1_10265149 3300003323 Bacteria 1386
6 JGI25404J52841_10000495 3300003659 Bacteria 5706
7 JGI25404J52841_10001459 3300003659 Bacteria 4165
8 JGI25404J52841_10001668 3300003659 Bacteria 3990
9 Ga0055531_10008838 3300003794 Bacteria 5239
10 Ga0055543_1020287 3300004625 Bacteria 1222
11 Ga0065165_1000183 3300005262 Bacteria 109988
12 Ga0065165_1050476 3300005262 Bacteria 1184
13 Ga0070683_100000135 3300005329 Bacteria 47783
14 Ga0070683_100385312 3300005329 Bacteria 1336
15 Ga0070690_100644885 3300005330 Bacteria 808
16 Ga0070670_100357222 3300005331 Bacteria 1284
17 Ga0070670_100700259 3300005331 Bacteria 911
18 Ga0068869_100002313 3300005334 Bacteria 11463
19 Ga0068869_100236175 3300005334 Bacteria 1454
20 Ga0070666_10068587 3300005335 Bacteria 2410
21 Ga0070682_100532377 3300005337 Bacteria 916
22 Ga0068868_100001022 3300005338 Bacteria 19117
23 Ga0068868_100069556 3300005338 Bacteria 2805
24 Ga0070689_100159468 3300005340 Bacteria 1823
25 Ga0070689_100182922 3300005340 Bacteria 1703
26 Ga0070661_100501004 3300005344 Bacteria 972
27 Ga0070668_100006628 3300005347 Bacteria 8582
28 Ga0070668_100015257 3300005347 Bacteria 5740
29 Ga0070668_100032556 3300005347 Bacteria 3967
30 Ga0070668_100116658 3300005347 Bacteria 2129
31 Ga0070668_100246549 3300005347 Bacteria 1481
32 Ga0070669_100255471 3300005353 Bacteria 1397
33 Ga0070675_100203658 3300005354 Bacteria 1718
34 Ga0070671_100011334 3300005355 Bacteria 7166
35 Ga0070671_100051419 3300005355 Bacteria 3427
36 Ga0070674_100002565 3300005356 Bacteria 10051
37 Ga0070673_100625353 3300005364 Bacteria 984
38 Ga0070688_100176367 3300005365 Bacteria 1479
39 Ga0070659_100300463 3300005366 Bacteria 1339
40 Ga0070667_100029578 3300005367 Bacteria 4566
41 Ga0070667_100440256 3300005367 Bacteria 1190
42 Ga0070667_100679321 3300005367 Bacteria 952
43 Ga0070667_100869199 3300005367 Bacteria 839
44 Ga0070709_10034328 3300005434 Bacteria 3075
45 Ga0070709_10201075 3300005434 Bacteria 1411
46 Ga0070714_100174474 3300005435 Bacteria 1953
47 Ga0070713_100021937 3300005436 Bacteria 4925
48 Ga0070713_100242188 3300005436 Bacteria 1643
49 Ga0070713_100264739 3300005436 Bacteria 1572
50 Ga0070713_100267254 3300005436 Bacteria 1565
51 Ga0070710_10000540 3300005437 Bacteria 17925
52 Ga0070710_10008491 3300005437 Bacteria 5000
53 Ga0070701_10169703 3300005438 Bacteria 1270
54 Ga0070711_100011179 3300005439 Bacteria 5566
55 Ga0070711_100017044 3300005439 Bacteria 4620
56 Ga0070711_100056918 3300005439 Bacteria 2705
57 Ga0070700_100178951 3300005441 Bacteria 1474
58 Ga0070700_100351772 3300005441 Bacteria 1092
59 Ga0070708_100360744 3300005445 Bacteria 1370
60 Ga0070708_100758164 3300005445 Bacteria 913
61 Ga0070663_100043697 3300005455 Bacteria 3154
62 Ga0070663_100075185 3300005455 Bacteria 2468
63 Ga0070663_100448780 3300005455 Bacteria 1063
64 Ga0070663_100516832 3300005455 Bacteria 994
65 Ga0070678_100034853 3300005456 Bacteria 3508
66 Ga0070678_100110244 3300005456 Bacteria 2152
67 Ga0070678_100149160 3300005456 Bacteria 1882
68 Ga0070662_100169806 3300005457 Bacteria 1712
69 Ga0070685_10146953 3300005466 Bacteria 1490
70 Ga0070706_100072284 3300005467 Bacteria 3192
71 Ga0070698_100293750 3300005471 Bacteria 1556
72 Ga0070679_100190420 3300005530 Bacteria 2021
73 Ga0070684_100000809 3300005535 Bacteria 21816
74 Ga0070697_100005807 3300005536 Bacteria 9521
75 Ga0068853_100021495 3300005539 Bacteria 5382
76 Ga0068853_100993177 3300005539 Bacteria 808
77 Ga0070672_100074384 3300005543 Bacteria 2710
78 Ga0070672_100222273 3300005543 Bacteria 1584
79 Ga0070686_100321303 3300005544 Bacteria 1154
80 Ga0070686_100424709 3300005544 Bacteria 1016
81 Ga0070695_100222725 3300005545 Bacteria 1360
82 Ga0070665_100017437 3300005548 Bacteria 7210
83 Ga0070665_100039336 3300005548 Bacteria 4755
84 Ga0070665_100132531 3300005548 Bacteria 2494
85 Ga0070665_100397117 3300005548 Bacteria 1387
86 Ga0068855_100120298 3300005563 Bacteria 3005
87 Ga0068855_100135082 3300005563 Bacteria 2814
88 Ga0068855_100357127 3300005563 Bacteria 1608
89 Ga0068857_100067731 3300005577 Bacteria 3177
90 Ga0068852_100146928 3300005616 Bacteria 2188
91 Ga0068859_100036039 3300005617 Bacteria 4965
92 Ga0068859_100154154 3300005617 Bacteria 2374
93 Ga0068864_100004413 3300005618 Bacteria 11555
94 Ga0068864_100308477 3300005618 Bacteria 1483
95 Ga0068861_100004996 3300005719 Bacteria 8939
96 Ga0068861_100020936 3300005719 Bacteria 4694
97 Ga0068861_100279927 3300005719 Bacteria 1436
98 Ga0068861_100301305 3300005719 Bacteria 1388
99 Ga0068861_100519540 3300005719 Bacteria 1080
100 Ga0068870_10219196 3300005840 Bacteria 1163
101 Ga0068863_100221147 3300005841 Bacteria 1825
102 Ga0068863_100371491 3300005841 Bacteria 1396
103 Ga0068858_100053344 3300005842 Bacteria 3740
104 Ga0068858_100747351 3300005842 Bacteria 953
105 Ga0068860_100146791 3300005843 Bacteria 2270
106 Ga0068860_100157892 3300005843 Bacteria 2186
107 Ga0068860_100608472 3300005843 Bacteria 1099
108 Ga0068862_100061991 3300005844 Bacteria 3215
109 Ga0068862_100132335 3300005844 Bacteria 2207
110 Ga0068862_100662759 3300005844 Bacteria 1007
111 Ga0081455_10041142 3300005937 Bacteria 4068
112 Ga0081455_10365477 3300005937 Bacteria 1013
113 Ga0081538_10055599 3300005981 Bacteria 2328
114 Ga0081540_1000894 3300005983 Bacteria 26949
115 Ga0081540_1001610 3300005983 Bacteria 19242
116 Ga0081540_1006149 3300005983 Bacteria 8811
117 Ga0081540_1008584 3300005983 Bacteria 7120
118 Ga0081540_1023511 3300005983 Bacteria 3602
119 Ga0081540_1039346 3300005983 Bacteria 2479
120 Ga0081540_1045401 3300005983 Bacteria 2232
121 Ga0081540_1096368 3300005983 Bacteria 1287
122 Ga0070717_10001959 3300006028 Bacteria 14386
123 Ga0070717_10004782 3300006028 Bacteria 9848
124 Ga0070717_10030744 3300006028 Bacteria 4315
125 Ga0070717_10191936 3300006028 Bacteria 1785
126 Ga0070717_10570963 3300006028 Bacteria 1025
127 Ga0075365_10000653 3300006038 Bacteria 13817
128 Ga0075365_10036579 3300006038 Bacteria 3181
129 Ga0075365_10301834 3300006038 Bacteria 1127
130 Ga0075368_10000870 3300006042 Bacteria 9346
131 Ga0075368_10206050 3300006042 Bacteria 833
132 Ga0075363_100017711 3300006048 Bacteria 3538
133 Ga0075363_100104174 3300006048 Bacteria 1572
134 Ga0075363_100127119 3300006048 Bacteria 1428
135 Ga0075364_10017317 3300006051 Bacteria 4500
136 Ga0075364_10036514 3300006051 Bacteria 3177
137 Ga0075364_10051311 3300006051 Bacteria 2693
138 Ga0075364_10080053 3300006051 Bacteria 2159
139 Ga0070715_10265100 3300006163 Bacteria 904
140 Ga0070716_100051617 3300006173 Bacteria 2338
141 Ga0070716_100136642 3300006173 Bacteria 1558
142 Ga0070716_100266578 3300006173 Bacteria 1174
143 Ga0070712_100062070 3300006175 Bacteria 2642
144 Ga0070712_100062786 3300006175 Bacteria 2628
145 Ga0070712_100199569 3300006175 Bacteria 1571
146 Ga0075362_10035534 3300006177 Bacteria 2176
147 Ga0075367_10000173 3300006178 Bacteria 20803
148 Ga0075367_10036488 3300006178 Bacteria 2851
149 Ga0075367_10037095 3300006178 Bacteria 2830
150 Ga0075367_10202358 3300006178 Bacteria 1241
151 Ga0075367_10227470 3300006178 Bacteria 1168
152 Ga0075367_10251278 3300006178 Bacteria 1109
153 Ga0075369_10000799 3300006186 Bacteria 10316
154 Ga0075369_10011937 3300006186 Bacteria 3424
155 Ga0075369_10013540 3300006186 Bacteria 3240
156 Ga0075369_10025955 3300006186 Bacteria 2440
157 Ga0075366_10045504 3300006195 Bacteria 2601
158 Ga0075366_10082506 3300006195 Bacteria 1921
159 Ga0097621_100438647 3300006237 Bacteria 1175
160 Ga0075370_10005051 3300006353 Bacteria 6500
161 Ga0075370_10005793 3300006353 Bacteria 6176
162 Ga0075370_10012738 3300006353 Bacteria 4452
163 Ga0075370_10035274 3300006353 Bacteria 2807
164 Ga0075370_10159909 3300006353 Bacteria 1322
165 Ga0075370_10479273 3300006353 Bacteria 750
166 Ga0068871_100075758 3300006358 Bacteria 2778
167 Ga0068871_100216276 3300006358 Bacteria 1659
168 Ga0075434_100009856 3300006871 Bacteria 8936
169 Ga0075434_100263245 3300006871 Bacteria 1743
170 Ga0068865_100028548 3300006881 Bacteria 3695
171 Ga0075436_100369611 3300006914 Bacteria 1036
172 Ga0097620_100036039 3300006931 Bacteria 4965
173 Ga0097620_100154143 3300006931 Bacteria 2374
174 Ga0099825_1022361 3300006941 Bacteria 4100
175 Ga0099823_1080415 3300006944 Bacteria 1269
176 Ga0075435_100015609 3300007076 Bacteria 5714
177 Ga0099794_10069610 3300007265 Bacteria 1722
178 Ga0099795_10012008 3300007788 Bacteria 2612
179 Ga0099795_10061664 3300007788 Bacteria 1393
180 Ga0099795_10088700 3300007788 Bacteria 1196
181 Ga0105240_10001503 3300009093 Bacteria 39730
182 Ga0105240_10090685 3300009093 Bacteria 3735
183 Ga0105240_10105804 3300009093 Bacteria 3414
184 Ga0105240_10419251 3300009093 Bacteria 1504
185 Ga0105240_10900356 3300009093 Bacteria 952
186 Ga0111539_10455596 3300009094 Bacteria 1490
187 Ga0105245_10025260 3300009098 Bacteria 5223
188 Ga0105245_10091963 3300009098 Bacteria 2793
189 Ga0105245_10099327 3300009098 Bacteria 2691
190 Ga0105247_10026598 3300009101 Bacteria 3495
191 Ga0105247_10164585 3300009101 Bacteria 1471
192 Ga0105243_10013638 3300009148 Bacteria 6147
193 Ga0105243_11020869 3300009148 Bacteria 831
194 Ga0105241_10002502 3300009174 Bacteria 13813
195 Ga0105241_10005358 3300009174 Bacteria 9480
196 Ga0105241_10092032 3300009174 Bacteria 2394
197 Ga0105241_10386341 3300009174 Bacteria 1224
198 Ga0105242_10049733 3300009176 Bacteria 3412
199 Ga0105242_10195074 3300009176 Bacteria 1795
200 Ga0105242_10396017 3300009176 Bacteria 1287
201 Ga0105242_10867610 3300009176 Bacteria 900
202 Ga0105248_10018891 3300009177 Bacteria 7622
203 Ga0105248_10042235 3300009177 Bacteria 5113
204 Ga0105248_10158484 3300009177 Bacteria 2554
205 Ga0105248_10745654 3300009177 Bacteria 1105
206 Ga0105237_10000992 3300009545 Bacteria 38167
207 Ga0105237_10006968 3300009545 Bacteria 12459
208 Ga0105237_10016105 3300009545 Bacteria 7775
209 Ga0105237_10137721 3300009545 Bacteria 2436
210 Ga0105237_10314702 3300009545 Bacteria 1569
211 Ga0105237_10465519 3300009545 Bacteria 1270
212 Ga0105237_10503344 3300009545 Bacteria 1218
213 Ga0105238_10269645 3300009551 Bacteria 1683
214 Ga0105238_10291567 3300009551 Bacteria 1614
215 Ga0105238_10515424 3300009551 Bacteria 1198
216 Ga0105249_10014442 3300009553 Bacteria 6980
217 Ga0099796_10012867 3300010159 Bacteria 2375
