F481394

General Info

Members Datasets Scaffolds Average Seq Length
800 403 800 99

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0149884|Ga0501040_0149884_985_1290
Length 101
Sequence MNLGDRIVRLMITGRVQGVGFRAFVEDEAMRHGLRGWVRNRRDGAVEAVLGGPADAVNAAIDACRRXXRAAQVRAVDVQEAETTALEQLLPGEDFSVLANG

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
20 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
130 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
131 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
132 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
220 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
221 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
222 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
223 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
224 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
227 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
233 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
234 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
247 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
248 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
249 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
263 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
264 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
265 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
266 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
273 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
286 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
287 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
293 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
294 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
295 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
296 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
315 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
333 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
334 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
335 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
336 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
366 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
367 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
368 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
369 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
370 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
371 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
372 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
373 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
374 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
375 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
376 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
379 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
380 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
381 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
382 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
383 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
384 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
385 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
388 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
389 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
390 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
391 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
392 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
393 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
394 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
395 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
396 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
397 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
398 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
399 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
400 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
402 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
403 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 10
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214884076 2209111006 Bacteria 7856
2 ARcpr5oldR_c004176 3300000041 Bacteria 1263
3 ARcpr5yngRDRAFT_c007081 3300000043 Bacteria 996
4 ARSoilOldRDRAFT_c000083 3300000044 Bacteria 17763
5 ARCol0yngRDRAFT_1000103 3300000652 Bacteria 15788
6 JGI24752J21851_1011378 3300001976 Bacteria 1163
7 JGI24747J21853_1009515 3300001978 Bacteria 962
8 JGI24739J22299_10062937 3300001989 Bacteria 1169
9 JGI24737J22298_10000053 3300001990 Bacteria 34054
10 JGI24743J22301_10039413 3300001991 Bacteria 946
11 JGI24750J21931_1005416 3300002070 Bacteria 1569
12 JGI24745J21846_1014742 3300002073 Bacteria 904
13 JGI24738J21930_10023527 3300002075 Bacteria 1269
14 JGI24744J21845_10031963 3300002077 Bacteria 1005
15 JGI24035J26624_1009285 3300002126 Bacteria 969
16 JGI24033J26618_1018880 3300002155 Bacteria 871
17 JGI24742J22300_10000381 3300002244 Bacteria 6546
18 JGI25406J46586_10032704 3300003203 Bacteria 1930
19 JGI26128J50194_1010721 3300003347 Bacteria 576
20 Ga0065716_1003653 3300005277 Bacteria 1165
21 Ga0065704_10270380 3300005289 Bacteria 944
22 Ga0065712_10009636 3300005290 Bacteria 2607
23 Ga0065712_10145316 3300005290 Bacteria 1414
24 Ga0065712_10147284 3300005290 Bacteria 1398
25 Ga0065715_10135200 3300005293 Bacteria 1942
26 Ga0065707_10265024 3300005295 Bacteria 1066
27 Ga0065707_10283437 3300005295 Bacteria 1042
28 Ga0070676_10000302 3300005328 Bacteria 22128
29 Ga0070683_100003623 3300005329 Bacteria 12583
30 Ga0070683_100157295 3300005329 Bacteria 2156
31 Ga0070683_100192210 3300005329 Bacteria 1938
32 Ga0070690_100000253 3300005330 Bacteria 27696
33 Ga0070690_100013798 3300005330 Bacteria 4785
34 Ga0070670_100011774 3300005331 Bacteria 7480
35 Ga0070670_100175861 3300005331 Bacteria 1858
36 Ga0070677_10000104 3300005333 Bacteria 27953
37 Ga0068869_100006200 3300005334 Bacteria 7571
38 Ga0068869_100816155 3300005334 Bacteria 803
39 Ga0070666_10013625 3300005335 Bacteria 5162
40 Ga0070666_10014594 3300005335 Bacteria 5002
41 Ga0070680_100016970 3300005336 Bacteria 5733
42 Ga0070680_100330323 3300005336 Unclassified 1295
43 Ga0070680_100600546 3300005336 Bacteria 945
44 Ga0070680_101901512 3300005336 Bacteria 516
45 Ga0070682_100000287 3300005337 Bacteria 35953
46 Ga0070682_100096987 3300005337 Bacteria 1939
47 Ga0070682_100099045 3300005337 Bacteria 1921
48 Ga0070682_100167020 3300005337 Bacteria 1526
49 Ga0070682_101715437 3300005337 Unclassified 546
50 Ga0068868_100001298 3300005338 Bacteria 17210
51 Ga0068868_100198953 3300005338 Bacteria 1670
52 Ga0070660_100002362 3300005339 Bacteria 12967
53 Ga0070660_100487633 3300005339 Bacteria 1025
54 Ga0070660_101335421 3300005339 Bacteria 609
55 Ga0070689_100000422 3300005340 Bacteria 24979
56 Ga0070689_100096627 3300005340 Bacteria 2335
57 Ga0070689_102043790 3300005340 Bacteria 524
58 Ga0070691_10004265 3300005341 Bacteria 6493
59 Ga0070691_10093428 3300005341 Bacteria 1486
60 Ga0070691_10742950 3300005341 Bacteria 593
61 Ga0070687_100002601 3300005343 Bacteria 6813
62 Ga0070687_100557641 3300005343 Bacteria 780
63 Ga0070661_100000017 3300005344 Bacteria 153232
64 Ga0070661_100315576 3300005344 Bacteria 1220
65 Ga0070661_101504479 3300005344 Unclassified 568
66 Ga0070692_10000546 3300005345 Bacteria 11692
67 Ga0070692_10179740 3300005345 Bacteria 1225
68 Ga0070668_100000656 3300005347 Bacteria 23401
69 Ga0070668_100025762 3300005347 Bacteria 4460
70 Ga0070668_100115939 3300005347 Bacteria 2135
71 Ga0070669_100000314 3300005353 Bacteria 37924
72 Ga0070669_100029627 3300005353 Bacteria 3946
73 Ga0070675_100000161 3300005354 Bacteria 40950
74 Ga0070675_100170284 3300005354 Bacteria 1877
75 Ga0070675_100606411 3300005354 Bacteria 993
76 Ga0070671_100000313 3300005355 Bacteria 32932
77 Ga0070671_100026052 3300005355 Bacteria 4803
78 Ga0070674_100016562 3300005356 Bacteria 4621
79 Ga0070673_100000272 3300005364 Bacteria 26555
80 Ga0070673_100238299 3300005364 Bacteria 1581
81 Ga0070673_100426570 3300005364 Bacteria 1190
82 Ga0070673_100793553 3300005364 Bacteria 874
83 Ga0070688_100000306 3300005365 Bacteria 24982
84 Ga0070688_100007962 3300005365 Bacteria 5731
85 Ga0070688_100045570 3300005365 Bacteria 2710
86 Ga0070688_100916269 3300005365 Bacteria 692
87 Ga0070688_100952739 3300005365 Unclassified 679
88 Ga0070659_100000252 3300005366 Bacteria 42278
89 Ga0070667_100014243 3300005367 Bacteria 6568
90 Ga0070667_100025494 3300005367 Bacteria 4915
91 Ga0070667_100068007 3300005367 Bacteria 3030
92 Ga0070667_100284498 3300005367 Bacteria 1486
93 Ga0070703_10013349 3300005406 Bacteria 2332
94 Ga0070703_10146970 3300005406 Bacteria 881
95 Ga0070709_10004420 3300005434 Bacteria 7584
96 Ga0070709_10012395 3300005434 Bacteria 4771
97 Ga0070709_10027064 3300005434 Bacteria 3406
98 Ga0070709_11377716 3300005434 Bacteria 570
99 Ga0070714_100134390 3300005435 Bacteria 2213
100 Ga0070713_100021553 3300005436 Bacteria 4959
101 Ga0070713_100025039 3300005436 Bacteria 4659
102 Ga0070713_100091102 3300005436 Bacteria 2622
103 Ga0070710_10003513 3300005437 Bacteria 7426
104 Ga0070710_10095668 3300005437 Bacteria 1759
105 Ga0070701_10000123 3300005438 Bacteria 22697
106 Ga0070711_100022505 3300005439 Bacteria 4086
107 Ga0070711_100115183 3300005439 Bacteria 1979
108 Ga0070711_101496320 3300005439 Unclassified 589
109 Ga0070705_100001543 3300005440 Bacteria 12097
110 Ga0070705_101020381 3300005440 Bacteria 672
111 Ga0070705_101625178 3300005440 Bacteria 544
112 Ga0070700_100015468 3300005441 Bacteria 4327
113 Ga0070700_100031644 3300005441 Bacteria 3172
114 Ga0070700_100112627 3300005441 Bacteria 1812
115 Ga0070700_100583680 3300005441 Bacteria 873
116 Ga0070694_100009283 3300005444 Bacteria 6036
117 Ga0070694_100056993 3300005444 Bacteria 2655
118 Ga0070694_100311579 3300005444 Bacteria 1209
119 Ga0070708_100185231 3300005445 Bacteria 1947
120 Ga0070663_100007039 3300005455 Bacteria 6816
121 Ga0070663_100039920 3300005455 Bacteria 3283
122 Ga0070663_100145644 3300005455 Bacteria 1812
123 Ga0070678_100122510 3300005456 Bacteria 2053
124 Ga0070678_100156678 3300005456 Bacteria 1840
125 Ga0070662_100013472 3300005457 Bacteria 5442
126 Ga0070662_100312407 3300005457 Bacteria 1280
127 Ga0070662_100357045 3300005457 Bacteria 1198
128 Ga0070681_10003031 3300005458 Bacteria 15578
129 Ga0070681_10228861 3300005458 Bacteria 1773
130 Ga0070681_10379344 3300005458 Bacteria 1324
131 Ga0070681_10775270 3300005458 Bacteria 876
132 Ga0070681_10784253 3300005458 Bacteria 870
133 Ga0070681_11211421 3300005458 Bacteria 677
134 Ga0068867_100004059 3300005459 Bacteria 10305
135 Ga0068867_100405774 3300005459 Bacteria 1150
136 Ga0068867_100715339 3300005459 Bacteria 885
137 Ga0070685_10000704 3300005466 Bacteria 18151
138 Ga0070685_10047414 3300005466 Bacteria 2471
139 Ga0070685_10102184 3300005466 Bacteria 1752
140 Ga0070707_100742272 3300005468 Bacteria 945
141 Ga0070698_100398161 3300005471 Bacteria 1310
142 Ga0070679_100022432 3300005530 Bacteria 6170
143 Ga0070679_100053555 3300005530 Bacteria 4016
144 Ga0070679_100098218 3300005530 Bacteria 2916
145 Ga0070684_100018176 3300005535 Bacteria 5786
146 Ga0070684_101303506 3300005535 Bacteria 683
147 Ga0070684_101445594 3300005535 Unclassified 648
148 Ga0070684_101669876 3300005535 Bacteria 601
149 Ga0068853_100160374 3300005539 Bacteria 2029
150 Ga0068853_100247118 3300005539 Bacteria 1636
151 Ga0068853_100464466 3300005539 Bacteria 1192
152 Ga0070672_100000014 3300005543 Bacteria 72627
153 Ga0070686_100000455 3300005544 Bacteria 24982
154 Ga0070686_101497410 3300005544 Unclassified 569
