F481394
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 800 | 403 | 800 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_0149884|Ga0501040_0149884_985_1290 |
| Length | 101 |
| Sequence | MNLGDRIVRLMITGRVQGVGFRAFVEDEAMRHGLRGWVRNRRDGAVEAVLGGPADAVNAAIDACRRXXRAAQVRAVDVQEAETTALEQLLPGEDFSVLANG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 16 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 20 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 130 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 131 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 132 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 216 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 217 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 223 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 226 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 249 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 258 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 259 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 263 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 264 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 265 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 266 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 267 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 273 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 274 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 341 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 354 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 380 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 381 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 382 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 395 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 396 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 397 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 398 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 399 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 400 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 403 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.12 |
| Nodule | 0 |
| Rhizoplane | 10 |
| Rhizosphere | 87.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214884076 | 2209111006 | Bacteria | 7856 |
| 2 | ARcpr5oldR_c004176 | 3300000041 | Bacteria | 1263 |
| 3 | ARcpr5yngRDRAFT_c007081 | 3300000043 | Bacteria | 996 |
| 4 | ARSoilOldRDRAFT_c000083 | 3300000044 | Bacteria | 17763 |
| 5 | ARCol0yngRDRAFT_1000103 | 3300000652 | Bacteria | 15788 |
| 6 | JGI24752J21851_1011378 | 3300001976 | Bacteria | 1163 |
| 7 | JGI24747J21853_1009515 | 3300001978 | Bacteria | 962 |
| 8 | JGI24739J22299_10062937 | 3300001989 | Bacteria | 1169 |
| 9 | JGI24737J22298_10000053 | 3300001990 | Bacteria | 34054 |
| 10 | JGI24743J22301_10039413 | 3300001991 | Bacteria | 946 |
| 11 | JGI24750J21931_1005416 | 3300002070 | Bacteria | 1569 |
| 12 | JGI24745J21846_1014742 | 3300002073 | Bacteria | 904 |
| 13 | JGI24738J21930_10023527 | 3300002075 | Bacteria | 1269 |
| 14 | JGI24744J21845_10031963 | 3300002077 | Bacteria | 1005 |
| 15 | JGI24035J26624_1009285 | 3300002126 | Bacteria | 969 |
| 16 | JGI24033J26618_1018880 | 3300002155 | Bacteria | 871 |
| 17 | JGI24742J22300_10000381 | 3300002244 | Bacteria | 6546 |
| 18 | JGI25406J46586_10032704 | 3300003203 | Bacteria | 1930 |
| 19 | JGI26128J50194_1010721 | 3300003347 | Bacteria | 576 |
| 20 | Ga0065716_1003653 | 3300005277 | Bacteria | 1165 |
| 21 | Ga0065704_10270380 | 3300005289 | Bacteria | 944 |
| 22 | Ga0065712_10009636 | 3300005290 | Bacteria | 2607 |
| 23 | Ga0065712_10145316 | 3300005290 | Bacteria | 1414 |
| 24 | Ga0065712_10147284 | 3300005290 | Bacteria | 1398 |
| 25 | Ga0065715_10135200 | 3300005293 | Bacteria | 1942 |
| 26 | Ga0065707_10265024 | 3300005295 | Bacteria | 1066 |
| 27 | Ga0065707_10283437 | 3300005295 | Bacteria | 1042 |
| 28 | Ga0070676_10000302 | 3300005328 | Bacteria | 22128 |
| 29 | Ga0070683_100003623 | 3300005329 | Bacteria | 12583 |
| 30 | Ga0070683_100157295 | 3300005329 | Bacteria | 2156 |
| 31 | Ga0070683_100192210 | 3300005329 | Bacteria | 1938 |
| 32 | Ga0070690_100000253 | 3300005330 | Bacteria | 27696 |
| 33 | Ga0070690_100013798 | 3300005330 | Bacteria | 4785 |
| 34 | Ga0070670_100011774 | 3300005331 | Bacteria | 7480 |
| 35 | Ga0070670_100175861 | 3300005331 | Bacteria | 1858 |
| 36 | Ga0070677_10000104 | 3300005333 | Bacteria | 27953 |
| 37 | Ga0068869_100006200 | 3300005334 | Bacteria | 7571 |
| 38 | Ga0068869_100816155 | 3300005334 | Bacteria | 803 |
| 39 | Ga0070666_10013625 | 3300005335 | Bacteria | 5162 |
| 40 | Ga0070666_10014594 | 3300005335 | Bacteria | 5002 |
| 41 | Ga0070680_100016970 | 3300005336 | Bacteria | 5733 |
| 42 | Ga0070680_100330323 | 3300005336 | Unclassified | 1295 |
| 43 | Ga0070680_100600546 | 3300005336 | Bacteria | 945 |
| 44 | Ga0070680_101901512 | 3300005336 | Bacteria | 516 |
| 45 | Ga0070682_100000287 | 3300005337 | Bacteria | 35953 |
| 46 | Ga0070682_100096987 | 3300005337 | Bacteria | 1939 |
| 47 | Ga0070682_100099045 | 3300005337 | Bacteria | 1921 |
| 48 | Ga0070682_100167020 | 3300005337 | Bacteria | 1526 |
| 49 | Ga0070682_101715437 | 3300005337 | Unclassified | 546 |
| 50 | Ga0068868_100001298 | 3300005338 | Bacteria | 17210 |
| 51 | Ga0068868_100198953 | 3300005338 | Bacteria | 1670 |
| 52 | Ga0070660_100002362 | 3300005339 | Bacteria | 12967 |
| 53 | Ga0070660_100487633 | 3300005339 | Bacteria | 1025 |
| 54 | Ga0070660_101335421 | 3300005339 | Bacteria | 609 |
| 55 | Ga0070689_100000422 | 3300005340 | Bacteria | 24979 |
| 56 | Ga0070689_100096627 | 3300005340 | Bacteria | 2335 |
| 57 | Ga0070689_102043790 | 3300005340 | Bacteria | 524 |
| 58 | Ga0070691_10004265 | 3300005341 | Bacteria | 6493 |
| 59 | Ga0070691_10093428 | 3300005341 | Bacteria | 1486 |
| 60 | Ga0070691_10742950 | 3300005341 | Bacteria | 593 |
| 61 | Ga0070687_100002601 | 3300005343 | Bacteria | 6813 |
| 62 | Ga0070687_100557641 | 3300005343 | Bacteria | 780 |
| 63 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 64 | Ga0070661_100315576 | 3300005344 | Bacteria | 1220 |
| 65 | Ga0070661_101504479 | 3300005344 | Unclassified | 568 |
| 66 | Ga0070692_10000546 | 3300005345 | Bacteria | 11692 |
| 67 | Ga0070692_10179740 | 3300005345 | Bacteria | 1225 |
| 68 | Ga0070668_100000656 | 3300005347 | Bacteria | 23401 |
| 69 | Ga0070668_100025762 | 3300005347 | Bacteria | 4460 |
| 70 | Ga0070668_100115939 | 3300005347 | Bacteria | 2135 |
| 71 | Ga0070669_100000314 | 3300005353 | Bacteria | 37924 |
| 72 | Ga0070669_100029627 | 3300005353 | Bacteria | 3946 |
| 73 | Ga0070675_100000161 | 3300005354 | Bacteria | 40950 |
| 74 | Ga0070675_100170284 | 3300005354 | Bacteria | 1877 |
| 75 | Ga0070675_100606411 | 3300005354 | Bacteria | 993 |
| 76 | Ga0070671_100000313 | 3300005355 | Bacteria | 32932 |
| 77 | Ga0070671_100026052 | 3300005355 | Bacteria | 4803 |
| 78 | Ga0070674_100016562 | 3300005356 | Bacteria | 4621 |
| 79 | Ga0070673_100000272 | 3300005364 | Bacteria | 26555 |
| 80 | Ga0070673_100238299 | 3300005364 | Bacteria | 1581 |
| 81 | Ga0070673_100426570 | 3300005364 | Bacteria | 1190 |
| 82 | Ga0070673_100793553 | 3300005364 | Bacteria | 874 |
| 83 | Ga0070688_100000306 | 3300005365 | Bacteria | 24982 |
| 84 | Ga0070688_100007962 | 3300005365 | Bacteria | 5731 |
| 85 | Ga0070688_100045570 | 3300005365 | Bacteria | 2710 |
| 86 | Ga0070688_100916269 | 3300005365 | Bacteria | 692 |
| 87 | Ga0070688_100952739 | 3300005365 | Unclassified | 679 |
| 88 | Ga0070659_100000252 | 3300005366 | Bacteria | 42278 |
| 89 | Ga0070667_100014243 | 3300005367 | Bacteria | 6568 |
| 90 | Ga0070667_100025494 | 3300005367 | Bacteria | 4915 |
| 91 | Ga0070667_100068007 | 3300005367 | Bacteria | 3030 |
| 92 | Ga0070667_100284498 | 3300005367 | Bacteria | 1486 |
| 93 | Ga0070703_10013349 | 3300005406 | Bacteria | 2332 |
| 94 | Ga0070703_10146970 | 3300005406 | Bacteria | 881 |
| 95 | Ga0070709_10004420 | 3300005434 | Bacteria | 7584 |
| 96 | Ga0070709_10012395 | 3300005434 | Bacteria | 4771 |
| 97 | Ga0070709_10027064 | 3300005434 | Bacteria | 3406 |
| 98 | Ga0070709_11377716 | 3300005434 | Bacteria | 570 |
| 99 | Ga0070714_100134390 | 3300005435 | Bacteria | 2213 |
| 100 | Ga0070713_100021553 | 3300005436 | Bacteria | 4959 |
| 101 | Ga0070713_100025039 | 3300005436 | Bacteria | 4659 |
| 102 | Ga0070713_100091102 | 3300005436 | Bacteria | 2622 |
| 103 | Ga0070710_10003513 | 3300005437 | Bacteria | 7426 |
| 104 | Ga0070710_10095668 | 3300005437 | Bacteria | 1759 |
| 105 | Ga0070701_10000123 | 3300005438 | Bacteria | 22697 |
| 106 | Ga0070711_100022505 | 3300005439 | Bacteria | 4086 |
| 107 | Ga0070711_100115183 | 3300005439 | Bacteria | 1979 |
| 108 | Ga0070711_101496320 | 3300005439 | Unclassified | 589 |
| 109 | Ga0070705_100001543 | 3300005440 | Bacteria | 12097 |
| 110 | Ga0070705_101020381 | 3300005440 | Bacteria | 672 |
| 111 | Ga0070705_101625178 | 3300005440 | Bacteria | 544 |
| 112 | Ga0070700_100015468 | 3300005441 | Bacteria | 4327 |
| 113 | Ga0070700_100031644 | 3300005441 | Bacteria | 3172 |
| 114 | Ga0070700_100112627 | 3300005441 | Bacteria | 1812 |
| 115 | Ga0070700_100583680 | 3300005441 | Bacteria | 873 |
| 116 | Ga0070694_100009283 | 3300005444 | Bacteria | 6036 |
| 117 | Ga0070694_100056993 | 3300005444 | Bacteria | 2655 |
| 118 | Ga0070694_100311579 | 3300005444 | Bacteria | 1209 |
| 119 | Ga0070708_100185231 | 3300005445 | Bacteria | 1947 |
| 120 | Ga0070663_100007039 | 3300005455 | Bacteria | 6816 |
| 121 | Ga0070663_100039920 | 3300005455 | Bacteria | 3283 |
| 122 | Ga0070663_100145644 | 3300005455 | Bacteria | 1812 |
| 123 | Ga0070678_100122510 | 3300005456 | Bacteria | 2053 |
| 124 | Ga0070678_100156678 | 3300005456 | Bacteria | 1840 |
| 125 | Ga0070662_100013472 | 3300005457 | Bacteria | 5442 |
| 126 | Ga0070662_100312407 | 3300005457 | Bacteria | 1280 |
| 127 | Ga0070662_100357045 | 3300005457 | Bacteria | 1198 |
| 128 | Ga0070681_10003031 | 3300005458 | Bacteria | 15578 |
| 129 | Ga0070681_10228861 | 3300005458 | Bacteria | 1773 |
| 130 | Ga0070681_10379344 | 3300005458 | Bacteria | 1324 |
| 131 | Ga0070681_10775270 | 3300005458 | Bacteria | 876 |
| 132 | Ga0070681_10784253 | 3300005458 | Bacteria | 870 |
| 133 | Ga0070681_11211421 | 3300005458 | Bacteria | 677 |
| 134 | Ga0068867_100004059 | 3300005459 | Bacteria | 10305 |
| 135 | Ga0068867_100405774 | 3300005459 | Bacteria | 1150 |
| 136 | Ga0068867_100715339 | 3300005459 | Bacteria | 885 |
| 137 | Ga0070685_10000704 | 3300005466 | Bacteria | 18151 |
| 138 | Ga0070685_10047414 | 3300005466 | Bacteria | 2471 |
| 139 | Ga0070685_10102184 | 3300005466 | Bacteria | 1752 |
| 140 | Ga0070707_100742272 | 3300005468 | Bacteria | 945 |
| 141 | Ga0070698_100398161 | 3300005471 | Bacteria | 1310 |
| 142 | Ga0070679_100022432 | 3300005530 | Bacteria | 6170 |
| 143 | Ga0070679_100053555 | 3300005530 | Bacteria | 4016 |
| 144 | Ga0070679_100098218 | 3300005530 | Bacteria | 2916 |
| 145 | Ga0070684_100018176 | 3300005535 | Bacteria | 5786 |
| 146 | Ga0070684_101303506 | 3300005535 | Bacteria | 683 |
| 147 | Ga0070684_101445594 | 3300005535 | Unclassified | 648 |
| 148 | Ga0070684_101669876 | 3300005535 | Bacteria | 601 |
| 149 | Ga0068853_100160374 | 3300005539 | Bacteria | 2029 |
| 150 | Ga0068853_100247118 | 3300005539 | Bacteria | 1636 |
| 151 | Ga0068853_100464466 | 3300005539 | Bacteria | 1192 |
| 152 | Ga0070672_100000014 | 3300005543 | Bacteria | 72627 |
| 153 | Ga0070686_100000455 | 3300005544 | Bacteria | 24982 |
| 154 | Ga0070686_101497410 | 3300005544 | Unclassified | 569 |
| 155 | Ga0070695_100001270 | 3300005545 | Bacteria | 13896 |
| 156 | Ga0070695_100725907 | 3300005545 | Bacteria | 790 |
| 157 | Ga0070696_100014212 | 3300005546 | Bacteria | 5342 |
| 158 | Ga0070696_100036591 | 3300005546 | Bacteria | 3385 |
| 159 | Ga0070696_100058136 | 3300005546 | Bacteria | 2700 |
| 160 | Ga0070696_100083960 | 3300005546 | Bacteria | 2259 |
| 161 | Ga0070696_100196720 | 3300005546 | Bacteria | 1503 |
| 162 | Ga0070693_100000141 | 3300005547 | Bacteria | 32426 |
| 163 | Ga0070693_100051130 | 3300005547 | Bacteria | 2365 |
| 164 | Ga0070693_100250330 | 3300005547 | Unclassified | 1174 |
| 165 | Ga0070693_101248257 | 3300005547 | Bacteria | 572 |
| 166 | Ga0070665_100241125 | 3300005548 | Bacteria | 1808 |
| 167 | Ga0070665_100904035 | 3300005548 | Bacteria | 895 |
| 168 | Ga0070665_101486425 | 3300005548 | Bacteria | 686 |
| 169 | Ga0070665_101626410 | 3300005548 | Bacteria | 654 |
| 170 | Ga0070704_100000197 | 3300005549 | Bacteria | 24897 |
| 171 | Ga0070704_100148429 | 3300005549 | Bacteria | 1840 |
| 172 | Ga0068855_100002843 | 3300005563 | Bacteria | 21276 |
| 173 | Ga0068855_100839480 | 3300005563 | Bacteria | 974 |
| 174 | Ga0070664_100000770 | 3300005564 | Bacteria | 24720 |
| 175 | Ga0070664_100105582 | 3300005564 | Bacteria | 2453 |
| 176 | Ga0068857_100000567 | 3300005577 | Bacteria | 26993 |
| 177 | Ga0068854_100000674 | 3300005578 | Bacteria | 20404 |
| 178 | Ga0068854_100622947 | 3300005578 | Bacteria | 923 |
| 179 | Ga0068856_100006891 | 3300005614 | Bacteria | 11113 |
| 180 | Ga0068856_100983673 | 3300005614 | Bacteria | 862 |
| 181 | Ga0070702_100000130 | 3300005615 | Bacteria | 22887 |
| 182 | Ga0070702_100105240 | 3300005615 | Bacteria | 1739 |
| 183 | Ga0070702_100565483 | 3300005615 | Bacteria | 847 |
| 184 | Ga0068852_100008916 | 3300005616 | Bacteria | 7420 |
| 185 | Ga0068859_100001568 | 3300005617 | Bacteria | 23306 |
| 186 | Ga0068859_100137068 | 3300005617 | Bacteria | 2521 |
| 187 | Ga0068859_100640124 | 3300005617 | Bacteria | 1155 |
| 188 | Ga0068859_100765446 | 3300005617 | Bacteria | 1054 |
| 189 | Ga0068864_100001514 | 3300005618 | Bacteria | 19100 |
| 190 | Ga0068864_100028524 | 3300005618 | Bacteria | 4719 |