218 Ga0105239_10013385 3300010375 Bacteria 9114
219 Ga0105239_10020360 3300010375 Bacteria 7318
220 Ga0105239_10021875 3300010375 Bacteria 7050
221 Ga0105239_10062055 3300010375 Bacteria 4103
222 Ga0105239_10062551 3300010375 Bacteria 4085
223 Ga0105239_10076460 3300010375 Bacteria 3682
224 Ga0105239_10090987 3300010375 Bacteria 3367
225 Ga0105239_10143484 3300010375 Bacteria 2662
226 Ga0105239_10278101 3300010375 Bacteria 1884
227 Ga0105239_10750760 3300010375 Bacteria 1117
228 Ga0105246_10166513 3300011119 Bacteria 1684
229 Ga0105246_10353901 3300011119 Bacteria 1204
230 Ga0157369_10008235 3300013105 Bacteria 11955
231 Ga0157374_10091824 3300013296 Bacteria 2896
232 Ga0157374_10203812 3300013296 Bacteria 1938
233 Ga0157374_10423280 3300013296 Bacteria 1331
234 Ga0157378_10020588 3300013297 Bacteria 5801
235 Ga0157378_10054093 3300013297 Bacteria 3575
236 Ga0157378_10384167 3300013297 Bacteria 1380
237 Ga0163162_10097876 3300013306 Bacteria 3023
238 Ga0163162_10253652 3300013306 Bacteria 1891
239 Ga0163162_10443546 3300013306 Bacteria 1430
240 Ga0157372_10095801 3300013307 Bacteria 3382
241 Ga0157372_10346156 3300013307 Bacteria 1732
242 Ga0157372_10393697 3300013307 Bacteria 1614
243 Ga0157375_10110192 3300013308 Bacteria 2850
244 Ga0157375_10114963 3300013308 Bacteria 2793
245 Ga0157375_10162155 3300013308 Bacteria 2378
246 Ga0163163_10017382 3300014325 Bacteria 6706
247 Ga0163163_10087542 3300014325 Bacteria 3125
248 Ga0163163_10104941 3300014325 Bacteria 2852
249 Ga0163163_10255560 3300014325 Bacteria 1803
250 Ga0157380_10016897 3300014326 Bacteria 5387
251 Ga0157377_10109856 3300014745 Bacteria 1656
252 Ga0157379_10023227 3300014968 Bacteria 5501
253 Ga0157379_10206144 3300014968 Bacteria 1778
254 Ga0157379_10290540 3300014968 Bacteria 1489
255 Ga0157379_10873020 3300014968 Bacteria 852
256 Ga0157376_10055754 3300014969 Bacteria 3299
257 Ga0157376_10419063 3300014969 Bacteria 1299
258 Ga0163161_10027902 3300017792 Bacteria 4006
259 Ga0163161_10388759 3300017792 Bacteria 1116
260 Ga0214544_1011461 3300021320 Bacteria 12220
261 Ga0213872_10213172 3300021361 Bacteria 824
262 Ga0213874_10010033 3300021377 Bacteria 2360
263 Ga0213874_10145890 3300021377 Bacteria 822
264 Ga0224712_10064542 3300022467 Bacteria 1469
265 Ga0209677_102995 3300025253 Bacteria 5845
266 Ga0209233_1003938 3300025261 Bacteria 5151
267 Ga0209564_1057965 3300025295 Bacteria 888
268 Ga0209758_1000026 3300025297 Bacteria 582706
269 Ga0209758_1000719 3300025297 Bacteria 48865
270 Ga0209758_1000761 3300025297 Bacteria 46617
271 Ga0209256_1000838 3300025299 Bacteria 38642
272 Ga0207426_1042271 3300025302 Bacteria 1407
273 Ga0209051_1043995 3300025303 Bacteria 1561
274 Ga0209257_1000201 3300025304 Bacteria 147272
275 Ga0209257_1012740 3300025304 Bacteria 3841
276 Ga0207688_10031950 3300025901 Bacteria 2908
277 Ga0207688_10231707 3300025901 Bacteria 1115
278 Ga0207647_10037170 3300025904 Bacteria 3089
279 Ga0207647_10062207 3300025904 Bacteria 2275
280 Ga0207647_10077076 3300025904 Bacteria 2004
281 Ga0207647_10135293 3300025904 Bacteria 1447
282 Ga0207699_10038889 3300025906 Bacteria 2730
283 Ga0207699_10102314 3300025906 Bacteria 1820
284 Ga0207699_10113734 3300025906 Bacteria 1739
285 Ga0207699_10177730 3300025906 Bacteria 1429
286 Ga0207643_10031720 3300025908 Bacteria 2947
287 Ga0207643_10109823 3300025908 Bacteria 1624
288 Ga0207705_10001314 3300025909 Bacteria 19928
289 Ga0207654_10034644 3300025911 Bacteria 2807
290 Ga0207654_10169450 3300025911 Bacteria 1417
291 Ga0207654_10206450 3300025911 Bacteria 1296
292 Ga0207707_10049105 3300025912 Bacteria 3676
293 Ga0207695_10000159 3300025913 Bacteria 201367
294 Ga0207695_10123220 3300025913 Bacteria 2558
295 Ga0207695_10139450 3300025913 Bacteria 2375
296 Ga0207671_10004461 3300025914 Bacteria 13369
297 Ga0207671_10054331 3300025914 Bacteria 2968
298 Ga0207671_10304142 3300025914 Bacteria 1260
299 Ga0207671_10758005 3300025914 Bacteria 771
300 Ga0207693_10003094 3300025915 Bacteria 14333
301 Ga0207693_10008912 3300025915 Bacteria 8193
302 Ga0207693_10015668 3300025915 Bacteria 6076
303 Ga0207693_10045900 3300025915 Bacteria 3433
304 Ga0207693_10129874 3300025915 Bacteria 1981
305 Ga0207663_10009233 3300025916 Bacteria 5202
306 Ga0207663_10012316 3300025916 Bacteria 4622
307 Ga0207663_10073865 3300025916 Bacteria 2208
308 Ga0207663_10185537 3300025916 Bacteria 1489
309 Ga0207660_10019147 3300025917 Bacteria 4572
310 Ga0207657_10052519 3300025919 Bacteria 3537
311 Ga0207657_10398938 3300025919 Bacteria 1082
312 Ga0207652_10062007 3300025921 Bacteria 3230
313 Ga0207652_10208558 3300025921 Bacteria 1759
314 Ga0207650_10314594 3300025925 Bacteria 1281
315 Ga0207650_10348298 3300025925 Bacteria 1218
316 Ga0207659_10173700 3300025926 Bacteria 1702
317 Ga0207687_10043470 3300025927 Bacteria 3096
318 Ga0207687_10044937 3300025927 Bacteria 3051
319 Ga0207700_10060556 3300025928 Bacteria 2868
320 Ga0207700_10133072 3300025928 Bacteria 2033
321 Ga0207700_10648646 3300025928 Bacteria 941
322 Ga0207664_10084347 3300025929 Bacteria 2591
323 Ga0207664_10575123 3300025929 Bacteria 1011
324 Ga0207664_10579204 3300025929 Bacteria 1008
325 Ga0207644_10023331 3300025931 Bacteria 4237
326 Ga0207690_10078093 3300025932 Bacteria 2303
327 Ga0207706_10070593 3300025933 Bacteria 3072
328 Ga0207686_10325416 3300025934 Bacteria 1150
329 Ga0207709_10604521 3300025935 Bacteria 869
330 Ga0207670_10225577 3300025936 Bacteria 1436
331 Ga0207669_10003823 3300025937 Bacteria 6561
332 Ga0207669_10598488 3300025937 Bacteria 896
333 Ga0207704_10183141 3300025938 Bacteria 1516
334 Ga0207665_10016844 3300025939 Bacteria 4800
335 Ga0207665_10037242 3300025939 Bacteria 3238
336 Ga0207665_10044121 3300025939 Bacteria 2983
337 Ga0207691_10165977 3300025940 Bacteria 1935
338 Ga0207711_10015806 3300025941 Bacteria 6261
339 Ga0207711_10096512 3300025941 Bacteria 2609
340 Ga0207711_10300187 3300025941 Bacteria 1481
341 Ga0207711_10584823 3300025941 Bacteria 1042
342 Ga0207689_10002279 3300025942 Bacteria 17956
343 Ga0207689_10245095 3300025942 Bacteria 1482
344 Ga0207661_10000041 3300025944 Bacteria 122817
345 Ga0207661_10544096 3300025944 Bacteria 1063
346 Ga0207667_10192977 3300025949 Bacteria 2090
347 Ga0207651_10119747 3300025960 Bacteria 1994
348 Ga0207712_10121513 3300025961 Bacteria 1977
349 Ga0207712_10516391 3300025961 Bacteria 1023
350 Ga0207668_10004695 3300025972 Bacteria 8039
351 Ga0207668_10008317 3300025972 Bacteria 6179
352 Ga0207668_10019241 3300025972 Bacteria 4312
353 Ga0207668_10080147 3300025972 Bacteria 2364
354 Ga0207640_10167833 3300025981 Bacteria 1632
355 Ga0207640_11032810 3300025981 Bacteria 724
356 Ga0207658_10369960 3300025986 Bacteria 1253
357 Ga0207658_10670907 3300025986 Bacteria 935
358 Ga0207677_10061644 3300026023 Bacteria 2598
359 Ga0207677_10350795 3300026023 Bacteria 1236
360 Ga0207677_10717735 3300026023 Bacteria 888
361 Ga0207703_10669006 3300026035 Bacteria 986
362 Ga0207639_10253398 3300026041 Bacteria 1536
363 Ga0207678_10006820 3300026067 Bacteria 10128
364 Ga0207678_10018762 3300026067 Bacteria 6076
365 Ga0207678_10079287 3300026067 Bacteria 2812
366 Ga0207678_10148814 3300026067 Bacteria 1999
367 Ga0207678_10531058 3300026067 Bacteria 1027
368 Ga0207708_10051352 3300026075 Bacteria 3138
369 Ga0207708_10197615 3300026075 Bacteria 1603
370 Ga0207708_10430747 3300026075 Bacteria 1095
371 Ga0207702_10157155 3300026078 Bacteria 2073
372 Ga0207641_10174887 3300026088 Bacteria 1963
373 Ga0207641_10369896 3300026088 Bacteria 1370
374 Ga0207648_10041401 3300026089 Bacteria 4045
375 Ga0207648_10098215 3300026089 Bacteria 2564
376 Ga0207648_10183313 3300026089 Bacteria 1853
377 Ga0207676_10017961 3300026095 Bacteria 5133
378 Ga0207674_10163807 3300026116 Bacteria 2178
379 Ga0207674_10300568 3300026116 Bacteria 1554
380 Ga0207674_10584052 3300026116 Bacteria 1079
381 Ga0207675_100008611 3300026118 Bacteria 9592
382 Ga0207675_100108766 3300026118 Bacteria 2615
383 Ga0207675_100255166 3300026118 Bacteria 1698
384 Ga0207675_100465581 3300026118 Bacteria 1254
385 Ga0207675_100473684 3300026118 Bacteria 1243
386 Ga0207683_10003329 3300026121 Bacteria 14006
387 Ga0207683_10026804 3300026121 Bacteria 4978
388 Ga0207683_10035061 3300026121 Bacteria 4364
389 Ga0207698_10214723 3300026142 Bacteria 1733
390 Ga0207698_11074890 3300026142 Bacteria 817
391 Ga0209389_1000162 3300027296 Bacteria 55061
392 Ga0209489_112699 3300027361 Bacteria 7416
393 Ga0209489_112709 3300027361 Bacteria 7410
394 Ga0209700_100509 3300027363 Bacteria 73459
395 Ga0209179_1013684 3300027512 Bacteria 1478
396 Ga0209179_1035980 3300027512 Bacteria 1030
397 Ga0209813_10000621 3300027866 Bacteria 8236
398 Ga0209813_10024965 3300027866 Bacteria 1714
399 Ga0268266_10006068 3300028379 Bacteria 11133
400 Ga0268265_10040684 3300028380 Bacteria 3434
401 Ga0268265_10040702 3300028380 Bacteria 3434
402 Ga0268265_10054929 3300028380 Bacteria 3024
403 Ga0268265_11081228 3300028380 Bacteria 795
404 Ga0268264_10517712 3300028381 Bacteria 1166
405 Ga0268264_11404290 3300028381 Bacteria 709
406 Ga0307517_10333033 3300028786 Bacteria 833
407 Ga0265340_10000984 3300031247 Bacteria 16277
408 Ga0265340_10193533 3300031247 Bacteria 916
409 Ga0265339_10004913 3300031249 Bacteria 9012
410 Ga0307513_10139103 3300031456 Bacteria 2358
411 Ga0307408_100364805 3300031548 Bacteria 1230
412 Ga0307408_100455223 3300031548 Bacteria 1111
413 Ga0265314_10069030 3300031711 Bacteria 2373
414 Ga0307516_10093721 3300031730 Bacteria 2828
415 Ga0307410_10319148 3300031852 Bacteria 1232
416 Ga0307411_10507022 3300032005 Bacteria 1021
417 Ga0307415_100294420 3300032126 Bacteria 1341
418 Ga0307415_100518101 3300032126 Bacteria 1046
419 Ga0307510_10043108 3300033180 Bacteria 4908
420 Ga0373943_0165877 3300035170 Bacteria 1205
421 Ga0373935_0337822 3300035692 Bacteria 1072
422 Ga0373927_0080832 3300035695 Bacteria 2106
423 Ga0373927_0207333 3300035695 Bacteria 1287
424 Ga0373933_0002036 3300035724 Bacteria 11624
425 Ga0373947_0004894 3300035725 Bacteria 7839
426 Ga0373925_0105652 3300037068 Bacteria 2170
427 Ga0395900_0174904 3300037418 Bacteria 2184
428 Ga0395900_0302304 3300037418 Bacteria 1586
429 Ga0395900_0670466 3300037418 Bacteria 972
430 Ga0395898_0054005 3300037466 Bacteria 3922