155 Ga0070695_100001270 3300005545 Bacteria 13896
156 Ga0070695_100725907 3300005545 Bacteria 790
157 Ga0070696_100014212 3300005546 Bacteria 5342
158 Ga0070696_100036591 3300005546 Bacteria 3385
159 Ga0070696_100058136 3300005546 Bacteria 2700
160 Ga0070696_100083960 3300005546 Bacteria 2259
161 Ga0070696_100196720 3300005546 Bacteria 1503
162 Ga0070693_100000141 3300005547 Bacteria 32426
163 Ga0070693_100051130 3300005547 Bacteria 2365
164 Ga0070693_100250330 3300005547 Unclassified 1174
165 Ga0070693_101248257 3300005547 Bacteria 572
166 Ga0070665_100241125 3300005548 Bacteria 1808
167 Ga0070665_100904035 3300005548 Bacteria 895
168 Ga0070665_101486425 3300005548 Bacteria 686
169 Ga0070665_101626410 3300005548 Bacteria 654
170 Ga0070704_100000197 3300005549 Bacteria 24897
171 Ga0070704_100148429 3300005549 Bacteria 1840
172 Ga0068855_100002843 3300005563 Bacteria 21276
173 Ga0068855_100839480 3300005563 Bacteria 974
174 Ga0070664_100000770 3300005564 Bacteria 24720
175 Ga0070664_100105582 3300005564 Bacteria 2453
176 Ga0068857_100000567 3300005577 Bacteria 26993
177 Ga0068854_100000674 3300005578 Bacteria 20404
178 Ga0068854_100622947 3300005578 Bacteria 923
179 Ga0068856_100006891 3300005614 Bacteria 11113
180 Ga0068856_100983673 3300005614 Bacteria 862
181 Ga0070702_100000130 3300005615 Bacteria 22887
182 Ga0070702_100105240 3300005615 Bacteria 1739
183 Ga0070702_100565483 3300005615 Bacteria 847
184 Ga0068852_100008916 3300005616 Bacteria 7420
185 Ga0068859_100001568 3300005617 Bacteria 23306
186 Ga0068859_100137068 3300005617 Bacteria 2521
187 Ga0068859_100640124 3300005617 Bacteria 1155
188 Ga0068859_100765446 3300005617 Bacteria 1054
189 Ga0068864_100001514 3300005618 Bacteria 19100
190 Ga0068864_100028524 3300005618 Bacteria 4719
191 Ga0068864_100098570 3300005618 Bacteria 2589
192 Ga0068866_10000615 3300005718 Bacteria 16277
193 Ga0068861_100000319 3300005719 Bacteria 26998
194 Ga0068851_11019645 3300005834 Bacteria 522
195 Ga0068870_10000002 3300005840 Bacteria 91107
196 Ga0068863_100000703 3300005841 Bacteria 33695
197 Ga0068863_100245600 3300005841 Bacteria 1728
198 Ga0068858_100003033 3300005842 Bacteria 16828
199 Ga0068858_100202482 3300005842 Bacteria 1877
200 Ga0068858_100227051 3300005842 Bacteria 1769
201 Ga0068860_100001895 3300005843 Bacteria 22206
202 Ga0068860_100130966 3300005843 Bacteria 2407
203 Ga0068860_100339139 3300005843 Bacteria 1478
204 Ga0068862_100013279 3300005844 Bacteria 6813
205 Ga0068862_100468954 3300005844 Unclassified 1190
206 Ga0068862_100786075 3300005844 Bacteria 928
207 Ga0081455_10000048 3300005937 Bacteria 126551
208 Ga0081455_10000664 3300005937 Bacteria 44581
209 Ga0081540_1004712 3300005983 Bacteria 10319
210 Ga0081539_10100755 3300005985 Unclassified 1473
211 Ga0070717_10000873 3300006028 Bacteria 19937
212 Ga0070717_10067963 3300006028 Bacteria 2966
213 Ga0070717_10701093 3300006028 Bacteria 920
214 Ga0075365_11279947 3300006038 Bacteria 515
215 Ga0075368_10233564 3300006042 Bacteria 783
216 Ga0075432_10196881 3300006058 Bacteria 796
217 Ga0070715_10153230 3300006163 Bacteria 1131
218 Ga0070715_10734516 3300006163 Unclassified 593
219 Ga0070716_100002585 3300006173 Bacteria 8361
220 Ga0070716_100143239 3300006173 Bacteria 1527
221 Ga0070712_100176827 3300006175 Bacteria 1660
222 Ga0070712_100302649 3300006175 Bacteria 1295
223 Ga0070712_100427741 3300006175 Bacteria 1098
224 Ga0070712_100427742 3300006175 Bacteria 1098
225 Ga0075367_10123200 3300006178 Bacteria 1598
226 Ga0075367_10375489 3300006178 Bacteria 898
227 Ga0097621_100000473 3300006237 Bacteria 28196
228 Ga0097621_100008980 3300006237 Bacteria 7230
229 Ga0075370_10353317 3300006353 Bacteria 878
230 Ga0075370_11028316 3300006353 Unclassified 505
231 Ga0068871_100000118 3300006358 Bacteria 49211
232 Ga0068871_100420430 3300006358 Bacteria 1193
233 Ga0075428_100354674 3300006844 Bacteria 1574
234 Ga0075428_100899534 3300006844 Bacteria 939
235 Ga0075431_100295956 3300006847 Bacteria 1636
236 Ga0075433_10010666 3300006852 Bacteria 7388
237 Ga0075433_10548803 3300006852 Unclassified 1016
238 Ga0075433_10567783 3300006852 Bacteria 997
239 Ga0075434_100001964 3300006871 Bacteria 17837
240 Ga0075434_100021155 3300006871 Bacteria 6322
241 Ga0075434_100042779 3300006871 Bacteria 4491
242 Ga0075434_100223533 3300006871 Bacteria 1902
243 Ga0075434_100667880 3300006871 Bacteria 1057
244 Ga0075434_100677953 3300006871 Bacteria 1049
245 Ga0075434_100918790 3300006871 Bacteria 890
246 Ga0068865_100006203 3300006881 Bacteria 7286
247 Ga0068865_100728940 3300006881 Bacteria 850
248 Ga0075436_100213877 3300006914 Unclassified 1367
249 Ga0075436_100350152 3300006914 Bacteria 1064
250 Ga0075436_100547022 3300006914 Unclassified 850
251 Ga0097620_100001568 3300006931 Bacteria 23306
252 Ga0097620_100137077 3300006931 Bacteria 2521
253 Ga0097620_100640126 3300006931 Bacteria 1155
254 Ga0097620_100765560 3300006931 Bacteria 1054
255 Ga0075435_100020961 3300007076 Bacteria 5020
256 Ga0075435_100207547 3300007076 Unclassified 1661
257 Ga0075435_100210657 3300007076 Unclassified 1649
258 Ga0075435_100692254 3300007076 Unclassified 886
259 Ga0075435_101135663 3300007076 Bacteria 683
260 Ga0105245_12304777 3300009098 Bacteria 592
261 Ga0105247_10844701 3300009101 Bacteria 702
262 Ga0105247_11030374 3300009101 Bacteria 645
263 Ga0114129_10025668 3300009147 Bacteria 8347
264 Ga0114129_10342275 3300009147 Bacteria 1983
265 Ga0114129_11443151 3300009147 Bacteria 848
266 Ga0105243_10091515 3300009148 Bacteria 2505
267 Ga0105243_11528744 3300009148 Bacteria 692
268 Ga0105241_10278766 3300009174 Bacteria 1427
269 Ga0105241_11450245 3300009174 Unclassified 659
270 Ga0105241_12060674 3300009174 Bacteria 563
271 Ga0105242_11402813 3300009176 Bacteria 726
272 Ga0105237_11592476 3300009545 Unclassified 660
273 Ga0105238_10798675 3300009551 Bacteria 959
274 Ga0105238_12730515 3300009551 Bacteria 530
275 Ga0105249_11611934 3300009553 Unclassified 721
276 Ga0105239_10809693 3300010375 Bacteria 1073
277 Ga0105239_11463087 3300010375 Bacteria 789
278 Ga0105246_10720845 3300011119 Bacteria 876
279 Ga0157328_1001223 3300012478 Bacteria 1072
280 Ga0157320_1011245 3300012481 Bacteria 702
281 Ga0157319_1032852 3300012497 Bacteria 570
282 Ga0157342_1014627 3300012507 Bacteria 851
283 Ga0157373_10219054 3300013100 Bacteria 1342
284 Ga0157374_11289228 3300013296 Bacteria 752
285 Ga0157374_11592690 3300013296 Unclassified 677
286 Ga0157375_11369081 3300013308 Unclassified 833
287 Ga0157380_11574056 3300014326 Bacteria 712
288 Ga0157377_10308387 3300014745 Bacteria 1047
289 Ga0157379_11186537 3300014968 Bacteria 734
290 Ga0157376_10853847 3300014969 Bacteria 926
291 Ga0163161_10005398 3300017792 Bacteria 8877
292 Ga0206356_10738097 3300020070 Bacteria 515
293 Ga0207666_1000120 3300025271 Bacteria 12166
294 Ga0207666_1002984 3300025271 Bacteria 2057
295 Ga0207673_1002080 3300025290 Bacteria 2246
296 Ga0207697_10000061 3300025315 Bacteria 45271
297 Ga0207697_10049723 3300025315 Bacteria 1731
298 Ga0207713_1021008 3300025735 Bacteria 3140
299 Ga0207682_10000332 3300025893 Bacteria 21608
300 Ga0207692_10003778 3300025898 Bacteria 5947
301 Ga0207692_10030854 3300025898 Bacteria 2561
302 Ga0207692_10092547 3300025898 Bacteria 1643
303 Ga0207642_10000520 3300025899 Bacteria 11771
304 Ga0207710_10003839 3300025900 Bacteria 6639
305 Ga0207710_10004780 3300025900 Bacteria 5877
306 Ga0207688_10000001 3300025901 Bacteria 107505
307 Ga0207680_10016478 3300025903 Bacteria 3880
308 Ga0207680_10250163 3300025903 Bacteria 1224
309 Ga0207680_10788711 3300025903 Bacteria 681
310 Ga0207647_10083515 3300025904 Bacteria 1913
311 Ga0207685_10007286 3300025905 Bacteria 3073
312 Ga0207685_10008345 3300025905 Bacteria 2946
313 Ga0207699_10005454 3300025906 Bacteria 6087
314 Ga0207699_10061169 3300025906 Bacteria 2265
315 Ga0207645_10000222 3300025907 Bacteria 47139
316 Ga0207643_10000009 3300025908 Bacteria 160496
317 Ga0207684_11624283 3300025910 Unclassified 523
318 Ga0207654_10008610 3300025911 Bacteria 5167
319 Ga0207654_10226472 3300025911 Bacteria 1243
320 Ga0207707_10001855 3300025912 Bacteria 19315
321 Ga0207707_10023067 3300025912 Bacteria 5445
322 Ga0207707_10168746 3300025912 Bacteria 1912
323 Ga0207707_10721384 3300025912 Unclassified 836
324 Ga0207695_10221647 3300025913 Bacteria 1798
325 Ga0207671_10024205 3300025914 Bacteria 4569
326 Ga0207693_10019742 3300025915 Bacteria 5358
327 Ga0207693_11000737 3300025915 Bacteria 638
328 Ga0207693_11000738 3300025915 Bacteria 638
329 Ga0207663_10025626 3300025916 Bacteria 3412
330 Ga0207663_10081715 3300025916 Bacteria 2117
331 Ga0207663_10997103 3300025916 Unclassified 672
332 Ga0207660_10001147 3300025917 Bacteria 17672
333 Ga0207660_10149471 3300025917 Bacteria 1793
334 Ga0207660_10475742 3300025917 Bacteria 1012
335 Ga0207660_11443093 3300025917 Bacteria 557
336 Ga0207662_10000616 3300025918 Bacteria 15934
337 Ga0207662_10108744 3300025918 Bacteria 1726
338 Ga0207657_10000776 3300025919 Bacteria 33868
339 Ga0207657_10206712 3300025919 Bacteria 1577
340 Ga0207657_10543961 3300025919 Bacteria 908
341 Ga0207657_11136497 3300025919 Bacteria 596
342 Ga0207649_10000052 3300025920 Bacteria 106800
343 Ga0207649_10403288 3300025920 Bacteria 1023
344 Ga0207649_11300813 3300025920 Unclassified 575
345 Ga0207652_10001328 3300025921 Bacteria 21958
346 Ga0207652_10990076 3300025921 Bacteria 739
347 Ga0207681_10000035 3300025923 Bacteria 161792
348 Ga0207681_10356887 3300025923 Bacteria 1171
349 Ga0207650_10001385 3300025925 Bacteria 17487
350 Ga0207650_10419749 3300025925 Bacteria 1110
351 Ga0207659_10000132 3300025926 Bacteria 43798
352 Ga0207659_10759185 3300025926 Bacteria 832
353 Ga0207687_10000174 3300025927 Bacteria 42351
354 Ga0207687_10009445 3300025927 Bacteria 6380
355 Ga0207700_10000810 3300025928 Bacteria 18078
356 Ga0207700_10013168 3300025928 Bacteria 5369
357 Ga0207700_10062828 3300025928 Bacteria 2821
358 Ga0207664_10081946 3300025929 Bacteria 2627
359 Ga0207664_10101779 3300025929 Bacteria 2374
360 Ga0207644_10002247 3300025931 Bacteria 12528
361 Ga0207690_10000148 3300025932 Bacteria 56244
362 Ga0207690_11007341 3300025932 Bacteria 693
363 Ga0207706_10018668 3300025933 Bacteria 6240
364 Ga0207706_10132685 3300025933 Bacteria 2191
365 Ga0207706_10206929 3300025933 Bacteria 1720
366 Ga0207686_10009703 3300025934 Bacteria 5230
367 Ga0207686_10109883 3300025934 Bacteria 1857
368 Ga0207709_10000087 3300025935 Bacteria 155019
369 Ga0207709_10052699 3300025935 Bacteria 2500
370 Ga0207709_10888424 3300025935 Bacteria 724
371 Ga0207709_11000282 3300025935 Bacteria 683
372 Ga0207670_10000528 3300025936 Bacteria 21114
373 Ga0207670_10059661 3300025936 Bacteria 2596
374 Ga0207670_10357773 3300025936 Bacteria 1158
375 Ga0207670_10472908 3300025936 Bacteria 1014
376 Ga0207670_10829918 3300025936 Unclassified 771
377 Ga0207669_10000589 3300025937 Bacteria 15806
378 Ga0207704_10000392 3300025938 Bacteria 19977
379 Ga0207665_10007965 3300025939 Bacteria 6996
380 Ga0207665_10050011 3300025939 Bacteria 2810
381 Ga0207691_10000517 3300025940 Bacteria 38398
382 Ga0207711_10011699 3300025941 Bacteria 7291
383 Ga0207711_10228324 3300025941 Bacteria 1704
384 Ga0207689_10000031 3300025942 Bacteria 97131
385 Ga0207689_10071476 3300025942 Bacteria 2850
386 Ga0207689_10736705 3300025942 Bacteria 832
387 Ga0207661_10007383 3300025944 Bacteria 7820
388 Ga0207661_10089610 3300025944 Bacteria 2560
389 Ga0207679_10000493 3300025945 Bacteria 27242
390 Ga0207679_10375903 3300025945 Bacteria 1244
391 Ga0207679_10598459 3300025945 Bacteria 993
392 Ga0207667_10017867 3300025949 Bacteria 7971