| 191 | Ga0068864_100098570 | 3300005618 | Bacteria | 2589 |
| 192 | Ga0068866_10000615 | 3300005718 | Bacteria | 16277 |
| 193 | Ga0068861_100000319 | 3300005719 | Bacteria | 26998 |
| 194 | Ga0068851_11019645 | 3300005834 | Bacteria | 522 |
| 195 | Ga0068870_10000002 | 3300005840 | Bacteria | 91107 |
| 196 | Ga0068863_100000703 | 3300005841 | Bacteria | 33695 |
| 197 | Ga0068863_100245600 | 3300005841 | Bacteria | 1728 |
| 198 | Ga0068858_100003033 | 3300005842 | Bacteria | 16828 |
| 199 | Ga0068858_100202482 | 3300005842 | Bacteria | 1877 |
| 200 | Ga0068858_100227051 | 3300005842 | Bacteria | 1769 |
| 201 | Ga0068860_100001895 | 3300005843 | Bacteria | 22206 |
| 202 | Ga0068860_100130966 | 3300005843 | Bacteria | 2407 |
| 203 | Ga0068860_100339139 | 3300005843 | Bacteria | 1478 |
| 204 | Ga0068862_100013279 | 3300005844 | Bacteria | 6813 |
| 205 | Ga0068862_100468954 | 3300005844 | Unclassified | 1190 |
| 206 | Ga0068862_100786075 | 3300005844 | Bacteria | 928 |
| 207 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 208 | Ga0081455_10000664 | 3300005937 | Bacteria | 44581 |
| 209 | Ga0081540_1004712 | 3300005983 | Bacteria | 10319 |
| 210 | Ga0081539_10100755 | 3300005985 | Unclassified | 1473 |
| 211 | Ga0070717_10000873 | 3300006028 | Bacteria | 19937 |
| 212 | Ga0070717_10067963 | 3300006028 | Bacteria | 2966 |
| 213 | Ga0070717_10701093 | 3300006028 | Bacteria | 920 |
| 214 | Ga0075365_11279947 | 3300006038 | Bacteria | 515 |
| 215 | Ga0075368_10233564 | 3300006042 | Bacteria | 783 |
| 216 | Ga0075432_10196881 | 3300006058 | Bacteria | 796 |
| 217 | Ga0070715_10153230 | 3300006163 | Bacteria | 1131 |
| 218 | Ga0070715_10734516 | 3300006163 | Unclassified | 593 |
| 219 | Ga0070716_100002585 | 3300006173 | Bacteria | 8361 |
| 220 | Ga0070716_100143239 | 3300006173 | Bacteria | 1527 |
| 221 | Ga0070712_100176827 | 3300006175 | Bacteria | 1660 |
| 222 | Ga0070712_100302649 | 3300006175 | Bacteria | 1295 |
| 223 | Ga0070712_100427741 | 3300006175 | Bacteria | 1098 |
| 224 | Ga0070712_100427742 | 3300006175 | Bacteria | 1098 |
| 225 | Ga0075367_10123200 | 3300006178 | Bacteria | 1598 |
| 226 | Ga0075367_10375489 | 3300006178 | Bacteria | 898 |
| 227 | Ga0097621_100000473 | 3300006237 | Bacteria | 28196 |
| 228 | Ga0097621_100008980 | 3300006237 | Bacteria | 7230 |
| 229 | Ga0075370_10353317 | 3300006353 | Bacteria | 878 |
| 230 | Ga0075370_11028316 | 3300006353 | Unclassified | 505 |
| 231 | Ga0068871_100000118 | 3300006358 | Bacteria | 49211 |
| 232 | Ga0068871_100420430 | 3300006358 | Bacteria | 1193 |
| 233 | Ga0075428_100354674 | 3300006844 | Bacteria | 1574 |
| 234 | Ga0075428_100899534 | 3300006844 | Bacteria | 939 |
| 235 | Ga0075431_100295956 | 3300006847 | Bacteria | 1636 |
| 236 | Ga0075433_10010666 | 3300006852 | Bacteria | 7388 |
| 237 | Ga0075433_10548803 | 3300006852 | Unclassified | 1016 |
| 238 | Ga0075433_10567783 | 3300006852 | Bacteria | 997 |
| 239 | Ga0075434_100001964 | 3300006871 | Bacteria | 17837 |
| 240 | Ga0075434_100021155 | 3300006871 | Bacteria | 6322 |
| 241 | Ga0075434_100042779 | 3300006871 | Bacteria | 4491 |
| 242 | Ga0075434_100223533 | 3300006871 | Bacteria | 1902 |
| 243 | Ga0075434_100667880 | 3300006871 | Bacteria | 1057 |
| 244 | Ga0075434_100677953 | 3300006871 | Bacteria | 1049 |
| 245 | Ga0075434_100918790 | 3300006871 | Bacteria | 890 |
| 246 | Ga0068865_100006203 | 3300006881 | Bacteria | 7286 |
| 247 | Ga0068865_100728940 | 3300006881 | Bacteria | 850 |
| 248 | Ga0075436_100213877 | 3300006914 | Unclassified | 1367 |
| 249 | Ga0075436_100350152 | 3300006914 | Bacteria | 1064 |
| 250 | Ga0075436_100547022 | 3300006914 | Unclassified | 850 |
| 251 | Ga0097620_100001568 | 3300006931 | Bacteria | 23306 |
| 252 | Ga0097620_100137077 | 3300006931 | Bacteria | 2521 |
| 253 | Ga0097620_100640126 | 3300006931 | Bacteria | 1155 |
| 254 | Ga0097620_100765560 | 3300006931 | Bacteria | 1054 |
| 255 | Ga0075435_100020961 | 3300007076 | Bacteria | 5020 |
| 256 | Ga0075435_100207547 | 3300007076 | Unclassified | 1661 |
| 257 | Ga0075435_100210657 | 3300007076 | Unclassified | 1649 |
| 258 | Ga0075435_100692254 | 3300007076 | Unclassified | 886 |
| 259 | Ga0075435_101135663 | 3300007076 | Bacteria | 683 |
| 260 | Ga0105245_12304777 | 3300009098 | Bacteria | 592 |
| 261 | Ga0105247_10844701 | 3300009101 | Bacteria | 702 |
| 262 | Ga0105247_11030374 | 3300009101 | Bacteria | 645 |
| 263 | Ga0114129_10025668 | 3300009147 | Bacteria | 8347 |
| 264 | Ga0114129_10342275 | 3300009147 | Bacteria | 1983 |
| 265 | Ga0114129_11443151 | 3300009147 | Bacteria | 848 |
| 266 | Ga0105243_10091515 | 3300009148 | Bacteria | 2505 |
| 267 | Ga0105243_11528744 | 3300009148 | Bacteria | 692 |
| 268 | Ga0105241_10278766 | 3300009174 | Bacteria | 1427 |
| 269 | Ga0105241_11450245 | 3300009174 | Unclassified | 659 |
| 270 | Ga0105241_12060674 | 3300009174 | Bacteria | 563 |
| 271 | Ga0105242_11402813 | 3300009176 | Bacteria | 726 |
| 272 | Ga0105237_11592476 | 3300009545 | Unclassified | 660 |
| 273 | Ga0105238_10798675 | 3300009551 | Bacteria | 959 |
| 274 | Ga0105238_12730515 | 3300009551 | Bacteria | 530 |
| 275 | Ga0105249_11611934 | 3300009553 | Unclassified | 721 |
| 276 | Ga0105239_10809693 | 3300010375 | Bacteria | 1073 |
| 277 | Ga0105239_11463087 | 3300010375 | Bacteria | 789 |
| 278 | Ga0105246_10720845 | 3300011119 | Bacteria | 876 |
| 279 | Ga0157328_1001223 | 3300012478 | Bacteria | 1072 |
| 280 | Ga0157320_1011245 | 3300012481 | Bacteria | 702 |
| 281 | Ga0157319_1032852 | 3300012497 | Bacteria | 570 |
| 282 | Ga0157342_1014627 | 3300012507 | Bacteria | 851 |
| 283 | Ga0157373_10219054 | 3300013100 | Bacteria | 1342 |
| 284 | Ga0157374_11289228 | 3300013296 | Bacteria | 752 |
| 285 | Ga0157374_11592690 | 3300013296 | Unclassified | 677 |
| 286 | Ga0157375_11369081 | 3300013308 | Unclassified | 833 |
| 287 | Ga0157380_11574056 | 3300014326 | Bacteria | 712 |
| 288 | Ga0157377_10308387 | 3300014745 | Bacteria | 1047 |
| 289 | Ga0157379_11186537 | 3300014968 | Bacteria | 734 |
| 290 | Ga0157376_10853847 | 3300014969 | Bacteria | 926 |
| 291 | Ga0163161_10005398 | 3300017792 | Bacteria | 8877 |
| 292 | Ga0206356_10738097 | 3300020070 | Bacteria | 515 |
| 293 | Ga0207666_1000120 | 3300025271 | Bacteria | 12166 |
| 294 | Ga0207666_1002984 | 3300025271 | Bacteria | 2057 |
| 295 | Ga0207673_1002080 | 3300025290 | Bacteria | 2246 |
| 296 | Ga0207697_10000061 | 3300025315 | Bacteria | 45271 |
| 297 | Ga0207697_10049723 | 3300025315 | Bacteria | 1731 |
| 298 | Ga0207713_1021008 | 3300025735 | Bacteria | 3140 |
| 299 | Ga0207682_10000332 | 3300025893 | Bacteria | 21608 |
| 300 | Ga0207692_10003778 | 3300025898 | Bacteria | 5947 |
| 301 | Ga0207692_10030854 | 3300025898 | Bacteria | 2561 |
| 302 | Ga0207692_10092547 | 3300025898 | Bacteria | 1643 |
| 303 | Ga0207642_10000520 | 3300025899 | Bacteria | 11771 |
| 304 | Ga0207710_10003839 | 3300025900 | Bacteria | 6639 |
| 305 | Ga0207710_10004780 | 3300025900 | Bacteria | 5877 |
| 306 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 307 | Ga0207680_10016478 | 3300025903 | Bacteria | 3880 |
| 308 | Ga0207680_10250163 | 3300025903 | Bacteria | 1224 |
| 309 | Ga0207680_10788711 | 3300025903 | Bacteria | 681 |
| 310 | Ga0207647_10083515 | 3300025904 | Bacteria | 1913 |
| 311 | Ga0207685_10007286 | 3300025905 | Bacteria | 3073 |
| 312 | Ga0207685_10008345 | 3300025905 | Bacteria | 2946 |
| 313 | Ga0207699_10005454 | 3300025906 | Bacteria | 6087 |
| 314 | Ga0207699_10061169 | 3300025906 | Bacteria | 2265 |
| 315 | Ga0207645_10000222 | 3300025907 | Bacteria | 47139 |
| 316 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 317 | Ga0207684_11624283 | 3300025910 | Unclassified | 523 |
| 318 | Ga0207654_10008610 | 3300025911 | Bacteria | 5167 |
| 319 | Ga0207654_10226472 | 3300025911 | Bacteria | 1243 |
| 320 | Ga0207707_10001855 | 3300025912 | Bacteria | 19315 |
| 321 | Ga0207707_10023067 | 3300025912 | Bacteria | 5445 |
| 322 | Ga0207707_10168746 | 3300025912 | Bacteria | 1912 |
| 323 | Ga0207707_10721384 | 3300025912 | Unclassified | 836 |
| 324 | Ga0207695_10221647 | 3300025913 | Bacteria | 1798 |
| 325 | Ga0207671_10024205 | 3300025914 | Bacteria | 4569 |
| 326 | Ga0207693_10019742 | 3300025915 | Bacteria | 5358 |
| 327 | Ga0207693_11000737 | 3300025915 | Bacteria | 638 |
| 328 | Ga0207693_11000738 | 3300025915 | Bacteria | 638 |
| 329 | Ga0207663_10025626 | 3300025916 | Bacteria | 3412 |
| 330 | Ga0207663_10081715 | 3300025916 | Bacteria | 2117 |
| 331 | Ga0207663_10997103 | 3300025916 | Unclassified | 672 |
| 332 | Ga0207660_10001147 | 3300025917 | Bacteria | 17672 |
| 333 | Ga0207660_10149471 | 3300025917 | Bacteria | 1793 |
| 334 | Ga0207660_10475742 | 3300025917 | Bacteria | 1012 |
| 335 | Ga0207660_11443093 | 3300025917 | Bacteria | 557 |
| 336 | Ga0207662_10000616 | 3300025918 | Bacteria | 15934 |
| 337 | Ga0207662_10108744 | 3300025918 | Bacteria | 1726 |
| 338 | Ga0207657_10000776 | 3300025919 | Bacteria | 33868 |
| 339 | Ga0207657_10206712 | 3300025919 | Bacteria | 1577 |
| 340 | Ga0207657_10543961 | 3300025919 | Bacteria | 908 |
| 341 | Ga0207657_11136497 | 3300025919 | Bacteria | 596 |
| 342 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 343 | Ga0207649_10403288 | 3300025920 | Bacteria | 1023 |
| 344 | Ga0207649_11300813 | 3300025920 | Unclassified | 575 |
| 345 | Ga0207652_10001328 | 3300025921 | Bacteria | 21958 |
| 346 | Ga0207652_10990076 | 3300025921 | Bacteria | 739 |
| 347 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 348 | Ga0207681_10356887 | 3300025923 | Bacteria | 1171 |
| 349 | Ga0207650_10001385 | 3300025925 | Bacteria | 17487 |
| 350 | Ga0207650_10419749 | 3300025925 | Bacteria | 1110 |
| 351 | Ga0207659_10000132 | 3300025926 | Bacteria | 43798 |
| 352 | Ga0207659_10759185 | 3300025926 | Bacteria | 832 |
| 353 | Ga0207687_10000174 | 3300025927 | Bacteria | 42351 |
| 354 | Ga0207687_10009445 | 3300025927 | Bacteria | 6380 |
| 355 | Ga0207700_10000810 | 3300025928 | Bacteria | 18078 |
| 356 | Ga0207700_10013168 | 3300025928 | Bacteria | 5369 |
| 357 | Ga0207700_10062828 | 3300025928 | Bacteria | 2821 |
| 358 | Ga0207664_10081946 | 3300025929 | Bacteria | 2627 |
| 359 | Ga0207664_10101779 | 3300025929 | Bacteria | 2374 |
| 360 | Ga0207644_10002247 | 3300025931 | Bacteria | 12528 |
| 361 | Ga0207690_10000148 | 3300025932 | Bacteria | 56244 |
| 362 | Ga0207690_11007341 | 3300025932 | Bacteria | 693 |
| 363 | Ga0207706_10018668 | 3300025933 | Bacteria | 6240 |
| 364 | Ga0207706_10132685 | 3300025933 | Bacteria | 2191 |
| 365 | Ga0207706_10206929 | 3300025933 | Bacteria | 1720 |
| 366 | Ga0207686_10009703 | 3300025934 | Bacteria | 5230 |
| 367 | Ga0207686_10109883 | 3300025934 | Bacteria | 1857 |
| 368 | Ga0207709_10000087 | 3300025935 | Bacteria | 155019 |
| 369 | Ga0207709_10052699 | 3300025935 | Bacteria | 2500 |
| 370 | Ga0207709_10888424 | 3300025935 | Bacteria | 724 |
| 371 | Ga0207709_11000282 | 3300025935 | Bacteria | 683 |
| 372 | Ga0207670_10000528 | 3300025936 | Bacteria | 21114 |
| 373 | Ga0207670_10059661 | 3300025936 | Bacteria | 2596 |
| 374 | Ga0207670_10357773 | 3300025936 | Bacteria | 1158 |
| 375 | Ga0207670_10472908 | 3300025936 | Bacteria | 1014 |
| 376 | Ga0207670_10829918 | 3300025936 | Unclassified | 771 |
| 377 | Ga0207669_10000589 | 3300025937 | Bacteria | 15806 |
| 378 | Ga0207704_10000392 | 3300025938 | Bacteria | 19977 |
| 379 | Ga0207665_10007965 | 3300025939 | Bacteria | 6996 |
| 380 | Ga0207665_10050011 | 3300025939 | Bacteria | 2810 |
| 381 | Ga0207691_10000517 | 3300025940 | Bacteria | 38398 |
| 382 | Ga0207711_10011699 | 3300025941 | Bacteria | 7291 |
| 383 | Ga0207711_10228324 | 3300025941 | Bacteria | 1704 |
| 384 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 385 | Ga0207689_10071476 | 3300025942 | Bacteria | 2850 |
| 386 | Ga0207689_10736705 | 3300025942 | Bacteria | 832 |
| 387 | Ga0207661_10007383 | 3300025944 | Bacteria | 7820 |
| 388 | Ga0207661_10089610 | 3300025944 | Bacteria | 2560 |
| 389 | Ga0207679_10000493 | 3300025945 | Bacteria | 27242 |
| 390 | Ga0207679_10375903 | 3300025945 | Bacteria | 1244 |
| 391 | Ga0207679_10598459 | 3300025945 | Bacteria | 993 |
| 392 | Ga0207667_10017867 | 3300025949 | Bacteria | 7971 |
| 393 | Ga0207651_10000051 | 3300025960 | Bacteria | 54163 |
| 394 | Ga0207651_10010449 | 3300025960 | Bacteria | 5147 |
| 395 | Ga0207651_10605747 | 3300025960 | Bacteria | 958 |
| 396 | Ga0207712_10000176 | 3300025961 | Bacteria | 66116 |
| 397 | Ga0207712_10214895 | 3300025961 | Bacteria | 1534 |
| 398 | Ga0207668_10000355 | 3300025972 | Bacteria | 29722 |
| 399 | Ga0207640_10000126 | 3300025981 | Bacteria | 58432 |
| 400 | Ga0207658_10002400 | 3300025986 | Bacteria | 13716 |
| 401 | Ga0207658_10643357 | 3300025986 | Bacteria | 955 |
| 402 | Ga0207677_10066304 | 3300026023 | Bacteria | 2523 |
| 403 | Ga0207677_10390662 | 3300026023 | Unclassified | 1177 |
| 404 | Ga0207703_10001969 | 3300026035 | Bacteria | 18133 |
| 405 | Ga0207703_10507924 | 3300026035 | Bacteria | 1132 |
| 406 | Ga0207703_10769509 | 3300026035 | Bacteria | 918 |
| 407 | Ga0207639_10144388 | 3300026041 | Bacteria | 1986 |
| 408 | Ga0207678_10000531 | 3300026067 | Bacteria | 34761 |
| 409 | Ga0207678_10057976 | 3300026067 | Bacteria | 3333 |
| 410 | Ga0207678_10314500 | 3300026067 | Bacteria | 1347 |
| 411 | Ga0207708_10000573 | 3300026075 | Bacteria | 28465 |
| 412 | Ga0207708_10077261 | 3300026075 | Bacteria | 2555 |
| 413 | Ga0207702_10010346 | 3300026078 | Bacteria | 7814 |
| 414 | Ga0207702_10277286 | 3300026078 | Bacteria | 1584 |
| 415 | Ga0207702_11257496 | 3300026078 | Archaea | 734 |
| 416 | Ga0207641_10001041 | 3300026088 | Bacteria | 28118 |
| 417 | Ga0207648_10000581 | 3300026089 | Bacteria | 41019 |