431 Ga0395905_0007905 3300037471 Bacteria 10520
432 Ga0395905_0071731 3300037471 Bacteria 3247
433 Ga0395905_0304380 3300037471 Bacteria 1482
434 Ga0395901_0030366 3300038443 Bacteria 5568
435 Ga0395901_0652854 3300038443 Bacteria 1055
436 Ga0436365_1232859 3300039437 Bacteria 5663
437 Ga0436360_0228572 3300039438 Bacteria 1797
438 Ga0436360_1248138 3300039438 Bacteria 1598
439 Ga0436361_0027838 3300039447 Bacteria 2356
440 Ga0436361_0251392 3300039447 Bacteria 1503
441 Ga0436361_0395654 3300039447 Bacteria 875
442 Ga0436363_0248112 3300039450 Bacteria 6713
443 Ga0436363_0659157 3300039450 Bacteria 8421
444 Ga0439461_0070203 3300041410 Bacteria 811
445 Ga0439465_0021691 3300041413 Bacteria 2016
446 Ga0439465_0056987 3300041413 Bacteria 1289
447 Ga0439465_0087771 3300041413 Bacteria 1061
448 Ga0439458_0060223 3300042157 Bacteria 947
449 Ga0439459_0065424 3300042438 Bacteria 830
450 Ga0466972_0000246 3300044658 Bacteria 36849
451 Ga0466965_0167211 3300044683 Bacteria 1155
452 Ga0466963_0072736 3300044694 Bacteria 2316
453 Ga0466957_0057337 3300044842 Bacteria 2384
454 Ga0466957_0221598 3300044842 Bacteria 1249
455 Ga0466959_0012229 3300045049 Bacteria 6194
456 Ga0466958_0073741 3300045836 Bacteria 2091
457 Ga0466967_0020322 3300045976 Bacteria 5364
458 Ga0495617_004868 3300046452 Bacteria 4833
459 Ga0495627_011674 3300046453 Bacteria 3144
460 Ga0495603_0056254 3300046455 Bacteria 2329
461 Ga0495638_0005602 3300046460 Bacteria 9278
462 Ga0495638_0063527 3300046460 Bacteria 2276
463 Ga0495638_0171916 3300046460 Bacteria 1242
464 Ga0495638_0384836 3300046460 Bacteria 732
465 Ga0495641_0080421 3300046461 Bacteria 1460
466 Ga0495650_0009492 3300046471 Bacteria 5525
467 Ga0495580_0199252 3300046472 Bacteria 1380
468 Ga0495605_0000007 3300046474 Bacteria 358289
469 Ga0495605_0060138 3300046474 Bacteria 1822
470 Ga0495585_0018902 3300046492 Bacteria 3975
471 Ga0495594_0005176 3300046499 Bacteria 6704
472 Ga0495596_0017144 3300046500 Bacteria 3003
473 Ga0495596_0063139 3300046500 Bacteria 1441
474 Ga0495607_0111107 3300046501 Bacteria 1453
475 Ga0495583_0000007 3300046506 Bacteria 434661
476 Ga0495606_0285259 3300046507 Bacteria 901
477 Ga0495610_0101036 3300046512 Bacteria 1292
478 Ga0495616_0028100 3300046513 Bacteria 2980
479 Ga0495620_0000014 3300046515 Bacteria 157890
480 Ga0495631_0017773 3300046518 Bacteria 3357
481 Ga0495631_0018469 3300046518 Bacteria 3281
482 Ga0495632_0057635 3300046519 Bacteria 1895
483 Ga0495632_0119702 3300046519 Bacteria 1231
484 Ga0495637_0071298 3300046520 Bacteria 1401
485 Ga0495637_0097801 3300046520 Bacteria 1151
486 Ga0495637_0124573 3300046520 Bacteria 989
487 Ga0495643_0006585 3300046522 Bacteria 7639
488 Ga0495648_0014862 3300046524 Bacteria 5672
489 Ga0495648_0020609 3300046524 Bacteria 4591
490 Ga0495666_0164804 3300046526 Bacteria 1027
491 Ga0495642_0139294 3300046528 Bacteria 1047
492 Ga0495654_0002301 3300046530 Bacteria 12355
493 Ga0495598_0014188 3300046537 Bacteria 1988
494 Ga0495598_0017371 3300046537 Bacteria 1853
495 Ga0495609_0000004 3300046538 Bacteria 697346
496 Ga0495609_0031446 3300046538 Bacteria 2412
497 Ga0495597_0007584 3300046542 Bacteria 5497
498 Ga0495622_0079314 3300046557 Bacteria 1511
499 Ga0495633_0000135 3300046558 Bacteria 97871
500 Ga0495633_0076351 3300046558 Bacteria 1560
501 Ga0495656_0002081 3300046615 Bacteria 6604
502 Ga0495656_0024725 3300046615 Bacteria 2375
503 Ga0495656_0316215 3300046615 Bacteria 803
504 Ga0495668_0049854 3300046616 Bacteria 2322
505 Ga0495668_0140301 3300046616 Bacteria 1322
506 Ga0495611_0010631 3300046648 Bacteria 3894
507 Ga0495611_0089105 3300046648 Bacteria 1425
508 Ga0495659_0006792 3300046664 Bacteria 3616
509 Ga0495659_0194226 3300046664 Bacteria 830
510 Ga0495661_0000009 3300046665 Bacteria 291327
511 Ga0495661_0059288 3300046665 Bacteria 2279
512 Ga0495661_0090799 3300046665 Bacteria 1738
513 Ga0495658_0400843 3300046683 Bacteria 874
514 Ga0495658_0557118 3300046683 Bacteria 734
515 Ga0495624_0069240 3300046690 Bacteria 2198
516 Ga0495624_0309658 3300046690 Bacteria 952
517 Ga0495670_0071292 3300046691 Bacteria 1759
518 Ga0495670_0108318 3300046691 Bacteria 1436
519 Ga0495670_0120583 3300046691 Bacteria 1362
520 Ga0495671_0003133 3300046692 Bacteria 10279
521 Ga0495671_0039938 3300046692 Bacteria 2367
522 Ga0495671_0059501 3300046692 Bacteria 1888
523 Ga0495589_0010436 3300046794 Bacteria 4826
524 Ga0495589_0068257 3300046794 Bacteria 1739
525 Ga0495589_0248773 3300046794 Bacteria 831
526 Ga0495660_0000782 3300046810 Bacteria 23813
527 Ga0495581_0347947 3300047315 Bacteria 865
528 Ga0495672_0046429 3300047320 Bacteria 2590
529 Ga0495672_0060308 3300047320 Bacteria 2192
530 Ga0495672_0197700 3300047320 Bacteria 1007
531 Ga0495676_0049778 3300047321 Bacteria 3365
532 Ga0495676_0064029 3300047321 Bacteria 2863
533 Ga0495683_0000004 3300047323 Bacteria 321136
534 Ga0495683_0072582 3300047323 Bacteria 1688
535 Ga0495687_082586 3300047443 Bacteria 1254
536 Ga0495679_005551 3300047446 Bacteria 5572
537 Ga0495679_090380 3300047446 Bacteria 860
538 Ga0495673_0067525 3300047469 Bacteria 1513
539 Ga0495681_0012940 3300047470 Bacteria 4877
540 Ga0495686_0037675 3300047472 Bacteria 3097
541 Ga0495686_0041047 3300047472 Bacteria 2948
542 Ga0495686_0314571 3300047472 Bacteria 860
543 Ga0496100_0336411 3300048903 Bacteria 1137
544 Ga0496101_0252569 3300048904 Bacteria 1374
545 Ga0496101_0272681 3300048904 Bacteria 1321
546 Ga0496102_0001105 3300048905 Bacteria 24771
547 Ga0496102_0033702 3300048905 Bacteria 4604
548 Ga0496104_0120526 3300048907 Bacteria 2518
549 Ga0496104_0122652 3300048907 Bacteria 2495
550 Ga0496104_0149479 3300048907 Bacteria 2243
551 Ga0496104_0324438 3300048907 Bacteria 1453
552 Ga0496105_0010795 3300048908 Bacteria 7192
553 Ga0496105_0027811 3300048908 Bacteria 4623
554 Ga0496106_0070323 3300048909 Bacteria 2673
555 Ga0496106_0109139 3300048909 Bacteria 2153
556 Ga0496107_0522405 3300048910 Bacteria 880
557 Ga0496108_0013055 3300048911 Bacteria 6770
558 Ga0496108_0044587 3300048911 Bacteria 3701
559 Ga0496108_0224331 3300048911 Bacteria 1633
560 Ga0496109_0025083 3300048912 Bacteria 5308
561 Ga0496109_0692897 3300048912 Bacteria 956
562 Ga0496110_0222508 3300048913 Bacteria 1716
563 Ga0496110_0384618 3300048913 Bacteria 1279
564 Ga0496111_0020383 3300048914 Bacteria 4615
565 Ga0496112_0010770 3300048915 Bacteria 8317
566 Ga0496112_0022589 3300048915 Bacteria 5996
567 Ga0496112_0030908 3300048915 Bacteria 5188
568 Ga0496113_0327457 3300048916 Bacteria 1228
569 Ga0496113_0481416 3300048916 Bacteria 997
570 Ga0496113_0825778 3300048916 Bacteria 735
571 Ga0496114_0756415 3300048917 Bacteria 849
572 Ga0496115_0034144 3300048918 Bacteria 4020
573 Ga0496115_0457946 3300048918 Bacteria 1029
574 Ga0496116_0169727 3300048919 Bacteria 1184
575 Ga0496118_0062240 3300048921 Bacteria 2757
576 Ga0496119_0186456 3300048922 Bacteria 1084
577 Ga0496119_0264408 3300048922 Bacteria 862
578 Ga0496119_0283022 3300048922 Bacteria 824
579 Ga0496121_0000178 3300048924 Bacteria 141429
580 Ga0496121_0037534 3300048924 Bacteria 4302
581 Ga0496121_0114904 3300048924 Bacteria 2045
582 Ga0496121_0118274 3300048924 Bacteria 2006
583 Ga0496121_0144264 3300048924 Bacteria 1761
584 Ga0496121_0204560 3300048924 Bacteria 1404
585 Ga0496121_0288835 3300048924 Bacteria 1118
586 Ga0496122_0042046 3300048925 Bacteria 3601
587 Ga0496123_0013584 3300048926 Bacteria 6818
588 Ga0496123_0140069 3300048926 Bacteria 1324
589 Ga0496124_0229223 3300048927 Bacteria 1390
590 Ga0496124_0236832 3300048927 Bacteria 1360
591 Ga0496126_0004249 3300048929 Bacteria 17244
592 Ga0496126_0004533 3300048929 Bacteria 16530
593 Ga0496126_0006868 3300048929 Bacteria 12616
594 Ga0496126_0063211 3300048929 Bacteria 3319
595 Ga0496126_0260347 3300048929 Bacteria 1443
596 Ga0496126_0329074 3300048929 Bacteria 1254
597 Ga0496126_0333408 3300048929 Bacteria 1244
598 Ga0496126_0551354 3300048929 Bacteria 915
599 Ga0495678_000014 3300049459 Bacteria 313755
600 Ga0495678_062769 3300049459 Bacteria 1390
601 Ga0501037_0470148 3300049573 Bacteria 856
602 Ga0501038_0065626 3300049574 Bacteria 3092
603 Ga0501038_0285897 3300049574 Bacteria 1297
604 Ga0501043_0744410 3300049579 Unclassified 713
605 Ga0501047_0049407 3300049581 Bacteria 4062
606 Ga0501047_0289675 3300049581 Bacteria 1481
607 Ga0501047_0292767 3300049581 Bacteria 1472
608 Ga0501047_0569511 3300049581 Bacteria 956
609 Ga0501073_0053478 3300049589 Bacteria 2827
610 Ga0501074_0541356 3300049590 Bacteria 824
611 Ga0501079_0687459 3300049741 Bacteria 805
612 Ga0501080_0076626 3300049742 Bacteria 3110
613 Ga0501081_0739987 3300049743 Bacteria 739
614 Ga0501044_0126613 3300049823 Bacteria 2551
615 Ga0501044_0187862 3300049823 Bacteria 2030
616 Ga0501044_0211580 3300049823 Bacteria 1893
617 Ga0501044_0470272 3300049823 Bacteria 1161
618 nmdc:mga03683_32425_c1 3300050489 Bacteria 2101
619 nmdc:mga03n38_143406_c1 3300050490 Bacteria 1195
620 nmdc:mga03n38_5257_c1 3300050490 Bacteria 4389
621 nmdc:mga03n38_5368_c1 3300050490 Bacteria 4356
622 nmdc:mga00v17_73791_c1 3300050491 Bacteria 2119
623 nmdc:mga0yw44_147_c1 3300050492 Bacteria 24337
624 nmdc:mga0yw44_163522_c1 3300050492 Bacteria 1458
625 nmdc:mga0yw44_4603_c1 3300050492 Bacteria 6361
626 nmdc:mga0yw44_543660_c1 3300050492 Bacteria 789
627 nmdc:mga0k408_12352_c1 3300050493 Bacteria 4667
628 nmdc:mga0k408_216585_c1 3300050493 Bacteria 1143
629 nmdc:mga0k408_28300_c1 3300050493 Bacteria 3186
630 nmdc:mga0k408_3305_c1 3300050493 Bacteria 8532
631 nmdc:mga06z11_1144_c1 3300050494 Bacteria 9683
632 nmdc:mga06z11_12226_c1 3300050494 Bacteria 3728
633 nmdc:mga06z11_1222_c1 3300050494 Bacteria 9490
634 nmdc:mga06z11_34442_c1 3300050494 Bacteria 2486
635 nmdc:mga06z11_399038_c1 3300050494 Bacteria 828
636 nmdc:mga04h51_12668_c1 3300050495 Bacteria 2373
637 nmdc:mga04h51_20329_c1 3300050495 Bacteria 1980
638 nmdc:mga04h51_21280_c1 3300050495 Bacteria 1949
639 nmdc:mga07m45_10176_c1 3300050496 Bacteria 4904
640 nmdc:mga07m45_11203_c1 3300050496 Bacteria 4707
641 nmdc:mga07m45_18918_c1 3300050496 Bacteria 3726
642 nmdc:mga07m45_2945_c1 3300050496 Bacteria 8088
643 nmdc:mga07m45_319534_c1 3300050496 Bacteria 902
644 nmdc:mga07m45_419756_c1 3300050496 Bacteria 776