393 Ga0207651_10000051 3300025960 Bacteria 54163
394 Ga0207651_10010449 3300025960 Bacteria 5147
395 Ga0207651_10605747 3300025960 Bacteria 958
396 Ga0207712_10000176 3300025961 Bacteria 66116
397 Ga0207712_10214895 3300025961 Bacteria 1534
398 Ga0207668_10000355 3300025972 Bacteria 29722
399 Ga0207640_10000126 3300025981 Bacteria 58432
400 Ga0207658_10002400 3300025986 Bacteria 13716
401 Ga0207658_10643357 3300025986 Bacteria 955
402 Ga0207677_10066304 3300026023 Bacteria 2523
403 Ga0207677_10390662 3300026023 Unclassified 1177
404 Ga0207703_10001969 3300026035 Bacteria 18133
405 Ga0207703_10507924 3300026035 Bacteria 1132
406 Ga0207703_10769509 3300026035 Bacteria 918
407 Ga0207639_10144388 3300026041 Bacteria 1986
408 Ga0207678_10000531 3300026067 Bacteria 34761
409 Ga0207678_10057976 3300026067 Bacteria 3333
410 Ga0207678_10314500 3300026067 Bacteria 1347
411 Ga0207708_10000573 3300026075 Bacteria 28465
412 Ga0207708_10077261 3300026075 Bacteria 2555
413 Ga0207702_10010346 3300026078 Bacteria 7814
414 Ga0207702_10277286 3300026078 Bacteria 1584
415 Ga0207702_11257496 3300026078 Archaea 734
416 Ga0207641_10001041 3300026088 Bacteria 28118
417 Ga0207648_10000581 3300026089 Bacteria 41019
418 Ga0207676_10000124 3300026095 Bacteria 67747
419 Ga0207676_10004875 3300026095 Bacteria 9497
420 Ga0207676_10193818 3300026095 Bacteria 1790
421 Ga0207676_11769616 3300026095 Unclassified 616
422 Ga0207674_10000095 3300026116 Bacteria 99278
423 Ga0207675_100000414 3300026118 Bacteria 41042
424 Ga0207675_100785923 3300026118 Bacteria 964
425 Ga0207683_10000242 3300026121 Bacteria 48576
426 Ga0207698_10003848 3300026142 Bacteria 9085
427 Ga0209966_1000536 3300027695 Bacteria 9649
428 Ga0209998_10094989 3300027717 Bacteria 734
429 Ga0209998_10214982 3300027717 Bacteria 504
430 Ga0209974_10011505 3300027876 Bacteria 2969
431 Ga0209974_10017542 3300027876 Bacteria 2374
432 Ga0209974_10167187 3300027876 Bacteria 800
433 Ga0207428_10000037 3300027907 Bacteria 218857
434 Ga0207428_10003190 3300027907 Bacteria 16047
435 Ga0268266_10025994 3300028379 Bacteria 4980
436 Ga0268266_10038038 3300028379 Bacteria 4097
437 Ga0268266_10826655 3300028379 Bacteria 895
438 Ga0268265_10000757 3300028380 Bacteria 31383
439 Ga0268265_12145268 3300028380 Bacteria 566
440 Ga0268264_10177820 3300028381 Bacteria 1930
441 Ga0268264_10320432 3300028381 Bacteria 1465
442 Ga0265325_10000049 3300031241 Bacteria 80854
443 Ga0265340_10369650 3300031247 Bacteria 633
444 Ga0265313_10027525 3300031595 Bacteria 2973
445 Ga0307412_10765917 3300031911 Bacteria 835
446 Ga0373930_0000167 3300034816 Bacteria 7621
447 Ga0373948_0000080 3300034817 Bacteria 9932
448 Ga0373948_0021532 3300034817 Bacteria 1235
449 Ga0373950_0001088 3300034818 Bacteria 3471
450 Ga0373950_0009479 3300034818 Bacteria 1556
451 Ga0373958_0118578 3300034819 Unclassified 637
452 Ga0373959_0005726 3300034820 Bacteria 2042
453 Ga0373959_0008295 3300034820 Bacteria 1765
454 Ga0373959_0054023 3300034820 Unclassified 874
455 Ga0373938_0002758 3300034957 Bacteria 2835
456 Ga0373938_0105208 3300034957 Bacteria 713
457 Ga0373926_0007052 3300035083 Bacteria 3739
458 Ga0373928_0005786 3300035084 Bacteria 2365
459 Ga0373928_0008944 3300035084 Bacteria 1954
460 Ga0373929_0000333 3300035085 Bacteria 8758
461 Ga0373929_0063482 3300035085 Bacteria 869
462 Ga0373929_0130608 3300035085 Bacteria 658
463 Ga0373929_0148072 3300035085 Unclassified 628
464 Ga0373934_0065473 3300035086 Unclassified 1451
465 Ga0373940_0001034 3300035088 Bacteria 4787
466 Ga0373944_0008009 3300035089 Bacteria 2848
467 Ga0373944_0105982 3300035089 Bacteria 955
468 Ga0373944_0177098 3300035089 Bacteria 763
469 Ga0373949_0002294 3300035090 Bacteria 4975
470 Ga0373949_0067769 3300035090 Bacteria 929
471 Ga0373951_0004760 3300035091 Bacteria 3201
472 Ga0373951_0009985 3300035091 Bacteria 2131
473 Ga0373952_0001546 3300035092 Bacteria 4195
474 Ga0373952_0001876 3300035092 Bacteria 3819
475 Ga0373952_0016287 3300035092 Bacteria 1510
476 Ga0373932_0000216 3300035112 Bacteria 17011
477 Ga0373932_0004711 3300035112 Bacteria 3218
478 Ga0373936_0010734 3300035113 Bacteria 3459
479 Ga0373936_0325321 3300035113 Bacteria 697
480 Ga0373936_0592755 3300035113 Unclassified 520
481 Ga0373939_0000125 3300035114 Bacteria 22622
482 Ga0373941_0064473 3300035115 Bacteria 1200
483 Ga0373941_0068623 3300035115 Bacteria 1172
484 Ga0373945_0005524 3300035116 Bacteria 4049
485 Ga0373945_0015449 3300035116 Bacteria 2569
486 Ga0373953_0063177 3300035117 Bacteria 1517
487 Ga0373954_0028451 3300035118 Bacteria 2570
488 Ga0373954_0343790 3300035118 Bacteria 737
489 Ga0373956_0059761 3300035119 Bacteria 1725
490 Ga0373956_0167260 3300035119 Bacteria 1037
491 Ga0373957_0092391 3300035120 Bacteria 1204
492 Ga0373960_0000232 3300035121 Bacteria 10352
493 Ga0373960_0001024 3300035121 Bacteria 6023
494 Ga0373943_0011235 3300035170 Bacteria 4028
495 Ga0373943_0081381 3300035170 Bacteria 1661
496 Ga0373955_0107113 3300035172 Bacteria 1612
497 Ga0373942_0000176 3300035207 Bacteria 15978
498 Ga0373942_0061067 3300035207 Bacteria 1081
499 Ga0373942_0066837 3300035207 Bacteria 1041
500 Ga0373961_0004636 3300035241 Bacteria 3315
501 Ga0373961_0006457 3300035241 Bacteria 2816
502 Ga0373962_0014531 3300035242 Bacteria 2007
503 Ga0373924_0020150 3300035410 Bacteria 2589
504 Ga0373924_0027139 3300035410 Bacteria 2276
505 Ga0373931_0000124 3300035691 Bacteria 34887
506 Ga0373935_0116159 3300035692 Bacteria 1782
507 Ga0373927_0028225 3300035695 Bacteria 3661
508 Ga0373927_0151289 3300035695 Bacteria 1519
509 Ga0373927_0215606 3300035695 Bacteria 1261
510 Ga0373927_0428799 3300035695 Bacteria 873
511 Ga0373933_0160433 3300035724 Bacteria 1427
512 Ga0373933_0240330 3300035724 Bacteria 1165
513 Ga0373947_0014361 3300035725 Bacteria 4543
514 Ga0373947_0102798 3300035725 Bacteria 1797
515 Ga0373947_0121146 3300035725 Bacteria 1662
516 Ga0373937_0034269 3300036401 Bacteria 4618
517 Ga0373937_0145375 3300036401 Bacteria 2219
518 Ga0373937_0323502 3300036401 Bacteria 1459
519 Ga0373925_0005504 3300037068 Bacteria 9426
520 Ga0373925_0031705 3300037068 Bacteria 3886
521 Ga0373925_0340598 3300037068 Bacteria 1216
522 Ga0395898_0454639 3300037466 Bacteria 1219
523 Ga0395905_0581148 3300037471 Bacteria 1022
524 Ga0395901_0405060 3300038443 Bacteria 1401
525 Ga0436365_0459934 3300039437 Bacteria 1194
526 Ga0451853_3961871 3300041512 Bacteria 613
527 Ga0439450_028188 3300042008 Bacteria 1248
528 Ga0439455_0193515 3300042012 Bacteria 587
529 Ga0450912_010614 3300042116 Bacteria 791
530 Ga0439464_0004464 3300042439 Bacteria 3583
531 Ga0439460_0064879 3300042461 Bacteria 1121
532 Ga0451577_0799660 3300042876 Bacteria 852
533 Ga0466969_0295654 3300044656 Bacteria 733
534 Ga0466966_0033902 3300044684 Bacteria 3304
535 Ga0466961_0314517 3300044693 Bacteria 955
536 Ga0466963_0149506 3300044694 Bacteria 1621
537 Ga0453684_0513542 3300044712 Bacteria 1325
538 Ga0466971_0169602 3300044719 Bacteria 1024
539 Ga0466957_0127929 3300044842 Bacteria 1624
540 Ga0466959_0336860 3300045049 Bacteria 1029
541 Ga0451576_0613609 3300045051 Bacteria 1143
542 Ga0466958_0088959 3300045836 Bacteria 1908
543 Ga0466967_0291786 3300045976 Bacteria 1567
544 Ga0495617_044085 3300046452 Bacteria 1489
545 Ga0495592_0076830 3300046454 Bacteria 2422
546 Ga0495592_0113131 3300046454 Bacteria 1918
547 Ga0495603_0033829 3300046455 Bacteria 3075
548 Ga0495603_0063121 3300046455 Bacteria 2186
549 Ga0495603_0125214 3300046455 Bacteria 1497
550 Ga0495629_0005418 3300046459 Bacteria 9518
551 Ga0495629_0357597 3300046459 Bacteria 995
552 Ga0495638_0122194 3300046460 Bacteria 1537
553 Ga0495638_0255206 3300046460 Bacteria 965
554 Ga0495651_0116918 3300046462 Bacteria 1963
555 Ga0495580_0090643 3300046472 Unclassified 2129
556 Ga0495582_0051485 3300046473 Bacteria 2270
557 Ga0495639_0200635 3300046475 Bacteria 976
558 Ga0495662_0074482 3300046476 Unclassified 1647
559 Ga0495664_0033039 3300046477 Bacteria 3040
560 Ga0495584_0053185 3300046491 Bacteria 2038
561 Ga0495585_0003758 3300046492 Bacteria 10133
562 Ga0495594_0003490 3300046499 Bacteria 8108
563 Ga0495594_0053988 3300046499 Bacteria 2214
564 Ga0495607_0084698 3300046501 Bacteria 1733
565 Ga0495608_0032489 3300046511 Bacteria 3528
566 Ga0495618_0204570 3300046514 Bacteria 1249
567 Ga0495618_0916053 3300046514 Unclassified 505
568 Ga0495628_0007284 3300046516 Bacteria 9588
569 Ga0495628_0319584 3300046516 Unclassified 1146
570 Ga0495631_0030448 3300046518 Bacteria 2448
571 Ga0495637_0058619 3300046520 Bacteria 1587
572 Ga0495644_0012715 3300046523 Bacteria 3236
573 Ga0495666_0021852 3300046526 Bacteria 3167
574 Ga0495666_0238565 3300046526 Bacteria 830
575 Ga0495652_0172977 3300046529 Bacteria 1665
576 Ga0495652_0517797 3300046529 Bacteria 825
577 Ga0495640_0017163 3300046533 Bacteria 5401
578 Ga0495586_0065777 3300046535 Bacteria 1976
579 Ga0495587_0194638 3300046536 Bacteria 1147
580 Ga0495587_0422177 3300046536 Bacteria 740
581 Ga0495598_0013102 3300046537 Bacteria 2049
582 Ga0495609_0041317 3300046538 Bacteria 2073
583 Ga0495609_0091173 3300046538 Bacteria 1326
584 Ga0495621_0042575 3300046539 Unclassified 1599
585 Ga0495645_0005770 3300046543 Bacteria 8538
586 Ga0495622_0221005 3300046557 Unclassified 839
587 Ga0495633_0005630 3300046558 Bacteria 7595
588 Ga0495656_0018371 3300046615 Bacteria 2683
589 Ga0495668_0381883 3300046616 Bacteria 774
590 Ga0495635_0235846 3300046663 Bacteria 1235
591 Ga0495659_0003259 3300046664 Bacteria 5204
592 Ga0495661_0037705 3300046665 Bacteria 3016
593 Ga0495588_0136414 3300046674 Bacteria 1295
594 Ga0495588_0140981 3300046674 Bacteria 1273
595 Ga0495657_0065914 3300046675 Bacteria 2381
596 Ga0495623_0258511 3300046679 Bacteria 976
597 Ga0495646_0356975 3300046680 Bacteria 765
598 Ga0495647_0021374 3300046681 Bacteria 2329
599 Ga0495658_0084743 3300046683 Bacteria 1866
600 Ga0495658_0424629 3300046683 Bacteria 848
601 Ga0495669_0342649 3300046684 Bacteria 722
602 Ga0495613_0006657 3300046689 Bacteria 8631
603 Ga0495613_0071710 3300046689 Bacteria 2525
604 Ga0495624_0036676 3300046690 Bacteria 3159
605 Ga0495670_0003018 3300046691 Bacteria 8304
606 Ga0495671_0044577 3300046692 Bacteria 2223
607 Ga0495589_0051818 3300046794 Bacteria 2028
608 Ga0495600_0839566 3300046809 Bacteria 545
609 Ga0495604_0029170 3300047317 Bacteria 4389
610 Ga0495636_0074309 3300047318 Bacteria 1456
611 Ga0495674_0140552 3300047319 Unclassified 2030
612 Ga0495676_0157557 3300047321 Bacteria 1609
613 Ga0495680_0041875 3300047322 Bacteria 3637
614 Ga0495680_0045246 3300047322 Bacteria 3476
615 Ga0495675_0388958 3300047444 Bacteria 815
616 Ga0495679_078840 3300047446 Bacteria 938
617 Ga0495681_0272553 3300047470 Bacteria 662
618 Ga0495614_0014398 3300048089 Bacteria 3462
619 Ga0496100_0029405 3300048903 Bacteria 3398
620 Ga0496100_0132875 3300048903 Bacteria 1755
621 Ga0496100_0370757 3300048903 Bacteria 1085
622 Ga0496100_0633087 3300048903 Bacteria 832
623 Ga0496101_0000151 3300048904 Bacteria 59751
624 Ga0496101_0691237 3300048904 Bacteria 805
625 Ga0496102_0024345 3300048905 Bacteria 5382
626 Ga0496102_0027609 3300048905 Bacteria 5068
627 Ga0496102_0029340 3300048905 Bacteria 4922
628 Ga0496102_0309024 3300048905 Bacteria 1490
629 Ga0496103_0006448 3300048906 Bacteria 7003
630 Ga0496103_0089607 3300048906 Bacteria 1940
631 Ga0496103_0168087 3300048906 Bacteria 1407
632 Ga0496103_0569510 3300048906 Bacteria 722
633 Ga0496103_0633909 3300048906 Bacteria 680
634 Ga0496104_0003813 3300048907 Bacteria 13044
635 Ga0496104_0035086 3300048907 Bacteria 4681
636 Ga0496104_0083596 3300048907 Bacteria 3044
637 Ga0496104_0091092 3300048907 Bacteria 2914