| 418 | Ga0207676_10000124 | 3300026095 | Bacteria | 67747 |
| 419 | Ga0207676_10004875 | 3300026095 | Bacteria | 9497 |
| 420 | Ga0207676_10193818 | 3300026095 | Bacteria | 1790 |
| 421 | Ga0207676_11769616 | 3300026095 | Unclassified | 616 |
| 422 | Ga0207674_10000095 | 3300026116 | Bacteria | 99278 |
| 423 | Ga0207675_100000414 | 3300026118 | Bacteria | 41042 |
| 424 | Ga0207675_100785923 | 3300026118 | Bacteria | 964 |
| 425 | Ga0207683_10000242 | 3300026121 | Bacteria | 48576 |
| 426 | Ga0207698_10003848 | 3300026142 | Bacteria | 9085 |
| 427 | Ga0209966_1000536 | 3300027695 | Bacteria | 9649 |
| 428 | Ga0209998_10094989 | 3300027717 | Bacteria | 734 |
| 429 | Ga0209998_10214982 | 3300027717 | Bacteria | 504 |
| 430 | Ga0209974_10011505 | 3300027876 | Bacteria | 2969 |
| 431 | Ga0209974_10017542 | 3300027876 | Bacteria | 2374 |
| 432 | Ga0209974_10167187 | 3300027876 | Bacteria | 800 |
| 433 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 434 | Ga0207428_10003190 | 3300027907 | Bacteria | 16047 |
| 435 | Ga0268266_10025994 | 3300028379 | Bacteria | 4980 |
| 436 | Ga0268266_10038038 | 3300028379 | Bacteria | 4097 |
| 437 | Ga0268266_10826655 | 3300028379 | Bacteria | 895 |
| 438 | Ga0268265_10000757 | 3300028380 | Bacteria | 31383 |
| 439 | Ga0268265_12145268 | 3300028380 | Bacteria | 566 |
| 440 | Ga0268264_10177820 | 3300028381 | Bacteria | 1930 |
| 441 | Ga0268264_10320432 | 3300028381 | Bacteria | 1465 |
| 442 | Ga0265325_10000049 | 3300031241 | Bacteria | 80854 |
| 443 | Ga0265340_10369650 | 3300031247 | Bacteria | 633 |
| 444 | Ga0265313_10027525 | 3300031595 | Bacteria | 2973 |
| 445 | Ga0307412_10765917 | 3300031911 | Bacteria | 835 |
| 446 | Ga0373930_0000167 | 3300034816 | Bacteria | 7621 |
| 447 | Ga0373948_0000080 | 3300034817 | Bacteria | 9932 |
| 448 | Ga0373948_0021532 | 3300034817 | Bacteria | 1235 |
| 449 | Ga0373950_0001088 | 3300034818 | Bacteria | 3471 |
| 450 | Ga0373950_0009479 | 3300034818 | Bacteria | 1556 |
| 451 | Ga0373958_0118578 | 3300034819 | Unclassified | 637 |
| 452 | Ga0373959_0005726 | 3300034820 | Bacteria | 2042 |
| 453 | Ga0373959_0008295 | 3300034820 | Bacteria | 1765 |
| 454 | Ga0373959_0054023 | 3300034820 | Unclassified | 874 |
| 455 | Ga0373938_0002758 | 3300034957 | Bacteria | 2835 |
| 456 | Ga0373938_0105208 | 3300034957 | Bacteria | 713 |
| 457 | Ga0373926_0007052 | 3300035083 | Bacteria | 3739 |
| 458 | Ga0373928_0005786 | 3300035084 | Bacteria | 2365 |
| 459 | Ga0373928_0008944 | 3300035084 | Bacteria | 1954 |
| 460 | Ga0373929_0000333 | 3300035085 | Bacteria | 8758 |
| 461 | Ga0373929_0063482 | 3300035085 | Bacteria | 869 |
| 462 | Ga0373929_0130608 | 3300035085 | Bacteria | 658 |
| 463 | Ga0373929_0148072 | 3300035085 | Unclassified | 628 |
| 464 | Ga0373934_0065473 | 3300035086 | Unclassified | 1451 |
| 465 | Ga0373940_0001034 | 3300035088 | Bacteria | 4787 |
| 466 | Ga0373944_0008009 | 3300035089 | Bacteria | 2848 |
| 467 | Ga0373944_0105982 | 3300035089 | Bacteria | 955 |
| 468 | Ga0373944_0177098 | 3300035089 | Bacteria | 763 |
| 469 | Ga0373949_0002294 | 3300035090 | Bacteria | 4975 |
| 470 | Ga0373949_0067769 | 3300035090 | Bacteria | 929 |
| 471 | Ga0373951_0004760 | 3300035091 | Bacteria | 3201 |
| 472 | Ga0373951_0009985 | 3300035091 | Bacteria | 2131 |
| 473 | Ga0373952_0001546 | 3300035092 | Bacteria | 4195 |
| 474 | Ga0373952_0001876 | 3300035092 | Bacteria | 3819 |
| 475 | Ga0373952_0016287 | 3300035092 | Bacteria | 1510 |
| 476 | Ga0373932_0000216 | 3300035112 | Bacteria | 17011 |
| 477 | Ga0373932_0004711 | 3300035112 | Bacteria | 3218 |
| 478 | Ga0373936_0010734 | 3300035113 | Bacteria | 3459 |
| 479 | Ga0373936_0325321 | 3300035113 | Bacteria | 697 |
| 480 | Ga0373936_0592755 | 3300035113 | Unclassified | 520 |
| 481 | Ga0373939_0000125 | 3300035114 | Bacteria | 22622 |
| 482 | Ga0373941_0064473 | 3300035115 | Bacteria | 1200 |
| 483 | Ga0373941_0068623 | 3300035115 | Bacteria | 1172 |
| 484 | Ga0373945_0005524 | 3300035116 | Bacteria | 4049 |
| 485 | Ga0373945_0015449 | 3300035116 | Bacteria | 2569 |
| 486 | Ga0373953_0063177 | 3300035117 | Bacteria | 1517 |
| 487 | Ga0373954_0028451 | 3300035118 | Bacteria | 2570 |
| 488 | Ga0373954_0343790 | 3300035118 | Bacteria | 737 |
| 489 | Ga0373956_0059761 | 3300035119 | Bacteria | 1725 |
| 490 | Ga0373956_0167260 | 3300035119 | Bacteria | 1037 |
| 491 | Ga0373957_0092391 | 3300035120 | Bacteria | 1204 |
| 492 | Ga0373960_0000232 | 3300035121 | Bacteria | 10352 |
| 493 | Ga0373960_0001024 | 3300035121 | Bacteria | 6023 |
| 494 | Ga0373943_0011235 | 3300035170 | Bacteria | 4028 |
| 495 | Ga0373943_0081381 | 3300035170 | Bacteria | 1661 |
| 496 | Ga0373955_0107113 | 3300035172 | Bacteria | 1612 |
| 497 | Ga0373942_0000176 | 3300035207 | Bacteria | 15978 |
| 498 | Ga0373942_0061067 | 3300035207 | Bacteria | 1081 |
| 499 | Ga0373942_0066837 | 3300035207 | Bacteria | 1041 |
| 500 | Ga0373961_0004636 | 3300035241 | Bacteria | 3315 |
| 501 | Ga0373961_0006457 | 3300035241 | Bacteria | 2816 |
| 502 | Ga0373962_0014531 | 3300035242 | Bacteria | 2007 |
| 503 | Ga0373924_0020150 | 3300035410 | Bacteria | 2589 |
| 504 | Ga0373924_0027139 | 3300035410 | Bacteria | 2276 |
| 505 | Ga0373931_0000124 | 3300035691 | Bacteria | 34887 |
| 506 | Ga0373935_0116159 | 3300035692 | Bacteria | 1782 |
| 507 | Ga0373927_0028225 | 3300035695 | Bacteria | 3661 |
| 508 | Ga0373927_0151289 | 3300035695 | Bacteria | 1519 |
| 509 | Ga0373927_0215606 | 3300035695 | Bacteria | 1261 |
| 510 | Ga0373927_0428799 | 3300035695 | Bacteria | 873 |
| 511 | Ga0373933_0160433 | 3300035724 | Bacteria | 1427 |
| 512 | Ga0373933_0240330 | 3300035724 | Bacteria | 1165 |
| 513 | Ga0373947_0014361 | 3300035725 | Bacteria | 4543 |
| 514 | Ga0373947_0102798 | 3300035725 | Bacteria | 1797 |
| 515 | Ga0373947_0121146 | 3300035725 | Bacteria | 1662 |
| 516 | Ga0373937_0034269 | 3300036401 | Bacteria | 4618 |
| 517 | Ga0373937_0145375 | 3300036401 | Bacteria | 2219 |
| 518 | Ga0373937_0323502 | 3300036401 | Bacteria | 1459 |
| 519 | Ga0373925_0005504 | 3300037068 | Bacteria | 9426 |
| 520 | Ga0373925_0031705 | 3300037068 | Bacteria | 3886 |
| 521 | Ga0373925_0340598 | 3300037068 | Bacteria | 1216 |
| 522 | Ga0395898_0454639 | 3300037466 | Bacteria | 1219 |
| 523 | Ga0395905_0581148 | 3300037471 | Bacteria | 1022 |
| 524 | Ga0395901_0405060 | 3300038443 | Bacteria | 1401 |
| 525 | Ga0436365_0459934 | 3300039437 | Bacteria | 1194 |
| 526 | Ga0451853_3961871 | 3300041512 | Bacteria | 613 |
| 527 | Ga0439450_028188 | 3300042008 | Bacteria | 1248 |
| 528 | Ga0439455_0193515 | 3300042012 | Bacteria | 587 |
| 529 | Ga0450912_010614 | 3300042116 | Bacteria | 791 |
| 530 | Ga0439464_0004464 | 3300042439 | Bacteria | 3583 |
| 531 | Ga0439460_0064879 | 3300042461 | Bacteria | 1121 |
| 532 | Ga0451577_0799660 | 3300042876 | Bacteria | 852 |
| 533 | Ga0466969_0295654 | 3300044656 | Bacteria | 733 |
| 534 | Ga0466966_0033902 | 3300044684 | Bacteria | 3304 |
| 535 | Ga0466961_0314517 | 3300044693 | Bacteria | 955 |
| 536 | Ga0466963_0149506 | 3300044694 | Bacteria | 1621 |
| 537 | Ga0453684_0513542 | 3300044712 | Bacteria | 1325 |
| 538 | Ga0466971_0169602 | 3300044719 | Bacteria | 1024 |
| 539 | Ga0466957_0127929 | 3300044842 | Bacteria | 1624 |
| 540 | Ga0466959_0336860 | 3300045049 | Bacteria | 1029 |
| 541 | Ga0451576_0613609 | 3300045051 | Bacteria | 1143 |
| 542 | Ga0466958_0088959 | 3300045836 | Bacteria | 1908 |
| 543 | Ga0466967_0291786 | 3300045976 | Bacteria | 1567 |
| 544 | Ga0495617_044085 | 3300046452 | Bacteria | 1489 |
| 545 | Ga0495592_0076830 | 3300046454 | Bacteria | 2422 |
| 546 | Ga0495592_0113131 | 3300046454 | Bacteria | 1918 |
| 547 | Ga0495603_0033829 | 3300046455 | Bacteria | 3075 |
| 548 | Ga0495603_0063121 | 3300046455 | Bacteria | 2186 |
| 549 | Ga0495603_0125214 | 3300046455 | Bacteria | 1497 |
| 550 | Ga0495629_0005418 | 3300046459 | Bacteria | 9518 |
| 551 | Ga0495629_0357597 | 3300046459 | Bacteria | 995 |
| 552 | Ga0495638_0122194 | 3300046460 | Bacteria | 1537 |
| 553 | Ga0495638_0255206 | 3300046460 | Bacteria | 965 |
| 554 | Ga0495651_0116918 | 3300046462 | Bacteria | 1963 |
| 555 | Ga0495580_0090643 | 3300046472 | Unclassified | 2129 |
| 556 | Ga0495582_0051485 | 3300046473 | Bacteria | 2270 |
| 557 | Ga0495639_0200635 | 3300046475 | Bacteria | 976 |
| 558 | Ga0495662_0074482 | 3300046476 | Unclassified | 1647 |
| 559 | Ga0495664_0033039 | 3300046477 | Bacteria | 3040 |
| 560 | Ga0495584_0053185 | 3300046491 | Bacteria | 2038 |
| 561 | Ga0495585_0003758 | 3300046492 | Bacteria | 10133 |
| 562 | Ga0495594_0003490 | 3300046499 | Bacteria | 8108 |
| 563 | Ga0495594_0053988 | 3300046499 | Bacteria | 2214 |
| 564 | Ga0495607_0084698 | 3300046501 | Bacteria | 1733 |
| 565 | Ga0495608_0032489 | 3300046511 | Bacteria | 3528 |
| 566 | Ga0495618_0204570 | 3300046514 | Bacteria | 1249 |
| 567 | Ga0495618_0916053 | 3300046514 | Unclassified | 505 |
| 568 | Ga0495628_0007284 | 3300046516 | Bacteria | 9588 |
| 569 | Ga0495628_0319584 | 3300046516 | Unclassified | 1146 |
| 570 | Ga0495631_0030448 | 3300046518 | Bacteria | 2448 |
| 571 | Ga0495637_0058619 | 3300046520 | Bacteria | 1587 |
| 572 | Ga0495644_0012715 | 3300046523 | Bacteria | 3236 |
| 573 | Ga0495666_0021852 | 3300046526 | Bacteria | 3167 |
| 574 | Ga0495666_0238565 | 3300046526 | Bacteria | 830 |
| 575 | Ga0495652_0172977 | 3300046529 | Bacteria | 1665 |
| 576 | Ga0495652_0517797 | 3300046529 | Bacteria | 825 |
| 577 | Ga0495640_0017163 | 3300046533 | Bacteria | 5401 |
| 578 | Ga0495586_0065777 | 3300046535 | Bacteria | 1976 |
| 579 | Ga0495587_0194638 | 3300046536 | Bacteria | 1147 |
| 580 | Ga0495587_0422177 | 3300046536 | Bacteria | 740 |
| 581 | Ga0495598_0013102 | 3300046537 | Bacteria | 2049 |
| 582 | Ga0495609_0041317 | 3300046538 | Bacteria | 2073 |
| 583 | Ga0495609_0091173 | 3300046538 | Bacteria | 1326 |
| 584 | Ga0495621_0042575 | 3300046539 | Unclassified | 1599 |
| 585 | Ga0495645_0005770 | 3300046543 | Bacteria | 8538 |
| 586 | Ga0495622_0221005 | 3300046557 | Unclassified | 839 |
| 587 | Ga0495633_0005630 | 3300046558 | Bacteria | 7595 |
| 588 | Ga0495656_0018371 | 3300046615 | Bacteria | 2683 |
| 589 | Ga0495668_0381883 | 3300046616 | Bacteria | 774 |
| 590 | Ga0495635_0235846 | 3300046663 | Bacteria | 1235 |
| 591 | Ga0495659_0003259 | 3300046664 | Bacteria | 5204 |
| 592 | Ga0495661_0037705 | 3300046665 | Bacteria | 3016 |
| 593 | Ga0495588_0136414 | 3300046674 | Bacteria | 1295 |
| 594 | Ga0495588_0140981 | 3300046674 | Bacteria | 1273 |
| 595 | Ga0495657_0065914 | 3300046675 | Bacteria | 2381 |
| 596 | Ga0495623_0258511 | 3300046679 | Bacteria | 976 |
| 597 | Ga0495646_0356975 | 3300046680 | Bacteria | 765 |
| 598 | Ga0495647_0021374 | 3300046681 | Bacteria | 2329 |
| 599 | Ga0495658_0084743 | 3300046683 | Bacteria | 1866 |
| 600 | Ga0495658_0424629 | 3300046683 | Bacteria | 848 |
| 601 | Ga0495669_0342649 | 3300046684 | Bacteria | 722 |
| 602 | Ga0495613_0006657 | 3300046689 | Bacteria | 8631 |
| 603 | Ga0495613_0071710 | 3300046689 | Bacteria | 2525 |
| 604 | Ga0495624_0036676 | 3300046690 | Bacteria | 3159 |
| 605 | Ga0495670_0003018 | 3300046691 | Bacteria | 8304 |
| 606 | Ga0495671_0044577 | 3300046692 | Bacteria | 2223 |
| 607 | Ga0495589_0051818 | 3300046794 | Bacteria | 2028 |
| 608 | Ga0495600_0839566 | 3300046809 | Bacteria | 545 |
| 609 | Ga0495604_0029170 | 3300047317 | Bacteria | 4389 |
| 610 | Ga0495636_0074309 | 3300047318 | Bacteria | 1456 |
| 611 | Ga0495674_0140552 | 3300047319 | Unclassified | 2030 |
| 612 | Ga0495676_0157557 | 3300047321 | Bacteria | 1609 |
| 613 | Ga0495680_0041875 | 3300047322 | Bacteria | 3637 |
| 614 | Ga0495680_0045246 | 3300047322 | Bacteria | 3476 |
| 615 | Ga0495675_0388958 | 3300047444 | Bacteria | 815 |
| 616 | Ga0495679_078840 | 3300047446 | Bacteria | 938 |
| 617 | Ga0495681_0272553 | 3300047470 | Bacteria | 662 |
| 618 | Ga0495614_0014398 | 3300048089 | Bacteria | 3462 |
| 619 | Ga0496100_0029405 | 3300048903 | Bacteria | 3398 |
| 620 | Ga0496100_0132875 | 3300048903 | Bacteria | 1755 |
| 621 | Ga0496100_0370757 | 3300048903 | Bacteria | 1085 |
| 622 | Ga0496100_0633087 | 3300048903 | Bacteria | 832 |
| 623 | Ga0496101_0000151 | 3300048904 | Bacteria | 59751 |
| 624 | Ga0496101_0691237 | 3300048904 | Bacteria | 805 |
| 625 | Ga0496102_0024345 | 3300048905 | Bacteria | 5382 |
| 626 | Ga0496102_0027609 | 3300048905 | Bacteria | 5068 |
| 627 | Ga0496102_0029340 | 3300048905 | Bacteria | 4922 |
| 628 | Ga0496102_0309024 | 3300048905 | Bacteria | 1490 |
| 629 | Ga0496103_0006448 | 3300048906 | Bacteria | 7003 |
| 630 | Ga0496103_0089607 | 3300048906 | Bacteria | 1940 |
| 631 | Ga0496103_0168087 | 3300048906 | Bacteria | 1407 |
| 632 | Ga0496103_0569510 | 3300048906 | Bacteria | 722 |
| 633 | Ga0496103_0633909 | 3300048906 | Bacteria | 680 |
| 634 | Ga0496104_0003813 | 3300048907 | Bacteria | 13044 |
| 635 | Ga0496104_0035086 | 3300048907 | Bacteria | 4681 |
| 636 | Ga0496104_0083596 | 3300048907 | Bacteria | 3044 |
| 637 | Ga0496104_0091092 | 3300048907 | Bacteria | 2914 |
| 638 | Ga0496104_0092885 | 3300048907 | Bacteria | 2885 |
| 639 | Ga0496104_0117274 | 3300048907 | Bacteria | 2555 |
| 640 | Ga0496104_0265889 | 3300048907 | Bacteria | 1627 |
| 641 | Ga0496104_0522252 | 3300048907 | Bacteria | 1098 |
| 642 | Ga0496104_1294436 | 3300048907 | Bacteria | 632 |
| 643 | Ga0496105_0001595 | 3300048908 | Bacteria | 16062 |
| 644 | Ga0496105_0170313 | 3300048908 | Bacteria | 1785 |
| 645 | Ga0496105_0346833 | 3300048908 | Bacteria | 1186 |
| 646 | Ga0496105_0680191 | 3300048908 | Bacteria | 791 |
| 647 | Ga0496105_0830124 | 3300048908 | Bacteria | 701 |
| 648 | Ga0496106_0014405 | 3300048909 | Bacteria | 5843 |
| 649 | Ga0496106_0050334 | 3300048909 | Bacteria | 3140 |