645 nmdc:mga07m45_436956_c1 3300050496 Bacteria 759
646 nmdc:mga07m45_5771_c1 3300050496 Bacteria 6199
647 nmdc:mga0n895_393580_c1 3300050512 Bacteria 1402
648 nmdc:mga0rr50_48031_c1 3300050513 Bacteria 3153
649 nmdc:mga08x19_107219_c1 3300050514 Bacteria 1859
650 nmdc:mga0sz30_146_c1 3300050516 Bacteria 26463
651 nmdc:mga0sz30_1566_c1 3300050516 Bacteria 8157
652 nmdc:mga0sz30_24654_c1 3300050516 Bacteria 2456
653 nmdc:mga0sz30_81875_c1 3300050516 Bacteria 1397
654 nmdc:mga0sz30_84302_c1 3300050516 Bacteria 1378
655 Ga0500610_0041200 3300053079 Bacteria 2388
656 Ga0495655_0056284 3300053083 Bacteria 1058
657 Ga0500578_0032053 3300053086 Bacteria 3379
658 Ga0500578_0043234 3300053086 Bacteria 2892
659 Ga0500646_0082878 3300053090 Bacteria 981
660 Ga0500651_0004173 3300053093 Bacteria 8056
661 Ga0500650_0033838 3300053098 Bacteria 2333
662 Ga0500555_029966 3300053103 Bacteria 1546
663 Ga0500556_0000003 3300053104 Bacteria 679379
664 Ga0500557_000013 3300053105 Bacteria 108649
665 Ga0500557_130391 3300053105 Bacteria 833
666 Ga0500562_001306 3300053108 Bacteria 6146
667 Ga0500595_001800 3300053119 Bacteria 11111
668 Ga0500595_003825 3300053119 Bacteria 6918
669 Ga0500597_134190 3300053120 Bacteria 1069
670 Ga0500642_0000021 3300053130 Bacteria 146938
671 Ga0500642_0135278 3300053130 Bacteria 1155
672 Ga0500642_0170905 3300053130 Bacteria 1017
673 Ga0500655_003131 3300053133 Bacteria 3003
674 Ga0500655_010034 3300053133 Bacteria 1708
675 Ga0500658_0150595 3300053134 Bacteria 1048
676 Ga0500658_0305600 3300053134 Bacteria 731
677 Ga0500561_0051494 3300053137 Bacteria 1125
678 Ga0500577_0020738 3300053142 Bacteria 2155
679 Ga0500577_0036271 3300053142 Bacteria 1765
680 Ga0500588_0088714 3300053146 Bacteria 1048
681 Ga0500616_0000034 3300053153 Bacteria 396651
682 Ga0500616_0015708 3300053153 Bacteria 4323
683 Ga0500616_0166968 3300053153 Bacteria 1003
684 Ga0500625_084496 3300053729 Bacteria 1375
685 Ga0500645_017019 3300053730 Bacteria 2283
686 Ga0500609_000618 3300053731 Bacteria 5406
687 Ga0500599_006345 3300053736 Bacteria 1507

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016613128 8016620294 189
2 iso_pu_bacteria 8016530956 8016537739 197
3 3300005548 Ga0070665_100132531 Ga0070665_1001325312 198
4 iso_pu_bacteria 8016530956 8016533394 199
5 3300031247 Ga0265340_10193533 Ga0265340_101935332 200
6 3300032005 Ga0307411_10507022 Ga0307411_105070221 200
7 3300005436 Ga0070713_100021937 Ga0070713_1000219373 201
8 3300005437 Ga0070710_10008491 Ga0070710_100084915 201
9 3300005439 Ga0070711_100056918 Ga0070711_1000569183 201
10 3300005445 Ga0070708_100758164 Ga0070708_1007581641 201
11 3300005467 Ga0070706_100072284 Ga0070706_1000722844 201
12 3300006028 Ga0070717_10030744 Ga0070717_100307443 201
13 3300006914 Ga0075436_100369611 Ga0075436_1003696111 201
14 3300025906 Ga0207699_10102314 Ga0207699_101023143 201
15 3300025915 Ga0207693_10003094 Ga0207693_1000309414 201
16 3300025928 Ga0207700_10133072 Ga0207700_101330723 201
17 3300025929 Ga0207664_10084347 Ga0207664_100843473 201
18 3300025937 Ga0207669_10598488 Ga0207669_105984882 201
19 iso_pu_bacteria 2508501128 2509149459 201
20 3300005439 Ga0070711_100017044 Ga0070711_1000170443 202
21 3300025916 Ga0207663_10009233 Ga0207663_100092334 202
22 3300025925 Ga0207650_10348298 Ga0207650_103482982 202
23 3300031247 Ga0265340_10000984 Ga0265340_100009845 202
24 3300046683 Ga0495658_0400843 Ga0495658_0400843_197_817 202
25 3300046453 Ga0495627_011674 Ga0495627_011674_1089_1700 203
26 3300046471 Ga0495650_0009492 Ga0495650_0009492_2472_3083 203
27 3300046474 Ga0495605_0000007 Ga0495605_0000007_219404_220015 203
28 3300046499 Ga0495594_0005176 Ga0495594_0005176_2623_3234 203
29 3300046506 Ga0495583_0000007 Ga0495583_0000007_177865_178476 203
30 3300046515 Ga0495620_0000014 Ga0495620_0000014_13228_13839 203
31 3300046518 Ga0495631_0017773 Ga0495631_0017773_260_871 203
32 3300046520 Ga0495637_0071298 Ga0495637_0071298_35_646 203
33 3300046524 Ga0495648_0020609 Ga0495648_0020609_1436_2047 203
34 3300046530 Ga0495654_0002301 Ga0495654_0002301_10879_11490 203
35 3300046538 Ga0495609_0000004 Ga0495609_0000004_221637_222248 203
36 3300046542 Ga0495597_0007584 Ga0495597_0007584_2432_3043 203
37 3300046558 Ga0495633_0000135 Ga0495633_0000135_94145_94756 203
38 3300046648 Ga0495611_0010631 Ga0495611_0010631_2503_3114 203
39 3300046665 Ga0495661_0000009 Ga0495661_0000009_185695_186306 203
40 3300046692 Ga0495671_0003133 Ga0495671_0003133_6961_7572 203
41 3300046794 Ga0495589_0010436 Ga0495589_0010436_2502_3113 203
42 3300046810 Ga0495660_0000782 Ga0495660_0000782_2081_2692 203
43 3300047323 Ga0495683_0000004 Ga0495683_0000004_3113_3724 203
44 3300047446 Ga0495679_005551 Ga0495679_005551_2464_3075 203
45 3300047470 Ga0495681_0012940 Ga0495681_0012940_2082_2693 203
46 3300047472 Ga0495686_0314571 Ga0495686_0314571_208_819 203
47 3300048925 Ga0496122_0042046 Ga0496122_0042046_1375_1986 203
48 3300048926 Ga0496123_0013584 Ga0496123_0013584_2475_3086 203
49 3300049459 Ga0495678_000014 Ga0495678_000014_310672_311283 203
50 iso_pu_bacteria 2903768456 2903777942 203
51 3300039438 Ga0436360_1248138 Ga0436360_1248138_45_689 204
52 3300039447 Ga0436361_0027838 Ga0436361_0027838_794_1417 204
53 3300049573 Ga0501037_0470148 Ga0501037_0470148_104_718 204
54 3300049574 Ga0501038_0065626 Ga0501038_0065626_2405_3019 204
55 3300049574 Ga0501038_0285897 Ga0501038_0285897_619_1233 204
56 3300049579 Ga0501043_0744410 Ga0501043_0744410_71_685 204
57 3300049581 Ga0501047_0292767 Ga0501047_0292767_325_945 204
58 3300049581 Ga0501047_0569511 Ga0501047_0569511_321_935 204
59 3300049823 Ga0501044_0126613 Ga0501044_0126613_1771_2385 204
60 3300049823 Ga0501044_0187862 Ga0501044_0187862_169_783 204
61 3300049823 Ga0501044_0470272 Ga0501044_0470272_353_967 204
62 3300005337 Ga0070682_100532377 Ga0070682_1005323772 205
63 3300005563 Ga0068855_100135082 Ga0068855_1001350823 205
64 3300025909 Ga0207705_10001314 Ga0207705_100013146 205
65 3300025912 Ga0207707_10049105 Ga0207707_100491054 205
66 3300025917 Ga0207660_10019147 Ga0207660_100191472 205
67 3300025919 Ga0207657_10052519 Ga0207657_100525193 205
68 3300025921 Ga0207652_10062007 Ga0207652_100620074 205
69 3300031711 Ga0265314_10069030 Ga0265314_100690303 205
70 3300039447 Ga0436361_0251392 Ga0436361_0251392_843_1460 205
71 iso_pu_bacteria 2513237139 2513878922 205
72 iso_pu_bacteria 2513237161 2514009884 205
73 iso_pu_bacteria 2617270735 2617346281 205
74 iso_pu_bacteria 2802429603 2805918220 205
75 iso_pu_bacteria 2824671348 2824672120 205
76 iso_pu_bacteria 2824687955 2824688719 205
77 iso_pu_bacteria 2824696289 2824697555 205
78 iso_pu_bacteria 2824773399 2824774327 205
79 iso_pu_bacteria 2838122688 2838123117 205
80 iso_pu_bacteria 2841941048 2841948200 205
81 iso_pu_bacteria 2841949485 2841954365 205
82 iso_pu_bacteria 2841966195 2841969736 205
83 iso_pu_bacteria 2841974524 2841978827 205
84 iso_pu_bacteria 2841983080 2841984058 205
85 iso_pu_bacteria 2847939898 2847947253 205
86 iso_pu_bacteria 3005506211 3005507598 205
87 3300006048 Ga0075363_100127119 Ga0075363_1001271192 206
88 3300006178 Ga0075367_10227470 Ga0075367_102274702 206
89 3300006178 Ga0075367_10251278 Ga0075367_102512781 206
90 3300006353 Ga0075370_10479273 Ga0075370_104792731 206
91 3300006871 Ga0075434_100009856 Ga0075434_1000098561 206
92 3300007076 Ga0075435_100015609 Ga0075435_1000156094 206
93 3300009177 Ga0105248_10158484 Ga0105248_101584842 206
94 3300009545 Ga0105237_10016105 Ga0105237_100161055 206
95 3300014968 Ga0157379_10290540 Ga0157379_102905401 206
96 3300025981 Ga0207640_11032810 Ga0207640_110328101 206
97 3300035695 Ga0373927_0080832 Ga0373927_0080832_1146_1766 206
98 3300041413 Ga0439465_0087771 Ga0439465_0087771_51_671 206
99 3300046452 Ga0495617_004868 Ga0495617_004868_1739_2359 206
100 3300046455 Ga0495603_0056254 Ga0495603_0056254_402_1022 206
101 3300046460 Ga0495638_0171916 Ga0495638_0171916_552_1172 206
102 3300046460 Ga0495638_0384836 Ga0495638_0384836_14_634 206
103 3300046461 Ga0495641_0080421 Ga0495641_0080421_780_1400 206
104 3300046492 Ga0495585_0018902 Ga0495585_0018902_939_1559 206
105 3300046500 Ga0495596_0017144 Ga0495596_0017144_483_1103 206
106 3300046513 Ga0495616_0028100 Ga0495616_0028100_258_878 206
107 3300046518 Ga0495631_0018469 Ga0495631_0018469_861_1481 206
108 3300046519 Ga0495632_0057635 Ga0495632_0057635_294_914 206
109 3300046520 Ga0495637_0097801 Ga0495637_0097801_252_872 206
110 3300046528 Ga0495642_0139294 Ga0495642_0139294_142_762 206
111 3300046538 Ga0495609_0031446 Ga0495609_0031446_245_865 206
112 3300046557 Ga0495622_0079314 Ga0495622_0079314_659_1279 206
113 3300046616 Ga0495668_0140301 Ga0495668_0140301_560_1180 206
114 3300046648 Ga0495611_0089105 Ga0495611_0089105_431_1051 206
115 3300046665 Ga0495661_0059288 Ga0495661_0059288_330_950 206
116 3300046691 Ga0495670_0071292 Ga0495670_0071292_72_692 206
117 3300046692 Ga0495671_0039938 Ga0495671_0039938_462_1082 206
118 3300046794 Ga0495589_0068257 Ga0495589_0068257_365_985 206
119 3300047320 Ga0495672_0197700 Ga0495672_0197700_349_969 206
120 3300047323 Ga0495683_0072582 Ga0495683_0072582_168_788 206
121 3300047469 Ga0495673_0067525 Ga0495673_0067525_824_1444 206
122 3300047472 Ga0495686_0037675 Ga0495686_0037675_2218_2838 206
123 3300048916 Ga0496113_0327457 Ga0496113_0327457_494_1114 206
124 3300048922 Ga0496119_0264408 Ga0496119_0264408_196_816 206
125 3300048924 Ga0496121_0118274 Ga0496121_0118274_508_1128 206
126 3300048929 Ga0496126_0004249 Ga0496126_0004249_15746_16366 206
127 3300048929 Ga0496126_0333408 Ga0496126_0333408_285_905 206
128 3300049459 Ga0495678_062769 Ga0495678_062769_691_1311 206
129 3300050490 nmdc:mga03n38_5257_c1 nmdc:mga03n38_5257_c1_971_1591 206
130 3300050494 nmdc:mga06z11_1144_c1 nmdc:mga06z11_1144_c1_804_1424 206
131 3300050496 nmdc:mga07m45_10176_c1 nmdc:mga07m45_10176_c1_59_679 206
132 3300050496 nmdc:mga07m45_436956_c1 nmdc:mga07m45_436956_c1_65_685 206
133 3300050513 nmdc:mga0rr50_48031_c1 nmdc:mga0rr50_48031_c1_764_1411 206
134 3300053103 Ga0500555_029966 Ga0500555_029966_196_816 206
135 3300053105 Ga0500557_130391 Ga0500557_130391_185_805 206
136 3300053130 Ga0500642_0135278 Ga0500642_0135278_479_1099 206
137 3300053130 Ga0500642_0170905 Ga0500642_0170905_357_977 206