638 Ga0496104_0092885 3300048907 Bacteria 2885
639 Ga0496104_0117274 3300048907 Bacteria 2555
640 Ga0496104_0265889 3300048907 Bacteria 1627
641 Ga0496104_0522252 3300048907 Bacteria 1098
642 Ga0496104_1294436 3300048907 Bacteria 632
643 Ga0496105_0001595 3300048908 Bacteria 16062
644 Ga0496105_0170313 3300048908 Bacteria 1785
645 Ga0496105_0346833 3300048908 Bacteria 1186
646 Ga0496105_0680191 3300048908 Bacteria 791
647 Ga0496105_0830124 3300048908 Bacteria 701
648 Ga0496106_0014405 3300048909 Bacteria 5843
649 Ga0496106_0050334 3300048909 Bacteria 3140
650 Ga0496106_0283421 3300048909 Bacteria 1327
651 Ga0496106_0334710 3300048909 Bacteria 1215
652 Ga0496106_0452430 3300048909 Bacteria 1031
653 Ga0496106_0762222 3300048909 Bacteria 769
654 Ga0496106_1053336 3300048909 Bacteria 638
655 Ga0496107_0000118 3300048910 Bacteria 38697
656 Ga0496107_0028493 3300048910 Bacteria 3969
657 Ga0496107_0091881 3300048910 Bacteria 2218
658 Ga0496107_0177076 3300048910 Bacteria 1583
659 Ga0496107_0194003 3300048910 Bacteria 1509
660 Ga0496107_0612130 3300048910 Bacteria 804
661 Ga0496108_0002446 3300048911 Bacteria 14846
662 Ga0496108_0004875 3300048911 Bacteria 10836
663 Ga0496108_0008170 3300048911 Bacteria 8489
664 Ga0496108_0596106 3300048911 Bacteria 963
665 Ga0496109_0001567 3300048912 Bacteria 19049
666 Ga0496109_0007673 3300048912 Bacteria 9147
667 Ga0496109_0014341 3300048912 Bacteria 6896
668 Ga0496109_0025468 3300048912 Bacteria 5272
669 Ga0496109_0033534 3300048912 Bacteria 4619
670 Ga0496109_0051256 3300048912 Bacteria 3759
671 Ga0496109_1152592 3300048912 Bacteria 712
672 Ga0496110_0088224 3300048913 Bacteria 2770
673 Ga0496110_0206078 3300048913 Bacteria 1787
674 Ga0496110_0350461 3300048913 Bacteria 1345
675 Ga0496110_0546741 3300048913 Unclassified 1052
676 Ga0496110_0583708 3300048913 Bacteria 1014
677 Ga0496111_0016804 3300048914 Bacteria 5048
678 Ga0496111_0023319 3300048914 Bacteria 4344
679 Ga0496111_0144813 3300048914 Bacteria 1761
680 Ga0496112_0008258 3300048915 Bacteria 9315
681 Ga0496112_0023998 3300048915 Bacteria 5834
682 Ga0496112_0202841 3300048915 Bacteria 1942
683 Ga0496112_0205887 3300048915 Bacteria 1925
684 Ga0496112_0767287 3300048915 Bacteria 890
685 Ga0496112_0873539 3300048915 Bacteria 822
686 Ga0496113_0011936 3300048916 Bacteria 5823
687 Ga0496113_0012142 3300048916 Bacteria 5779
688 Ga0496113_0726757 3300048916 Bacteria 791
689 Ga0496113_1292783 3300048916 Bacteria 567
690 Ga0496114_0007779 3300048917 Bacteria 8482
691 Ga0496114_0341737 3300048917 Bacteria 1323
692 Ga0496114_1526650 3300048917 Unclassified 556
693 Ga0496115_0035263 3300048918 Bacteria 3957
694 Ga0496115_0063810 3300048918 Bacteria 2972
695 Ga0496115_0299621 3300048918 Bacteria 1317
696 Ga0496115_0707293 3300048918 Bacteria 791
697 Ga0496115_0979710 3300048918 Bacteria 647
698 Ga0496115_0984418 3300048918 Bacteria 645
699 Ga0496121_0389030 3300048924 Bacteria 917
700 Ga0501034_0087583 3300049571 Bacteria 3113
701 Ga0501037_0489821 3300049573 Bacteria 835
702 Ga0501038_0593306 3300049574 Bacteria 839
703 Ga0501040_0149884 3300049576 Bacteria 1645
704 Ga0501041_0089606 3300049577 Bacteria 1899
705 Ga0501043_0187091 3300049579 Bacteria 1612
706 Ga0501043_1044290 3300049579 Bacteria 580
707 Ga0501047_0158202 3300049581 Bacteria 2138
708 Ga0501047_0537551 3300049581 Bacteria 994
709 Ga0501067_0193544 3300049583 Bacteria 1133
710 Ga0501069_0034940 3300049585 Bacteria 2768
711 Ga0501069_0123124 3300049585 Bacteria 1482
712 Ga0501070_0087049 3300049586 Bacteria 2586
713 Ga0501070_0228354 3300049586 Bacteria 1525
714 Ga0501070_0592745 3300049586 Bacteria 884
715 Ga0501070_1162523 3300049586 Bacteria 593
716 Ga0501071_0244708 3300049587 Bacteria 1353
717 Ga0501072_0633404 3300049588 Bacteria 842
718 Ga0501072_0652782 3300049588 Bacteria 828
719 Ga0501073_0070644 3300049589 Bacteria 2432
720 Ga0501073_0211640 3300049589 Bacteria 1340
721 Ga0501073_0331045 3300049589 Bacteria 1051
722 Ga0501073_0905649 3300049589 Bacteria 607
723 Ga0501074_0131812 3300049590 Bacteria 1788
724 Ga0501074_0480881 3300049590 Bacteria 880
725 Ga0501074_0566329 3300049590 Bacteria 804
726 Ga0501075_0002913 3300049591 Bacteria 11483
727 Ga0501076_0020221 3300049592 Bacteria 5094
728 Ga0501076_0676523 3300049592 Bacteria 852
729 Ga0501076_1006433 3300049592 Bacteria 687
730 Ga0501077_0014314 3300049593 Bacteria 4983
731 Ga0501077_0054700 3300049593 Bacteria 2534
732 Ga0501079_0022226 3300049741 Bacteria 4862
733 Ga0501079_0309137 3300049741 Bacteria 1237
734 Ga0501080_0180173 3300049742 Bacteria 1945
735 Ga0501080_0769613 3300049742 Bacteria 846
736 Ga0501080_0957302 3300049742 Unclassified 744
737 Ga0501080_1092781 3300049742 Bacteria 689
738 Ga0501081_0000595 3300049743 Bacteria 20607
739 Ga0501081_0110220 3300049743 Bacteria 1953
740 Ga0501083_0604780 3300049744 Bacteria 713
741 Ga0501083_0638958 3300049744 Bacteria 692
742 Ga0501083_0692158 3300049744 Bacteria 663
743 Ga0501035_0003762 3300049822 Bacteria 14460
744 Ga0501044_0100974 3300049823 Bacteria 2903
745 Ga0501044_0232536 3300049823 Bacteria 1790
746 Ga0501045_1260393 3300049824 Bacteria 539
747 nmdc:mga0k408_427641_c1 3300050493 Bacteria 787
748 nmdc:mga06z11_53984_c1 3300050494 Bacteria 2069
749 nmdc:mga07m45_323256_c1 3300050496 Bacteria 897
750 nmdc:mga05p37_59706_c1 3300050507 Bacteria 4696
751 nmdc:mga06r32_687334_c1 3300050510 Bacteria 989
752 nmdc:mga08y16_243413_c1 3300050511 Bacteria 1859
753 nmdc:mga08y16_333_c1 3300050511 Bacteria 42807
754 nmdc:mga08y16_41762_c1 3300050511 Bacteria 4804
755 nmdc:mga08y16_90680_c1 3300050511 Bacteria 3186
756 nmdc:mga0n895_13320_c1 3300050512 Bacteria 7415
757 nmdc:mga0n895_29477_c1 3300050512 Bacteria 5235
758 nmdc:mga0n895_402224_c1 3300050512 Bacteria 1385
759 nmdc:mga0n895_62_c1 3300050512 Bacteria 62891
760 nmdc:mga0n895_633841_c1 3300050512 Bacteria 1069
761 nmdc:mga0n895_649955_c1 3300050512 Bacteria 1053
762 nmdc:mga0rr50_14190_c1 3300050513 Bacteria 5217
763 nmdc:mga0rr50_167156_c1 3300050513 Bacteria 1789
764 nmdc:mga0rr50_39550_c1 3300050513 Bacteria 3422
765 nmdc:mga0rr50_435635_c1 3300050513 Bacteria 1110
766 nmdc:mga0rr50_67222_c1 3300050513 Unclassified 2722
767 nmdc:mga0rr50_906756_c1 3300050513 Bacteria 751
768 nmdc:mga08x19_188511_c1 3300050514 Bacteria 1410
769 nmdc:mga08x19_316665_c1 3300050514 Bacteria 1085
770 nmdc:mga08x19_423684_c1 3300050514 Bacteria 935
771 nmdc:mga0a205_160430_c1 3300050515 Bacteria 2145
772 nmdc:mga0a205_394761_c1 3300050515 Bacteria 1247
773 nmdc:mga0a205_557610_c1 3300050515 Unclassified 1001
774 nmdc:mga0a205_7202_c1 3300050515 Bacteria 10058
775 nmdc:mga0a205_96413_c1 3300050515 Bacteria 2856
776 Ga0495601_0018908 3300053077 Bacteria 4197
777 Ga0495601_0220581 3300053077 Bacteria 1238
778 Ga0495612_0012859 3300053078 Bacteria 3373
779 Ga0495612_0046322 3300053078 Bacteria 1781
780 Ga0495595_0011676 3300053084 Bacteria 3677
781 Ga0495595_0019992 3300053084 Bacteria 2910
782 Ga0495595_0086694 3300053084 Bacteria 1498
783 Ga0495619_0002485 3300053085 Bacteria 12063
784 Ga0495619_0051751 3300053085 Bacteria 2714
785 Ga0495619_0114009 3300053085 Bacteria 1849
786 Ga0500644_0494901 3300053088 Bacteria 538
787 Ga0500646_0142524 3300053090 Unclassified 788
788 Ga0500641_0016625 3300053096 Bacteria 2742
789 Ga0500641_0093896 3300053096 Bacteria 1282
790 Ga0500577_0009850 3300053142 Bacteria 2790
791 Ga0500588_0214755 3300053146 Bacteria 716
792 Ga0500589_231828 3300053147 Bacteria 689
793 Ga0500604_0054395 3300053151 Bacteria 1243
794 Ga0501084_0323640 3300054114 Bacteria 1302
795 Ga0501082_0003176 3300060353 Bacteria 14331
796 Ga0501082_0168092 3300060353 Bacteria 1906
797 Ga0501082_0394239 3300060353 Bacteria 1208
798 Ga0466962_0286655 3300061719 Bacteria 813
799 Ga0530510_0501479 3300061734 Bacteria 920
800 Ga0530510_0624427 3300061734 Bacteria 820

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053147 Ga0500589_231828 Ga0500589_231828_378_674 79
2 3300053088 Ga0500644_0494901 Ga0500644_0494901_21_314 80
3 3300046460 Ga0495638_0255206 Ga0495638_0255206_531_827 90
4 3300046616 Ga0495668_0381883 Ga0495668_0381883_214_510 90
5 3300053096 Ga0500641_0016625 Ga0500641_0016625_2279_2575 90
6 3300053146 Ga0500588_0214755 Ga0500588_0214755_282_578 90
7 3300053151 Ga0500604_0054395 Ga0500604_0054395_68_364 90
8 3300005535 Ga0070684_101445594 Ga0070684_1014455941 94
9 3300005937 Ga0081455_10000664 Ga0081455_1000066439 94
10 3300006042 Ga0075368_10233564 Ga0075368_102335642 94
11 3300006871 Ga0075434_100223533 Ga0075434_1002235334 94
12 3300009098 Ga0105245_12304777 Ga0105245_123047771 95
13 3300026078 Ga0207702_11257496 Ga0207702_112574962 95
14 3300035119 Ga0373956_0167260 Ga0373956_0167260_670_960 95
15 3300035120 Ga0373957_0092391 Ga0373957_0092391_528_818 95
16 3300035724 Ga0373933_0240330 Ga0373933_0240330_472_762 95
17 3300036401 Ga0373937_0323502 Ga0373937_0323502_1063_1353 95
18 3300046536 Ga0495587_0422177 Ga0495587_0422177_163_453 95
19 3300053084 Ga0495595_0011676 Ga0495595_0011676_1194_1484 95
20 3300053085 Ga0495619_0114009 Ga0495619_0114009_1207_1497 95
21 3300003203 JGI25406J46586_10032704 JGI25406J46586_100327043 96
22 3300005336 Ga0070680_100330323 Ga0070680_1003303233 96
23 3300005434 Ga0070709_10012395 Ga0070709_100123954 96
24 3300005435 Ga0070714_100134390 Ga0070714_1001343903 96
25 3300005436 Ga0070713_100091102 Ga0070713_1000911024 96
26 3300005437 Ga0070710_10003513 Ga0070710_100035134 96
27 3300005439 Ga0070711_100115183 Ga0070711_1001151832 96
28 3300005440 Ga0070705_101625178 Ga0070705_1016251782 96
29 3300005471 Ga0070698_100398161 Ga0070698_1003981612 96
30 3300005546 Ga0070696_100196720 Ga0070696_1001967201 96
31 3300005547 Ga0070693_101248257 Ga0070693_1012482571 96
32 3300005983 Ga0081540_1004712 Ga0081540_10047123 96
33 3300005985 Ga0081539_10100755 Ga0081539_101007553 96
34 3300006028 Ga0070717_10067963 Ga0070717_100679633 96
35 3300006163 Ga0070715_10153230 Ga0070715_101532302 96
36 3300006173 Ga0070716_100143239 Ga0070716_1001432393 96
37 3300006175 Ga0070712_100427741 Ga0070712_1004277412 96
38 3300006175 Ga0070712_100427742 Ga0070712_1004277422 96
39 3300006844 Ga0075428_100899534 Ga0075428_1008995342 96
40 3300006847 Ga0075431_100295956 Ga0075431_1002959563 96
41 3300009147 Ga0114129_11443151 Ga0114129_114431512 96
42 3300010375 Ga0105239_10809693 Ga0105239_108096932 96
43 3300025898 Ga0207692_10003778 Ga0207692_100037786 96
44 3300025905 Ga0207685_10008345 Ga0207685_100083453 96
45 3300025906 Ga0207699_10061169 Ga0207699_100611693 96
46 3300025915 Ga0207693_11000737 Ga0207693_110007371 96
47 3300025915 Ga0207693_11000738 Ga0207693_110007381 96
48 3300025916 Ga0207663_10025626 Ga0207663_100256266 96
49 3300025928 Ga0207700_10000810 Ga0207700_1000081010 96
50 3300025929 Ga0207664_10101779 Ga0207664_101017793 96
51 3300025939 Ga0207665_10050011 Ga0207665_100500113 96
52 3300041512 Ga0451853_3961871 Ga0451853_3961871_120_413 96
53 3300046460 Ga0495638_0122194 Ga0495638_0122194_831_1127 96
54 3300048903 Ga0496100_0132875 Ga0496100_0132875_510_803 96
55 3300048903 Ga0496100_0633087 Ga0496100_0633087_285_578 96
56 3300048905 Ga0496102_0309024 Ga0496102_0309024_1084_1377 96
57 3300048907 Ga0496104_1294436 Ga0496104_1294436_15_308 96
58 3300048910 Ga0496107_0194003 Ga0496107_0194003_187_480 96
59 3300048913 Ga0496110_0350461 Ga0496110_0350461_75_368 96
60 3300048915 Ga0496112_0767287 Ga0496112_0767287_417_710 96
61 3300048917 Ga0496114_1526650 Ga0496114_1526650_116_409 96
62 3300050510 nmdc:mga06r32_687334_c1 nmdc:mga06r32_687334_c1_190_483 96
63 3300050513 nmdc:mga0rr50_167156_c1 nmdc:mga0rr50_167156_c1_1060_1353 96