| 650 | Ga0496106_0283421 | 3300048909 | Bacteria | 1327 |
| 651 | Ga0496106_0334710 | 3300048909 | Bacteria | 1215 |
| 652 | Ga0496106_0452430 | 3300048909 | Bacteria | 1031 |
| 653 | Ga0496106_0762222 | 3300048909 | Bacteria | 769 |
| 654 | Ga0496106_1053336 | 3300048909 | Bacteria | 638 |
| 655 | Ga0496107_0000118 | 3300048910 | Bacteria | 38697 |
| 656 | Ga0496107_0028493 | 3300048910 | Bacteria | 3969 |
| 657 | Ga0496107_0091881 | 3300048910 | Bacteria | 2218 |
| 658 | Ga0496107_0177076 | 3300048910 | Bacteria | 1583 |
| 659 | Ga0496107_0194003 | 3300048910 | Bacteria | 1509 |
| 660 | Ga0496107_0612130 | 3300048910 | Bacteria | 804 |
| 661 | Ga0496108_0002446 | 3300048911 | Bacteria | 14846 |
| 662 | Ga0496108_0004875 | 3300048911 | Bacteria | 10836 |
| 663 | Ga0496108_0008170 | 3300048911 | Bacteria | 8489 |
| 664 | Ga0496108_0596106 | 3300048911 | Bacteria | 963 |
| 665 | Ga0496109_0001567 | 3300048912 | Bacteria | 19049 |
| 666 | Ga0496109_0007673 | 3300048912 | Bacteria | 9147 |
| 667 | Ga0496109_0014341 | 3300048912 | Bacteria | 6896 |
| 668 | Ga0496109_0025468 | 3300048912 | Bacteria | 5272 |
| 669 | Ga0496109_0033534 | 3300048912 | Bacteria | 4619 |
| 670 | Ga0496109_0051256 | 3300048912 | Bacteria | 3759 |
| 671 | Ga0496109_1152592 | 3300048912 | Bacteria | 712 |
| 672 | Ga0496110_0088224 | 3300048913 | Bacteria | 2770 |
| 673 | Ga0496110_0206078 | 3300048913 | Bacteria | 1787 |
| 674 | Ga0496110_0350461 | 3300048913 | Bacteria | 1345 |
| 675 | Ga0496110_0546741 | 3300048913 | Unclassified | 1052 |
| 676 | Ga0496110_0583708 | 3300048913 | Bacteria | 1014 |
| 677 | Ga0496111_0016804 | 3300048914 | Bacteria | 5048 |
| 678 | Ga0496111_0023319 | 3300048914 | Bacteria | 4344 |
| 679 | Ga0496111_0144813 | 3300048914 | Bacteria | 1761 |
| 680 | Ga0496112_0008258 | 3300048915 | Bacteria | 9315 |
| 681 | Ga0496112_0023998 | 3300048915 | Bacteria | 5834 |
| 682 | Ga0496112_0202841 | 3300048915 | Bacteria | 1942 |
| 683 | Ga0496112_0205887 | 3300048915 | Bacteria | 1925 |
| 684 | Ga0496112_0767287 | 3300048915 | Bacteria | 890 |
| 685 | Ga0496112_0873539 | 3300048915 | Bacteria | 822 |
| 686 | Ga0496113_0011936 | 3300048916 | Bacteria | 5823 |
| 687 | Ga0496113_0012142 | 3300048916 | Bacteria | 5779 |
| 688 | Ga0496113_0726757 | 3300048916 | Bacteria | 791 |
| 689 | Ga0496113_1292783 | 3300048916 | Bacteria | 567 |
| 690 | Ga0496114_0007779 | 3300048917 | Bacteria | 8482 |
| 691 | Ga0496114_0341737 | 3300048917 | Bacteria | 1323 |
| 692 | Ga0496114_1526650 | 3300048917 | Unclassified | 556 |
| 693 | Ga0496115_0035263 | 3300048918 | Bacteria | 3957 |
| 694 | Ga0496115_0063810 | 3300048918 | Bacteria | 2972 |
| 695 | Ga0496115_0299621 | 3300048918 | Bacteria | 1317 |
| 696 | Ga0496115_0707293 | 3300048918 | Bacteria | 791 |
| 697 | Ga0496115_0979710 | 3300048918 | Bacteria | 647 |
| 698 | Ga0496115_0984418 | 3300048918 | Bacteria | 645 |
| 699 | Ga0496121_0389030 | 3300048924 | Bacteria | 917 |
| 700 | Ga0501034_0087583 | 3300049571 | Bacteria | 3113 |
| 701 | Ga0501037_0489821 | 3300049573 | Bacteria | 835 |
| 702 | Ga0501038_0593306 | 3300049574 | Bacteria | 839 |
| 703 | Ga0501040_0149884 | 3300049576 | Bacteria | 1645 |
| 704 | Ga0501041_0089606 | 3300049577 | Bacteria | 1899 |
| 705 | Ga0501043_0187091 | 3300049579 | Bacteria | 1612 |
| 706 | Ga0501043_1044290 | 3300049579 | Bacteria | 580 |
| 707 | Ga0501047_0158202 | 3300049581 | Bacteria | 2138 |
| 708 | Ga0501047_0537551 | 3300049581 | Bacteria | 994 |
| 709 | Ga0501067_0193544 | 3300049583 | Bacteria | 1133 |
| 710 | Ga0501069_0034940 | 3300049585 | Bacteria | 2768 |
| 711 | Ga0501069_0123124 | 3300049585 | Bacteria | 1482 |
| 712 | Ga0501070_0087049 | 3300049586 | Bacteria | 2586 |
| 713 | Ga0501070_0228354 | 3300049586 | Bacteria | 1525 |
| 714 | Ga0501070_0592745 | 3300049586 | Bacteria | 884 |
| 715 | Ga0501070_1162523 | 3300049586 | Bacteria | 593 |
| 716 | Ga0501071_0244708 | 3300049587 | Bacteria | 1353 |
| 717 | Ga0501072_0633404 | 3300049588 | Bacteria | 842 |
| 718 | Ga0501072_0652782 | 3300049588 | Bacteria | 828 |
| 719 | Ga0501073_0070644 | 3300049589 | Bacteria | 2432 |
| 720 | Ga0501073_0211640 | 3300049589 | Bacteria | 1340 |
| 721 | Ga0501073_0331045 | 3300049589 | Bacteria | 1051 |
| 722 | Ga0501073_0905649 | 3300049589 | Bacteria | 607 |
| 723 | Ga0501074_0131812 | 3300049590 | Bacteria | 1788 |
| 724 | Ga0501074_0480881 | 3300049590 | Bacteria | 880 |
| 725 | Ga0501074_0566329 | 3300049590 | Bacteria | 804 |
| 726 | Ga0501075_0002913 | 3300049591 | Bacteria | 11483 |
| 727 | Ga0501076_0020221 | 3300049592 | Bacteria | 5094 |
| 728 | Ga0501076_0676523 | 3300049592 | Bacteria | 852 |
| 729 | Ga0501076_1006433 | 3300049592 | Bacteria | 687 |
| 730 | Ga0501077_0014314 | 3300049593 | Bacteria | 4983 |
| 731 | Ga0501077_0054700 | 3300049593 | Bacteria | 2534 |
| 732 | Ga0501079_0022226 | 3300049741 | Bacteria | 4862 |
| 733 | Ga0501079_0309137 | 3300049741 | Bacteria | 1237 |
| 734 | Ga0501080_0180173 | 3300049742 | Bacteria | 1945 |
| 735 | Ga0501080_0769613 | 3300049742 | Bacteria | 846 |
| 736 | Ga0501080_0957302 | 3300049742 | Unclassified | 744 |
| 737 | Ga0501080_1092781 | 3300049742 | Bacteria | 689 |
| 738 | Ga0501081_0000595 | 3300049743 | Bacteria | 20607 |
| 739 | Ga0501081_0110220 | 3300049743 | Bacteria | 1953 |
| 740 | Ga0501083_0604780 | 3300049744 | Bacteria | 713 |
| 741 | Ga0501083_0638958 | 3300049744 | Bacteria | 692 |
| 742 | Ga0501083_0692158 | 3300049744 | Bacteria | 663 |
| 743 | Ga0501035_0003762 | 3300049822 | Bacteria | 14460 |
| 744 | Ga0501044_0100974 | 3300049823 | Bacteria | 2903 |
| 745 | Ga0501044_0232536 | 3300049823 | Bacteria | 1790 |
| 746 | Ga0501045_1260393 | 3300049824 | Bacteria | 539 |
| 747 | nmdc:mga0k408_427641_c1 | 3300050493 | Bacteria | 787 |
| 748 | nmdc:mga06z11_53984_c1 | 3300050494 | Bacteria | 2069 |
| 749 | nmdc:mga07m45_323256_c1 | 3300050496 | Bacteria | 897 |
| 750 | nmdc:mga05p37_59706_c1 | 3300050507 | Bacteria | 4696 |
| 751 | nmdc:mga06r32_687334_c1 | 3300050510 | Bacteria | 989 |
| 752 | nmdc:mga08y16_243413_c1 | 3300050511 | Bacteria | 1859 |
| 753 | nmdc:mga08y16_333_c1 | 3300050511 | Bacteria | 42807 |
| 754 | nmdc:mga08y16_41762_c1 | 3300050511 | Bacteria | 4804 |
| 755 | nmdc:mga08y16_90680_c1 | 3300050511 | Bacteria | 3186 |
| 756 | nmdc:mga0n895_13320_c1 | 3300050512 | Bacteria | 7415 |
| 757 | nmdc:mga0n895_29477_c1 | 3300050512 | Bacteria | 5235 |
| 758 | nmdc:mga0n895_402224_c1 | 3300050512 | Bacteria | 1385 |
| 759 | nmdc:mga0n895_62_c1 | 3300050512 | Bacteria | 62891 |
| 760 | nmdc:mga0n895_633841_c1 | 3300050512 | Bacteria | 1069 |
| 761 | nmdc:mga0n895_649955_c1 | 3300050512 | Bacteria | 1053 |
| 762 | nmdc:mga0rr50_14190_c1 | 3300050513 | Bacteria | 5217 |
| 763 | nmdc:mga0rr50_167156_c1 | 3300050513 | Bacteria | 1789 |
| 764 | nmdc:mga0rr50_39550_c1 | 3300050513 | Bacteria | 3422 |
| 765 | nmdc:mga0rr50_435635_c1 | 3300050513 | Bacteria | 1110 |
| 766 | nmdc:mga0rr50_67222_c1 | 3300050513 | Unclassified | 2722 |
| 767 | nmdc:mga0rr50_906756_c1 | 3300050513 | Bacteria | 751 |
| 768 | nmdc:mga08x19_188511_c1 | 3300050514 | Bacteria | 1410 |
| 769 | nmdc:mga08x19_316665_c1 | 3300050514 | Bacteria | 1085 |
| 770 | nmdc:mga08x19_423684_c1 | 3300050514 | Bacteria | 935 |
| 771 | nmdc:mga0a205_160430_c1 | 3300050515 | Bacteria | 2145 |
| 772 | nmdc:mga0a205_394761_c1 | 3300050515 | Bacteria | 1247 |
| 773 | nmdc:mga0a205_557610_c1 | 3300050515 | Unclassified | 1001 |
| 774 | nmdc:mga0a205_7202_c1 | 3300050515 | Bacteria | 10058 |
| 775 | nmdc:mga0a205_96413_c1 | 3300050515 | Bacteria | 2856 |
| 776 | Ga0495601_0018908 | 3300053077 | Bacteria | 4197 |
| 777 | Ga0495601_0220581 | 3300053077 | Bacteria | 1238 |
| 778 | Ga0495612_0012859 | 3300053078 | Bacteria | 3373 |
| 779 | Ga0495612_0046322 | 3300053078 | Bacteria | 1781 |
| 780 | Ga0495595_0011676 | 3300053084 | Bacteria | 3677 |
| 781 | Ga0495595_0019992 | 3300053084 | Bacteria | 2910 |
| 782 | Ga0495595_0086694 | 3300053084 | Bacteria | 1498 |
| 783 | Ga0495619_0002485 | 3300053085 | Bacteria | 12063 |
| 784 | Ga0495619_0051751 | 3300053085 | Bacteria | 2714 |
| 785 | Ga0495619_0114009 | 3300053085 | Bacteria | 1849 |
| 786 | Ga0500644_0494901 | 3300053088 | Bacteria | 538 |
| 787 | Ga0500646_0142524 | 3300053090 | Unclassified | 788 |
| 788 | Ga0500641_0016625 | 3300053096 | Bacteria | 2742 |
| 789 | Ga0500641_0093896 | 3300053096 | Bacteria | 1282 |
| 790 | Ga0500577_0009850 | 3300053142 | Bacteria | 2790 |
| 791 | Ga0500588_0214755 | 3300053146 | Bacteria | 716 |
| 792 | Ga0500589_231828 | 3300053147 | Bacteria | 689 |
| 793 | Ga0500604_0054395 | 3300053151 | Bacteria | 1243 |
| 794 | Ga0501084_0323640 | 3300054114 | Bacteria | 1302 |
| 795 | Ga0501082_0003176 | 3300060353 | Bacteria | 14331 |
| 796 | Ga0501082_0168092 | 3300060353 | Bacteria | 1906 |
| 797 | Ga0501082_0394239 | 3300060353 | Bacteria | 1208 |
| 798 | Ga0466962_0286655 | 3300061719 | Bacteria | 813 |
| 799 | Ga0530510_0501479 | 3300061734 | Bacteria | 920 |
| 800 | Ga0530510_0624427 | 3300061734 | Bacteria | 820 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053147 | Ga0500589_231828 | Ga0500589_231828_378_674 | 79 |
| 2 | 3300053088 | Ga0500644_0494901 | Ga0500644_0494901_21_314 | 80 |
| 3 | 3300046460 | Ga0495638_0255206 | Ga0495638_0255206_531_827 | 90 |
| 4 | 3300046616 | Ga0495668_0381883 | Ga0495668_0381883_214_510 | 90 |
| 5 | 3300053096 | Ga0500641_0016625 | Ga0500641_0016625_2279_2575 | 90 |
| 6 | 3300053146 | Ga0500588_0214755 | Ga0500588_0214755_282_578 | 90 |
| 7 | 3300053151 | Ga0500604_0054395 | Ga0500604_0054395_68_364 | 90 |
| 8 | 3300005535 | Ga0070684_101445594 | Ga0070684_1014455941 | 94 |
| 9 | 3300005937 | Ga0081455_10000664 | Ga0081455_1000066439 | 94 |
| 10 | 3300006042 | Ga0075368_10233564 | Ga0075368_102335642 | 94 |
| 11 | 3300006871 | Ga0075434_100223533 | Ga0075434_1002235334 | 94 |
| 12 | 3300009098 | Ga0105245_12304777 | Ga0105245_123047771 | 95 |
| 13 | 3300026078 | Ga0207702_11257496 | Ga0207702_112574962 | 95 |
| 14 | 3300035119 | Ga0373956_0167260 | Ga0373956_0167260_670_960 | 95 |
| 15 | 3300035120 | Ga0373957_0092391 | Ga0373957_0092391_528_818 | 95 |
| 16 | 3300035724 | Ga0373933_0240330 | Ga0373933_0240330_472_762 | 95 |
| 17 | 3300036401 | Ga0373937_0323502 | Ga0373937_0323502_1063_1353 | 95 |
| 18 | 3300046536 | Ga0495587_0422177 | Ga0495587_0422177_163_453 | 95 |
| 19 | 3300053084 | Ga0495595_0011676 | Ga0495595_0011676_1194_1484 | 95 |
| 20 | 3300053085 | Ga0495619_0114009 | Ga0495619_0114009_1207_1497 | 95 |
| 21 | 3300003203 | JGI25406J46586_10032704 | JGI25406J46586_100327043 | 96 |
| 22 | 3300005336 | Ga0070680_100330323 | Ga0070680_1003303233 | 96 |
| 23 | 3300005434 | Ga0070709_10012395 | Ga0070709_100123954 | 96 |
| 24 | 3300005435 | Ga0070714_100134390 | Ga0070714_1001343903 | 96 |
| 25 | 3300005436 | Ga0070713_100091102 | Ga0070713_1000911024 | 96 |
| 26 | 3300005437 | Ga0070710_10003513 | Ga0070710_100035134 | 96 |
| 27 | 3300005439 | Ga0070711_100115183 | Ga0070711_1001151832 | 96 |
| 28 | 3300005440 | Ga0070705_101625178 | Ga0070705_1016251782 | 96 |
| 29 | 3300005471 | Ga0070698_100398161 | Ga0070698_1003981612 | 96 |
| 30 | 3300005546 | Ga0070696_100196720 | Ga0070696_1001967201 | 96 |
| 31 | 3300005547 | Ga0070693_101248257 | Ga0070693_1012482571 | 96 |
| 32 | 3300005983 | Ga0081540_1004712 | Ga0081540_10047123 | 96 |
| 33 | 3300005985 | Ga0081539_10100755 | Ga0081539_101007553 | 96 |
| 34 | 3300006028 | Ga0070717_10067963 | Ga0070717_100679633 | 96 |
| 35 | 3300006163 | Ga0070715_10153230 | Ga0070715_101532302 | 96 |
| 36 | 3300006173 | Ga0070716_100143239 | Ga0070716_1001432393 | 96 |
| 37 | 3300006175 | Ga0070712_100427741 | Ga0070712_1004277412 | 96 |
| 38 | 3300006175 | Ga0070712_100427742 | Ga0070712_1004277422 | 96 |
| 39 | 3300006844 | Ga0075428_100899534 | Ga0075428_1008995342 | 96 |
| 40 | 3300006847 | Ga0075431_100295956 | Ga0075431_1002959563 | 96 |
| 41 | 3300009147 | Ga0114129_11443151 | Ga0114129_114431512 | 96 |
| 42 | 3300010375 | Ga0105239_10809693 | Ga0105239_108096932 | 96 |
| 43 | 3300025898 | Ga0207692_10003778 | Ga0207692_100037786 | 96 |
| 44 | 3300025905 | Ga0207685_10008345 | Ga0207685_100083453 | 96 |
| 45 | 3300025906 | Ga0207699_10061169 | Ga0207699_100611693 | 96 |
| 46 | 3300025915 | Ga0207693_11000737 | Ga0207693_110007371 | 96 |
| 47 | 3300025915 | Ga0207693_11000738 | Ga0207693_110007381 | 96 |
| 48 | 3300025916 | Ga0207663_10025626 | Ga0207663_100256266 | 96 |
| 49 | 3300025928 | Ga0207700_10000810 | Ga0207700_1000081010 | 96 |
| 50 | 3300025929 | Ga0207664_10101779 | Ga0207664_101017793 | 96 |
| 51 | 3300025939 | Ga0207665_10050011 | Ga0207665_100500113 | 96 |
| 52 | 3300041512 | Ga0451853_3961871 | Ga0451853_3961871_120_413 | 96 |
| 53 | 3300046460 | Ga0495638_0122194 | Ga0495638_0122194_831_1127 | 96 |
| 54 | 3300048903 | Ga0496100_0132875 | Ga0496100_0132875_510_803 | 96 |
| 55 | 3300048903 | Ga0496100_0633087 | Ga0496100_0633087_285_578 | 96 |
| 56 | 3300048905 | Ga0496102_0309024 | Ga0496102_0309024_1084_1377 | 96 |
| 57 | 3300048907 | Ga0496104_1294436 | Ga0496104_1294436_15_308 | 96 |
| 58 | 3300048910 | Ga0496107_0194003 | Ga0496107_0194003_187_480 | 96 |
| 59 | 3300048913 | Ga0496110_0350461 | Ga0496110_0350461_75_368 | 96 |
| 60 | 3300048915 | Ga0496112_0767287 | Ga0496112_0767287_417_710 | 96 |
| 61 | 3300048917 | Ga0496114_1526650 | Ga0496114_1526650_116_409 | 96 |
| 62 | 3300050510 | nmdc:mga06r32_687334_c1 | nmdc:mga06r32_687334_c1_190_483 | 96 |
| 63 | 3300050513 | nmdc:mga0rr50_167156_c1 | nmdc:mga0rr50_167156_c1_1060_1353 | 96 |
| 64 | 3300050513 | nmdc:mga0rr50_906756_c1 | nmdc:mga0rr50_906756_c1_253_546 | 96 |
| 65 | 3300050515 | nmdc:mga0a205_394761_c1 | nmdc:mga0a205_394761_c1_473_766 | 96 |