138 3300053134 Ga0500658_0150595 Ga0500658_0150595_71_691 206
139 3300053137 Ga0500561_0051494 Ga0500561_0051494_152_772 206
140 3300053146 Ga0500588_0088714 Ga0500588_0088714_358_978 206
141 iso_pu_bacteria 2513237092 2513621556 206
142 iso_pu_bacteria 2513237101 2513693855 206
143 iso_pu_bacteria 2513237102 2513703327 206
144 iso_pu_bacteria 2513237141 2513887638 206
145 iso_pu_bacteria 2513237161 2514011604 206
146 iso_pu_bacteria 2515154112 2515626978 206
147 iso_pu_bacteria 2617270741 2617375233 206
148 iso_pu_bacteria 2721755755 2723843342 206
149 iso_pu_bacteria 2824617872 2824619059 206
150 iso_pu_bacteria 2824626560 2824627421 206
151 iso_pu_bacteria 2824635225 2824637642 206
152 iso_pu_bacteria 2824644064 2824644585 206
153 iso_pu_bacteria 2824714736 2824722260 206
154 iso_pu_bacteria 2824723954 2824724273 206
155 iso_pu_bacteria 2842038055 2842040931 206
156 iso_pu_bacteria 2842045827 2842046124 206
157 iso_pu_bacteria 2847930680 2847933799 206
158 iso_pu_bacteria 2847939898 2847947079 206
159 iso_pu_bacteria 2857509624 2857511276 206
160 iso_pu_bacteria 2874590934 2874592992 206
161 iso_pu_bacteria 2874604998 2874611743 206
162 iso_pu_bacteria 2874612657 2874619880 206
163 iso_pu_bacteria 2874645413 2874647608 206
164 iso_pu_bacteria 2876771140 2876779225 206
165 iso_pu_bacteria 2876808645 2876815301 206
166 iso_pu_bacteria 2876818435 2876820144 206
167 iso_pu_bacteria 2879074833 2879076648 206
168 iso_pu_bacteria 2879083081 2879087326 206
169 iso_pu_bacteria 2879110137 2879117212 206
170 iso_pu_bacteria 2879127579 2879129422 206
171 iso_pu_bacteria 2879142872 2879145355 206
172 iso_pu_bacteria 2889033259 2889036770 206
173 iso_pu_bacteria 2906626472 2906634371 206
174 iso_pu_bacteria 2906643746 2906644319 206
175 iso_pu_bacteria 2906643746 2906651625 206
176 iso_pu_bacteria 2906660503 2906664917 206
177 iso_pu_bacteria 2922386360 2922387133 206
178 iso_pu_bacteria 2935608549 2935609106 206
179 iso_pu_bacteria 2935703347 2935708170 206
180 iso_pu_bacteria 2935769743 2935770094 206
181 iso_pu_bacteria 2935769743 2935774536 206
182 iso_pu_bacteria 2935777560 2935781827 206
183 iso_pu_bacteria 2935785616 2935785665 206
184 iso_pu_bacteria 2935785616 2935789449 206
185 iso_pu_bacteria 2935793552 2935794407 206
186 iso_pu_bacteria 2935793552 2935797508 206
187 iso_pu_bacteria 2935819856 2935822266 206
188 iso_pu_bacteria 2935847175 2935847848 206
189 iso_pu_bacteria 2935916978 2935923683 206
190 iso_pu_bacteria 2936002035 2936009406 206
191 iso_pu_bacteria 2941531003 2941536172 206
192 iso_pu_bacteria 3005506211 3005512810 206
193 iso_pu_bacteria 8006964411 8006968510 206
194 iso_pu_bacteria 8006984368 8006984830 206
195 iso_pu_bacteria 8006984368 8006987223 206
196 iso_pu_bacteria 8006994254 8006994753 206
197 iso_pu_bacteria 8016522445 8016524194 206
198 iso_pu_bacteria 8016522445 8016528251 206
199 iso_pu_bacteria 8016539877 8016546632 206
200 iso_pu_bacteria 8016548790 8016551263 206
201 iso_pu_bacteria 8016548790 8016555497 206
202 iso_pu_bacteria 8016557553 8016559655 206
203 iso_pu_bacteria 8016557553 8016563854 206
204 iso_pu_bacteria 8016566248 8016567397 206
205 iso_pu_bacteria 8016566248 8016571728 206
206 iso_pu_bacteria 8016575299 8016575949 206
207 iso_pu_bacteria 8016575299 8016580104 206
208 iso_pu_bacteria 8016583857 8016594680 206
209 iso_pu_bacteria 8016595262 8016597594 206
210 iso_pu_bacteria 8016595262 8016601575 206
211 iso_pu_bacteria 8016603502 8016604719 206
212 iso_pu_bacteria 8016622563 8016629684 206
213 iso_pu_bacteria 8019530166 8019533190 206
214 iso_pu_bacteria 8019530166 8019537414 206
215 iso_pu_bacteria 8019538911 8019539127 206
216 iso_pu_bacteria 8019547302 8019548623 206
217 iso_pu_bacteria 8019555841 8019556350 206
218 iso_pu_bacteria 8019565922 8019568964 206
219 iso_pu_bacteria 8019648815 8019656888 206
220 iso_pu_bacteria 8019668869 8019671172 206
221 iso_pu_bacteria 8019678201 8019685016 206
222 iso_pu_bacteria 8056673599 8056680745 206
223 3300005436 Ga0070713_100264739 Ga0070713_1002647393 207
224 3300005618 Ga0068864_100308477 Ga0068864_1003084771 207
225 3300014325 Ga0163163_10017382 Ga0163163_100173824 207
226 3300021361 Ga0213872_10213172 Ga0213872_102131721 207
227 3300037471 Ga0395905_0304380 Ga0395905_0304380_269_892 207
228 3300039447 Ga0436361_0395654 Ga0436361_0395654_91_744 207
229 3300047320 Ga0495672_0046429 Ga0495672_0046429_1545_2168 207
230 3300048904 Ga0496101_0272681 Ga0496101_0272681_201_830 207
231 3300048907 Ga0496104_0120526 Ga0496104_0120526_171_800 207
232 3300048908 Ga0496105_0010795 Ga0496105_0010795_4426_5055 207
233 3300048911 Ga0496108_0013055 Ga0496108_0013055_4413_5042 207
234 3300048912 Ga0496109_0025083 Ga0496109_0025083_260_889 207
235 3300048914 Ga0496111_0020383 Ga0496111_0020383_1612_2241 207
236 3300048915 Ga0496112_0030908 Ga0496112_0030908_148_777 207
237 3300048916 Ga0496113_0825778 Ga0496113_0825778_33_662 207
238 3300048918 Ga0496115_0034144 Ga0496115_0034144_1667_2296 207
239 iso_pu_bacteria 2513237098 2513679210 207
240 iso_pu_bacteria 2524023210 2524463641 207
241 iso_pu_bacteria 2885383462 2885383623 207
242 iso_pu_bacteria 2922361189 2922362461 207
243 iso_pu_bacteria 8056681323 8056685789 207
244 3300035170 Ga0373943_0165877 Ga0373943_0165877_266_892 208
245 3300035692 Ga0373935_0337822 Ga0373935_0337822_225_851 208
246 3300035695 Ga0373927_0207333 Ga0373927_0207333_574_1200 208
247 3300035725 Ga0373947_0004894 Ga0373947_0004894_5807_6433 208
248 3300037068 Ga0373925_0105652 Ga0373925_0105652_1330_1956 208
249 3300046690 Ga0495624_0069240 Ga0495624_0069240_1175_1801 208
250 3300047321 Ga0495676_0064029 Ga0495676_0064029_819_1445 208
251 3300047472 Ga0495686_0041047 Ga0495686_0041047_770_1396 208
252 iso_pu_bacteria 2643221651 2644288894 208
253 3300003320 rootH2_10200493 rootH2_102004933 209
254 3300003659 JGI25404J52841_10000495 JGI25404J52841_100004953 209
255 3300003659 JGI25404J52841_10001459 JGI25404J52841_100014592 209
256 3300005329 Ga0070683_100385312 Ga0070683_1003853122 209
257 3300005330 Ga0070690_100644885 Ga0070690_1006448851 209
258 3300005334 Ga0068869_100002313 Ga0068869_1000023132 209
259 3300005335 Ga0070666_10068587 Ga0070666_100685872 209
260 3300005338 Ga0068868_100001022 Ga0068868_10000102216 209
261 3300005340 Ga0070689_100159468 Ga0070689_1001594682 209
262 3300005347 Ga0070668_100015257 Ga0070668_1000152573 209
263 3300005355 Ga0070671_100011334 Ga0070671_1000113342 209
264 3300005365 Ga0070688_100176367 Ga0070688_1001763671 209
265 3300005366 Ga0070659_100300463 Ga0070659_1003004631 209
266 3300005367 Ga0070667_100029578 Ga0070667_1000295783 209
267 3300005434 Ga0070709_10034328 Ga0070709_100343282 209
268 3300005434 Ga0070709_10201075 Ga0070709_102010752 209
269 3300005435 Ga0070714_100174474 Ga0070714_1001744742 209
270 3300005436 Ga0070713_100242188 Ga0070713_1002421881 209
271 3300005437 Ga0070710_10000540 Ga0070710_100005405 209
272 3300005439 Ga0070711_100011179 Ga0070711_1000111794 209
273 3300005455 Ga0070663_100516832 Ga0070663_1005168321 209
274 3300005456 Ga0070678_100034853 Ga0070678_1000348532 209
275 3300005530 Ga0070679_100190420 Ga0070679_1001904202 209
276 3300005539 Ga0068853_100021495 Ga0068853_1000214954 209
277 3300005539 Ga0068853_100993177 Ga0068853_1009931771 209
278 3300005543 Ga0070672_100222273 Ga0070672_1002222732 209
279 3300005544 Ga0070686_100321303 Ga0070686_1003213032 209
280 3300005548 Ga0070665_100039336 Ga0070665_1000393365 209
281 3300005563 Ga0068855_100120298 Ga0068855_1001202983 209
282 3300005577 Ga0068857_100067731 Ga0068857_1000677311 209
283 3300005616 Ga0068852_100146928 Ga0068852_1001469282 209
284 3300005617 Ga0068859_100154154 Ga0068859_1001541542 209
285 3300005618 Ga0068864_100004413 Ga0068864_1000044133 209
286 3300005719 Ga0068861_100279927 Ga0068861_1002799272 209
287 3300005841 Ga0068863_100371491 Ga0068863_1003714911 209
288 3300005842 Ga0068858_100053344 Ga0068858_1000533443 209
289 3300005937 Ga0081455_10365477 Ga0081455_103654772 209
290 3300005983 Ga0081540_1000894 Ga0081540_100089414 209
291 3300005983 Ga0081540_1001610 Ga0081540_100161011 209
292 3300005983 Ga0081540_1023511 Ga0081540_10235113 209
293 3300006028 Ga0070717_10004782 Ga0070717_100047826 209
294 3300006028 Ga0070717_10191936 Ga0070717_101919361 209
295 3300006048 Ga0075363_100017711 Ga0075363_1000177112 209
296 3300006051 Ga0075364_10017317 Ga0075364_100173174 209
297 3300006163 Ga0070715_10265100 Ga0070715_102651001 209
298 3300006173 Ga0070716_100266578 Ga0070716_1002665781 209
299 3300006175 Ga0070712_100062070 Ga0070712_1000620702 209
300 3300006175 Ga0070712_100062786 Ga0070712_1000627863 209
301 3300006186 Ga0075369_10011937 Ga0075369_100119373 209
302 3300006237 Ga0097621_100438647 Ga0097621_1004386472 209
303 3300006353 Ga0075370_10035274 Ga0075370_100352743 209
304 3300006358 Ga0068871_100075758 Ga0068871_1000757582 209
305 3300006871 Ga0075434_100263245 Ga0075434_1002632452 209
306 3300006931 Ga0097620_100154143 Ga0097620_1001541432 209
307 3300007788 Ga0099795_10088700 Ga0099795_100887002 209
308 3300009093 Ga0105240_10001503 Ga0105240_1000150342 209
309 3300009093 Ga0105240_10090685 Ga0105240_100906853 209
310 3300009093 Ga0105240_10105804 Ga0105240_101058043 209
311 3300009098 Ga0105245_10025260 Ga0105245_100252605 209
312 3300009098 Ga0105245_10099327 Ga0105245_100993273 209
313 3300009101 Ga0105247_10026598 Ga0105247_100265983 209
314 3300009174 Ga0105241_10002502 Ga0105241_1000250210 209
315 3300009174 Ga0105241_10005358 Ga0105241_1000535810 209
316 3300009176 Ga0105242_10195074 Ga0105242_101950742 209
317 3300009177 Ga0105248_10018891 Ga0105248_100188917 209
318 3300009545 Ga0105237_10000992 Ga0105237_1000099235 209
319 3300009545 Ga0105237_10006968 Ga0105237_100069684 209
320 3300009545 Ga0105237_10137721 Ga0105237_101377212 209
321 3300009551 Ga0105238_10515424 Ga0105238_105154242 209
322 3300010375 Ga0105239_10013385 Ga0105239_100133852 209
323 3300010375 Ga0105239_10020360 Ga0105239_100203604 209
324 3300013105 Ga0157369_10008235 Ga0157369_100082352 209
325 3300013296 Ga0157374_10091824 Ga0157374_100918243 209
326 3300013297 Ga0157378_10054093 Ga0157378_100540933 209
327 3300013297 Ga0157378_10384167 Ga0157378_103841671 209