64 3300050513 nmdc:mga0rr50_906756_c1 nmdc:mga0rr50_906756_c1_253_546 96
65 3300050515 nmdc:mga0a205_394761_c1 nmdc:mga0a205_394761_c1_473_766 96
66 3300053090 Ga0500646_0142524 Ga0500646_0142524_162_458 96
67 3300053096 Ga0500641_0093896 Ga0500641_0093896_74_370 96
68 3300053142 Ga0500577_0009850 Ga0500577_0009850_330_626 96
69 3300060353 Ga0501082_0394239 Ga0501082_0394239_92_385 96
70 3300005290 Ga0065712_10145316 Ga0065712_101453163 97
71 3300005331 Ga0070670_100175861 Ga0070670_1001758612 97
72 3300005337 Ga0070682_100099045 Ga0070682_1000990453 97
73 3300005340 Ga0070689_102043790 Ga0070689_1020437901 97
74 3300005364 Ga0070673_100793553 Ga0070673_1007935532 97
75 3300005365 Ga0070688_100916269 Ga0070688_1009162692 97
76 3300005458 Ga0070681_10775270 Ga0070681_107752702 97
77 3300005547 Ga0070693_100250330 Ga0070693_1002503303 97
78 3300005563 Ga0068855_100839480 Ga0068855_1008394802 97
79 3300005614 Ga0068856_100983673 Ga0068856_1009836732 97
80 3300005617 Ga0068859_100765446 Ga0068859_1007654462 97
81 3300005618 Ga0068864_100098570 Ga0068864_1000985703 97
82 3300006178 Ga0075367_10375489 Ga0075367_103754892 97
83 3300006353 Ga0075370_10353317 Ga0075370_103533172 97
84 3300006871 Ga0075434_100667880 Ga0075434_1006678802 97
85 3300006931 Ga0097620_100765560 Ga0097620_1007655602 97
86 3300009147 Ga0114129_10342275 Ga0114129_103422751 97
87 3300009174 Ga0105241_10278766 Ga0105241_102787661 97
88 3300009174 Ga0105241_11450245 Ga0105241_114502451 97
89 3300009551 Ga0105238_10798675 Ga0105238_107986751 97
90 3300013296 Ga0157374_11289228 Ga0157374_112892282 97
91 3300014326 Ga0157380_11574056 Ga0157380_115740562 97
92 3300014968 Ga0157379_11186537 Ga0157379_111865372 97
93 3300025925 Ga0207650_10419749 Ga0207650_104197492 97
94 3300025936 Ga0207670_10357773 Ga0207670_103577732 97
95 3300025936 Ga0207670_10829918 Ga0207670_108299181 97
96 3300025941 Ga0207711_10228324 Ga0207711_102283242 97
97 3300025942 Ga0207689_10736705 Ga0207689_107367052 97
98 3300025945 Ga0207679_10375903 Ga0207679_103759032 97
99 3300026023 Ga0207677_10390662 Ga0207677_103906622 97
100 3300026035 Ga0207703_10769509 Ga0207703_107695092 97
101 3300026078 Ga0207702_10277286 Ga0207702_102772862 97
102 3300026095 Ga0207676_10193818 Ga0207676_101938182 97
103 3300031911 Ga0307412_10765917 Ga0307412_107659172 97
104 3300035085 Ga0373929_0130608 Ga0373929_0130608_354_647 97
105 3300037471 Ga0395905_0581148 Ga0395905_0581148_466_762 97
106 3300048907 Ga0496104_0091092 Ga0496104_0091092_918_1211 97
107 3300048908 Ga0496105_0346833 Ga0496105_0346833_405_698 97
108 3300048909 Ga0496106_0452430 Ga0496106_0452430_630_923 97
109 3300048910 Ga0496107_0612130 Ga0496107_0612130_111_404 97
110 3300048911 Ga0496108_0008170 Ga0496108_0008170_1333_1626 97
111 3300048912 Ga0496109_0033534 Ga0496109_0033534_2768_3061 97
112 3300048913 Ga0496110_0088224 Ga0496110_0088224_1969_2262 97
113 3300048914 Ga0496111_0023319 Ga0496111_0023319_2369_2662 97
114 3300048915 Ga0496112_0008258 Ga0496112_0008258_3099_3392 97
115 3300048916 Ga0496113_0012142 Ga0496113_0012142_4188_4481 97
116 3300048918 Ga0496115_0984418 Ga0496115_0984418_54_347 97
117 3300049571 Ga0501034_0087583 Ga0501034_0087583_1328_1624 97
118 3300049573 Ga0501037_0489821 Ga0501037_0489821_134_430 97
119 3300049579 Ga0501043_0187091 Ga0501043_0187091_358_654 97
120 3300049579 Ga0501043_1044290 Ga0501043_1044290_82_402 97
121 3300049581 Ga0501047_0158202 Ga0501047_0158202_83_379 97
122 3300049581 Ga0501047_0537551 Ga0501047_0537551_290_610 97
123 3300049583 Ga0501067_0193544 Ga0501067_0193544_686_1006 97
124 3300049585 Ga0501069_0034940 Ga0501069_0034940_819_1115 97
125 3300049586 Ga0501070_0087049 Ga0501070_0087049_317_613 97
126 3300049586 Ga0501070_0228354 Ga0501070_0228354_1050_1370 97
127 3300049587 Ga0501071_0244708 Ga0501071_0244708_467_787 97
128 3300049588 Ga0501072_0633404 Ga0501072_0633404_214_534 97
129 3300049589 Ga0501073_0070644 Ga0501073_0070644_524_844 97
130 3300049589 Ga0501073_0331045 Ga0501073_0331045_638_934 97
131 3300049590 Ga0501074_0566329 Ga0501074_0566329_190_486 97
132 3300049741 Ga0501079_0309137 Ga0501079_0309137_103_399 97
133 3300049742 Ga0501080_0769613 Ga0501080_0769613_465_812 97
134 3300049742 Ga0501080_1092781 Ga0501080_1092781_357_653 97
135 3300049744 Ga0501083_0638958 Ga0501083_0638958_197_517 97
136 3300049822 Ga0501035_0003762 Ga0501035_0003762_6701_7000 97
137 3300049823 Ga0501044_0100974 Ga0501044_0100974_200_496 97
138 3300049823 Ga0501044_0232536 Ga0501044_0232536_482_802 97
139 3300050496 nmdc:mga07m45_323256_c1 nmdc:mga07m45_323256_c1_170_463 97
140 3300050512 nmdc:mga0n895_633841_c1 nmdc:mga0n895_633841_c1_304_597 97
141 3300001976 JGI24752J21851_1011378 JGI24752J21851_10113782 98
142 3300001978 JGI24747J21853_1009515 JGI24747J21853_10095152 98
143 3300001989 JGI24739J22299_10062937 JGI24739J22299_100629372 98
144 3300001990 JGI24737J22298_10000053 JGI24737J22298_100000532 98
145 3300001991 JGI24743J22301_10039413 JGI24743J22301_100394132 98
146 3300002070 JGI24750J21931_1005416 JGI24750J21931_10054163 98
147 3300002073 JGI24745J21846_1014742 JGI24745J21846_10147422 98
148 3300002075 JGI24738J21930_10023527 JGI24738J21930_100235272 98
149 3300002077 JGI24744J21845_10031963 JGI24744J21845_100319632 98
150 3300002126 JGI24035J26624_1009285 JGI24035J26624_10092852 98
151 3300002155 JGI24033J26618_1018880 JGI24033J26618_10188802 98
152 3300002244 JGI24742J22300_10000381 JGI24742J22300_100003812 98
153 3300005290 Ga0065712_10147284 Ga0065712_101472842 98
154 3300005293 Ga0065715_10135200 Ga0065715_101352002 98
155 3300005328 Ga0070676_10000302 Ga0070676_1000030224 98
156 3300005329 Ga0070683_100003623 Ga0070683_1000036234 98
157 3300005330 Ga0070690_100000253 Ga0070690_10000025323 98
158 3300005331 Ga0070670_100011774 Ga0070670_1000117744 98
159 3300005333 Ga0070677_10000104 Ga0070677_1000010429 98
160 3300005334 Ga0068869_100006200 Ga0068869_1000062003 98
161 3300005335 Ga0070666_10013625 Ga0070666_100136255 98
162 3300005336 Ga0070680_100016970 Ga0070680_1000169703 98
163 3300005336 Ga0070680_101901512 Ga0070680_1019015121 98
164 3300005337 Ga0070682_100000287 Ga0070682_10000028726 98
165 3300005338 Ga0068868_100001298 Ga0068868_1000012986 98
166 3300005339 Ga0070660_100002362 Ga0070660_1000023622 98
167 3300005340 Ga0070689_100000422 Ga0070689_10000042226 98
168 3300005341 Ga0070691_10004265 Ga0070691_100042655 98
169 3300005343 Ga0070687_100002601 Ga0070687_1000026013 98
170 3300005344 Ga0070661_100000017 Ga0070661_100000017129 98
171 3300005345 Ga0070692_10000546 Ga0070692_100005462 98
172 3300005347 Ga0070668_100000656 Ga0070668_10000065624 98
173 3300005353 Ga0070669_100000314 Ga0070669_1000003143 98
174 3300005354 Ga0070675_100000161 Ga0070675_1000001613 98
175 3300005355 Ga0070671_100000313 Ga0070671_1000003132 98
176 3300005356 Ga0070674_100016562 Ga0070674_1000165623 98
177 3300005364 Ga0070673_100000272 Ga0070673_1000002723 98
178 3300005365 Ga0070688_100000306 Ga0070688_10000030626 98
179 3300005366 Ga0070659_100000252 Ga0070659_10000025235 98
180 3300005367 Ga0070667_100014243 Ga0070667_1000142432 98
181 3300005406 Ga0070703_10013349 Ga0070703_100133493 98
182 3300005438 Ga0070701_10000123 Ga0070701_100001236 98
183 3300005440 Ga0070705_100001543 Ga0070705_1000015431 98
184 3300005440 Ga0070705_101020381 Ga0070705_1010203811 98
185 3300005441 Ga0070700_100031644 Ga0070700_1000316443 98
186 3300005444 Ga0070694_100009283 Ga0070694_1000092833 98
187 3300005445 Ga0070708_100185231 Ga0070708_1001852313 98
188 3300005455 Ga0070663_100007039 Ga0070663_1000070396 98
189 3300005456 Ga0070678_100156678 Ga0070678_1001566782 98
190 3300005457 Ga0070662_100013472 Ga0070662_1000134725 98
191 3300005458 Ga0070681_10003031 Ga0070681_1000303118 98
192 3300005458 Ga0070681_11211421 Ga0070681_112114212 98
193 3300005459 Ga0068867_100004059 Ga0068867_1000040599 98
194 3300005466 Ga0070685_10000704 Ga0070685_1000070419 98
195 3300005468 Ga0070707_100742272 Ga0070707_1007422722 98
196 3300005530 Ga0070679_100022432 Ga0070679_1000224324 98
197 3300005535 Ga0070684_100018176 Ga0070684_1000181762 98
198 3300005539 Ga0068853_100160374 Ga0068853_1001603742 98
199 3300005543 Ga0070672_100000014 Ga0070672_10000001415 98
200 3300005544 Ga0070686_100000455 Ga0070686_10000045526 98
201 3300005545 Ga0070695_100001270 Ga0070695_1000012703 98
202 3300005546 Ga0070696_100014212 Ga0070696_1000142124 98
203 3300005546 Ga0070696_100058136 Ga0070696_1000581363 98
204 3300005547 Ga0070693_100000141 Ga0070693_10000014140 98
205 3300005548 Ga0070665_101486425 Ga0070665_1014864252 98
206 3300005549 Ga0070704_100000197 Ga0070704_1000001973 98
207 3300005563 Ga0068855_100002843 Ga0068855_1000028435 98
208 3300005564 Ga0070664_100000770 Ga0070664_1000007707 98
209 3300005577 Ga0068857_100000567 Ga0068857_1000005673 98
210 3300005578 Ga0068854_100000674 Ga0068854_10000067417 98
211 3300005614 Ga0068856_100006891 Ga0068856_1000068917 98
212 3300005615 Ga0070702_100000130 Ga0070702_1000001303 98
213 3300005615 Ga0070702_100565483 Ga0070702_1005654832 98
214 3300005616 Ga0068852_100008916 Ga0068852_1000089166 98
215 3300005617 Ga0068859_100001568 Ga0068859_10000156824 98
216 3300005618 Ga0068864_100001514 Ga0068864_10000151421 98
217 3300005718 Ga0068866_10000615 Ga0068866_1000061517 98
218 3300005719 Ga0068861_100000319 Ga0068861_10000031915 98
219 3300005834 Ga0068851_11019645 Ga0068851_110196452 98
220 3300005840 Ga0068870_10000002 Ga0068870_1000000289 98
221 3300005841 Ga0068863_100000703 Ga0068863_10000070336 98
222 3300005842 Ga0068858_100003033 Ga0068858_1000030333 98
223 3300005843 Ga0068860_100001895 Ga0068860_1000018954 98
224 3300005844 Ga0068862_100013279 Ga0068862_1000132793 98
225 3300006178 Ga0075367_10123200 Ga0075367_101232003 98
226 3300006237 Ga0097621_100000473 Ga0097621_1000004733 98
227 3300006358 Ga0068871_100000118 Ga0068871_10000011861 98
228 3300006852 Ga0075433_10010666 Ga0075433_100106666 98
229 3300006871 Ga0075434_100001964 Ga0075434_1000019642 98
230 3300006881 Ga0068865_100006203 Ga0068865_1000062035 98
231 3300006931 Ga0097620_100001568 Ga0097620_10000156824 98
232 3300007076 Ga0075435_100020961 Ga0075435_1000209613 98
233 3300017792 Ga0163161_10005398 Ga0163161_100053983 98
234 3300025271 Ga0207666_1000120 Ga0207666_100012015 98
235 3300025290 Ga0207673_1002080 Ga0207673_10020801 98
236 3300025315 Ga0207697_10000061 Ga0207697_1000006115 98
237 3300025893 Ga0207682_10000332 Ga0207682_1000033220 98
238 3300025899 Ga0207642_10000520 Ga0207642_100005205 98
239 3300025900 Ga0207710_10004780 Ga0207710_100047805 98
240 3300025901 Ga0207688_10000001 Ga0207688_1000000172 98
241 3300025903 Ga0207680_10016478 Ga0207680_100164786 98
242 3300025904 Ga0207647_10083515 Ga0207647_100835153 98
243 3300025907 Ga0207645_10000222 Ga0207645_100002225 98
244 3300025908 Ga0207643_10000009 Ga0207643_1000000965 98
245 3300025911 Ga0207654_10008610 Ga0207654_100086105 98
246 3300025912 Ga0207707_10001855 Ga0207707_100018556 98
247 3300025913 Ga0207695_10221647 Ga0207695_102216473 98
248 3300025914 Ga0207671_10024205 Ga0207671_100242055 98
249 3300025917 Ga0207660_10001147 Ga0207660_100011478 98
250 3300025917 Ga0207660_11443093 Ga0207660_114430931 98
251 3300025918 Ga0207662_10000616 Ga0207662_100006163 98
252 3300025919 Ga0207657_10000776 Ga0207657_100007763 98
253 3300025920 Ga0207649_10000052 Ga0207649_1000005265 98
254 3300025921 Ga0207652_10001328 Ga0207652_100013285 98
255 3300025923 Ga0207681_10000035 Ga0207681_10000035142 98
256 3300025925 Ga0207650_10001385 Ga0207650_100013853 98
257 3300025926 Ga0207659_10000132 Ga0207659_1000013249 98