| 66 | 3300053090 | Ga0500646_0142524 | Ga0500646_0142524_162_458 | 96 |
| 67 | 3300053096 | Ga0500641_0093896 | Ga0500641_0093896_74_370 | 96 |
| 68 | 3300053142 | Ga0500577_0009850 | Ga0500577_0009850_330_626 | 96 |
| 69 | 3300060353 | Ga0501082_0394239 | Ga0501082_0394239_92_385 | 96 |
| 70 | 3300005290 | Ga0065712_10145316 | Ga0065712_101453163 | 97 |
| 71 | 3300005331 | Ga0070670_100175861 | Ga0070670_1001758612 | 97 |
| 72 | 3300005337 | Ga0070682_100099045 | Ga0070682_1000990453 | 97 |
| 73 | 3300005340 | Ga0070689_102043790 | Ga0070689_1020437901 | 97 |
| 74 | 3300005364 | Ga0070673_100793553 | Ga0070673_1007935532 | 97 |
| 75 | 3300005365 | Ga0070688_100916269 | Ga0070688_1009162692 | 97 |
| 76 | 3300005458 | Ga0070681_10775270 | Ga0070681_107752702 | 97 |
| 77 | 3300005547 | Ga0070693_100250330 | Ga0070693_1002503303 | 97 |
| 78 | 3300005563 | Ga0068855_100839480 | Ga0068855_1008394802 | 97 |
| 79 | 3300005614 | Ga0068856_100983673 | Ga0068856_1009836732 | 97 |
| 80 | 3300005617 | Ga0068859_100765446 | Ga0068859_1007654462 | 97 |
| 81 | 3300005618 | Ga0068864_100098570 | Ga0068864_1000985703 | 97 |
| 82 | 3300006178 | Ga0075367_10375489 | Ga0075367_103754892 | 97 |
| 83 | 3300006353 | Ga0075370_10353317 | Ga0075370_103533172 | 97 |
| 84 | 3300006871 | Ga0075434_100667880 | Ga0075434_1006678802 | 97 |
| 85 | 3300006931 | Ga0097620_100765560 | Ga0097620_1007655602 | 97 |
| 86 | 3300009147 | Ga0114129_10342275 | Ga0114129_103422751 | 97 |
| 87 | 3300009174 | Ga0105241_10278766 | Ga0105241_102787661 | 97 |
| 88 | 3300009174 | Ga0105241_11450245 | Ga0105241_114502451 | 97 |
| 89 | 3300009551 | Ga0105238_10798675 | Ga0105238_107986751 | 97 |
| 90 | 3300013296 | Ga0157374_11289228 | Ga0157374_112892282 | 97 |
| 91 | 3300014326 | Ga0157380_11574056 | Ga0157380_115740562 | 97 |
| 92 | 3300014968 | Ga0157379_11186537 | Ga0157379_111865372 | 97 |
| 93 | 3300025925 | Ga0207650_10419749 | Ga0207650_104197492 | 97 |
| 94 | 3300025936 | Ga0207670_10357773 | Ga0207670_103577732 | 97 |
| 95 | 3300025936 | Ga0207670_10829918 | Ga0207670_108299181 | 97 |
| 96 | 3300025941 | Ga0207711_10228324 | Ga0207711_102283242 | 97 |
| 97 | 3300025942 | Ga0207689_10736705 | Ga0207689_107367052 | 97 |
| 98 | 3300025945 | Ga0207679_10375903 | Ga0207679_103759032 | 97 |
| 99 | 3300026023 | Ga0207677_10390662 | Ga0207677_103906622 | 97 |
| 100 | 3300026035 | Ga0207703_10769509 | Ga0207703_107695092 | 97 |
| 101 | 3300026078 | Ga0207702_10277286 | Ga0207702_102772862 | 97 |
| 102 | 3300026095 | Ga0207676_10193818 | Ga0207676_101938182 | 97 |
| 103 | 3300031911 | Ga0307412_10765917 | Ga0307412_107659172 | 97 |
| 104 | 3300035085 | Ga0373929_0130608 | Ga0373929_0130608_354_647 | 97 |
| 105 | 3300037471 | Ga0395905_0581148 | Ga0395905_0581148_466_762 | 97 |
| 106 | 3300048907 | Ga0496104_0091092 | Ga0496104_0091092_918_1211 | 97 |
| 107 | 3300048908 | Ga0496105_0346833 | Ga0496105_0346833_405_698 | 97 |
| 108 | 3300048909 | Ga0496106_0452430 | Ga0496106_0452430_630_923 | 97 |
| 109 | 3300048910 | Ga0496107_0612130 | Ga0496107_0612130_111_404 | 97 |
| 110 | 3300048911 | Ga0496108_0008170 | Ga0496108_0008170_1333_1626 | 97 |
| 111 | 3300048912 | Ga0496109_0033534 | Ga0496109_0033534_2768_3061 | 97 |
| 112 | 3300048913 | Ga0496110_0088224 | Ga0496110_0088224_1969_2262 | 97 |
| 113 | 3300048914 | Ga0496111_0023319 | Ga0496111_0023319_2369_2662 | 97 |
| 114 | 3300048915 | Ga0496112_0008258 | Ga0496112_0008258_3099_3392 | 97 |
| 115 | 3300048916 | Ga0496113_0012142 | Ga0496113_0012142_4188_4481 | 97 |
| 116 | 3300048918 | Ga0496115_0984418 | Ga0496115_0984418_54_347 | 97 |
| 117 | 3300049571 | Ga0501034_0087583 | Ga0501034_0087583_1328_1624 | 97 |
| 118 | 3300049573 | Ga0501037_0489821 | Ga0501037_0489821_134_430 | 97 |
| 119 | 3300049579 | Ga0501043_0187091 | Ga0501043_0187091_358_654 | 97 |
| 120 | 3300049579 | Ga0501043_1044290 | Ga0501043_1044290_82_402 | 97 |
| 121 | 3300049581 | Ga0501047_0158202 | Ga0501047_0158202_83_379 | 97 |
| 122 | 3300049581 | Ga0501047_0537551 | Ga0501047_0537551_290_610 | 97 |
| 123 | 3300049583 | Ga0501067_0193544 | Ga0501067_0193544_686_1006 | 97 |
| 124 | 3300049585 | Ga0501069_0034940 | Ga0501069_0034940_819_1115 | 97 |
| 125 | 3300049586 | Ga0501070_0087049 | Ga0501070_0087049_317_613 | 97 |
| 126 | 3300049586 | Ga0501070_0228354 | Ga0501070_0228354_1050_1370 | 97 |
| 127 | 3300049587 | Ga0501071_0244708 | Ga0501071_0244708_467_787 | 97 |
| 128 | 3300049588 | Ga0501072_0633404 | Ga0501072_0633404_214_534 | 97 |
| 129 | 3300049589 | Ga0501073_0070644 | Ga0501073_0070644_524_844 | 97 |
| 130 | 3300049589 | Ga0501073_0331045 | Ga0501073_0331045_638_934 | 97 |
| 131 | 3300049590 | Ga0501074_0566329 | Ga0501074_0566329_190_486 | 97 |
| 132 | 3300049741 | Ga0501079_0309137 | Ga0501079_0309137_103_399 | 97 |
| 133 | 3300049742 | Ga0501080_0769613 | Ga0501080_0769613_465_812 | 97 |
| 134 | 3300049742 | Ga0501080_1092781 | Ga0501080_1092781_357_653 | 97 |
| 135 | 3300049744 | Ga0501083_0638958 | Ga0501083_0638958_197_517 | 97 |
| 136 | 3300049822 | Ga0501035_0003762 | Ga0501035_0003762_6701_7000 | 97 |
| 137 | 3300049823 | Ga0501044_0100974 | Ga0501044_0100974_200_496 | 97 |
| 138 | 3300049823 | Ga0501044_0232536 | Ga0501044_0232536_482_802 | 97 |
| 139 | 3300050496 | nmdc:mga07m45_323256_c1 | nmdc:mga07m45_323256_c1_170_463 | 97 |
| 140 | 3300050512 | nmdc:mga0n895_633841_c1 | nmdc:mga0n895_633841_c1_304_597 | 97 |
| 141 | 3300001976 | JGI24752J21851_1011378 | JGI24752J21851_10113782 | 98 |
| 142 | 3300001978 | JGI24747J21853_1009515 | JGI24747J21853_10095152 | 98 |
| 143 | 3300001989 | JGI24739J22299_10062937 | JGI24739J22299_100629372 | 98 |
| 144 | 3300001990 | JGI24737J22298_10000053 | JGI24737J22298_100000532 | 98 |
| 145 | 3300001991 | JGI24743J22301_10039413 | JGI24743J22301_100394132 | 98 |
| 146 | 3300002070 | JGI24750J21931_1005416 | JGI24750J21931_10054163 | 98 |
| 147 | 3300002073 | JGI24745J21846_1014742 | JGI24745J21846_10147422 | 98 |
| 148 | 3300002075 | JGI24738J21930_10023527 | JGI24738J21930_100235272 | 98 |
| 149 | 3300002077 | JGI24744J21845_10031963 | JGI24744J21845_100319632 | 98 |
| 150 | 3300002126 | JGI24035J26624_1009285 | JGI24035J26624_10092852 | 98 |
| 151 | 3300002155 | JGI24033J26618_1018880 | JGI24033J26618_10188802 | 98 |
| 152 | 3300002244 | JGI24742J22300_10000381 | JGI24742J22300_100003812 | 98 |
| 153 | 3300005290 | Ga0065712_10147284 | Ga0065712_101472842 | 98 |
| 154 | 3300005293 | Ga0065715_10135200 | Ga0065715_101352002 | 98 |
| 155 | 3300005328 | Ga0070676_10000302 | Ga0070676_1000030224 | 98 |
| 156 | 3300005329 | Ga0070683_100003623 | Ga0070683_1000036234 | 98 |
| 157 | 3300005330 | Ga0070690_100000253 | Ga0070690_10000025323 | 98 |
| 158 | 3300005331 | Ga0070670_100011774 | Ga0070670_1000117744 | 98 |
| 159 | 3300005333 | Ga0070677_10000104 | Ga0070677_1000010429 | 98 |
| 160 | 3300005334 | Ga0068869_100006200 | Ga0068869_1000062003 | 98 |
| 161 | 3300005335 | Ga0070666_10013625 | Ga0070666_100136255 | 98 |
| 162 | 3300005336 | Ga0070680_100016970 | Ga0070680_1000169703 | 98 |
| 163 | 3300005336 | Ga0070680_101901512 | Ga0070680_1019015121 | 98 |
| 164 | 3300005337 | Ga0070682_100000287 | Ga0070682_10000028726 | 98 |
| 165 | 3300005338 | Ga0068868_100001298 | Ga0068868_1000012986 | 98 |
| 166 | 3300005339 | Ga0070660_100002362 | Ga0070660_1000023622 | 98 |
| 167 | 3300005340 | Ga0070689_100000422 | Ga0070689_10000042226 | 98 |
| 168 | 3300005341 | Ga0070691_10004265 | Ga0070691_100042655 | 98 |
| 169 | 3300005343 | Ga0070687_100002601 | Ga0070687_1000026013 | 98 |
| 170 | 3300005344 | Ga0070661_100000017 | Ga0070661_100000017129 | 98 |
| 171 | 3300005345 | Ga0070692_10000546 | Ga0070692_100005462 | 98 |
| 172 | 3300005347 | Ga0070668_100000656 | Ga0070668_10000065624 | 98 |
| 173 | 3300005353 | Ga0070669_100000314 | Ga0070669_1000003143 | 98 |
| 174 | 3300005354 | Ga0070675_100000161 | Ga0070675_1000001613 | 98 |
| 175 | 3300005355 | Ga0070671_100000313 | Ga0070671_1000003132 | 98 |
| 176 | 3300005356 | Ga0070674_100016562 | Ga0070674_1000165623 | 98 |
| 177 | 3300005364 | Ga0070673_100000272 | Ga0070673_1000002723 | 98 |
| 178 | 3300005365 | Ga0070688_100000306 | Ga0070688_10000030626 | 98 |
| 179 | 3300005366 | Ga0070659_100000252 | Ga0070659_10000025235 | 98 |
| 180 | 3300005367 | Ga0070667_100014243 | Ga0070667_1000142432 | 98 |
| 181 | 3300005406 | Ga0070703_10013349 | Ga0070703_100133493 | 98 |
| 182 | 3300005438 | Ga0070701_10000123 | Ga0070701_100001236 | 98 |
| 183 | 3300005440 | Ga0070705_100001543 | Ga0070705_1000015431 | 98 |
| 184 | 3300005440 | Ga0070705_101020381 | Ga0070705_1010203811 | 98 |
| 185 | 3300005441 | Ga0070700_100031644 | Ga0070700_1000316443 | 98 |
| 186 | 3300005444 | Ga0070694_100009283 | Ga0070694_1000092833 | 98 |
| 187 | 3300005445 | Ga0070708_100185231 | Ga0070708_1001852313 | 98 |
| 188 | 3300005455 | Ga0070663_100007039 | Ga0070663_1000070396 | 98 |
| 189 | 3300005456 | Ga0070678_100156678 | Ga0070678_1001566782 | 98 |
| 190 | 3300005457 | Ga0070662_100013472 | Ga0070662_1000134725 | 98 |
| 191 | 3300005458 | Ga0070681_10003031 | Ga0070681_1000303118 | 98 |
| 192 | 3300005458 | Ga0070681_11211421 | Ga0070681_112114212 | 98 |
| 193 | 3300005459 | Ga0068867_100004059 | Ga0068867_1000040599 | 98 |
| 194 | 3300005466 | Ga0070685_10000704 | Ga0070685_1000070419 | 98 |
| 195 | 3300005468 | Ga0070707_100742272 | Ga0070707_1007422722 | 98 |
| 196 | 3300005530 | Ga0070679_100022432 | Ga0070679_1000224324 | 98 |
| 197 | 3300005535 | Ga0070684_100018176 | Ga0070684_1000181762 | 98 |
| 198 | 3300005539 | Ga0068853_100160374 | Ga0068853_1001603742 | 98 |
| 199 | 3300005543 | Ga0070672_100000014 | Ga0070672_10000001415 | 98 |
| 200 | 3300005544 | Ga0070686_100000455 | Ga0070686_10000045526 | 98 |
| 201 | 3300005545 | Ga0070695_100001270 | Ga0070695_1000012703 | 98 |
| 202 | 3300005546 | Ga0070696_100014212 | Ga0070696_1000142124 | 98 |
| 203 | 3300005546 | Ga0070696_100058136 | Ga0070696_1000581363 | 98 |
| 204 | 3300005547 | Ga0070693_100000141 | Ga0070693_10000014140 | 98 |
| 205 | 3300005548 | Ga0070665_101486425 | Ga0070665_1014864252 | 98 |
| 206 | 3300005549 | Ga0070704_100000197 | Ga0070704_1000001973 | 98 |
| 207 | 3300005563 | Ga0068855_100002843 | Ga0068855_1000028435 | 98 |
| 208 | 3300005564 | Ga0070664_100000770 | Ga0070664_1000007707 | 98 |
| 209 | 3300005577 | Ga0068857_100000567 | Ga0068857_1000005673 | 98 |
| 210 | 3300005578 | Ga0068854_100000674 | Ga0068854_10000067417 | 98 |
| 211 | 3300005614 | Ga0068856_100006891 | Ga0068856_1000068917 | 98 |
| 212 | 3300005615 | Ga0070702_100000130 | Ga0070702_1000001303 | 98 |
| 213 | 3300005615 | Ga0070702_100565483 | Ga0070702_1005654832 | 98 |
| 214 | 3300005616 | Ga0068852_100008916 | Ga0068852_1000089166 | 98 |
| 215 | 3300005617 | Ga0068859_100001568 | Ga0068859_10000156824 | 98 |
| 216 | 3300005618 | Ga0068864_100001514 | Ga0068864_10000151421 | 98 |
| 217 | 3300005718 | Ga0068866_10000615 | Ga0068866_1000061517 | 98 |
| 218 | 3300005719 | Ga0068861_100000319 | Ga0068861_10000031915 | 98 |
| 219 | 3300005834 | Ga0068851_11019645 | Ga0068851_110196452 | 98 |
| 220 | 3300005840 | Ga0068870_10000002 | Ga0068870_1000000289 | 98 |
| 221 | 3300005841 | Ga0068863_100000703 | Ga0068863_10000070336 | 98 |
| 222 | 3300005842 | Ga0068858_100003033 | Ga0068858_1000030333 | 98 |
| 223 | 3300005843 | Ga0068860_100001895 | Ga0068860_1000018954 | 98 |
| 224 | 3300005844 | Ga0068862_100013279 | Ga0068862_1000132793 | 98 |
| 225 | 3300006178 | Ga0075367_10123200 | Ga0075367_101232003 | 98 |
| 226 | 3300006237 | Ga0097621_100000473 | Ga0097621_1000004733 | 98 |
| 227 | 3300006358 | Ga0068871_100000118 | Ga0068871_10000011861 | 98 |
| 228 | 3300006852 | Ga0075433_10010666 | Ga0075433_100106666 | 98 |
| 229 | 3300006871 | Ga0075434_100001964 | Ga0075434_1000019642 | 98 |
| 230 | 3300006881 | Ga0068865_100006203 | Ga0068865_1000062035 | 98 |
| 231 | 3300006931 | Ga0097620_100001568 | Ga0097620_10000156824 | 98 |
| 232 | 3300007076 | Ga0075435_100020961 | Ga0075435_1000209613 | 98 |
| 233 | 3300017792 | Ga0163161_10005398 | Ga0163161_100053983 | 98 |
| 234 | 3300025271 | Ga0207666_1000120 | Ga0207666_100012015 | 98 |
| 235 | 3300025290 | Ga0207673_1002080 | Ga0207673_10020801 | 98 |
| 236 | 3300025315 | Ga0207697_10000061 | Ga0207697_1000006115 | 98 |
| 237 | 3300025893 | Ga0207682_10000332 | Ga0207682_1000033220 | 98 |
| 238 | 3300025899 | Ga0207642_10000520 | Ga0207642_100005205 | 98 |
| 239 | 3300025900 | Ga0207710_10004780 | Ga0207710_100047805 | 98 |
| 240 | 3300025901 | Ga0207688_10000001 | Ga0207688_1000000172 | 98 |
| 241 | 3300025903 | Ga0207680_10016478 | Ga0207680_100164786 | 98 |
| 242 | 3300025904 | Ga0207647_10083515 | Ga0207647_100835153 | 98 |
| 243 | 3300025907 | Ga0207645_10000222 | Ga0207645_100002225 | 98 |
| 244 | 3300025908 | Ga0207643_10000009 | Ga0207643_1000000965 | 98 |
| 245 | 3300025911 | Ga0207654_10008610 | Ga0207654_100086105 | 98 |
| 246 | 3300025912 | Ga0207707_10001855 | Ga0207707_100018556 | 98 |
| 247 | 3300025913 | Ga0207695_10221647 | Ga0207695_102216473 | 98 |
| 248 | 3300025914 | Ga0207671_10024205 | Ga0207671_100242055 | 98 |
| 249 | 3300025917 | Ga0207660_10001147 | Ga0207660_100011478 | 98 |
| 250 | 3300025917 | Ga0207660_11443093 | Ga0207660_114430931 | 98 |
| 251 | 3300025918 | Ga0207662_10000616 | Ga0207662_100006163 | 98 |
| 252 | 3300025919 | Ga0207657_10000776 | Ga0207657_100007763 | 98 |
| 253 | 3300025920 | Ga0207649_10000052 | Ga0207649_1000005265 | 98 |
| 254 | 3300025921 | Ga0207652_10001328 | Ga0207652_100013285 | 98 |
| 255 | 3300025923 | Ga0207681_10000035 | Ga0207681_10000035142 | 98 |
| 256 | 3300025925 | Ga0207650_10001385 | Ga0207650_100013853 | 98 |
| 257 | 3300025926 | Ga0207659_10000132 | Ga0207659_1000013249 | 98 |