328 3300013306 Ga0163162_10443546 Ga0163162_104435461 209
329 3300013307 Ga0157372_10095801 Ga0157372_100958013 209
330 3300013307 Ga0157372_10346156 Ga0157372_103461562 209
331 3300013307 Ga0157372_10393697 Ga0157372_103936972 209
332 3300013308 Ga0157375_10114963 Ga0157375_101149632 209
333 3300014325 Ga0163163_10104941 Ga0163163_101049413 209
334 3300014325 Ga0163163_10255560 Ga0163163_102555602 209
335 3300014968 Ga0157379_10023227 Ga0157379_100232274 209
336 3300014969 Ga0157376_10055754 Ga0157376_100557542 209
337 3300014969 Ga0157376_10419063 Ga0157376_104190633 209
338 3300021377 Ga0213874_10010033 Ga0213874_100100332 209
339 3300022467 Ga0224712_10064542 Ga0224712_100645421 209
340 3300025904 Ga0207647_10062207 Ga0207647_100622072 209
341 3300025906 Ga0207699_10038889 Ga0207699_100388893 209
342 3300025908 Ga0207643_10109823 Ga0207643_101098231 209
343 3300025913 Ga0207695_10000159 Ga0207695_1000015985 209
344 3300025913 Ga0207695_10123220 Ga0207695_101232202 209
345 3300025913 Ga0207695_10139450 Ga0207695_101394503 209
346 3300025914 Ga0207671_10004461 Ga0207671_100044615 209
347 3300025914 Ga0207671_10054331 Ga0207671_100543314 209
348 3300025915 Ga0207693_10008912 Ga0207693_100089128 209
349 3300025915 Ga0207693_10015668 Ga0207693_100156684 209
350 3300025916 Ga0207663_10073865 Ga0207663_100738652 209
351 3300025916 Ga0207663_10185537 Ga0207663_101855371 209
352 3300025921 Ga0207652_10208558 Ga0207652_102085582 209
353 3300025925 Ga0207650_10314594 Ga0207650_103145941 209
354 3300025926 Ga0207659_10173700 Ga0207659_101737002 209
355 3300025927 Ga0207687_10043470 Ga0207687_100434704 209
356 3300025928 Ga0207700_10060556 Ga0207700_100605563 209
357 3300025928 Ga0207700_10648646 Ga0207700_106486462 209
358 3300025929 Ga0207664_10575123 Ga0207664_105751232 209
359 3300025932 Ga0207690_10078093 Ga0207690_100780931 209
360 3300025935 Ga0207709_10604521 Ga0207709_106045211 209
361 3300025936 Ga0207670_10225577 Ga0207670_102255771 209
362 3300025939 Ga0207665_10016844 Ga0207665_100168445 209
363 3300025941 Ga0207711_10300187 Ga0207711_103001871 209
364 3300025942 Ga0207689_10002279 Ga0207689_1000227912 209
365 3300025944 Ga0207661_10544096 Ga0207661_105440961 209
366 3300025949 Ga0207667_10192977 Ga0207667_101929771 209
367 3300025960 Ga0207651_10119747 Ga0207651_101197473 209
368 3300025972 Ga0207668_10008317 Ga0207668_100083172 209
369 3300026023 Ga0207677_10061644 Ga0207677_100616443 209
370 3300026067 Ga0207678_10006820 Ga0207678_1000682010 209
371 3300026067 Ga0207678_10079287 Ga0207678_100792872 209
372 3300026078 Ga0207702_10157155 Ga0207702_101571551 209
373 3300026088 Ga0207641_10369896 Ga0207641_103698962 209
374 3300026089 Ga0207648_10183313 Ga0207648_101833132 209
375 3300026095 Ga0207676_10017961 Ga0207676_100179614 209
376 3300026116 Ga0207674_10163807 Ga0207674_101638072 209
377 3300026118 Ga0207675_100255166 Ga0207675_1002551662 209
378 3300026121 Ga0207683_10003329 Ga0207683_100033294 209
379 3300026142 Ga0207698_10214723 Ga0207698_102147232 209
380 3300027512 Ga0209179_1035980 Ga0209179_10359801 209
381 3300028380 Ga0268265_10040702 Ga0268265_100407023 209
382 3300031249 Ga0265339_10004913 Ga0265339_100049137 209
383 3300037418 Ga0395900_0670466 Ga0395900_0670466_47_709 209
384 3300037466 Ga0395898_0054005 Ga0395898_0054005_807_1469 209
385 3300038443 Ga0395901_0030366 Ga0395901_0030366_1609_2271 209
386 3300039437 Ga0436365_1232859 Ga0436365_1232859_596_1282 209
387 3300039438 Ga0436360_0228572 Ga0436360_0228572_238_873 209
388 3300039450 Ga0436363_0659157 Ga0436363_0659157_2546_3193 209
389 3300041413 Ga0439465_0021691 Ga0439465_0021691_385_1026 209
390 3300046474 Ga0495605_0060138 Ga0495605_0060138_188_817 209
391 3300046691 Ga0495670_0120583 Ga0495670_0120583_132_761 209
392 3300048905 Ga0496102_0033702 Ga0496102_0033702_3060_3716 209
393 3300048907 Ga0496104_0324438 Ga0496104_0324438_68_724 209
394 3300048909 Ga0496106_0070323 Ga0496106_0070323_1801_2436 209
395 3300048909 Ga0496106_0109139 Ga0496106_0109139_18_674 209
396 3300048910 Ga0496107_0522405 Ga0496107_0522405_110_766 209
397 3300048911 Ga0496108_0044587 Ga0496108_0044587_2274_2930 209
398 3300048912 Ga0496109_0692897 Ga0496109_0692897_32_688 209
399 3300048913 Ga0496110_0384618 Ga0496110_0384618_112_768 209
400 3300048916 Ga0496113_0481416 Ga0496113_0481416_96_752 209
401 3300048917 Ga0496114_0756415 Ga0496114_0756415_88_723 209
402 3300048929 Ga0496126_0004533 Ga0496126_0004533_264_899 209
403 3300048929 Ga0496126_0006868 Ga0496126_0006868_10826_11524 209
404 3300048929 Ga0496126_0063211 Ga0496126_0063211_1122_1784 209
405 3300048929 Ga0496126_0260347 Ga0496126_0260347_363_1103 209
406 3300048929 Ga0496126_0551354 Ga0496126_0551354_27_662 209
407 3300049581 Ga0501047_0049407 Ga0501047_0049407_3194_3829 209
408 3300049581 Ga0501047_0289675 Ga0501047_0289675_711_1373 209
409 3300049589 Ga0501073_0053478 Ga0501073_0053478_2146_2808 209
410 3300049590 Ga0501074_0541356 Ga0501074_0541356_17_679 209
411 3300049741 Ga0501079_0687459 Ga0501079_0687459_21_656 209
412 3300049742 Ga0501080_0076626 Ga0501080_0076626_1563_2225 209
413 3300049823 Ga0501044_0211580 Ga0501044_0211580_833_1495 209
414 3300050492 nmdc:mga0yw44_543660_c1 nmdc:mga0yw44_543660_c1_46_702 209
415 3300050493 nmdc:mga0k408_28300_c1 nmdc:mga0k408_28300_c1_1889_2545 209
416 3300050494 nmdc:mga06z11_399038_c1 nmdc:mga06z11_399038_c1_105_761 209
417 3300050495 nmdc:mga04h51_20329_c1 nmdc:mga04h51_20329_c1_1209_1865 209
418 3300050496 nmdc:mga07m45_419756_c1 nmdc:mga07m45_419756_c1_70_699 209
419 3300050512 nmdc:mga0n895_393580_c1 nmdc:mga0n895_393580_c1_240_896 209
420 3300050514 nmdc:mga08x19_107219_c1 nmdc:mga08x19_107219_c1_643_1299 209
421 3300050516 nmdc:mga0sz30_24654_c1 nmdc:mga0sz30_24654_c1_1583_2239 209
422 3300053083 Ga0495655_0056284 Ga0495655_0056284_52_750 209
423 3300053130 Ga0500642_0000021 Ga0500642_0000021_76727_77356 209
424 3300001989 JGI24739J22299_10081553 JGI24739J22299_100815531 210
425 3300003214 JGI25165J46597_1002506 JGI25165J46597_10025067 210
426 3300003215 JGI25153J46596_10000116 JGI25153J46596_1000011646 210
427 3300003323 rootH1_10265149 rootH1_102651492 210
428 3300003659 JGI25404J52841_10001668 JGI25404J52841_100016684 210
429 3300003794 Ga0055531_10008838 Ga0055531_100088383 210
430 3300004625 Ga0055543_1020287 Ga0055543_10202872 210
431 3300005262 Ga0065165_1000183 Ga0065165_100018360 210
432 3300005262 Ga0065165_1050476 Ga0065165_10504762 210
433 3300005329 Ga0070683_100000135 Ga0070683_10000013542 210
434 3300005331 Ga0070670_100357222 Ga0070670_1003572221 210
435 3300005331 Ga0070670_100700259 Ga0070670_1007002591 210
436 3300005334 Ga0068869_100236175 Ga0068869_1002361752 210
437 3300005338 Ga0068868_100069556 Ga0068868_1000695563 210
438 3300005340 Ga0070689_100182922 Ga0070689_1001829222 210
439 3300005344 Ga0070661_100501004 Ga0070661_1005010041 210
440 3300005347 Ga0070668_100006628 Ga0070668_1000066284 210
441 3300005347 Ga0070668_100032556 Ga0070668_1000325562 210
442 3300005347 Ga0070668_100116658 Ga0070668_1001166581 210
443 3300005347 Ga0070668_100246549 Ga0070668_1002465492 210
444 3300005353 Ga0070669_100255471 Ga0070669_1002554712 210
445 3300005354 Ga0070675_100203658 Ga0070675_1002036581 210
446 3300005355 Ga0070671_100051419 Ga0070671_1000514191 210
447 3300005356 Ga0070674_100002565 Ga0070674_1000025652 210
448 3300005364 Ga0070673_100625353 Ga0070673_1006253531 210
449 3300005367 Ga0070667_100440256 Ga0070667_1004402561 210
450 3300005367 Ga0070667_100679321 Ga0070667_1006793211 210
451 3300005367 Ga0070667_100869199 Ga0070667_1008691991 210
452 3300005436 Ga0070713_100267254 Ga0070713_1002672541 210
453 3300005438 Ga0070701_10169703 Ga0070701_101697031 210
454 3300005441 Ga0070700_100178951 Ga0070700_1001789512 210
455 3300005441 Ga0070700_100351772 Ga0070700_1003517721 210
456 3300005445 Ga0070708_100360744 Ga0070708_1003607441 210
457 3300005455 Ga0070663_100043697 Ga0070663_1000436973 210
458 3300005455 Ga0070663_100075185 Ga0070663_1000751853 210
459 3300005455 Ga0070663_100448780 Ga0070663_1004487802 210
460 3300005456 Ga0070678_100110244 Ga0070678_1001102442 210
461 3300005456 Ga0070678_100149160 Ga0070678_1001491601 210
462 3300005457 Ga0070662_100169806 Ga0070662_1001698061 210
463 3300005466 Ga0070685_10146953 Ga0070685_101469532 210
464 3300005471 Ga0070698_100293750 Ga0070698_1002937501 210
465 3300005535 Ga0070684_100000809 Ga0070684_10000080917 210
466 3300005536 Ga0070697_100005807 Ga0070697_1000058079 210
467 3300005543 Ga0070672_100074384 Ga0070672_1000743842 210
468 3300005544 Ga0070686_100424709 Ga0070686_1004247092 210
469 3300005545 Ga0070695_100222725 Ga0070695_1002227252 210
470 3300005548 Ga0070665_100017437 Ga0070665_1000174377 210
471 3300005548 Ga0070665_100397117 Ga0070665_1003971172 210
472 3300005563 Ga0068855_100357127 Ga0068855_1003571271 210
473 3300005617 Ga0068859_100036039 Ga0068859_1000360395 210
474 3300005719 Ga0068861_100004996 Ga0068861_1000049962 210
475 3300005719 Ga0068861_100020936 Ga0068861_1000209364 210
476 3300005719 Ga0068861_100301305 Ga0068861_1003013052 210
477 3300005719 Ga0068861_100519540 Ga0068861_1005195401 210
478 3300005840 Ga0068870_10219196 Ga0068870_102191962 210
479 3300005841 Ga0068863_100221147 Ga0068863_1002211472 210
480 3300005842 Ga0068858_100747351 Ga0068858_1007473511 210
481 3300005843 Ga0068860_100146791 Ga0068860_1001467912 210
482 3300005843 Ga0068860_100157892 Ga0068860_1001578924 210
483 3300005843 Ga0068860_100608472 Ga0068860_1006084721 210
484 3300005844 Ga0068862_100061991 Ga0068862_1000619912 210
485 3300005844 Ga0068862_100132335 Ga0068862_1001323352 210
486 3300005844 Ga0068862_100662759 Ga0068862_1006627592 210
487 3300005937 Ga0081455_10041142 Ga0081455_100411424 210
488 3300005981 Ga0081538_10055599 Ga0081538_100555992 210
489 3300005983 Ga0081540_1006149 Ga0081540_10061492 210
490 3300005983 Ga0081540_1008584 Ga0081540_10085843 210
491 3300005983 Ga0081540_1039346 Ga0081540_10393461 210
492 3300005983 Ga0081540_1045401 Ga0081540_10454012 210
493 3300005983 Ga0081540_1096368 Ga0081540_10963682 210
494 3300006028 Ga0070717_10001959 Ga0070717_1000195910 210
495 3300006028 Ga0070717_10570963 Ga0070717_105709631 210
496 3300006038 Ga0075365_10000653 Ga0075365_100006539 210