258 3300025927 Ga0207687_10000174 Ga0207687_1000017448 98
259 3300025931 Ga0207644_10002247 Ga0207644_100022472 98
260 3300025932 Ga0207690_10000148 Ga0207690_1000014829 98
261 3300025933 Ga0207706_10018668 Ga0207706_100186685 98
262 3300025934 Ga0207686_10009703 Ga0207686_100097038 98
263 3300025935 Ga0207709_10000087 Ga0207709_10000087145 98
264 3300025936 Ga0207670_10000528 Ga0207670_100005283 98
265 3300025937 Ga0207669_10000589 Ga0207669_100005895 98
266 3300025938 Ga0207704_10000392 Ga0207704_100003923 98
267 3300025940 Ga0207691_10000517 Ga0207691_1000051739 98
268 3300025942 Ga0207689_10000031 Ga0207689_1000003151 98
269 3300025944 Ga0207661_10007383 Ga0207661_100073834 98
270 3300025945 Ga0207679_10000493 Ga0207679_1000049335 98
271 3300025949 Ga0207667_10017867 Ga0207667_100178675 98
272 3300025960 Ga0207651_10000051 Ga0207651_1000005166 98
273 3300025961 Ga0207712_10000176 Ga0207712_1000017663 98
274 3300025972 Ga0207668_10000355 Ga0207668_1000035522 98
275 3300025981 Ga0207640_10000126 Ga0207640_1000012653 98
276 3300025986 Ga0207658_10002400 Ga0207658_1000240016 98
277 3300026023 Ga0207677_10066304 Ga0207677_100663043 98
278 3300026035 Ga0207703_10001969 Ga0207703_100019697 98
279 3300026041 Ga0207639_10144388 Ga0207639_101443884 98
280 3300026067 Ga0207678_10000531 Ga0207678_1000053135 98
281 3300026075 Ga0207708_10000573 Ga0207708_1000057330 98
282 3300026078 Ga0207702_10010346 Ga0207702_100103466 98
283 3300026088 Ga0207641_10001041 Ga0207641_1000104129 98
284 3300026089 Ga0207648_10000581 Ga0207648_100005813 98
285 3300026095 Ga0207676_10000124 Ga0207676_1000012417 98
286 3300026116 Ga0207674_10000095 Ga0207674_1000009535 98
287 3300026118 Ga0207675_100000414 Ga0207675_1000004143 98
288 3300026121 Ga0207683_10000242 Ga0207683_1000024260 98
289 3300026142 Ga0207698_10003848 Ga0207698_100038484 98
290 3300027717 Ga0209998_10214982 Ga0209998_102149822 98
291 3300027876 Ga0209974_10011505 Ga0209974_100115051 98
292 3300027876 Ga0209974_10167187 Ga0209974_101671871 98
293 3300027907 Ga0207428_10000037 Ga0207428_10000037166 98
294 3300028379 Ga0268266_10025994 Ga0268266_100259942 98
295 3300028380 Ga0268265_10000757 Ga0268265_1000075729 98
296 3300034817 Ga0373948_0021532 Ga0373948_0021532_277_573 98
297 3300034818 Ga0373950_0009479 Ga0373950_0009479_79_375 98
298 3300034820 Ga0373959_0005726 Ga0373959_0005726_879_1175 98
299 3300034957 Ga0373938_0002758 Ga0373938_0002758_1616_1912 98
300 3300035084 Ga0373928_0008944 Ga0373928_0008944_1393_1689 98
301 3300035085 Ga0373929_0063482 Ga0373929_0063482_324_620 98
302 3300035090 Ga0373949_0002294 Ga0373949_0002294_2303_2599 98
303 3300035091 Ga0373951_0009985 Ga0373951_0009985_766_1062 98
304 3300035092 Ga0373952_0001876 Ga0373952_0001876_2155_2451 98
305 3300035112 Ga0373932_0004711 Ga0373932_0004711_1859_2155 98
306 3300035114 Ga0373939_0000125 Ga0373939_0000125_12752_13048 98
307 3300035115 Ga0373941_0068623 Ga0373941_0068623_83_379 98
308 3300035121 Ga0373960_0000232 Ga0373960_0000232_8856_9152 98
309 3300035207 Ga0373942_0061067 Ga0373942_0061067_53_349 98
310 3300035241 Ga0373961_0006457 Ga0373961_0006457_787_1083 98
311 3300035691 Ga0373931_0000124 Ga0373931_0000124_14869_15165 98
312 3300037466 Ga0395898_0454639 Ga0395898_0454639_315_614 98
313 3300038443 Ga0395901_0405060 Ga0395901_0405060_503_802 98
314 3300039437 Ga0436365_0459934 Ga0436365_0459934_425_727 98
315 3300042008 Ga0439450_028188 Ga0439450_028188_373_723 98
316 3300042012 Ga0439455_0193515 Ga0439455_0193515_55_351 98
317 3300042116 Ga0450912_010614 Ga0450912_010614_245_550 98
318 3300042439 Ga0439464_0004464 Ga0439464_0004464_639_935 98
319 3300042461 Ga0439460_0064879 Ga0439460_0064879_604_900 98
320 3300045976 Ga0466967_0291786 Ga0466967_0291786_195_494 98
321 3300046520 Ga0495637_0058619 Ga0495637_0058619_1070_1366 98
322 3300046538 Ga0495609_0091173 Ga0495609_0091173_445_741 98
323 3300046684 Ga0495669_0342649 Ga0495669_0342649_27_323 98
324 3300048903 Ga0496100_0029405 Ga0496100_0029405_1379_1675 98
325 3300048904 Ga0496101_0000151 Ga0496101_0000151_18929_19225 98
326 3300048905 Ga0496102_0029340 Ga0496102_0029340_1254_1550 98
327 3300048906 Ga0496103_0168087 Ga0496103_0168087_489_785 98
328 3300048907 Ga0496104_0117274 Ga0496104_0117274_1956_2252 98
329 3300048909 Ga0496106_0283421 Ga0496106_0283421_543_839 98
330 3300048910 Ga0496107_0000118 Ga0496107_0000118_23929_24225 98
331 3300048911 Ga0496108_0004875 Ga0496108_0004875_3380_3676 98
332 3300048912 Ga0496109_0001567 Ga0496109_0001567_17127_17423 98
333 3300048913 Ga0496110_0206078 Ga0496110_0206078_925_1221 98
334 3300048915 Ga0496112_0202841 Ga0496112_0202841_739_1035 98
335 3300048917 Ga0496114_0341737 Ga0496114_0341737_1009_1305 98
336 3300048918 Ga0496115_0063810 Ga0496115_0063810_1168_1464 98
337 3300049574 Ga0501038_0593306 Ga0501038_0593306_214_510 98
338 3300049576 Ga0501040_0149884 Ga0501040_0149884_985_1290 98
339 3300049577 Ga0501041_0089606 Ga0501041_0089606_443_748 98
340 3300049586 Ga0501070_0592745 Ga0501070_0592745_274_570 98
341 3300049589 Ga0501073_0211640 Ga0501073_0211640_396_695 98
342 3300049589 Ga0501073_0905649 Ga0501073_0905649_53_349 98
343 3300049590 Ga0501074_0131812 Ga0501074_0131812_899_1204 98
344 3300049590 Ga0501074_0480881 Ga0501074_0480881_191_487 98
345 3300049591 Ga0501075_0002913 Ga0501075_0002913_1700_2005 98
346 3300049592 Ga0501076_0020221 Ga0501076_0020221_4579_4884 98
347 3300049592 Ga0501076_0676523 Ga0501076_0676523_367_663 98
348 3300049593 Ga0501077_0014314 Ga0501077_0014314_3684_3989 98
349 3300049593 Ga0501077_0054700 Ga0501077_0054700_1330_1626 98
350 3300049741 Ga0501079_0022226 Ga0501079_0022226_1693_1998 98
351 3300049742 Ga0501080_0180173 Ga0501080_0180173_1317_1613 98
352 3300049743 Ga0501081_0000595 Ga0501081_0000595_13930_14235 98
353 3300049743 Ga0501081_0110220 Ga0501081_0110220_576_881 98
354 3300049744 Ga0501083_0604780 Ga0501083_0604780_228_533 98
355 3300049744 Ga0501083_0692158 Ga0501083_0692158_292_642 98
356 3300050494 nmdc:mga06z11_53984_c1 nmdc:mga06z11_53984_c1_501_797 98
357 3300050511 nmdc:mga08y16_243413_c1 nmdc:mga08y16_243413_c1_251_550 98
358 3300050511 nmdc:mga08y16_333_c1 nmdc:mga08y16_333_c1_41252_41548 98
359 3300050511 nmdc:mga08y16_90680_c1 nmdc:mga08y16_90680_c1_784_1083 98
360 3300050512 nmdc:mga0n895_62_c1 nmdc:mga0n895_62_c1_23318_23614 98
361 3300050513 nmdc:mga0rr50_14190_c1 nmdc:mga0rr50_14190_c1_3834_4130 98
362 3300050515 nmdc:mga0a205_7202_c1 nmdc:mga0a205_7202_c1_5214_5510 98
363 3300054114 Ga0501084_0323640 Ga0501084_0323640_472_777 98
364 3300060353 Ga0501082_0003176 Ga0501082_0003176_2865_3170 98
365 3300060353 Ga0501082_0168092 Ga0501082_0168092_614_964 98
366 3300061734 Ga0530510_0501479 Ga0530510_0501479_160_465 98
367 3300061734 Ga0530510_0624427 Ga0530510_0624427_64_414 98
368 2209111006 2214884076 2213936925 99
369 3300000041 ARcpr5oldR_c004176 ARcpr5oldR_0041762 99
370 3300000043 ARcpr5yngRDRAFT_c007081 ARcpr5yngRDRAFT_0070812 99
371 3300000044 ARSoilOldRDRAFT_c000083 ARSoilOldRDRAFT_0000836 99
372 3300000652 ARCol0yngRDRAFT_1000103 ARCol0yngRDRAFT_100010316 99
373 3300003347 JGI26128J50194_1010721 JGI26128J50194_10107211 99
374 3300005277 Ga0065716_1003653 Ga0065716_10036532 99
375 3300005289 Ga0065704_10270380 Ga0065704_102703801 99
376 3300005290 Ga0065712_10009636 Ga0065712_100096364 99
377 3300005295 Ga0065707_10265024 Ga0065707_102650242 99
378 3300005295 Ga0065707_10283437 Ga0065707_102834372 99
379 3300005329 Ga0070683_100157295 Ga0070683_1001572954 99
380 3300005329 Ga0070683_100192210 Ga0070683_1001922102 99
381 3300005330 Ga0070690_100013798 Ga0070690_1000137984 99
382 3300005334 Ga0068869_100816155 Ga0068869_1008161552 99
383 3300005335 Ga0070666_10014594 Ga0070666_100145942 99
384 3300005336 Ga0070680_100600546 Ga0070680_1006005462 99
385 3300005337 Ga0070682_100096987 Ga0070682_1000969872 99
386 3300005337 Ga0070682_100167020 Ga0070682_1001670202 99
387 3300005337 Ga0070682_101715437 Ga0070682_1017154372 99
388 3300005338 Ga0068868_100198953 Ga0068868_1001989534 99
389 3300005339 Ga0070660_100487633 Ga0070660_1004876332 99
390 3300005339 Ga0070660_101335421 Ga0070660_1013354212 99
391 3300005340 Ga0070689_100096627 Ga0070689_1000966273 99
392 3300005341 Ga0070691_10093428 Ga0070691_100934284 99
393 3300005341 Ga0070691_10742950 Ga0070691_107429502 99
394 3300005343 Ga0070687_100557641 Ga0070687_1005576412 99
395 3300005344 Ga0070661_100315576 Ga0070661_1003155762 99
396 3300005344 Ga0070661_101504479 Ga0070661_1015044791 99
397 3300005345 Ga0070692_10179740 Ga0070692_101797402 99
398 3300005347 Ga0070668_100025762 Ga0070668_1000257625 99
399 3300005347 Ga0070668_100115939 Ga0070668_1001159394 99
400 3300005353 Ga0070669_100029627 Ga0070669_1000296272 99
401 3300005354 Ga0070675_100170284 Ga0070675_1001702842 99
402 3300005354 Ga0070675_100606411 Ga0070675_1006064112 99
403 3300005355 Ga0070671_100026052 Ga0070671_1000260525 99
404 3300005364 Ga0070673_100238299 Ga0070673_1002382993 99
405 3300005364 Ga0070673_100426570 Ga0070673_1004265703 99
406 3300005365 Ga0070688_100007962 Ga0070688_1000079626 99
407 3300005365 Ga0070688_100045570 Ga0070688_1000455704 99
408 3300005365 Ga0070688_100952739 Ga0070688_1009527392 99
409 3300005367 Ga0070667_100025494 Ga0070667_1000254944 99
410 3300005367 Ga0070667_100068007 Ga0070667_1000680075 99
411 3300005367 Ga0070667_100284498 Ga0070667_1002844983 99
412 3300005406 Ga0070703_10146970 Ga0070703_101469702 99
413 3300005434 Ga0070709_10004420 Ga0070709_100044208 99
414 3300005434 Ga0070709_10027064 Ga0070709_100270644 99
415 3300005434 Ga0070709_11377716 Ga0070709_113777162 99
416 3300005436 Ga0070713_100021553 Ga0070713_1000215533 99
417 3300005436 Ga0070713_100025039 Ga0070713_1000250393 99
418 3300005437 Ga0070710_10095668 Ga0070710_100956684 99
419 3300005439 Ga0070711_100022505 Ga0070711_1000225054 99
420 3300005439 Ga0070711_101496320 Ga0070711_1014963202 99
421 3300005441 Ga0070700_100015468 Ga0070700_1000154683 99
422 3300005441 Ga0070700_100112627 Ga0070700_1001126274 99
423 3300005441 Ga0070700_100583680 Ga0070700_1005836802 99
424 3300005444 Ga0070694_100056993 Ga0070694_1000569932 99
425 3300005444 Ga0070694_100311579 Ga0070694_1003115792 99
426 3300005455 Ga0070663_100039920 Ga0070663_1000399204 99
427 3300005455 Ga0070663_100145644 Ga0070663_1001456443 99
428 3300005456 Ga0070678_100122510 Ga0070678_1001225102 99
429 3300005457 Ga0070662_100312407 Ga0070662_1003124073 99
430 3300005457 Ga0070662_100357045 Ga0070662_1003570452 99
431 3300005458 Ga0070681_10228861 Ga0070681_102288612 99
432 3300005458 Ga0070681_10379344 Ga0070681_103793442 99
433 3300005458 Ga0070681_10784253 Ga0070681_107842532 99
434 3300005459 Ga0068867_100405774 Ga0068867_1004057742 99
435 3300005459 Ga0068867_100715339 Ga0068867_1007153392 99
436 3300005466 Ga0070685_10047414 Ga0070685_100474143 99
437 3300005466 Ga0070685_10102184 Ga0070685_101021842 99
438 3300005530 Ga0070679_100053555 Ga0070679_1000535554 99
439 3300005530 Ga0070679_100098218 Ga0070679_1000982182 99
440 3300005535 Ga0070684_101303506 Ga0070684_1013035062 99
441 3300005535 Ga0070684_101669876 Ga0070684_1016698762 99
442 3300005539 Ga0068853_100247118 Ga0068853_1002471182 99
443 3300005539 Ga0068853_100464466 Ga0068853_1004644662 99
444 3300005544 Ga0070686_101497410 Ga0070686_1014974102 99
445 3300005545 Ga0070695_100725907 Ga0070695_1007259072 99
446 3300005546 Ga0070696_100036591 Ga0070696_1000365913 99
447 3300005546 Ga0070696_100083960 Ga0070696_1000839604 99
448 3300005547 Ga0070693_100051130 Ga0070693_1000511303 99
449 3300005548 Ga0070665_100241125 Ga0070665_1002411254 99