| 258 | 3300025927 | Ga0207687_10000174 | Ga0207687_1000017448 | 98 |
| 259 | 3300025931 | Ga0207644_10002247 | Ga0207644_100022472 | 98 |
| 260 | 3300025932 | Ga0207690_10000148 | Ga0207690_1000014829 | 98 |
| 261 | 3300025933 | Ga0207706_10018668 | Ga0207706_100186685 | 98 |
| 262 | 3300025934 | Ga0207686_10009703 | Ga0207686_100097038 | 98 |
| 263 | 3300025935 | Ga0207709_10000087 | Ga0207709_10000087145 | 98 |
| 264 | 3300025936 | Ga0207670_10000528 | Ga0207670_100005283 | 98 |
| 265 | 3300025937 | Ga0207669_10000589 | Ga0207669_100005895 | 98 |
| 266 | 3300025938 | Ga0207704_10000392 | Ga0207704_100003923 | 98 |
| 267 | 3300025940 | Ga0207691_10000517 | Ga0207691_1000051739 | 98 |
| 268 | 3300025942 | Ga0207689_10000031 | Ga0207689_1000003151 | 98 |
| 269 | 3300025944 | Ga0207661_10007383 | Ga0207661_100073834 | 98 |
| 270 | 3300025945 | Ga0207679_10000493 | Ga0207679_1000049335 | 98 |
| 271 | 3300025949 | Ga0207667_10017867 | Ga0207667_100178675 | 98 |
| 272 | 3300025960 | Ga0207651_10000051 | Ga0207651_1000005166 | 98 |
| 273 | 3300025961 | Ga0207712_10000176 | Ga0207712_1000017663 | 98 |
| 274 | 3300025972 | Ga0207668_10000355 | Ga0207668_1000035522 | 98 |
| 275 | 3300025981 | Ga0207640_10000126 | Ga0207640_1000012653 | 98 |
| 276 | 3300025986 | Ga0207658_10002400 | Ga0207658_1000240016 | 98 |
| 277 | 3300026023 | Ga0207677_10066304 | Ga0207677_100663043 | 98 |
| 278 | 3300026035 | Ga0207703_10001969 | Ga0207703_100019697 | 98 |
| 279 | 3300026041 | Ga0207639_10144388 | Ga0207639_101443884 | 98 |
| 280 | 3300026067 | Ga0207678_10000531 | Ga0207678_1000053135 | 98 |
| 281 | 3300026075 | Ga0207708_10000573 | Ga0207708_1000057330 | 98 |
| 282 | 3300026078 | Ga0207702_10010346 | Ga0207702_100103466 | 98 |
| 283 | 3300026088 | Ga0207641_10001041 | Ga0207641_1000104129 | 98 |
| 284 | 3300026089 | Ga0207648_10000581 | Ga0207648_100005813 | 98 |
| 285 | 3300026095 | Ga0207676_10000124 | Ga0207676_1000012417 | 98 |
| 286 | 3300026116 | Ga0207674_10000095 | Ga0207674_1000009535 | 98 |
| 287 | 3300026118 | Ga0207675_100000414 | Ga0207675_1000004143 | 98 |
| 288 | 3300026121 | Ga0207683_10000242 | Ga0207683_1000024260 | 98 |
| 289 | 3300026142 | Ga0207698_10003848 | Ga0207698_100038484 | 98 |
| 290 | 3300027717 | Ga0209998_10214982 | Ga0209998_102149822 | 98 |
| 291 | 3300027876 | Ga0209974_10011505 | Ga0209974_100115051 | 98 |
| 292 | 3300027876 | Ga0209974_10167187 | Ga0209974_101671871 | 98 |
| 293 | 3300027907 | Ga0207428_10000037 | Ga0207428_10000037166 | 98 |
| 294 | 3300028379 | Ga0268266_10025994 | Ga0268266_100259942 | 98 |
| 295 | 3300028380 | Ga0268265_10000757 | Ga0268265_1000075729 | 98 |
| 296 | 3300034817 | Ga0373948_0021532 | Ga0373948_0021532_277_573 | 98 |
| 297 | 3300034818 | Ga0373950_0009479 | Ga0373950_0009479_79_375 | 98 |
| 298 | 3300034820 | Ga0373959_0005726 | Ga0373959_0005726_879_1175 | 98 |
| 299 | 3300034957 | Ga0373938_0002758 | Ga0373938_0002758_1616_1912 | 98 |
| 300 | 3300035084 | Ga0373928_0008944 | Ga0373928_0008944_1393_1689 | 98 |
| 301 | 3300035085 | Ga0373929_0063482 | Ga0373929_0063482_324_620 | 98 |
| 302 | 3300035090 | Ga0373949_0002294 | Ga0373949_0002294_2303_2599 | 98 |
| 303 | 3300035091 | Ga0373951_0009985 | Ga0373951_0009985_766_1062 | 98 |
| 304 | 3300035092 | Ga0373952_0001876 | Ga0373952_0001876_2155_2451 | 98 |
| 305 | 3300035112 | Ga0373932_0004711 | Ga0373932_0004711_1859_2155 | 98 |
| 306 | 3300035114 | Ga0373939_0000125 | Ga0373939_0000125_12752_13048 | 98 |
| 307 | 3300035115 | Ga0373941_0068623 | Ga0373941_0068623_83_379 | 98 |
| 308 | 3300035121 | Ga0373960_0000232 | Ga0373960_0000232_8856_9152 | 98 |
| 309 | 3300035207 | Ga0373942_0061067 | Ga0373942_0061067_53_349 | 98 |
| 310 | 3300035241 | Ga0373961_0006457 | Ga0373961_0006457_787_1083 | 98 |
| 311 | 3300035691 | Ga0373931_0000124 | Ga0373931_0000124_14869_15165 | 98 |
| 312 | 3300037466 | Ga0395898_0454639 | Ga0395898_0454639_315_614 | 98 |
| 313 | 3300038443 | Ga0395901_0405060 | Ga0395901_0405060_503_802 | 98 |
| 314 | 3300039437 | Ga0436365_0459934 | Ga0436365_0459934_425_727 | 98 |
| 315 | 3300042008 | Ga0439450_028188 | Ga0439450_028188_373_723 | 98 |
| 316 | 3300042012 | Ga0439455_0193515 | Ga0439455_0193515_55_351 | 98 |
| 317 | 3300042116 | Ga0450912_010614 | Ga0450912_010614_245_550 | 98 |
| 318 | 3300042439 | Ga0439464_0004464 | Ga0439464_0004464_639_935 | 98 |
| 319 | 3300042461 | Ga0439460_0064879 | Ga0439460_0064879_604_900 | 98 |
| 320 | 3300045976 | Ga0466967_0291786 | Ga0466967_0291786_195_494 | 98 |
| 321 | 3300046520 | Ga0495637_0058619 | Ga0495637_0058619_1070_1366 | 98 |
| 322 | 3300046538 | Ga0495609_0091173 | Ga0495609_0091173_445_741 | 98 |
| 323 | 3300046684 | Ga0495669_0342649 | Ga0495669_0342649_27_323 | 98 |
| 324 | 3300048903 | Ga0496100_0029405 | Ga0496100_0029405_1379_1675 | 98 |
| 325 | 3300048904 | Ga0496101_0000151 | Ga0496101_0000151_18929_19225 | 98 |
| 326 | 3300048905 | Ga0496102_0029340 | Ga0496102_0029340_1254_1550 | 98 |
| 327 | 3300048906 | Ga0496103_0168087 | Ga0496103_0168087_489_785 | 98 |
| 328 | 3300048907 | Ga0496104_0117274 | Ga0496104_0117274_1956_2252 | 98 |
| 329 | 3300048909 | Ga0496106_0283421 | Ga0496106_0283421_543_839 | 98 |
| 330 | 3300048910 | Ga0496107_0000118 | Ga0496107_0000118_23929_24225 | 98 |
| 331 | 3300048911 | Ga0496108_0004875 | Ga0496108_0004875_3380_3676 | 98 |
| 332 | 3300048912 | Ga0496109_0001567 | Ga0496109_0001567_17127_17423 | 98 |
| 333 | 3300048913 | Ga0496110_0206078 | Ga0496110_0206078_925_1221 | 98 |
| 334 | 3300048915 | Ga0496112_0202841 | Ga0496112_0202841_739_1035 | 98 |
| 335 | 3300048917 | Ga0496114_0341737 | Ga0496114_0341737_1009_1305 | 98 |
| 336 | 3300048918 | Ga0496115_0063810 | Ga0496115_0063810_1168_1464 | 98 |
| 337 | 3300049574 | Ga0501038_0593306 | Ga0501038_0593306_214_510 | 98 |
| 338 | 3300049576 | Ga0501040_0149884 | Ga0501040_0149884_985_1290 | 98 |
| 339 | 3300049577 | Ga0501041_0089606 | Ga0501041_0089606_443_748 | 98 |
| 340 | 3300049586 | Ga0501070_0592745 | Ga0501070_0592745_274_570 | 98 |
| 341 | 3300049589 | Ga0501073_0211640 | Ga0501073_0211640_396_695 | 98 |
| 342 | 3300049589 | Ga0501073_0905649 | Ga0501073_0905649_53_349 | 98 |
| 343 | 3300049590 | Ga0501074_0131812 | Ga0501074_0131812_899_1204 | 98 |
| 344 | 3300049590 | Ga0501074_0480881 | Ga0501074_0480881_191_487 | 98 |
| 345 | 3300049591 | Ga0501075_0002913 | Ga0501075_0002913_1700_2005 | 98 |
| 346 | 3300049592 | Ga0501076_0020221 | Ga0501076_0020221_4579_4884 | 98 |
| 347 | 3300049592 | Ga0501076_0676523 | Ga0501076_0676523_367_663 | 98 |
| 348 | 3300049593 | Ga0501077_0014314 | Ga0501077_0014314_3684_3989 | 98 |
| 349 | 3300049593 | Ga0501077_0054700 | Ga0501077_0054700_1330_1626 | 98 |
| 350 | 3300049741 | Ga0501079_0022226 | Ga0501079_0022226_1693_1998 | 98 |
| 351 | 3300049742 | Ga0501080_0180173 | Ga0501080_0180173_1317_1613 | 98 |
| 352 | 3300049743 | Ga0501081_0000595 | Ga0501081_0000595_13930_14235 | 98 |
| 353 | 3300049743 | Ga0501081_0110220 | Ga0501081_0110220_576_881 | 98 |
| 354 | 3300049744 | Ga0501083_0604780 | Ga0501083_0604780_228_533 | 98 |
| 355 | 3300049744 | Ga0501083_0692158 | Ga0501083_0692158_292_642 | 98 |
| 356 | 3300050494 | nmdc:mga06z11_53984_c1 | nmdc:mga06z11_53984_c1_501_797 | 98 |
| 357 | 3300050511 | nmdc:mga08y16_243413_c1 | nmdc:mga08y16_243413_c1_251_550 | 98 |
| 358 | 3300050511 | nmdc:mga08y16_333_c1 | nmdc:mga08y16_333_c1_41252_41548 | 98 |
| 359 | 3300050511 | nmdc:mga08y16_90680_c1 | nmdc:mga08y16_90680_c1_784_1083 | 98 |
| 360 | 3300050512 | nmdc:mga0n895_62_c1 | nmdc:mga0n895_62_c1_23318_23614 | 98 |
| 361 | 3300050513 | nmdc:mga0rr50_14190_c1 | nmdc:mga0rr50_14190_c1_3834_4130 | 98 |
| 362 | 3300050515 | nmdc:mga0a205_7202_c1 | nmdc:mga0a205_7202_c1_5214_5510 | 98 |
| 363 | 3300054114 | Ga0501084_0323640 | Ga0501084_0323640_472_777 | 98 |
| 364 | 3300060353 | Ga0501082_0003176 | Ga0501082_0003176_2865_3170 | 98 |
| 365 | 3300060353 | Ga0501082_0168092 | Ga0501082_0168092_614_964 | 98 |
| 366 | 3300061734 | Ga0530510_0501479 | Ga0530510_0501479_160_465 | 98 |
| 367 | 3300061734 | Ga0530510_0624427 | Ga0530510_0624427_64_414 | 98 |
| 368 | 2209111006 | 2214884076 | 2213936925 | 99 |
| 369 | 3300000041 | ARcpr5oldR_c004176 | ARcpr5oldR_0041762 | 99 |
| 370 | 3300000043 | ARcpr5yngRDRAFT_c007081 | ARcpr5yngRDRAFT_0070812 | 99 |
| 371 | 3300000044 | ARSoilOldRDRAFT_c000083 | ARSoilOldRDRAFT_0000836 | 99 |
| 372 | 3300000652 | ARCol0yngRDRAFT_1000103 | ARCol0yngRDRAFT_100010316 | 99 |
| 373 | 3300003347 | JGI26128J50194_1010721 | JGI26128J50194_10107211 | 99 |
| 374 | 3300005277 | Ga0065716_1003653 | Ga0065716_10036532 | 99 |
| 375 | 3300005289 | Ga0065704_10270380 | Ga0065704_102703801 | 99 |
| 376 | 3300005290 | Ga0065712_10009636 | Ga0065712_100096364 | 99 |
| 377 | 3300005295 | Ga0065707_10265024 | Ga0065707_102650242 | 99 |
| 378 | 3300005295 | Ga0065707_10283437 | Ga0065707_102834372 | 99 |
| 379 | 3300005329 | Ga0070683_100157295 | Ga0070683_1001572954 | 99 |
| 380 | 3300005329 | Ga0070683_100192210 | Ga0070683_1001922102 | 99 |
| 381 | 3300005330 | Ga0070690_100013798 | Ga0070690_1000137984 | 99 |
| 382 | 3300005334 | Ga0068869_100816155 | Ga0068869_1008161552 | 99 |
| 383 | 3300005335 | Ga0070666_10014594 | Ga0070666_100145942 | 99 |
| 384 | 3300005336 | Ga0070680_100600546 | Ga0070680_1006005462 | 99 |
| 385 | 3300005337 | Ga0070682_100096987 | Ga0070682_1000969872 | 99 |
| 386 | 3300005337 | Ga0070682_100167020 | Ga0070682_1001670202 | 99 |
| 387 | 3300005337 | Ga0070682_101715437 | Ga0070682_1017154372 | 99 |
| 388 | 3300005338 | Ga0068868_100198953 | Ga0068868_1001989534 | 99 |
| 389 | 3300005339 | Ga0070660_100487633 | Ga0070660_1004876332 | 99 |
| 390 | 3300005339 | Ga0070660_101335421 | Ga0070660_1013354212 | 99 |
| 391 | 3300005340 | Ga0070689_100096627 | Ga0070689_1000966273 | 99 |
| 392 | 3300005341 | Ga0070691_10093428 | Ga0070691_100934284 | 99 |
| 393 | 3300005341 | Ga0070691_10742950 | Ga0070691_107429502 | 99 |
| 394 | 3300005343 | Ga0070687_100557641 | Ga0070687_1005576412 | 99 |
| 395 | 3300005344 | Ga0070661_100315576 | Ga0070661_1003155762 | 99 |
| 396 | 3300005344 | Ga0070661_101504479 | Ga0070661_1015044791 | 99 |
| 397 | 3300005345 | Ga0070692_10179740 | Ga0070692_101797402 | 99 |
| 398 | 3300005347 | Ga0070668_100025762 | Ga0070668_1000257625 | 99 |
| 399 | 3300005347 | Ga0070668_100115939 | Ga0070668_1001159394 | 99 |
| 400 | 3300005353 | Ga0070669_100029627 | Ga0070669_1000296272 | 99 |
| 401 | 3300005354 | Ga0070675_100170284 | Ga0070675_1001702842 | 99 |
| 402 | 3300005354 | Ga0070675_100606411 | Ga0070675_1006064112 | 99 |
| 403 | 3300005355 | Ga0070671_100026052 | Ga0070671_1000260525 | 99 |
| 404 | 3300005364 | Ga0070673_100238299 | Ga0070673_1002382993 | 99 |
| 405 | 3300005364 | Ga0070673_100426570 | Ga0070673_1004265703 | 99 |
| 406 | 3300005365 | Ga0070688_100007962 | Ga0070688_1000079626 | 99 |
| 407 | 3300005365 | Ga0070688_100045570 | Ga0070688_1000455704 | 99 |
| 408 | 3300005365 | Ga0070688_100952739 | Ga0070688_1009527392 | 99 |
| 409 | 3300005367 | Ga0070667_100025494 | Ga0070667_1000254944 | 99 |
| 410 | 3300005367 | Ga0070667_100068007 | Ga0070667_1000680075 | 99 |
| 411 | 3300005367 | Ga0070667_100284498 | Ga0070667_1002844983 | 99 |
| 412 | 3300005406 | Ga0070703_10146970 | Ga0070703_101469702 | 99 |
| 413 | 3300005434 | Ga0070709_10004420 | Ga0070709_100044208 | 99 |
| 414 | 3300005434 | Ga0070709_10027064 | Ga0070709_100270644 | 99 |
| 415 | 3300005434 | Ga0070709_11377716 | Ga0070709_113777162 | 99 |
| 416 | 3300005436 | Ga0070713_100021553 | Ga0070713_1000215533 | 99 |
| 417 | 3300005436 | Ga0070713_100025039 | Ga0070713_1000250393 | 99 |
| 418 | 3300005437 | Ga0070710_10095668 | Ga0070710_100956684 | 99 |
| 419 | 3300005439 | Ga0070711_100022505 | Ga0070711_1000225054 | 99 |
| 420 | 3300005439 | Ga0070711_101496320 | Ga0070711_1014963202 | 99 |
| 421 | 3300005441 | Ga0070700_100015468 | Ga0070700_1000154683 | 99 |
| 422 | 3300005441 | Ga0070700_100112627 | Ga0070700_1001126274 | 99 |
| 423 | 3300005441 | Ga0070700_100583680 | Ga0070700_1005836802 | 99 |
| 424 | 3300005444 | Ga0070694_100056993 | Ga0070694_1000569932 | 99 |
| 425 | 3300005444 | Ga0070694_100311579 | Ga0070694_1003115792 | 99 |
| 426 | 3300005455 | Ga0070663_100039920 | Ga0070663_1000399204 | 99 |
| 427 | 3300005455 | Ga0070663_100145644 | Ga0070663_1001456443 | 99 |
| 428 | 3300005456 | Ga0070678_100122510 | Ga0070678_1001225102 | 99 |
| 429 | 3300005457 | Ga0070662_100312407 | Ga0070662_1003124073 | 99 |
| 430 | 3300005457 | Ga0070662_100357045 | Ga0070662_1003570452 | 99 |
| 431 | 3300005458 | Ga0070681_10228861 | Ga0070681_102288612 | 99 |
| 432 | 3300005458 | Ga0070681_10379344 | Ga0070681_103793442 | 99 |
| 433 | 3300005458 | Ga0070681_10784253 | Ga0070681_107842532 | 99 |
| 434 | 3300005459 | Ga0068867_100405774 | Ga0068867_1004057742 | 99 |
| 435 | 3300005459 | Ga0068867_100715339 | Ga0068867_1007153392 | 99 |
| 436 | 3300005466 | Ga0070685_10047414 | Ga0070685_100474143 | 99 |
| 437 | 3300005466 | Ga0070685_10102184 | Ga0070685_101021842 | 99 |
| 438 | 3300005530 | Ga0070679_100053555 | Ga0070679_1000535554 | 99 |
| 439 | 3300005530 | Ga0070679_100098218 | Ga0070679_1000982182 | 99 |
| 440 | 3300005535 | Ga0070684_101303506 | Ga0070684_1013035062 | 99 |
| 441 | 3300005535 | Ga0070684_101669876 | Ga0070684_1016698762 | 99 |
| 442 | 3300005539 | Ga0068853_100247118 | Ga0068853_1002471182 | 99 |
| 443 | 3300005539 | Ga0068853_100464466 | Ga0068853_1004644662 | 99 |
| 444 | 3300005544 | Ga0070686_101497410 | Ga0070686_1014974102 | 99 |
| 445 | 3300005545 | Ga0070695_100725907 | Ga0070695_1007259072 | 99 |
| 446 | 3300005546 | Ga0070696_100036591 | Ga0070696_1000365913 | 99 |
| 447 | 3300005546 | Ga0070696_100083960 | Ga0070696_1000839604 | 99 |