497 3300006038 Ga0075365_10036579 Ga0075365_100365792 210
498 3300006038 Ga0075365_10301834 Ga0075365_103018342 210
499 3300006042 Ga0075368_10000870 Ga0075368_100008702 210
500 3300006042 Ga0075368_10206050 Ga0075368_102060501 210
501 3300006048 Ga0075363_100104174 Ga0075363_1001041742 210
502 3300006051 Ga0075364_10036514 Ga0075364_100365143 210
503 3300006051 Ga0075364_10051311 Ga0075364_100513112 210
504 3300006051 Ga0075364_10080053 Ga0075364_100800532 210
505 3300006173 Ga0070716_100051617 Ga0070716_1000516172 210
506 3300006173 Ga0070716_100136642 Ga0070716_1001366422 210
507 3300006175 Ga0070712_100199569 Ga0070712_1001995692 210
508 3300006177 Ga0075362_10035534 Ga0075362_100355342 210
509 3300006178 Ga0075367_10000173 Ga0075367_1000017310 210
510 3300006178 Ga0075367_10036488 Ga0075367_100364883 210
511 3300006178 Ga0075367_10037095 Ga0075367_100370952 210
512 3300006178 Ga0075367_10202358 Ga0075367_102023582 210
513 3300006186 Ga0075369_10000799 Ga0075369_100007994 210
514 3300006186 Ga0075369_10013540 Ga0075369_100135403 210
515 3300006186 Ga0075369_10025955 Ga0075369_100259553 210
516 3300006195 Ga0075366_10045504 Ga0075366_100455042 210
517 3300006195 Ga0075366_10082506 Ga0075366_100825062 210
518 3300006353 Ga0075370_10005051 Ga0075370_100050512 210
519 3300006353 Ga0075370_10005793 Ga0075370_100057932 210
520 3300006353 Ga0075370_10012738 Ga0075370_100127383 210
521 3300006353 Ga0075370_10159909 Ga0075370_101599091 210
522 3300006358 Ga0068871_100216276 Ga0068871_1002162762 210
523 3300006881 Ga0068865_100028548 Ga0068865_1000285482 210
524 3300006931 Ga0097620_100036039 Ga0097620_1000360392 210
525 3300006941 Ga0099825_1022361 Ga0099825_10223613 210
526 3300006944 Ga0099823_1080415 Ga0099823_10804152 210
527 3300007265 Ga0099794_10069610 Ga0099794_100696101 210
528 3300007788 Ga0099795_10012008 Ga0099795_100120082 210
529 3300007788 Ga0099795_10061664 Ga0099795_100616642 210
530 3300009093 Ga0105240_10419251 Ga0105240_104192512 210
531 3300009093 Ga0105240_10900356 Ga0105240_109003561 210
532 3300009094 Ga0111539_10455596 Ga0111539_104555962 210
533 3300009098 Ga0105245_10091963 Ga0105245_100919632 210
534 3300009101 Ga0105247_10164585 Ga0105247_101645852 210
535 3300009148 Ga0105243_10013638 Ga0105243_100136385 210
536 3300009148 Ga0105243_11020869 Ga0105243_110208691 210
537 3300009174 Ga0105241_10092032 Ga0105241_100920323 210
538 3300009174 Ga0105241_10386341 Ga0105241_103863411 210
539 3300009176 Ga0105242_10049733 Ga0105242_100497333 210
540 3300009176 Ga0105242_10396017 Ga0105242_103960172 210
541 3300009176 Ga0105242_10867610 Ga0105242_108676101 210
542 3300009177 Ga0105248_10042235 Ga0105248_100422353 210
543 3300009177 Ga0105248_10745654 Ga0105248_107456541 210
544 3300009545 Ga0105237_10314702 Ga0105237_103147022 210
545 3300009545 Ga0105237_10465519 Ga0105237_104655192 210
546 3300009545 Ga0105237_10503344 Ga0105237_105033442 210
547 3300009551 Ga0105238_10269645 Ga0105238_102696452 210
548 3300009551 Ga0105238_10291567 Ga0105238_102915672 210
549 3300009553 Ga0105249_10014442 Ga0105249_100144423 210
550 3300010159 Ga0099796_10012867 Ga0099796_100128673 210
551 3300010375 Ga0105239_10021875 Ga0105239_100218752 210
552 3300010375 Ga0105239_10062055 Ga0105239_100620554 210
553 3300010375 Ga0105239_10062551 Ga0105239_100625512 210
554 3300010375 Ga0105239_10076460 Ga0105239_100764603 210
555 3300010375 Ga0105239_10090987 Ga0105239_100909873 210
556 3300010375 Ga0105239_10143484 Ga0105239_101434845 210
557 3300010375 Ga0105239_10278101 Ga0105239_102781013 210
558 3300010375 Ga0105239_10750760 Ga0105239_107507601 210
559 3300011119 Ga0105246_10166513 Ga0105246_101665132 210
560 3300011119 Ga0105246_10353901 Ga0105246_103539012 210
561 3300013296 Ga0157374_10203812 Ga0157374_102038121 210
562 3300013296 Ga0157374_10423280 Ga0157374_104232801 210
563 3300013297 Ga0157378_10020588 Ga0157378_100205884 210
564 3300013306 Ga0163162_10097876 Ga0163162_100978763 210
565 3300013306 Ga0163162_10253652 Ga0163162_102536522 210
566 3300013308 Ga0157375_10110192 Ga0157375_101101922 210
567 3300013308 Ga0157375_10162155 Ga0157375_101621553 210
568 3300014325 Ga0163163_10087542 Ga0163163_100875421 210
569 3300014326 Ga0157380_10016897 Ga0157380_100168974 210
570 3300014745 Ga0157377_10109856 Ga0157377_101098562 210
571 3300014968 Ga0157379_10206144 Ga0157379_102061441 210
572 3300014968 Ga0157379_10873020 Ga0157379_108730202 210
573 3300017792 Ga0163161_10027902 Ga0163161_100279022 210
574 3300017792 Ga0163161_10388759 Ga0163161_103887591 210
575 3300021320 Ga0214544_1011461 Ga0214544_101146111 210
576 3300021377 Ga0213874_10145890 Ga0213874_101458901 210
577 3300025253 Ga0209677_102995 Ga0209677_1029954 210
578 3300025261 Ga0209233_1003938 Ga0209233_10039382 210
579 3300025295 Ga0209564_1057965 Ga0209564_10579651 210
580 3300025297 Ga0209758_1000026 Ga0209758_1000026443 210
581 3300025297 Ga0209758_1000719 Ga0209758_100071917 210
582 3300025297 Ga0209758_1000761 Ga0209758_100076124 210
583 3300025299 Ga0209256_1000838 Ga0209256_100083813 210
584 3300025302 Ga0207426_1042271 Ga0207426_10422711 210
585 3300025303 Ga0209051_1043995 Ga0209051_10439952 210
586 3300025304 Ga0209257_1000201 Ga0209257_100020112 210
587 3300025304 Ga0209257_1012740 Ga0209257_10127403 210
588 3300025901 Ga0207688_10031950 Ga0207688_100319501 210
589 3300025901 Ga0207688_10231707 Ga0207688_102317072 210
590 3300025904 Ga0207647_10037170 Ga0207647_100371702 210
591 3300025904 Ga0207647_10077076 Ga0207647_100770762 210
592 3300025904 Ga0207647_10135293 Ga0207647_101352931 210
593 3300025906 Ga0207699_10113734 Ga0207699_101137343 210
594 3300025906 Ga0207699_10177730 Ga0207699_101777301 210
595 3300025908 Ga0207643_10031720 Ga0207643_100317201 210
596 3300025911 Ga0207654_10034644 Ga0207654_100346442 210
597 3300025911 Ga0207654_10169450 Ga0207654_101694502 210
598 3300025911 Ga0207654_10206450 Ga0207654_102064502 210
599 3300025914 Ga0207671_10304142 Ga0207671_103041422 210
600 3300025914 Ga0207671_10758005 Ga0207671_107580051 210
601 3300025915 Ga0207693_10045900 Ga0207693_100459003 210
602 3300025915 Ga0207693_10129874 Ga0207693_101298742 210
603 3300025916 Ga0207663_10012316 Ga0207663_100123165 210
604 3300025919 Ga0207657_10398938 Ga0207657_103989381 210
605 3300025927 Ga0207687_10044937 Ga0207687_100449372 210
606 3300025929 Ga0207664_10579204 Ga0207664_105792042 210
607 3300025931 Ga0207644_10023331 Ga0207644_100233311 210
608 3300025933 Ga0207706_10070593 Ga0207706_100705932 210
609 3300025934 Ga0207686_10325416 Ga0207686_103254162 210
610 3300025937 Ga0207669_10003823 Ga0207669_100038232 210
611 3300025938 Ga0207704_10183141 Ga0207704_101831412 210
612 3300025939 Ga0207665_10037242 Ga0207665_100372423 210
613 3300025939 Ga0207665_10044121 Ga0207665_100441213 210
614 3300025940 Ga0207691_10165977 Ga0207691_101659772 210
615 3300025941 Ga0207711_10015806 Ga0207711_100158063 210
616 3300025941 Ga0207711_10096512 Ga0207711_100965122 210
617 3300025941 Ga0207711_10584823 Ga0207711_105848231 210
618 3300025942 Ga0207689_10245095 Ga0207689_102450951 210
619 3300025944 Ga0207661_10000041 Ga0207661_1000004126 210
620 3300025961 Ga0207712_10121513 Ga0207712_101215132 210
621 3300025961 Ga0207712_10516391 Ga0207712_105163911 210
622 3300025972 Ga0207668_10004695 Ga0207668_100046958 210
623 3300025972 Ga0207668_10019241 Ga0207668_100192413 210
624 3300025972 Ga0207668_10080147 Ga0207668_100801471 210
625 3300025981 Ga0207640_10167833 Ga0207640_101678332 210
626 3300025986 Ga0207658_10369960 Ga0207658_103699602 210
627 3300025986 Ga0207658_10670907 Ga0207658_106709071 210
628 3300026023 Ga0207677_10350795 Ga0207677_103507951 210
629 3300026023 Ga0207677_10717735 Ga0207677_107177352 210
630 3300026035 Ga0207703_10669006 Ga0207703_106690061 210
631 3300026041 Ga0207639_10253398 Ga0207639_102533982 210
632 3300026067 Ga0207678_10018762 Ga0207678_100187622 210
633 3300026067 Ga0207678_10148814 Ga0207678_101488141 210
634 3300026067 Ga0207678_10531058 Ga0207678_105310581 210
635 3300026075 Ga0207708_10051352 Ga0207708_100513523 210
636 3300026075 Ga0207708_10197615 Ga0207708_101976152 210
637 3300026075 Ga0207708_10430747 Ga0207708_104307471 210
638 3300026088 Ga0207641_10174887 Ga0207641_101748872 210
639 3300026089 Ga0207648_10041401 Ga0207648_100414014 210
640 3300026089 Ga0207648_10098215 Ga0207648_100982153 210
641 3300026116 Ga0207674_10300568 Ga0207674_103005682 210
642 3300026116 Ga0207674_10584052 Ga0207674_105840521 210
643 3300026118 Ga0207675_100008611 Ga0207675_1000086118 210
644 3300026118 Ga0207675_100108766 Ga0207675_1001087662 210
645 3300026118 Ga0207675_100465581 Ga0207675_1004655812 210
646 3300026118 Ga0207675_100473684 Ga0207675_1004736842 210
647 3300026121 Ga0207683_10026804 Ga0207683_100268045 210
648 3300026121 Ga0207683_10035061 Ga0207683_100350615 210
649 3300026142 Ga0207698_11074890 Ga0207698_110748901 210
650 3300027296 Ga0209389_1000162 Ga0209389_100016215 210
651 3300027361 Ga0209489_112699 Ga0209489_1126992 210
652 3300027361 Ga0209489_112709 Ga0209489_1127092 210
653 3300027363 Ga0209700_100509 Ga0209700_10050957 210
654 3300027512 Ga0209179_1013684 Ga0209179_10136842 210
655 3300027866 Ga0209813_10000621 Ga0209813_100006211 210
656 3300027866 Ga0209813_10024965 Ga0209813_100249651 210
657 3300028379 Ga0268266_10006068 Ga0268266_1000606810 210
658 3300028380 Ga0268265_10040684 Ga0268265_100406843 210
659 3300028380 Ga0268265_10054929 Ga0268265_100549293 210
660 3300028380 Ga0268265_11081228 Ga0268265_110812281 210
661 3300028381 Ga0268264_10517712 Ga0268264_105177122 210
662 3300028381 Ga0268264_11404290 Ga0268264_114042901 210
663 3300028786 Ga0307517_10333033 Ga0307517_103330331 210
664 3300031456 Ga0307513_10139103 Ga0307513_101391033 210
665 3300031548 Ga0307408_100364805 Ga0307408_1003648052 210
666 3300031548 Ga0307408_100455223 Ga0307408_1004552231 210
667 3300031730 Ga0307516_10093721 Ga0307516_100937212 210
668 3300031852 Ga0307410_10319148 Ga0307410_103191482 210
669 3300032126 Ga0307415_100294420 Ga0307415_1002944201 210
670 3300032126 Ga0307415_100518101 Ga0307415_1005181012 210
671 3300033180 Ga0307510_10043108 Ga0307510_100431083 210
672 3300035724 Ga0373933_0002036 Ga0373933_0002036_8761_9399 210