450 3300005548 Ga0070665_100904035 Ga0070665_1009040352 99
451 3300005548 Ga0070665_101626410 Ga0070665_1016264101 99
452 3300005549 Ga0070704_100148429 Ga0070704_1001484293 99
453 3300005564 Ga0070664_100105582 Ga0070664_1001055824 99
454 3300005578 Ga0068854_100622947 Ga0068854_1006229472 99
455 3300005615 Ga0070702_100105240 Ga0070702_1001052403 99
456 3300005617 Ga0068859_100137068 Ga0068859_1001370683 99
457 3300005617 Ga0068859_100640124 Ga0068859_1006401243 99
458 3300005618 Ga0068864_100028524 Ga0068864_1000285245 99
459 3300005841 Ga0068863_100245600 Ga0068863_1002456002 99
460 3300005842 Ga0068858_100202482 Ga0068858_1002024823 99
461 3300005842 Ga0068858_100227051 Ga0068858_1002270511 99
462 3300005843 Ga0068860_100130966 Ga0068860_1001309662 99
463 3300005843 Ga0068860_100339139 Ga0068860_1003391393 99
464 3300005844 Ga0068862_100468954 Ga0068862_1004689541 99
465 3300005844 Ga0068862_100786075 Ga0068862_1007860752 99
466 3300005937 Ga0081455_10000048 Ga0081455_1000004896 99
467 3300006028 Ga0070717_10000873 Ga0070717_1000087322 99
468 3300006028 Ga0070717_10701093 Ga0070717_107010931 99
469 3300006038 Ga0075365_11279947 Ga0075365_112799472 99
470 3300006058 Ga0075432_10196881 Ga0075432_101968812 99
471 3300006163 Ga0070715_10734516 Ga0070715_107345162 99
472 3300006173 Ga0070716_100002585 Ga0070716_1000025856 99
473 3300006175 Ga0070712_100176827 Ga0070712_1001768273 99
474 3300006175 Ga0070712_100302649 Ga0070712_1003026492 99
475 3300006237 Ga0097621_100008980 Ga0097621_1000089806 99
476 3300006353 Ga0075370_11028316 Ga0075370_110283161 99
477 3300006358 Ga0068871_100420430 Ga0068871_1004204303 99
478 3300006844 Ga0075428_100354674 Ga0075428_1003546743 99
479 3300006852 Ga0075433_10548803 Ga0075433_105488032 99
480 3300006852 Ga0075433_10567783 Ga0075433_105677832 99
481 3300006871 Ga0075434_100021155 Ga0075434_1000211554 99
482 3300006871 Ga0075434_100042779 Ga0075434_1000427795 99
483 3300006871 Ga0075434_100677953 Ga0075434_1006779532 99
484 3300006871 Ga0075434_100918790 Ga0075434_1009187902 99
485 3300006881 Ga0068865_100728940 Ga0068865_1007289402 99
486 3300006914 Ga0075436_100213877 Ga0075436_1002138772 99
487 3300006914 Ga0075436_100350152 Ga0075436_1003501522 99
488 3300006914 Ga0075436_100547022 Ga0075436_1005470222 99
489 3300006931 Ga0097620_100137077 Ga0097620_1001370773 99
490 3300006931 Ga0097620_100640126 Ga0097620_1006401262 99
491 3300007076 Ga0075435_100207547 Ga0075435_1002075474 99
492 3300007076 Ga0075435_100210657 Ga0075435_1002106571 99
493 3300007076 Ga0075435_100692254 Ga0075435_1006922542 99
494 3300007076 Ga0075435_101135663 Ga0075435_1011356632 99
495 3300009101 Ga0105247_10844701 Ga0105247_108447012 99
496 3300009101 Ga0105247_11030374 Ga0105247_110303742 99
497 3300009147 Ga0114129_10025668 Ga0114129_100256687 99
498 3300009148 Ga0105243_10091515 Ga0105243_100915153 99
499 3300009148 Ga0105243_11528744 Ga0105243_115287442 99
500 3300009174 Ga0105241_12060674 Ga0105241_120606742 99
501 3300009176 Ga0105242_11402813 Ga0105242_114028132 99
502 3300009545 Ga0105237_11592476 Ga0105237_115924762 99
503 3300009551 Ga0105238_12730515 Ga0105238_127305151 99
504 3300009553 Ga0105249_11611934 Ga0105249_116119342 99
505 3300010375 Ga0105239_11463087 Ga0105239_114630872 99
506 3300011119 Ga0105246_10720845 Ga0105246_107208451 99
507 3300012478 Ga0157328_1001223 Ga0157328_10012233 99
508 3300012481 Ga0157320_1011245 Ga0157320_10112452 99
509 3300012497 Ga0157319_1032852 Ga0157319_10328522 99
510 3300012507 Ga0157342_1014627 Ga0157342_10146272 99
511 3300013100 Ga0157373_10219054 Ga0157373_102190543 99
512 3300013296 Ga0157374_11592690 Ga0157374_115926902 99
513 3300013308 Ga0157375_11369081 Ga0157375_113690811 99
514 3300014745 Ga0157377_10308387 Ga0157377_103083873 99
515 3300014969 Ga0157376_10853847 Ga0157376_108538472 99
516 3300020070 Ga0206356_10738097 Ga0206356_107380972 99
517 3300025271 Ga0207666_1002984 Ga0207666_10029842 99
518 3300025315 Ga0207697_10049723 Ga0207697_100497232 99
519 3300025735 Ga0207713_1021008 Ga0207713_10210083 99
520 3300025898 Ga0207692_10030854 Ga0207692_100308543 99
521 3300025898 Ga0207692_10092547 Ga0207692_100925474 99
522 3300025900 Ga0207710_10003839 Ga0207710_100038394 99
523 3300025903 Ga0207680_10250163 Ga0207680_102501632 99
524 3300025903 Ga0207680_10788711 Ga0207680_107887112 99
525 3300025905 Ga0207685_10007286 Ga0207685_100072863 99
526 3300025906 Ga0207699_10005454 Ga0207699_100054546 99
527 3300025910 Ga0207684_11624283 Ga0207684_116242831 99
528 3300025911 Ga0207654_10226472 Ga0207654_102264722 99
529 3300025912 Ga0207707_10023067 Ga0207707_100230674 99
530 3300025912 Ga0207707_10168746 Ga0207707_101687462 99
531 3300025912 Ga0207707_10721384 Ga0207707_107213842 99
532 3300025915 Ga0207693_10019742 Ga0207693_100197424 99
533 3300025916 Ga0207663_10081715 Ga0207663_100817153 99
534 3300025916 Ga0207663_10997103 Ga0207663_109971032 99
535 3300025917 Ga0207660_10149471 Ga0207660_101494713 99
536 3300025917 Ga0207660_10475742 Ga0207660_104757421 99
537 3300025918 Ga0207662_10108744 Ga0207662_101087442 99
538 3300025919 Ga0207657_10206712 Ga0207657_102067123 99
539 3300025919 Ga0207657_10543961 Ga0207657_105439612 99
540 3300025919 Ga0207657_11136497 Ga0207657_111364972 99
541 3300025920 Ga0207649_10403288 Ga0207649_104032882 99
542 3300025920 Ga0207649_11300813 Ga0207649_113008132 99
543 3300025921 Ga0207652_10990076 Ga0207652_109900762 99
544 3300025923 Ga0207681_10356887 Ga0207681_103568872 99
545 3300025926 Ga0207659_10759185 Ga0207659_107591852 99
546 3300025927 Ga0207687_10009445 Ga0207687_100094454 99
547 3300025928 Ga0207700_10013168 Ga0207700_100131685 99
548 3300025928 Ga0207700_10062828 Ga0207700_100628284 99
549 3300025929 Ga0207664_10081946 Ga0207664_100819464 99
550 3300025932 Ga0207690_11007341 Ga0207690_110073411 99
551 3300025933 Ga0207706_10132685 Ga0207706_101326854 99
552 3300025933 Ga0207706_10206929 Ga0207706_102069292 99
553 3300025934 Ga0207686_10109883 Ga0207686_101098834 99
554 3300025935 Ga0207709_10052699 Ga0207709_100526993 99
555 3300025935 Ga0207709_10888424 Ga0207709_108884242 99
556 3300025935 Ga0207709_11000282 Ga0207709_110002822 99
557 3300025936 Ga0207670_10059661 Ga0207670_100596614 99
558 3300025936 Ga0207670_10472908 Ga0207670_104729082 99
559 3300025939 Ga0207665_10007965 Ga0207665_100079656 99
560 3300025941 Ga0207711_10011699 Ga0207711_100116994 99
561 3300025942 Ga0207689_10071476 Ga0207689_100714762 99
562 3300025944 Ga0207661_10089610 Ga0207661_100896102 99
563 3300025945 Ga0207679_10598459 Ga0207679_105984592 99
564 3300025960 Ga0207651_10010449 Ga0207651_100104492 99
565 3300025960 Ga0207651_10605747 Ga0207651_106057472 99
566 3300025961 Ga0207712_10214895 Ga0207712_102148952 99
567 3300025986 Ga0207658_10643357 Ga0207658_106433572 99
568 3300026035 Ga0207703_10507924 Ga0207703_105079242 99
569 3300026067 Ga0207678_10057976 Ga0207678_100579764 99
570 3300026067 Ga0207678_10314500 Ga0207678_103145002 99
571 3300026075 Ga0207708_10077261 Ga0207708_100772614 99
572 3300026095 Ga0207676_10004875 Ga0207676_100048756 99
573 3300026095 Ga0207676_11769616 Ga0207676_117696161 99
574 3300026118 Ga0207675_100785923 Ga0207675_1007859232 99
575 3300027695 Ga0209966_1000536 Ga0209966_100053613 99
576 3300027717 Ga0209998_10094989 Ga0209998_100949892 99
577 3300027876 Ga0209974_10017542 Ga0209974_100175423 99
578 3300027907 Ga0207428_10003190 Ga0207428_1000319010 99
579 3300028379 Ga0268266_10038038 Ga0268266_100380384 99
580 3300028379 Ga0268266_10826655 Ga0268266_108266552 99
581 3300028380 Ga0268265_12145268 Ga0268265_121452681 99
582 3300028381 Ga0268264_10177820 Ga0268264_101778203 99
583 3300028381 Ga0268264_10320432 Ga0268264_103204322 99
584 3300031241 Ga0265325_10000049 Ga0265325_1000004932 99
585 3300031247 Ga0265340_10369650 Ga0265340_103696502 99
586 3300031595 Ga0265313_10027525 Ga0265313_100275253 99
587 3300034816 Ga0373930_0000167 Ga0373930_0000167_69_422 99
588 3300034817 Ga0373948_0000080 Ga0373948_0000080_6712_7011 99
589 3300034818 Ga0373950_0001088 Ga0373950_0001088_2166_2465 99
590 3300034819 Ga0373958_0118578 Ga0373958_0118578_288_590 99
591 3300034820 Ga0373959_0008295 Ga0373959_0008295_1270_1569 99
592 3300034820 Ga0373959_0054023 Ga0373959_0054023_476_778 99
593 3300034957 Ga0373938_0105208 Ga0373938_0105208_312_614 99
594 3300035083 Ga0373926_0007052 Ga0373926_0007052_2350_2652 99
595 3300035084 Ga0373928_0005786 Ga0373928_0005786_1603_1902 99
596 3300035085 Ga0373929_0000333 Ga0373929_0000333_87_386 99
597 3300035085 Ga0373929_0148072 Ga0373929_0148072_140_442 99
598 3300035086 Ga0373934_0065473 Ga0373934_0065473_421_723 99
599 3300035088 Ga0373940_0001034 Ga0373940_0001034_1618_1917 99
600 3300035089 Ga0373944_0008009 Ga0373944_0008009_808_1110 99
601 3300035089 Ga0373944_0105982 Ga0373944_0105982_300_599 99
602 3300035089 Ga0373944_0177098 Ga0373944_0177098_254_556 99
603 3300035090 Ga0373949_0067769 Ga0373949_0067769_211_510 99
604 3300035091 Ga0373951_0004760 Ga0373951_0004760_380_679 99
605 3300035092 Ga0373952_0001546 Ga0373952_0001546_411_710 99
606 3300035092 Ga0373952_0016287 Ga0373952_0016287_79_381 99
607 3300035112 Ga0373932_0000216 Ga0373932_0000216_6350_6649 99
608 3300035113 Ga0373936_0010734 Ga0373936_0010734_1993_2295 99
609 3300035113 Ga0373936_0325321 Ga0373936_0325321_15_317 99
610 3300035113 Ga0373936_0592755 Ga0373936_0592755_98_400 99
611 3300035115 Ga0373941_0064473 Ga0373941_0064473_253_552 99
612 3300035116 Ga0373945_0005524 Ga0373945_0005524_1560_1862 99
613 3300035116 Ga0373945_0015449 Ga0373945_0015449_932_1234 99
614 3300035117 Ga0373953_0063177 Ga0373953_0063177_124_423 99
615 3300035118 Ga0373954_0028451 Ga0373954_0028451_1277_1579 99
616 3300035118 Ga0373954_0343790 Ga0373954_0343790_368_670 99
617 3300035119 Ga0373956_0059761 Ga0373956_0059761_362_661 99
618 3300035121 Ga0373960_0001024 Ga0373960_0001024_73_426 99
619 3300035170 Ga0373943_0011235 Ga0373943_0011235_2854_3156 99
620 3300035170 Ga0373943_0081381 Ga0373943_0081381_26_328 99
621 3300035172 Ga0373955_0107113 Ga0373955_0107113_1089_1388 99
622 3300035207 Ga0373942_0000176 Ga0373942_0000176_10423_10722 99
623 3300035207 Ga0373942_0066837 Ga0373942_0066837_463_765 99
624 3300035241 Ga0373961_0004636 Ga0373961_0004636_1397_1696 99
625 3300035242 Ga0373962_0014531 Ga0373962_0014531_569_871 99
626 3300035410 Ga0373924_0020150 Ga0373924_0020150_411_713 99
627 3300035410 Ga0373924_0027139 Ga0373924_0027139_833_1132 99
628 3300035692 Ga0373935_0116159 Ga0373935_0116159_1070_1372 99
629 3300035695 Ga0373927_0028225 Ga0373927_0028225_2023_2325 99
630 3300035695 Ga0373927_0151289 Ga0373927_0151289_1113_1415 99
631 3300035695 Ga0373927_0215606 Ga0373927_0215606_666_968 99
632 3300035695 Ga0373927_0428799 Ga0373927_0428799_550_849 99
633 3300035724 Ga0373933_0160433 Ga0373933_0160433_347_646 99
634 3300035725 Ga0373947_0014361 Ga0373947_0014361_3120_3422 99
635 3300035725 Ga0373947_0102798 Ga0373947_0102798_890_1192 99
636 3300035725 Ga0373947_0121146 Ga0373947_0121146_1231_1530 99
637 3300036401 Ga0373937_0034269 Ga0373937_0034269_2237_2536 99
638 3300036401 Ga0373937_0145375 Ga0373937_0145375_197_499 99
639 3300037068 Ga0373925_0005504 Ga0373925_0005504_2250_2552 99
640 3300037068 Ga0373925_0031705 Ga0373925_0031705_3489_3791 99
641 3300037068 Ga0373925_0340598 Ga0373925_0340598_258_557 99
642 3300042876 Ga0451577_0799660 Ga0451577_0799660_109_408 99
643 3300044656 Ga0466969_0295654 Ga0466969_0295654_108_410 99
644 3300044684 Ga0466966_0033902 Ga0466966_0033902_2510_2812 99
645 3300044693 Ga0466961_0314517 Ga0466961_0314517_441_743 99
646 3300044694 Ga0466963_0149506 Ga0466963_0149506_1154_1456 99
647 3300044712 Ga0453684_0513542 Ga0453684_0513542_1006_1305 99
648 3300044719 Ga0466971_0169602 Ga0466971_0169602_587_889 99
649 3300044842 Ga0466957_0127929 Ga0466957_0127929_997_1299 99
650 3300045049 Ga0466959_0336860 Ga0466959_0336860_440_742 99
651 3300045051 Ga0451576_0613609 Ga0451576_0613609_382_681 99
652 3300045836 Ga0466958_0088959 Ga0466958_0088959_661_963 99
653 3300046452 Ga0495617_044085 Ga0495617_044085_779_1081 99
654 3300046454 Ga0495592_0076830 Ga0495592_0076830_1275_1574 99
655 3300046454 Ga0495592_0113131 Ga0495592_0113131_896_1198 99
656 3300046455 Ga0495603_0033829 Ga0495603_0033829_2636_2938 99
657 3300046455 Ga0495603_0063121 Ga0495603_0063121_1730_2032 99
658 3300046455 Ga0495603_0125214 Ga0495603_0125214_353_655 99
659 3300046459 Ga0495629_0005418 Ga0495629_0005418_5136_5438 99
660 3300046459 Ga0495629_0357597 Ga0495629_0357597_284_586 99
661 3300046462 Ga0495651_0116918 Ga0495651_0116918_533_832 99
662 3300046472 Ga0495580_0090643 Ga0495580_0090643_298_600 99
663 3300046473 Ga0495582_0051485 Ga0495582_0051485_812_1114 99
664 3300046475 Ga0495639_0200635 Ga0495639_0200635_552_854 99
665 3300046476 Ga0495662_0074482 Ga0495662_0074482_1330_1632 99
666 3300046477 Ga0495664_0033039 Ga0495664_0033039_1105_1407 99
667 3300046491 Ga0495584_0053185 Ga0495584_0053185_787_1089 99
668 3300046492 Ga0495585_0003758 Ga0495585_0003758_9096_9398 99
669 3300046499 Ga0495594_0003490 Ga0495594_0003490_6814_7116 99
670 3300046499 Ga0495594_0053988 Ga0495594_0053988_850_1152 99
671 3300046501 Ga0495607_0084698 Ga0495607_0084698_874_1176 99
672 3300046511 Ga0495608_0032489 Ga0495608_0032489_2211_2510 99
673 3300046514 Ga0495618_0204570 Ga0495618_0204570_635_937 99
674 3300046514 Ga0495618_0916053 Ga0495618_0916053_161_463 99
675 3300046516 Ga0495628_0007284 Ga0495628_0007284_1422_1721 99
676 3300046516 Ga0495628_0319584 Ga0495628_0319584_746_1048 99
677 3300046518 Ga0495631_0030448 Ga0495631_0030448_1383_1685 99
678 3300046523 Ga0495644_0012715 Ga0495644_0012715_1322_1624 99
679 3300046526 Ga0495666_0021852 Ga0495666_0021852_2097_2399 99
680 3300046526 Ga0495666_0238565 Ga0495666_0238565_356_658 99
681 3300046529 Ga0495652_0172977 Ga0495652_0172977_349_648 99
682 3300046529 Ga0495652_0517797 Ga0495652_0517797_297_599 99
683 3300046533 Ga0495640_0017163 Ga0495640_0017163_1757_2059 99
684 3300046535 Ga0495586_0065777 Ga0495586_0065777_779_1081 99
685 3300046536 Ga0495587_0194638 Ga0495587_0194638_464_763 99
686 3300046537 Ga0495598_0013102 Ga0495598_0013102_667_969 99
687 3300046538 Ga0495609_0041317 Ga0495609_0041317_1209_1511 99
688 3300046539 Ga0495621_0042575 Ga0495621_0042575_886_1188 99
689 3300046543 Ga0495645_0005770 Ga0495645_0005770_6982_7281 99
690 3300046557 Ga0495622_0221005 Ga0495622_0221005_508_810 99
691 3300046558 Ga0495633_0005630 Ga0495633_0005630_1288_1590 99
692 3300046615 Ga0495656_0018371 Ga0495656_0018371_1219_1521 99
693 3300046663 Ga0495635_0235846 Ga0495635_0235846_399_698 99
694 3300046664 Ga0495659_0003259 Ga0495659_0003259_3647_3949 99
695 3300046665 Ga0495661_0037705 Ga0495661_0037705_1953_2255 99
696 3300046674 Ga0495588_0136414 Ga0495588_0136414_899_1201 99
697 3300046674 Ga0495588_0140981 Ga0495588_0140981_377_679 99
698 3300046675 Ga0495657_0065914 Ga0495657_0065914_614_913 99
699 3300046679 Ga0495623_0258511 Ga0495623_0258511_424_723 99
700 3300046680 Ga0495646_0356975 Ga0495646_0356975_412_714 99
701 3300046681 Ga0495647_0021374 Ga0495647_0021374_1072_1374 99
702 3300046683 Ga0495658_0084743 Ga0495658_0084743_578_880 99
703 3300046683 Ga0495658_0424629 Ga0495658_0424629_434_733 99
704 3300046689 Ga0495613_0006657 Ga0495613_0006657_2477_2779 99
705 3300046689 Ga0495613_0071710 Ga0495613_0071710_1328_1630 99
706 3300046690 Ga0495624_0036676 Ga0495624_0036676_1427_1729 99
707 3300046691 Ga0495670_0003018 Ga0495670_0003018_832_1134 99
708 3300046692 Ga0495671_0044577 Ga0495671_0044577_1145_1447 99
709 3300046794 Ga0495589_0051818 Ga0495589_0051818_522_824 99
710 3300046809 Ga0495600_0839566 Ga0495600_0839566_117_416 99
711 3300047317 Ga0495604_0029170 Ga0495604_0029170_3218_3517 99
712 3300047318 Ga0495636_0074309 Ga0495636_0074309_674_976 99
713 3300047319 Ga0495674_0140552 Ga0495674_0140552_272_574 99
714 3300047321 Ga0495676_0157557 Ga0495676_0157557_1225_1527 99
715 3300047322 Ga0495680_0041875 Ga0495680_0041875_1450_1749 99
716 3300047322 Ga0495680_0045246 Ga0495680_0045246_789_1091 99
717 3300047444 Ga0495675_0388958 Ga0495675_0388958_123_422 99
718 3300047446 Ga0495679_078840 Ga0495679_078840_280_582 99
719 3300047470 Ga0495681_0272553 Ga0495681_0272553_266_568 99
720 3300048089 Ga0495614_0014398 Ga0495614_0014398_812_1114 99
721 3300048903 Ga0496100_0370757 Ga0496100_0370757_235_534 99
722 3300048904 Ga0496101_0691237 Ga0496101_0691237_272_571 99
723 3300048905 Ga0496102_0024345 Ga0496102_0024345_4813_5112 99
724 3300048905 Ga0496102_0027609 Ga0496102_0027609_1383_1682 99
725 3300048906 Ga0496103_0006448 Ga0496103_0006448_5273_5572 99
726 3300048906 Ga0496103_0089607 Ga0496103_0089607_912_1214 99
727 3300048906 Ga0496103_0569510 Ga0496103_0569510_253_552 99
728 3300048906 Ga0496103_0633909 Ga0496103_0633909_147_446 99
729 3300048907 Ga0496104_0003813 Ga0496104_0003813_4804_5103 99
730 3300048907 Ga0496104_0035086 Ga0496104_0035086_1432_1731 99
731 3300048907 Ga0496104_0083596 Ga0496104_0083596_396_698 99
732 3300048907 Ga0496104_0092885 Ga0496104_0092885_1088_1387 99
733 3300048907 Ga0496104_0265889 Ga0496104_0265889_806_1108 99
734 3300048907 Ga0496104_0522252 Ga0496104_0522252_51_353 99
735 3300048908 Ga0496105_0001595 Ga0496105_0001595_12485_12784 99
736 3300048908 Ga0496105_0170313 Ga0496105_0170313_393_695 99
737 3300048908 Ga0496105_0680191 Ga0496105_0680191_221_520 99
738 3300048908 Ga0496105_0830124 Ga0496105_0830124_306_605 99
739 3300048909 Ga0496106_0014405 Ga0496106_0014405_5273_5572 99
740 3300048909 Ga0496106_0050334 Ga0496106_0050334_2570_2869 99
741 3300048909 Ga0496106_0334710 Ga0496106_0334710_603_905 99
742 3300048909 Ga0496106_0762222 Ga0496106_0762222_306_608 99
743 3300048909 Ga0496106_1053336 Ga0496106_1053336_74_373 99
744 3300048910 Ga0496107_0028493 Ga0496107_0028493_821_1120 99
745 3300048910 Ga0496107_0091881 Ga0496107_0091881_1699_1998 99
746 3300048910 Ga0496107_0177076 Ga0496107_0177076_1064_1363 99
747 3300048911 Ga0496108_0002446 Ga0496108_0002446_12849_13148 99
748 3300048911 Ga0496108_0596106 Ga0496108_0596106_649_948 99
749 3300048912 Ga0496109_0007673 Ga0496109_0007673_6365_6664 99
750 3300048912 Ga0496109_0014341 Ga0496109_0014341_502_804 99
751 3300048912 Ga0496109_0025468 Ga0496109_0025468_272_571 99
752 3300048912 Ga0496109_0051256 Ga0496109_0051256_1829_2131 99
753 3300048912 Ga0496109_1152592 Ga0496109_1152592_111_413 99
754 3300048913 Ga0496110_0546741 Ga0496110_0546741_202_501 99
755 3300048913 Ga0496110_0583708 Ga0496110_0583708_481_780 99
756 3300048914 Ga0496111_0016804 Ga0496111_0016804_4478_4777 99
757 3300048914 Ga0496111_0144813 Ga0496111_0144813_647_946 99
758 3300048915 Ga0496112_0023998 Ga0496112_0023998_5264_5563 99
759 3300048915 Ga0496112_0205887 Ga0496112_0205887_218_517 99
760 3300048915 Ga0496112_0873539 Ga0496112_0873539_489_791 99
761 3300048916 Ga0496113_0011936 Ga0496113_0011936_272_571 99
762 3300048916 Ga0496113_0726757 Ga0496113_0726757_221_520 99
763 3300048916 Ga0496113_1292783 Ga0496113_1292783_26_379 99
764 3300048917 Ga0496114_0007779 Ga0496114_0007779_2950_3249 99
765 3300048918 Ga0496115_0035263 Ga0496115_0035263_272_571 99
766 3300048918 Ga0496115_0299621 Ga0496115_0299621_766_1068 99
767 3300048918 Ga0496115_0707293 Ga0496115_0707293_221_520 99
768 3300048918 Ga0496115_0979710 Ga0496115_0979710_194_496 99
769 3300048924 Ga0496121_0389030 Ga0496121_0389030_203_502 99
770 3300049585 Ga0501069_0123124 Ga0501069_0123124_939_1244 99
771 3300049586 Ga0501070_1162523 Ga0501070_1162523_104_430 99
772 3300049588 Ga0501072_0652782 Ga0501072_0652782_254_562 99
773 3300049592 Ga0501076_1006433 Ga0501076_1006433_225_524 99
774 3300049742 Ga0501080_0957302 Ga0501080_0957302_403_705 99
775 3300049824 Ga0501045_1260393 Ga0501045_1260393_139_438 99
776 3300050493 nmdc:mga0k408_427641_c1 nmdc:mga0k408_427641_c1_50_349 99
777 3300050507 nmdc:mga05p37_59706_c1 nmdc:mga05p37_59706_c1_3541_3843 99
778 3300050511 nmdc:mga08y16_41762_c1 nmdc:mga08y16_41762_c1_485_784 99
779 3300050512 nmdc:mga0n895_13320_c1 nmdc:mga0n895_13320_c1_4405_4707 99
780 3300050512 nmdc:mga0n895_29477_c1 nmdc:mga0n895_29477_c1_2058_2360 99
781 3300050512 nmdc:mga0n895_402224_c1 nmdc:mga0n895_402224_c1_926_1228 99
782 3300050512 nmdc:mga0n895_649955_c1 nmdc:mga0n895_649955_c1_232_549 99
783 3300050513 nmdc:mga0rr50_39550_c1 nmdc:mga0rr50_39550_c1_2620_2922 99
784 3300050513 nmdc:mga0rr50_435635_c1 nmdc:mga0rr50_435635_c1_18_335 99
785 3300050513 nmdc:mga0rr50_67222_c1 nmdc:mga0rr50_67222_c1_445_747 99
786 3300050514 nmdc:mga08x19_188511_c1 nmdc:mga08x19_188511_c1_681_983 99
787 3300050514 nmdc:mga08x19_316665_c1 nmdc:mga08x19_316665_c1_404_706 99
788 3300050514 nmdc:mga08x19_423684_c1 nmdc:mga08x19_423684_c1_218_535 99
789 3300050515 nmdc:mga0a205_160430_c1 nmdc:mga0a205_160430_c1_1322_1624 99
790 3300050515 nmdc:mga0a205_557610_c1 nmdc:mga0a205_557610_c1_349_651 99
791 3300050515 nmdc:mga0a205_96413_c1 nmdc:mga0a205_96413_c1_78_377 99
792 3300053077 Ga0495601_0018908 Ga0495601_0018908_1810_2109 99
793 3300053077 Ga0495601_0220581 Ga0495601_0220581_185_487 99
794 3300053078 Ga0495612_0012859 Ga0495612_0012859_733_1032 99
795 3300053078 Ga0495612_0046322 Ga0495612_0046322_958_1260 99
796 3300053084 Ga0495595_0019992 Ga0495595_0019992_2362_2661 99
797 3300053084 Ga0495595_0086694 Ga0495595_0086694_619_918 99
798 3300053085 Ga0495619_0002485 Ga0495619_0002485_4153_4455 99
799 3300053085 Ga0495619_0051751 Ga0495619_0051751_745_1044 99
800 3300061719 Ga0466962_0286655 Ga0466962_0286655_175_477 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00708

Acylphosphatase

Acylphosphatase

8

97

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ulr-assembly1.cif.gz_A crystal structure of tt0497 from thermus thermophilus hb8 0.9324 6 96
3tnv-assembly1.cif.gz_A acylphosphatase with thermophilic surface and mesophilic core 0.9289 4 96
2w4d-assembly1.cif.gz_B acylphosphatase variant g91a from pyrococcus horikoshii 0.9282 4 96
8jfs-assembly2.cif.gz_B phosphate bound acylphosphatase from deinococcus radiodurans at 1 angstrom resolution 0.9238 6 96
3trg-assembly1.cif.gz_A structure of an acylphosphatase from coxiella burnetii 0.9206 3 96
ID Description Score Start End Superfamily
af_A4I1P4_95_208_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9695 4 81 3.30.70.100
af_K7LZQ3_146_256_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9557 4 96 3.30.70.100
3tnvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9289 4 96 3.30.70.100
3trgA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9195 3 96 3.30.70.100
2hltA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9124 5 97 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6A4L873-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.9918 3 79 GO:0003998
GO:0009733
GO:0016020
AF-A0A6N2DDH4-F1-model_v4 deleted 0.9903 4 81
AF-Q07L15-F1-model_v4 Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) 0.9902 6 99 GO:0003998
AF-A0A537N4B7-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.9883 4 99 GO:0003998
AF-A0A537L887-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 0.9881 4 99 GO:0003998

Feature Viewer

pLDDT pTM Quality
94.64 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map