| 448 | 3300005547 | Ga0070693_100051130 | Ga0070693_1000511303 | 99 |
| 449 | 3300005548 | Ga0070665_100241125 | Ga0070665_1002411254 | 99 |
| 450 | 3300005548 | Ga0070665_100904035 | Ga0070665_1009040352 | 99 |
| 451 | 3300005548 | Ga0070665_101626410 | Ga0070665_1016264101 | 99 |
| 452 | 3300005549 | Ga0070704_100148429 | Ga0070704_1001484293 | 99 |
| 453 | 3300005564 | Ga0070664_100105582 | Ga0070664_1001055824 | 99 |
| 454 | 3300005578 | Ga0068854_100622947 | Ga0068854_1006229472 | 99 |
| 455 | 3300005615 | Ga0070702_100105240 | Ga0070702_1001052403 | 99 |
| 456 | 3300005617 | Ga0068859_100137068 | Ga0068859_1001370683 | 99 |
| 457 | 3300005617 | Ga0068859_100640124 | Ga0068859_1006401243 | 99 |
| 458 | 3300005618 | Ga0068864_100028524 | Ga0068864_1000285245 | 99 |
| 459 | 3300005841 | Ga0068863_100245600 | Ga0068863_1002456002 | 99 |
| 460 | 3300005842 | Ga0068858_100202482 | Ga0068858_1002024823 | 99 |
| 461 | 3300005842 | Ga0068858_100227051 | Ga0068858_1002270511 | 99 |
| 462 | 3300005843 | Ga0068860_100130966 | Ga0068860_1001309662 | 99 |
| 463 | 3300005843 | Ga0068860_100339139 | Ga0068860_1003391393 | 99 |
| 464 | 3300005844 | Ga0068862_100468954 | Ga0068862_1004689541 | 99 |
| 465 | 3300005844 | Ga0068862_100786075 | Ga0068862_1007860752 | 99 |
| 466 | 3300005937 | Ga0081455_10000048 | Ga0081455_1000004896 | 99 |
| 467 | 3300006028 | Ga0070717_10000873 | Ga0070717_1000087322 | 99 |
| 468 | 3300006028 | Ga0070717_10701093 | Ga0070717_107010931 | 99 |
| 469 | 3300006038 | Ga0075365_11279947 | Ga0075365_112799472 | 99 |
| 470 | 3300006058 | Ga0075432_10196881 | Ga0075432_101968812 | 99 |
| 471 | 3300006163 | Ga0070715_10734516 | Ga0070715_107345162 | 99 |
| 472 | 3300006173 | Ga0070716_100002585 | Ga0070716_1000025856 | 99 |
| 473 | 3300006175 | Ga0070712_100176827 | Ga0070712_1001768273 | 99 |
| 474 | 3300006175 | Ga0070712_100302649 | Ga0070712_1003026492 | 99 |
| 475 | 3300006237 | Ga0097621_100008980 | Ga0097621_1000089806 | 99 |
| 476 | 3300006353 | Ga0075370_11028316 | Ga0075370_110283161 | 99 |
| 477 | 3300006358 | Ga0068871_100420430 | Ga0068871_1004204303 | 99 |
| 478 | 3300006844 | Ga0075428_100354674 | Ga0075428_1003546743 | 99 |
| 479 | 3300006852 | Ga0075433_10548803 | Ga0075433_105488032 | 99 |
| 480 | 3300006852 | Ga0075433_10567783 | Ga0075433_105677832 | 99 |
| 481 | 3300006871 | Ga0075434_100021155 | Ga0075434_1000211554 | 99 |
| 482 | 3300006871 | Ga0075434_100042779 | Ga0075434_1000427795 | 99 |
| 483 | 3300006871 | Ga0075434_100677953 | Ga0075434_1006779532 | 99 |
| 484 | 3300006871 | Ga0075434_100918790 | Ga0075434_1009187902 | 99 |
| 485 | 3300006881 | Ga0068865_100728940 | Ga0068865_1007289402 | 99 |
| 486 | 3300006914 | Ga0075436_100213877 | Ga0075436_1002138772 | 99 |
| 487 | 3300006914 | Ga0075436_100350152 | Ga0075436_1003501522 | 99 |
| 488 | 3300006914 | Ga0075436_100547022 | Ga0075436_1005470222 | 99 |
| 489 | 3300006931 | Ga0097620_100137077 | Ga0097620_1001370773 | 99 |
| 490 | 3300006931 | Ga0097620_100640126 | Ga0097620_1006401262 | 99 |
| 491 | 3300007076 | Ga0075435_100207547 | Ga0075435_1002075474 | 99 |
| 492 | 3300007076 | Ga0075435_100210657 | Ga0075435_1002106571 | 99 |
| 493 | 3300007076 | Ga0075435_100692254 | Ga0075435_1006922542 | 99 |
| 494 | 3300007076 | Ga0075435_101135663 | Ga0075435_1011356632 | 99 |
| 495 | 3300009101 | Ga0105247_10844701 | Ga0105247_108447012 | 99 |
| 496 | 3300009101 | Ga0105247_11030374 | Ga0105247_110303742 | 99 |
| 497 | 3300009147 | Ga0114129_10025668 | Ga0114129_100256687 | 99 |
| 498 | 3300009148 | Ga0105243_10091515 | Ga0105243_100915153 | 99 |
| 499 | 3300009148 | Ga0105243_11528744 | Ga0105243_115287442 | 99 |
| 500 | 3300009174 | Ga0105241_12060674 | Ga0105241_120606742 | 99 |
| 501 | 3300009176 | Ga0105242_11402813 | Ga0105242_114028132 | 99 |
| 502 | 3300009545 | Ga0105237_11592476 | Ga0105237_115924762 | 99 |
| 503 | 3300009551 | Ga0105238_12730515 | Ga0105238_127305151 | 99 |
| 504 | 3300009553 | Ga0105249_11611934 | Ga0105249_116119342 | 99 |
| 505 | 3300010375 | Ga0105239_11463087 | Ga0105239_114630872 | 99 |
| 506 | 3300011119 | Ga0105246_10720845 | Ga0105246_107208451 | 99 |
| 507 | 3300012478 | Ga0157328_1001223 | Ga0157328_10012233 | 99 |
| 508 | 3300012481 | Ga0157320_1011245 | Ga0157320_10112452 | 99 |
| 509 | 3300012497 | Ga0157319_1032852 | Ga0157319_10328522 | 99 |
| 510 | 3300012507 | Ga0157342_1014627 | Ga0157342_10146272 | 99 |
| 511 | 3300013100 | Ga0157373_10219054 | Ga0157373_102190543 | 99 |
| 512 | 3300013296 | Ga0157374_11592690 | Ga0157374_115926902 | 99 |
| 513 | 3300013308 | Ga0157375_11369081 | Ga0157375_113690811 | 99 |
| 514 | 3300014745 | Ga0157377_10308387 | Ga0157377_103083873 | 99 |
| 515 | 3300014969 | Ga0157376_10853847 | Ga0157376_108538472 | 99 |
| 516 | 3300020070 | Ga0206356_10738097 | Ga0206356_107380972 | 99 |
| 517 | 3300025271 | Ga0207666_1002984 | Ga0207666_10029842 | 99 |
| 518 | 3300025315 | Ga0207697_10049723 | Ga0207697_100497232 | 99 |
| 519 | 3300025735 | Ga0207713_1021008 | Ga0207713_10210083 | 99 |
| 520 | 3300025898 | Ga0207692_10030854 | Ga0207692_100308543 | 99 |
| 521 | 3300025898 | Ga0207692_10092547 | Ga0207692_100925474 | 99 |
| 522 | 3300025900 | Ga0207710_10003839 | Ga0207710_100038394 | 99 |
| 523 | 3300025903 | Ga0207680_10250163 | Ga0207680_102501632 | 99 |
| 524 | 3300025903 | Ga0207680_10788711 | Ga0207680_107887112 | 99 |
| 525 | 3300025905 | Ga0207685_10007286 | Ga0207685_100072863 | 99 |
| 526 | 3300025906 | Ga0207699_10005454 | Ga0207699_100054546 | 99 |
| 527 | 3300025910 | Ga0207684_11624283 | Ga0207684_116242831 | 99 |
| 528 | 3300025911 | Ga0207654_10226472 | Ga0207654_102264722 | 99 |
| 529 | 3300025912 | Ga0207707_10023067 | Ga0207707_100230674 | 99 |
| 530 | 3300025912 | Ga0207707_10168746 | Ga0207707_101687462 | 99 |
| 531 | 3300025912 | Ga0207707_10721384 | Ga0207707_107213842 | 99 |
| 532 | 3300025915 | Ga0207693_10019742 | Ga0207693_100197424 | 99 |
| 533 | 3300025916 | Ga0207663_10081715 | Ga0207663_100817153 | 99 |
| 534 | 3300025916 | Ga0207663_10997103 | Ga0207663_109971032 | 99 |
| 535 | 3300025917 | Ga0207660_10149471 | Ga0207660_101494713 | 99 |
| 536 | 3300025917 | Ga0207660_10475742 | Ga0207660_104757421 | 99 |
| 537 | 3300025918 | Ga0207662_10108744 | Ga0207662_101087442 | 99 |
| 538 | 3300025919 | Ga0207657_10206712 | Ga0207657_102067123 | 99 |
| 539 | 3300025919 | Ga0207657_10543961 | Ga0207657_105439612 | 99 |
| 540 | 3300025919 | Ga0207657_11136497 | Ga0207657_111364972 | 99 |
| 541 | 3300025920 | Ga0207649_10403288 | Ga0207649_104032882 | 99 |
| 542 | 3300025920 | Ga0207649_11300813 | Ga0207649_113008132 | 99 |
| 543 | 3300025921 | Ga0207652_10990076 | Ga0207652_109900762 | 99 |
| 544 | 3300025923 | Ga0207681_10356887 | Ga0207681_103568872 | 99 |
| 545 | 3300025926 | Ga0207659_10759185 | Ga0207659_107591852 | 99 |
| 546 | 3300025927 | Ga0207687_10009445 | Ga0207687_100094454 | 99 |
| 547 | 3300025928 | Ga0207700_10013168 | Ga0207700_100131685 | 99 |
| 548 | 3300025928 | Ga0207700_10062828 | Ga0207700_100628284 | 99 |
| 549 | 3300025929 | Ga0207664_10081946 | Ga0207664_100819464 | 99 |
| 550 | 3300025932 | Ga0207690_11007341 | Ga0207690_110073411 | 99 |
| 551 | 3300025933 | Ga0207706_10132685 | Ga0207706_101326854 | 99 |
| 552 | 3300025933 | Ga0207706_10206929 | Ga0207706_102069292 | 99 |
| 553 | 3300025934 | Ga0207686_10109883 | Ga0207686_101098834 | 99 |
| 554 | 3300025935 | Ga0207709_10052699 | Ga0207709_100526993 | 99 |
| 555 | 3300025935 | Ga0207709_10888424 | Ga0207709_108884242 | 99 |
| 556 | 3300025935 | Ga0207709_11000282 | Ga0207709_110002822 | 99 |
| 557 | 3300025936 | Ga0207670_10059661 | Ga0207670_100596614 | 99 |
| 558 | 3300025936 | Ga0207670_10472908 | Ga0207670_104729082 | 99 |
| 559 | 3300025939 | Ga0207665_10007965 | Ga0207665_100079656 | 99 |
| 560 | 3300025941 | Ga0207711_10011699 | Ga0207711_100116994 | 99 |
| 561 | 3300025942 | Ga0207689_10071476 | Ga0207689_100714762 | 99 |
| 562 | 3300025944 | Ga0207661_10089610 | Ga0207661_100896102 | 99 |
| 563 | 3300025945 | Ga0207679_10598459 | Ga0207679_105984592 | 99 |
| 564 | 3300025960 | Ga0207651_10010449 | Ga0207651_100104492 | 99 |
| 565 | 3300025960 | Ga0207651_10605747 | Ga0207651_106057472 | 99 |
| 566 | 3300025961 | Ga0207712_10214895 | Ga0207712_102148952 | 99 |
| 567 | 3300025986 | Ga0207658_10643357 | Ga0207658_106433572 | 99 |
| 568 | 3300026035 | Ga0207703_10507924 | Ga0207703_105079242 | 99 |
| 569 | 3300026067 | Ga0207678_10057976 | Ga0207678_100579764 | 99 |
| 570 | 3300026067 | Ga0207678_10314500 | Ga0207678_103145002 | 99 |
| 571 | 3300026075 | Ga0207708_10077261 | Ga0207708_100772614 | 99 |
| 572 | 3300026095 | Ga0207676_10004875 | Ga0207676_100048756 | 99 |
| 573 | 3300026095 | Ga0207676_11769616 | Ga0207676_117696161 | 99 |
| 574 | 3300026118 | Ga0207675_100785923 | Ga0207675_1007859232 | 99 |
| 575 | 3300027695 | Ga0209966_1000536 | Ga0209966_100053613 | 99 |
| 576 | 3300027717 | Ga0209998_10094989 | Ga0209998_100949892 | 99 |
| 577 | 3300027876 | Ga0209974_10017542 | Ga0209974_100175423 | 99 |
| 578 | 3300027907 | Ga0207428_10003190 | Ga0207428_1000319010 | 99 |
| 579 | 3300028379 | Ga0268266_10038038 | Ga0268266_100380384 | 99 |
| 580 | 3300028379 | Ga0268266_10826655 | Ga0268266_108266552 | 99 |
| 581 | 3300028380 | Ga0268265_12145268 | Ga0268265_121452681 | 99 |
| 582 | 3300028381 | Ga0268264_10177820 | Ga0268264_101778203 | 99 |
| 583 | 3300028381 | Ga0268264_10320432 | Ga0268264_103204322 | 99 |
| 584 | 3300031241 | Ga0265325_10000049 | Ga0265325_1000004932 | 99 |
| 585 | 3300031247 | Ga0265340_10369650 | Ga0265340_103696502 | 99 |
| 586 | 3300031595 | Ga0265313_10027525 | Ga0265313_100275253 | 99 |
| 587 | 3300034816 | Ga0373930_0000167 | Ga0373930_0000167_69_422 | 99 |
| 588 | 3300034817 | Ga0373948_0000080 | Ga0373948_0000080_6712_7011 | 99 |
| 589 | 3300034818 | Ga0373950_0001088 | Ga0373950_0001088_2166_2465 | 99 |
| 590 | 3300034819 | Ga0373958_0118578 | Ga0373958_0118578_288_590 | 99 |
| 591 | 3300034820 | Ga0373959_0008295 | Ga0373959_0008295_1270_1569 | 99 |
| 592 | 3300034820 | Ga0373959_0054023 | Ga0373959_0054023_476_778 | 99 |
| 593 | 3300034957 | Ga0373938_0105208 | Ga0373938_0105208_312_614 | 99 |
| 594 | 3300035083 | Ga0373926_0007052 | Ga0373926_0007052_2350_2652 | 99 |
| 595 | 3300035084 | Ga0373928_0005786 | Ga0373928_0005786_1603_1902 | 99 |
| 596 | 3300035085 | Ga0373929_0000333 | Ga0373929_0000333_87_386 | 99 |
| 597 | 3300035085 | Ga0373929_0148072 | Ga0373929_0148072_140_442 | 99 |
| 598 | 3300035086 | Ga0373934_0065473 | Ga0373934_0065473_421_723 | 99 |
| 599 | 3300035088 | Ga0373940_0001034 | Ga0373940_0001034_1618_1917 | 99 |
| 600 | 3300035089 | Ga0373944_0008009 | Ga0373944_0008009_808_1110 | 99 |
| 601 | 3300035089 | Ga0373944_0105982 | Ga0373944_0105982_300_599 | 99 |
| 602 | 3300035089 | Ga0373944_0177098 | Ga0373944_0177098_254_556 | 99 |
| 603 | 3300035090 | Ga0373949_0067769 | Ga0373949_0067769_211_510 | 99 |
| 604 | 3300035091 | Ga0373951_0004760 | Ga0373951_0004760_380_679 | 99 |
| 605 | 3300035092 | Ga0373952_0001546 | Ga0373952_0001546_411_710 | 99 |
| 606 | 3300035092 | Ga0373952_0016287 | Ga0373952_0016287_79_381 | 99 |
| 607 | 3300035112 | Ga0373932_0000216 | Ga0373932_0000216_6350_6649 | 99 |
| 608 | 3300035113 | Ga0373936_0010734 | Ga0373936_0010734_1993_2295 | 99 |
| 609 | 3300035113 | Ga0373936_0325321 | Ga0373936_0325321_15_317 | 99 |
| 610 | 3300035113 | Ga0373936_0592755 | Ga0373936_0592755_98_400 | 99 |
| 611 | 3300035115 | Ga0373941_0064473 | Ga0373941_0064473_253_552 | 99 |
| 612 | 3300035116 | Ga0373945_0005524 | Ga0373945_0005524_1560_1862 | 99 |
| 613 | 3300035116 | Ga0373945_0015449 | Ga0373945_0015449_932_1234 | 99 |
| 614 | 3300035117 | Ga0373953_0063177 | Ga0373953_0063177_124_423 | 99 |
| 615 | 3300035118 | Ga0373954_0028451 | Ga0373954_0028451_1277_1579 | 99 |
| 616 | 3300035118 | Ga0373954_0343790 | Ga0373954_0343790_368_670 | 99 |
| 617 | 3300035119 | Ga0373956_0059761 | Ga0373956_0059761_362_661 | 99 |
| 618 | 3300035121 | Ga0373960_0001024 | Ga0373960_0001024_73_426 | 99 |
| 619 | 3300035170 | Ga0373943_0011235 | Ga0373943_0011235_2854_3156 | 99 |
| 620 | 3300035170 | Ga0373943_0081381 | Ga0373943_0081381_26_328 | 99 |
| 621 | 3300035172 | Ga0373955_0107113 | Ga0373955_0107113_1089_1388 | 99 |
| 622 | 3300035207 | Ga0373942_0000176 | Ga0373942_0000176_10423_10722 | 99 |
| 623 | 3300035207 | Ga0373942_0066837 | Ga0373942_0066837_463_765 | 99 |
| 624 | 3300035241 | Ga0373961_0004636 | Ga0373961_0004636_1397_1696 | 99 |
| 625 | 3300035242 | Ga0373962_0014531 | Ga0373962_0014531_569_871 | 99 |
| 626 | 3300035410 | Ga0373924_0020150 | Ga0373924_0020150_411_713 | 99 |
| 627 | 3300035410 | Ga0373924_0027139 | Ga0373924_0027139_833_1132 | 99 |
| 628 | 3300035692 | Ga0373935_0116159 | Ga0373935_0116159_1070_1372 | 99 |
| 629 | 3300035695 | Ga0373927_0028225 | Ga0373927_0028225_2023_2325 | 99 |
| 630 | 3300035695 | Ga0373927_0151289 | Ga0373927_0151289_1113_1415 | 99 |
| 631 | 3300035695 | Ga0373927_0215606 | Ga0373927_0215606_666_968 | 99 |
| 632 | 3300035695 | Ga0373927_0428799 | Ga0373927_0428799_550_849 | 99 |
| 633 | 3300035724 | Ga0373933_0160433 | Ga0373933_0160433_347_646 | 99 |
| 634 | 3300035725 | Ga0373947_0014361 | Ga0373947_0014361_3120_3422 | 99 |
| 635 | 3300035725 | Ga0373947_0102798 | Ga0373947_0102798_890_1192 | 99 |
| 636 | 3300035725 | Ga0373947_0121146 | Ga0373947_0121146_1231_1530 | 99 |
| 637 | 3300036401 | Ga0373937_0034269 | Ga0373937_0034269_2237_2536 | 99 |
| 638 | 3300036401 | Ga0373937_0145375 | Ga0373937_0145375_197_499 | 99 |
| 639 | 3300037068 | Ga0373925_0005504 | Ga0373925_0005504_2250_2552 | 99 |
| 640 | 3300037068 | Ga0373925_0031705 | Ga0373925_0031705_3489_3791 | 99 |
| 641 | 3300037068 | Ga0373925_0340598 | Ga0373925_0340598_258_557 | 99 |