673 3300037418 Ga0395900_0174904 Ga0395900_0174904_1464_2099 210
674 3300037418 Ga0395900_0302304 Ga0395900_0302304_232_864 210
675 3300037471 Ga0395905_0007905 Ga0395905_0007905_6636_7268 210
676 3300037471 Ga0395905_0071731 Ga0395905_0071731_1029_1664 210
677 3300038443 Ga0395901_0652854 Ga0395901_0652854_78_710 210
678 3300039450 Ga0436363_0248112 Ga0436363_0248112_5081_5719 210
679 3300041410 Ga0439461_0070203 Ga0439461_0070203_87_731 210
680 3300041413 Ga0439465_0056987 Ga0439465_0056987_566_1198 210
681 3300042157 Ga0439458_0060223 Ga0439458_0060223_266_898 210
682 3300042438 Ga0439459_0065424 Ga0439459_0065424_158_790 210
683 3300044658 Ga0466972_0000246 Ga0466972_0000246_29343_29975 210
684 3300044683 Ga0466965_0167211 Ga0466965_0167211_181_813 210
685 3300044694 Ga0466963_0072736 Ga0466963_0072736_307_939 210
686 3300044842 Ga0466957_0057337 Ga0466957_0057337_496_1128 210
687 3300044842 Ga0466957_0221598 Ga0466957_0221598_28_723 210
688 3300045049 Ga0466959_0012229 Ga0466959_0012229_3135_3830 210
689 3300045836 Ga0466958_0073741 Ga0466958_0073741_651_1346 210
690 3300045976 Ga0466967_0020322 Ga0466967_0020322_801_1433 210
691 3300046460 Ga0495638_0005602 Ga0495638_0005602_6038_6670 210
692 3300046460 Ga0495638_0063527 Ga0495638_0063527_765_1397 210
693 3300046472 Ga0495580_0199252 Ga0495580_0199252_38_670 210
694 3300046500 Ga0495596_0063139 Ga0495596_0063139_790_1422 210
695 3300046501 Ga0495607_0111107 Ga0495607_0111107_756_1388 210
696 3300046507 Ga0495606_0285259 Ga0495606_0285259_253_885 210
697 3300046512 Ga0495610_0101036 Ga0495610_0101036_43_675 210
698 3300046519 Ga0495632_0119702 Ga0495632_0119702_440_1072 210
699 3300046520 Ga0495637_0124573 Ga0495637_0124573_139_771 210
700 3300046522 Ga0495643_0006585 Ga0495643_0006585_5557_6189 210
701 3300046524 Ga0495648_0014862 Ga0495648_0014862_3628_4260 210
702 3300046526 Ga0495666_0164804 Ga0495666_0164804_371_1003 210
703 3300046537 Ga0495598_0014188 Ga0495598_0014188_683_1315 210
704 3300046537 Ga0495598_0017371 Ga0495598_0017371_1154_1786 210
705 3300046558 Ga0495633_0076351 Ga0495633_0076351_334_966 210
706 3300046615 Ga0495656_0002081 Ga0495656_0002081_5463_6095 210
707 3300046615 Ga0495656_0024725 Ga0495656_0024725_1312_1950 210
708 3300046615 Ga0495656_0316215 Ga0495656_0316215_13_651 210
709 3300046616 Ga0495668_0049854 Ga0495668_0049854_1597_2229 210
710 3300046664 Ga0495659_0006792 Ga0495659_0006792_1700_2332 210
711 3300046664 Ga0495659_0194226 Ga0495659_0194226_125_817 210
712 3300046665 Ga0495661_0090799 Ga0495661_0090799_388_1020 210
713 3300046683 Ga0495658_0557118 Ga0495658_0557118_28_666 210
714 3300046690 Ga0495624_0309658 Ga0495624_0309658_26_670 210
715 3300046691 Ga0495670_0108318 Ga0495670_0108318_153_785 210
716 3300046692 Ga0495671_0059501 Ga0495671_0059501_829_1461 210
717 3300046794 Ga0495589_0248773 Ga0495589_0248773_30_668 210
718 3300047315 Ga0495581_0347947 Ga0495581_0347947_54_686 210
719 3300047320 Ga0495672_0060308 Ga0495672_0060308_129_770 210
720 3300047321 Ga0495676_0049778 Ga0495676_0049778_2295_2927 210
721 3300047443 Ga0495687_082586 Ga0495687_082586_524_1156 210
722 3300047446 Ga0495679_090380 Ga0495679_090380_34_666 210
723 3300048903 Ga0496100_0336411 Ga0496100_0336411_158_796 210
724 3300048904 Ga0496101_0252569 Ga0496101_0252569_653_1291 210
725 3300048905 Ga0496102_0001105 Ga0496102_0001105_7575_8207 210
726 3300048907 Ga0496104_0122652 Ga0496104_0122652_879_1562 210
727 3300048907 Ga0496104_0149479 Ga0496104_0149479_607_1245 210
728 3300048908 Ga0496105_0027811 Ga0496105_0027811_1110_1742 210
729 3300048911 Ga0496108_0224331 Ga0496108_0224331_480_1136 210
730 3300048913 Ga0496110_0222508 Ga0496110_0222508_171_809 210
731 3300048915 Ga0496112_0010770 Ga0496112_0010770_1163_1795 210
732 3300048915 Ga0496112_0022589 Ga0496112_0022589_2950_3639 210
733 3300048918 Ga0496115_0457946 Ga0496115_0457946_285_1007 210
734 3300048919 Ga0496116_0169727 Ga0496116_0169727_260_892 210
735 3300048921 Ga0496118_0062240 Ga0496118_0062240_1402_2034 210
736 3300048922 Ga0496119_0186456 Ga0496119_0186456_54_743 210
737 3300048922 Ga0496119_0283022 Ga0496119_0283022_126_758 210
738 3300048924 Ga0496121_0000178 Ga0496121_0000178_62663_63304 210
739 3300048924 Ga0496121_0037534 Ga0496121_0037534_3418_4050 210
740 3300048924 Ga0496121_0114904 Ga0496121_0114904_1236_1874 210
741 3300048924 Ga0496121_0144264 Ga0496121_0144264_309_941 210
742 3300048924 Ga0496121_0204560 Ga0496121_0204560_64_696 210
743 3300048924 Ga0496121_0288835 Ga0496121_0288835_398_1030 210
744 3300048926 Ga0496123_0140069 Ga0496123_0140069_133_777 210
745 3300048927 Ga0496124_0229223 Ga0496124_0229223_630_1262 210
746 3300048927 Ga0496124_0236832 Ga0496124_0236832_21_659 210
747 3300048929 Ga0496126_0329074 Ga0496126_0329074_166_804 210
748 3300049743 Ga0501081_0739987 Ga0501081_0739987_55_699 210
749 3300050489 nmdc:mga03683_32425_c1 nmdc:mga03683_32425_c1_484_1116 210
750 3300050490 nmdc:mga03n38_143406_c1 nmdc:mga03n38_143406_c1_16_648 210
751 3300050490 nmdc:mga03n38_5368_c1 nmdc:mga03n38_5368_c1_3060_3698 210
752 3300050491 nmdc:mga00v17_73791_c1 nmdc:mga00v17_73791_c1_200_889 210
753 3300050492 nmdc:mga0yw44_147_c1 nmdc:mga0yw44_147_c1_7483_8172 210
754 3300050492 nmdc:mga0yw44_163522_c1 nmdc:mga0yw44_163522_c1_567_1199 210
755 3300050492 nmdc:mga0yw44_4603_c1 nmdc:mga0yw44_4603_c1_127_828 210
756 3300050493 nmdc:mga0k408_12352_c1 nmdc:mga0k408_12352_c1_283_915 210
757 3300050493 nmdc:mga0k408_216585_c1 nmdc:mga0k408_216585_c1_29_661 210
758 3300050493 nmdc:mga0k408_3305_c1 nmdc:mga0k408_3305_c1_2689_3378 210
759 3300050494 nmdc:mga06z11_12226_c1 nmdc:mga06z11_12226_c1_619_1251 210
760 3300050494 nmdc:mga06z11_1222_c1 nmdc:mga06z11_1222_c1_7114_7803 210
761 3300050494 nmdc:mga06z11_34442_c1 nmdc:mga06z11_34442_c1_405_1043 210
762 3300050495 nmdc:mga04h51_12668_c1 nmdc:mga04h51_12668_c1_94_783 210
763 3300050495 nmdc:mga04h51_21280_c1 nmdc:mga04h51_21280_c1_872_1504 210
764 3300050496 nmdc:mga07m45_11203_c1 nmdc:mga07m45_11203_c1_3865_4518 210
765 3300050496 nmdc:mga07m45_18918_c1 nmdc:mga07m45_18918_c1_3023_3661 210
766 3300050496 nmdc:mga07m45_2945_c1 nmdc:mga07m45_2945_c1_2349_2987 210
767 3300050496 nmdc:mga07m45_319534_c1 nmdc:mga07m45_319534_c1_153_785 210
768 3300050496 nmdc:mga07m45_5771_c1 nmdc:mga07m45_5771_c1_2327_3016 210
769 3300050516 nmdc:mga0sz30_146_c1 nmdc:mga0sz30_146_c1_20166_20819 210
770 3300050516 nmdc:mga0sz30_1566_c1 nmdc:mga0sz30_1566_c1_735_1424 210
771 3300050516 nmdc:mga0sz30_81875_c1 nmdc:mga0sz30_81875_c1_395_1078 210
772 3300050516 nmdc:mga0sz30_84302_c1 nmdc:mga0sz30_84302_c1_223_855 210
773 3300053079 Ga0500610_0041200 Ga0500610_0041200_902_1534 210
774 3300053086 Ga0500578_0032053 Ga0500578_0032053_1241_1873 210
775 3300053086 Ga0500578_0043234 Ga0500578_0043234_1212_1844 210
776 3300053090 Ga0500646_0082878 Ga0500646_0082878_189_821 210
777 3300053093 Ga0500651_0004173 Ga0500651_0004173_7132_7764 210
778 3300053098 Ga0500650_0033838 Ga0500650_0033838_965_1597 210
779 3300053104 Ga0500556_0000003 Ga0500556_0000003_112302_112940 210
780 3300053105 Ga0500557_000013 Ga0500557_000013_38894_39583 210
781 3300053108 Ga0500562_001306 Ga0500562_001306_4600_5232 210
782 3300053119 Ga0500595_001800 Ga0500595_001800_4785_5426 210
783 3300053119 Ga0500595_003825 Ga0500595_003825_4480_5118 210
784 3300053120 Ga0500597_134190 Ga0500597_134190_244_933 210
785 3300053133 Ga0500655_003131 Ga0500655_003131_389_1021 210
786 3300053133 Ga0500655_010034 Ga0500655_010034_871_1503 210
787 3300053134 Ga0500658_0305600 Ga0500658_0305600_36_668 210
788 3300053142 Ga0500577_0020738 Ga0500577_0020738_59_691 210
789 3300053142 Ga0500577_0036271 Ga0500577_0036271_452_1084 210
790 3300053153 Ga0500616_0000034 Ga0500616_0000034_393109_393747 210
791 3300053153 Ga0500616_0015708 Ga0500616_0015708_1148_1780 210
792 3300053153 Ga0500616_0166968 Ga0500616_0166968_112_753 210
793 3300053729 Ga0500625_084496 Ga0500625_084496_428_1060 210
794 3300053730 Ga0500645_017019 Ga0500645_017019_407_1039 210
795 3300053731 Ga0500609_000618 Ga0500609_000618_4492_5124 210
796 3300053736 Ga0500599_006345 Ga0500599_006345_460_1092 210
797 iso_pu_bacteria 2824679649 2824683940 210
798 iso_pu_bacteria 2935975950 2935981161 210
799 iso_pu_bacteria 8019619141 8019619352 210
800 iso_pu_bacteria 8019629233 8019633764 210
801 iso_pu_bacteria 8019638758 8019646141 210
802 iso_pu_bacteria 8019659431 8019661643 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

43

238

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rpn-assembly3.cif.gz_F crystal structure of human kappa class glutathione transferase in complex with s-hexylglutathione 0.8297 3 193
2imd-assembly1.cif.gz_A structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) 0.8236 5 197
3fz5-assembly2.cif.gz_D crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8128 4 196
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.8091 2 200
3fz5-assembly2.cif.gz_D crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.7941 4 196
ID Description Score Start End Superfamily
af_Q09652_5_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8642 4 193 3.40.30.10
af_Q18973_4_212_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8427 3 193 3.40.30.10
af_A0A2R8QHN7_5_203_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8091 3 193 3.40.30.10
af_Q09652_5_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8019 4 193 3.40.30.10
3rppC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7952 3 193 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Q8R4M4-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9934 1 197 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170
AF-A0A1Z9AF78-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9906 4 196 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170
AF-A0A7C7SAF1-F1-model_v4 deleted 0.9832 4 196
AF-A0A2U8PGI6-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9817 1 205 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170
AF-J4KRL4-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9815 5 196 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170

Feature Viewer

pLDDT pTM Quality
94.92 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map