| 642 | 3300042876 | Ga0451577_0799660 | Ga0451577_0799660_109_408 | 99 |
| 643 | 3300044656 | Ga0466969_0295654 | Ga0466969_0295654_108_410 | 99 |
| 644 | 3300044684 | Ga0466966_0033902 | Ga0466966_0033902_2510_2812 | 99 |
| 645 | 3300044693 | Ga0466961_0314517 | Ga0466961_0314517_441_743 | 99 |
| 646 | 3300044694 | Ga0466963_0149506 | Ga0466963_0149506_1154_1456 | 99 |
| 647 | 3300044712 | Ga0453684_0513542 | Ga0453684_0513542_1006_1305 | 99 |
| 648 | 3300044719 | Ga0466971_0169602 | Ga0466971_0169602_587_889 | 99 |
| 649 | 3300044842 | Ga0466957_0127929 | Ga0466957_0127929_997_1299 | 99 |
| 650 | 3300045049 | Ga0466959_0336860 | Ga0466959_0336860_440_742 | 99 |
| 651 | 3300045051 | Ga0451576_0613609 | Ga0451576_0613609_382_681 | 99 |
| 652 | 3300045836 | Ga0466958_0088959 | Ga0466958_0088959_661_963 | 99 |
| 653 | 3300046452 | Ga0495617_044085 | Ga0495617_044085_779_1081 | 99 |
| 654 | 3300046454 | Ga0495592_0076830 | Ga0495592_0076830_1275_1574 | 99 |
| 655 | 3300046454 | Ga0495592_0113131 | Ga0495592_0113131_896_1198 | 99 |
| 656 | 3300046455 | Ga0495603_0033829 | Ga0495603_0033829_2636_2938 | 99 |
| 657 | 3300046455 | Ga0495603_0063121 | Ga0495603_0063121_1730_2032 | 99 |
| 658 | 3300046455 | Ga0495603_0125214 | Ga0495603_0125214_353_655 | 99 |
| 659 | 3300046459 | Ga0495629_0005418 | Ga0495629_0005418_5136_5438 | 99 |
| 660 | 3300046459 | Ga0495629_0357597 | Ga0495629_0357597_284_586 | 99 |
| 661 | 3300046462 | Ga0495651_0116918 | Ga0495651_0116918_533_832 | 99 |
| 662 | 3300046472 | Ga0495580_0090643 | Ga0495580_0090643_298_600 | 99 |
| 663 | 3300046473 | Ga0495582_0051485 | Ga0495582_0051485_812_1114 | 99 |
| 664 | 3300046475 | Ga0495639_0200635 | Ga0495639_0200635_552_854 | 99 |
| 665 | 3300046476 | Ga0495662_0074482 | Ga0495662_0074482_1330_1632 | 99 |
| 666 | 3300046477 | Ga0495664_0033039 | Ga0495664_0033039_1105_1407 | 99 |
| 667 | 3300046491 | Ga0495584_0053185 | Ga0495584_0053185_787_1089 | 99 |
| 668 | 3300046492 | Ga0495585_0003758 | Ga0495585_0003758_9096_9398 | 99 |
| 669 | 3300046499 | Ga0495594_0003490 | Ga0495594_0003490_6814_7116 | 99 |
| 670 | 3300046499 | Ga0495594_0053988 | Ga0495594_0053988_850_1152 | 99 |
| 671 | 3300046501 | Ga0495607_0084698 | Ga0495607_0084698_874_1176 | 99 |
| 672 | 3300046511 | Ga0495608_0032489 | Ga0495608_0032489_2211_2510 | 99 |
| 673 | 3300046514 | Ga0495618_0204570 | Ga0495618_0204570_635_937 | 99 |
| 674 | 3300046514 | Ga0495618_0916053 | Ga0495618_0916053_161_463 | 99 |
| 675 | 3300046516 | Ga0495628_0007284 | Ga0495628_0007284_1422_1721 | 99 |
| 676 | 3300046516 | Ga0495628_0319584 | Ga0495628_0319584_746_1048 | 99 |
| 677 | 3300046518 | Ga0495631_0030448 | Ga0495631_0030448_1383_1685 | 99 |
| 678 | 3300046523 | Ga0495644_0012715 | Ga0495644_0012715_1322_1624 | 99 |
| 679 | 3300046526 | Ga0495666_0021852 | Ga0495666_0021852_2097_2399 | 99 |
| 680 | 3300046526 | Ga0495666_0238565 | Ga0495666_0238565_356_658 | 99 |
| 681 | 3300046529 | Ga0495652_0172977 | Ga0495652_0172977_349_648 | 99 |
| 682 | 3300046529 | Ga0495652_0517797 | Ga0495652_0517797_297_599 | 99 |
| 683 | 3300046533 | Ga0495640_0017163 | Ga0495640_0017163_1757_2059 | 99 |
| 684 | 3300046535 | Ga0495586_0065777 | Ga0495586_0065777_779_1081 | 99 |
| 685 | 3300046536 | Ga0495587_0194638 | Ga0495587_0194638_464_763 | 99 |
| 686 | 3300046537 | Ga0495598_0013102 | Ga0495598_0013102_667_969 | 99 |
| 687 | 3300046538 | Ga0495609_0041317 | Ga0495609_0041317_1209_1511 | 99 |
| 688 | 3300046539 | Ga0495621_0042575 | Ga0495621_0042575_886_1188 | 99 |
| 689 | 3300046543 | Ga0495645_0005770 | Ga0495645_0005770_6982_7281 | 99 |
| 690 | 3300046557 | Ga0495622_0221005 | Ga0495622_0221005_508_810 | 99 |
| 691 | 3300046558 | Ga0495633_0005630 | Ga0495633_0005630_1288_1590 | 99 |
| 692 | 3300046615 | Ga0495656_0018371 | Ga0495656_0018371_1219_1521 | 99 |
| 693 | 3300046663 | Ga0495635_0235846 | Ga0495635_0235846_399_698 | 99 |
| 694 | 3300046664 | Ga0495659_0003259 | Ga0495659_0003259_3647_3949 | 99 |
| 695 | 3300046665 | Ga0495661_0037705 | Ga0495661_0037705_1953_2255 | 99 |
| 696 | 3300046674 | Ga0495588_0136414 | Ga0495588_0136414_899_1201 | 99 |
| 697 | 3300046674 | Ga0495588_0140981 | Ga0495588_0140981_377_679 | 99 |
| 698 | 3300046675 | Ga0495657_0065914 | Ga0495657_0065914_614_913 | 99 |
| 699 | 3300046679 | Ga0495623_0258511 | Ga0495623_0258511_424_723 | 99 |
| 700 | 3300046680 | Ga0495646_0356975 | Ga0495646_0356975_412_714 | 99 |
| 701 | 3300046681 | Ga0495647_0021374 | Ga0495647_0021374_1072_1374 | 99 |
| 702 | 3300046683 | Ga0495658_0084743 | Ga0495658_0084743_578_880 | 99 |
| 703 | 3300046683 | Ga0495658_0424629 | Ga0495658_0424629_434_733 | 99 |
| 704 | 3300046689 | Ga0495613_0006657 | Ga0495613_0006657_2477_2779 | 99 |
| 705 | 3300046689 | Ga0495613_0071710 | Ga0495613_0071710_1328_1630 | 99 |
| 706 | 3300046690 | Ga0495624_0036676 | Ga0495624_0036676_1427_1729 | 99 |
| 707 | 3300046691 | Ga0495670_0003018 | Ga0495670_0003018_832_1134 | 99 |
| 708 | 3300046692 | Ga0495671_0044577 | Ga0495671_0044577_1145_1447 | 99 |
| 709 | 3300046794 | Ga0495589_0051818 | Ga0495589_0051818_522_824 | 99 |
| 710 | 3300046809 | Ga0495600_0839566 | Ga0495600_0839566_117_416 | 99 |
| 711 | 3300047317 | Ga0495604_0029170 | Ga0495604_0029170_3218_3517 | 99 |
| 712 | 3300047318 | Ga0495636_0074309 | Ga0495636_0074309_674_976 | 99 |
| 713 | 3300047319 | Ga0495674_0140552 | Ga0495674_0140552_272_574 | 99 |
| 714 | 3300047321 | Ga0495676_0157557 | Ga0495676_0157557_1225_1527 | 99 |
| 715 | 3300047322 | Ga0495680_0041875 | Ga0495680_0041875_1450_1749 | 99 |
| 716 | 3300047322 | Ga0495680_0045246 | Ga0495680_0045246_789_1091 | 99 |
| 717 | 3300047444 | Ga0495675_0388958 | Ga0495675_0388958_123_422 | 99 |
| 718 | 3300047446 | Ga0495679_078840 | Ga0495679_078840_280_582 | 99 |
| 719 | 3300047470 | Ga0495681_0272553 | Ga0495681_0272553_266_568 | 99 |
| 720 | 3300048089 | Ga0495614_0014398 | Ga0495614_0014398_812_1114 | 99 |
| 721 | 3300048903 | Ga0496100_0370757 | Ga0496100_0370757_235_534 | 99 |
| 722 | 3300048904 | Ga0496101_0691237 | Ga0496101_0691237_272_571 | 99 |
| 723 | 3300048905 | Ga0496102_0024345 | Ga0496102_0024345_4813_5112 | 99 |
| 724 | 3300048905 | Ga0496102_0027609 | Ga0496102_0027609_1383_1682 | 99 |
| 725 | 3300048906 | Ga0496103_0006448 | Ga0496103_0006448_5273_5572 | 99 |
| 726 | 3300048906 | Ga0496103_0089607 | Ga0496103_0089607_912_1214 | 99 |
| 727 | 3300048906 | Ga0496103_0569510 | Ga0496103_0569510_253_552 | 99 |
| 728 | 3300048906 | Ga0496103_0633909 | Ga0496103_0633909_147_446 | 99 |
| 729 | 3300048907 | Ga0496104_0003813 | Ga0496104_0003813_4804_5103 | 99 |
| 730 | 3300048907 | Ga0496104_0035086 | Ga0496104_0035086_1432_1731 | 99 |
| 731 | 3300048907 | Ga0496104_0083596 | Ga0496104_0083596_396_698 | 99 |
| 732 | 3300048907 | Ga0496104_0092885 | Ga0496104_0092885_1088_1387 | 99 |
| 733 | 3300048907 | Ga0496104_0265889 | Ga0496104_0265889_806_1108 | 99 |
| 734 | 3300048907 | Ga0496104_0522252 | Ga0496104_0522252_51_353 | 99 |
| 735 | 3300048908 | Ga0496105_0001595 | Ga0496105_0001595_12485_12784 | 99 |
| 736 | 3300048908 | Ga0496105_0170313 | Ga0496105_0170313_393_695 | 99 |
| 737 | 3300048908 | Ga0496105_0680191 | Ga0496105_0680191_221_520 | 99 |
| 738 | 3300048908 | Ga0496105_0830124 | Ga0496105_0830124_306_605 | 99 |
| 739 | 3300048909 | Ga0496106_0014405 | Ga0496106_0014405_5273_5572 | 99 |
| 740 | 3300048909 | Ga0496106_0050334 | Ga0496106_0050334_2570_2869 | 99 |
| 741 | 3300048909 | Ga0496106_0334710 | Ga0496106_0334710_603_905 | 99 |
| 742 | 3300048909 | Ga0496106_0762222 | Ga0496106_0762222_306_608 | 99 |
| 743 | 3300048909 | Ga0496106_1053336 | Ga0496106_1053336_74_373 | 99 |
| 744 | 3300048910 | Ga0496107_0028493 | Ga0496107_0028493_821_1120 | 99 |
| 745 | 3300048910 | Ga0496107_0091881 | Ga0496107_0091881_1699_1998 | 99 |
| 746 | 3300048910 | Ga0496107_0177076 | Ga0496107_0177076_1064_1363 | 99 |
| 747 | 3300048911 | Ga0496108_0002446 | Ga0496108_0002446_12849_13148 | 99 |
| 748 | 3300048911 | Ga0496108_0596106 | Ga0496108_0596106_649_948 | 99 |
| 749 | 3300048912 | Ga0496109_0007673 | Ga0496109_0007673_6365_6664 | 99 |
| 750 | 3300048912 | Ga0496109_0014341 | Ga0496109_0014341_502_804 | 99 |
| 751 | 3300048912 | Ga0496109_0025468 | Ga0496109_0025468_272_571 | 99 |
| 752 | 3300048912 | Ga0496109_0051256 | Ga0496109_0051256_1829_2131 | 99 |
| 753 | 3300048912 | Ga0496109_1152592 | Ga0496109_1152592_111_413 | 99 |
| 754 | 3300048913 | Ga0496110_0546741 | Ga0496110_0546741_202_501 | 99 |
| 755 | 3300048913 | Ga0496110_0583708 | Ga0496110_0583708_481_780 | 99 |
| 756 | 3300048914 | Ga0496111_0016804 | Ga0496111_0016804_4478_4777 | 99 |
| 757 | 3300048914 | Ga0496111_0144813 | Ga0496111_0144813_647_946 | 99 |
| 758 | 3300048915 | Ga0496112_0023998 | Ga0496112_0023998_5264_5563 | 99 |
| 759 | 3300048915 | Ga0496112_0205887 | Ga0496112_0205887_218_517 | 99 |
| 760 | 3300048915 | Ga0496112_0873539 | Ga0496112_0873539_489_791 | 99 |
| 761 | 3300048916 | Ga0496113_0011936 | Ga0496113_0011936_272_571 | 99 |
| 762 | 3300048916 | Ga0496113_0726757 | Ga0496113_0726757_221_520 | 99 |
| 763 | 3300048916 | Ga0496113_1292783 | Ga0496113_1292783_26_379 | 99 |
| 764 | 3300048917 | Ga0496114_0007779 | Ga0496114_0007779_2950_3249 | 99 |
| 765 | 3300048918 | Ga0496115_0035263 | Ga0496115_0035263_272_571 | 99 |
| 766 | 3300048918 | Ga0496115_0299621 | Ga0496115_0299621_766_1068 | 99 |
| 767 | 3300048918 | Ga0496115_0707293 | Ga0496115_0707293_221_520 | 99 |
| 768 | 3300048918 | Ga0496115_0979710 | Ga0496115_0979710_194_496 | 99 |
| 769 | 3300048924 | Ga0496121_0389030 | Ga0496121_0389030_203_502 | 99 |
| 770 | 3300049585 | Ga0501069_0123124 | Ga0501069_0123124_939_1244 | 99 |
| 771 | 3300049586 | Ga0501070_1162523 | Ga0501070_1162523_104_430 | 99 |
| 772 | 3300049588 | Ga0501072_0652782 | Ga0501072_0652782_254_562 | 99 |
| 773 | 3300049592 | Ga0501076_1006433 | Ga0501076_1006433_225_524 | 99 |
| 774 | 3300049742 | Ga0501080_0957302 | Ga0501080_0957302_403_705 | 99 |
| 775 | 3300049824 | Ga0501045_1260393 | Ga0501045_1260393_139_438 | 99 |
| 776 | 3300050493 | nmdc:mga0k408_427641_c1 | nmdc:mga0k408_427641_c1_50_349 | 99 |
| 777 | 3300050507 | nmdc:mga05p37_59706_c1 | nmdc:mga05p37_59706_c1_3541_3843 | 99 |
| 778 | 3300050511 | nmdc:mga08y16_41762_c1 | nmdc:mga08y16_41762_c1_485_784 | 99 |
| 779 | 3300050512 | nmdc:mga0n895_13320_c1 | nmdc:mga0n895_13320_c1_4405_4707 | 99 |
| 780 | 3300050512 | nmdc:mga0n895_29477_c1 | nmdc:mga0n895_29477_c1_2058_2360 | 99 |
| 781 | 3300050512 | nmdc:mga0n895_402224_c1 | nmdc:mga0n895_402224_c1_926_1228 | 99 |
| 782 | 3300050512 | nmdc:mga0n895_649955_c1 | nmdc:mga0n895_649955_c1_232_549 | 99 |
| 783 | 3300050513 | nmdc:mga0rr50_39550_c1 | nmdc:mga0rr50_39550_c1_2620_2922 | 99 |
| 784 | 3300050513 | nmdc:mga0rr50_435635_c1 | nmdc:mga0rr50_435635_c1_18_335 | 99 |
| 785 | 3300050513 | nmdc:mga0rr50_67222_c1 | nmdc:mga0rr50_67222_c1_445_747 | 99 |
| 786 | 3300050514 | nmdc:mga08x19_188511_c1 | nmdc:mga08x19_188511_c1_681_983 | 99 |
| 787 | 3300050514 | nmdc:mga08x19_316665_c1 | nmdc:mga08x19_316665_c1_404_706 | 99 |
| 788 | 3300050514 | nmdc:mga08x19_423684_c1 | nmdc:mga08x19_423684_c1_218_535 | 99 |
| 789 | 3300050515 | nmdc:mga0a205_160430_c1 | nmdc:mga0a205_160430_c1_1322_1624 | 99 |
| 790 | 3300050515 | nmdc:mga0a205_557610_c1 | nmdc:mga0a205_557610_c1_349_651 | 99 |
| 791 | 3300050515 | nmdc:mga0a205_96413_c1 | nmdc:mga0a205_96413_c1_78_377 | 99 |
| 792 | 3300053077 | Ga0495601_0018908 | Ga0495601_0018908_1810_2109 | 99 |
| 793 | 3300053077 | Ga0495601_0220581 | Ga0495601_0220581_185_487 | 99 |
| 794 | 3300053078 | Ga0495612_0012859 | Ga0495612_0012859_733_1032 | 99 |
| 795 | 3300053078 | Ga0495612_0046322 | Ga0495612_0046322_958_1260 | 99 |
| 796 | 3300053084 | Ga0495595_0019992 | Ga0495595_0019992_2362_2661 | 99 |
| 797 | 3300053084 | Ga0495595_0086694 | Ga0495595_0086694_619_918 | 99 |
| 798 | 3300053085 | Ga0495619_0002485 | Ga0495619_0002485_4153_4455 | 99 |
| 799 | 3300053085 | Ga0495619_0051751 | Ga0495619_0051751_745_1044 | 99 |
| 800 | 3300061719 | Ga0466962_0286655 | Ga0466962_0286655_175_477 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ulr-assembly1.cif.gz_A | crystal structure of tt0497 from thermus thermophilus hb8 | 0.9324 | 6 | 96 |
| 3tnv-assembly1.cif.gz_A | acylphosphatase with thermophilic surface and mesophilic core | 0.9289 | 4 | 96 |
| 2w4d-assembly1.cif.gz_B | acylphosphatase variant g91a from pyrococcus horikoshii | 0.9282 | 4 | 96 |
| 8jfs-assembly2.cif.gz_B | phosphate bound acylphosphatase from deinococcus radiodurans at 1 angstrom resolution | 0.9238 | 6 | 96 |
| 3trg-assembly1.cif.gz_A | structure of an acylphosphatase from coxiella burnetii | 0.9206 | 3 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I1P4_95_208_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9695 | 4 | 81 | 3.30.70.100 |
| af_K7LZQ3_146_256_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9557 | 4 | 96 | 3.30.70.100 |
| 3tnvA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9289 | 4 | 96 | 3.30.70.100 |
| 3trgA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9195 | 3 | 96 | 3.30.70.100 |
| 2hltA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9124 | 5 | 97 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A4L873-F1-model_v4 | acylphosphatase (EC 3.6.1.7) | 0.9918 | 3 | 79 |
GO:0003998
GO:0009733 GO:0016020 |
| AF-A0A6N2DDH4-F1-model_v4 | deleted | 0.9903 | 4 | 81 |
|
| AF-Q07L15-F1-model_v4 | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) | 0.9902 | 6 | 99 |
GO:0003998
|
| AF-A0A537N4B7-F1-model_v4 | acylphosphatase (EC 3.6.1.7) | 0.9883 | 4 | 99 |
GO:0003998
|
| AF-A0A537L887-F1-model_v4 | Acylphosphatase (EC 3.6.1.7) | 0.9881 | 4 | 99 |
GO:0003998
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar