F481371

General Info

Members Datasets Scaffolds Average Seq Length
800 403 1600 284

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100050084|Ga0068855_1000500845
Length 310
Sequence MRAQFVLSEIFIGLRRNLTMTVAVVVSAAVALGMLGVALLMLFQTSHMKDFWYNKVEVTVFMCTKDDATLHPTTCIGGAASQNQMNTLQTALQSNPLVQTVYTESQADAFARYQQQSQGSTSGTSMAQYVTPDQIPASLRVKLKNPSTQNIDAMISSYQGQQGVETVSDQRTILQPLFKLFNGLTVSATTVAIVMVGLALMLIVNTVRLSAFSRRRETGIMRLVGASNFYIRLPFLMEGAVAGLGGVAVATLGVASFKFFLIDRVLAPNFTFTSFIGWDKVVVTVLILIPVGLLMAVGASALSLRKYLKV

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
137 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
150 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
166 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
167 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
199 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
200 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
204 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
205 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
206 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
207 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
210 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
211 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
212 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
213 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
214 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
215 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
216 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
217 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
218 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
219 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
330 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
352 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
353 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
357 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
358 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
359 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
360 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
361 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
362 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
365 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
366 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
367 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
368 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
369 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
373 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
374 2643221613 Oerskovia sp. Root22 Isolate Unclassified
375 2643221721 Oerskovia sp. Root918 Isolate Unclassified
376 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
377 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
378 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
379 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
380 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
381 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
382 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
383 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
384 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
385 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
386 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
387 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
388 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
389 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
390 2867369537 Streptomyces sp. Z26 Isolate Unclassified
391 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
392 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
393 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
394 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
395 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
396 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
397 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
398 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
399 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
400 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
401 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
402 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
403 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.38
Metatranscriptomes 1.75
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 3.38
Rhizosphere 89
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100050084 3300005563 Bacteria 4923
2 JGI24740J21852_10008298 3300001979 Bacteria 4147
3 JGI24739J22299_10017776 3300001989 Bacteria 2562
4 JGI24739J22299_10018374 3300001989 Bacteria 2514
5 JGI24737J22298_10007355 3300001990 Bacteria 3721
6 JGI24738J21930_10023679 3300002075 Bacteria 1264
7 JGI25152J39213_1000165 3300002773 Bacteria 45327
8 rootH2_10060078 3300003320 Bacteria 2576
9 JGI25160J50197_1018483 3300003354 Bacteria 2171
10 JGI25404J52841_10010151 3300003659 Bacteria 2022
11 Ga0070658_10006268 3300005327 Bacteria 9635
12 Ga0070658_10021938 3300005327 Bacteria 5121
13 Ga0070683_100081204 3300005329 Bacteria 3035
14 Ga0070683_100213351 3300005329 Bacteria 1834
15 Ga0070680_100234315 3300005336 Bacteria 1551
16 Ga0070682_100005228 3300005337 Bacteria 7219
17 Ga0070682_100065954 3300005337 Bacteria 2302
18 Ga0070682_100311752 3300005337 Bacteria 1158
19 Ga0070660_100017404 3300005339 Bacteria 5239
20 Ga0070691_10011679 3300005341 Bacteria 4016
21 Ga0070674_100035129 3300005356 Bacteria 3355
22 Ga0070674_100287225 3300005356 Bacteria 1306
23 Ga0070659_100044672 3300005366 Bacteria 3470
24 Ga0070709_10006680 3300005434 Bacteria 6299
25 Ga0070709_10016013 3300005434 Bacteria 4273
26 Ga0070709_10034956 3300005434 Bacteria 3051
27 Ga0070709_10125992 3300005434 Bacteria 1742
28 Ga0070714_100060895 3300005435 Bacteria 3241
29 Ga0070714_100077143 3300005435 Bacteria 2894
30 Ga0070714_100109057 3300005435 Bacteria 2448
31 Ga0070714_100137288 3300005435 Bacteria 2191
32 Ga0070714_100239149 3300005435 Bacteria 1675
33 Ga0070714_100239428 3300005435 Bacteria 1674
34 Ga0070713_100033715 3300005436 Bacteria 4105
35 Ga0070713_100068025 3300005436 Bacteria 3001
36 Ga0070713_100113238 3300005436 Bacteria 2368
37 Ga0070713_100184567 3300005436 Bacteria 1876
38 Ga0070710_10048013 3300005437 Bacteria 2383
39 Ga0070710_10082821 3300005437 Bacteria 1876
40 Ga0070711_100039936 3300005439 Bacteria 3162
41 Ga0070711_100233178 3300005439 Bacteria 1436
42 Ga0070705_100015445 3300005440 Bacteria 3949
43 Ga0070705_100249688 3300005440 Bacteria 1245
44 Ga0070708_100013731 3300005445 Bacteria 6644
45 Ga0070663_100080682 3300005455 Bacteria 2389
46 Ga0070678_100164582 3300005456 Bacteria 1800
47 Ga0070678_100252684 3300005456 Bacteria 1479
48 Ga0070681_10336124 3300005458 Bacteria 1420
49 Ga0070706_100003693 3300005467 Bacteria 14981
50 Ga0070706_100027028 3300005467 Bacteria 5280
51 Ga0070706_100051000 3300005467 Bacteria 3817
52 Ga0070707_100011627 3300005468 Bacteria 8214
53 Ga0070707_100015326 3300005468 Bacteria 7192
54 Ga0070698_100000926 3300005471 Bacteria 32043
55 Ga0070698_100009552 3300005471 Bacteria 10380
56 Ga0070698_100035328 3300005471 Bacteria 5169
57 Ga0070679_100064354 3300005530 Bacteria 3655
58 Ga0070679_100338784 3300005530 Bacteria 1452
59 Ga0070679_100604459 3300005530 Bacteria 1040
60 Ga0070684_100107708 3300005535 Bacteria 2496
61 Ga0070684_100153945 3300005535 Bacteria 2084
62 Ga0070684_100178754 3300005535 Bacteria 1929
63 Ga0070696_100014395 3300005546 Bacteria 5306
64 Ga0070696_100070067 3300005546 Bacteria 2466
65 Ga0070696_100094166 3300005546 Bacteria 2137
66 Ga0070693_100138432 3300005547 Bacteria 1529
67 Ga0070665_100027413 3300005548 Bacteria 5739
68 Ga0070704_100132356 3300005549 Bacteria 1935
69 Ga0068857_100215937 3300005577 Bacteria 1751
70 Ga0068854_100073281 3300005578 Bacteria 2509
71 Ga0068856_100075337 3300005614 Bacteria 3342
72 Ga0068856_100223031 3300005614 Bacteria 1900
73 Ga0068856_100354629 3300005614 Bacteria 1485
74 Ga0070702_100009738 3300005615 Bacteria 4712
75 Ga0068852_100144356 3300005616 Bacteria 2206
76 Ga0068851_10109569 3300005834 Bacteria 1473
77 Ga0068863_100023280 3300005841 Bacteria 5918
78 Ga0081455_10088919 3300005937 Bacteria 2508
79 Ga0081540_1040499 3300005983 Bacteria 2428
80 Ga0070717_10023373 3300006028 Bacteria 4896
81 Ga0070717_10046013 3300006028 Bacteria 3569
82 Ga0070717_10062242 3300006028 Bacteria 3094
83 Ga0070715_10004152 3300006163 Bacteria 4713
84 Ga0070715_10017749 3300006163 Bacteria 2698
85 Ga0070716_100015285 3300006173 Bacteria 3941
86 Ga0070716_100035223 3300006173 Bacteria 2751
87 Ga0070716_100047627 3300006173 Bacteria 2419
88 Ga0070712_100107040 3300006175 Bacteria 2079
89 Ga0097621_100176707 3300006237 Bacteria 1843
90 Ga0068871_100113288 3300006358 Bacteria 2284
91 Ga0075428_100067123 3300006844 Bacteria 3927
92 Ga0075428_100188677 3300006844 Bacteria 2230
93 Ga0075430_100007169 3300006846 Bacteria 9407
94 Ga0075431_100004096 3300006847 Bacteria 14231
95 Ga0075433_10088980 3300006852 Bacteria 2729
96 Ga0075434_100037823 3300006871 Bacteria 4777
97 Ga0075429_100007666 3300006880 Bacteria 9371
98 Ga0075436_100010207 3300006914 Bacteria 6431
99 Ga0075436_100044832 3300006914 Bacteria 3050
100 Ga0075436_100064277 3300006914 Bacteria 2536
101 Ga0075435_100080382 3300007076 Bacteria 2676
102 Ga0099794_10051910 3300007265 Bacteria 1976
103 Ga0105244_10017621 3300009036 Bacteria 4031
104 Ga0105240_10597729 3300009093 Bacteria 1215
105 Ga0105240_10634057 3300009093 Bacteria 1173
106 Ga0105245_10400397 3300009098 Bacteria 1372
107 Ga0114129_10003686 3300009147 Bacteria 21566
108 Ga0114129_10007477 3300009147 Bacteria 15557
109 Ga0114129_10209998 3300009147 Bacteria 2632
110 Ga0105243_10008338 3300009148 Bacteria 7960
111 Ga0105243_10059805 3300009148 Bacteria 3042
112 Ga0105243_10082521 3300009148 Bacteria 2627
113 Ga0105243_10241678 3300009148 Bacteria 1607
114 Ga0105243_10288724 3300009148 Bacteria 1481
115 Ga0105241_10008019 3300009174 Bacteria 7769
116 Ga0105241_10131033 3300009174 Bacteria 2030
117 Ga0105241_10249048 3300009174 Bacteria 1505
118 Ga0105242_10223404 3300009176 Bacteria 1684
119 Ga0105238_10440531 3300009551 Bacteria 1299
120 Ga0105238_10469152 3300009551 Bacteria 1257
121 Ga0105249_10011959 3300009553 Bacteria 7635
122 Ga0105239_10488489 3300010375 Bacteria 1399
123 Ga0105239_10679274 3300010375 Bacteria 1177
124 Ga0105239_10954702 3300010375 Bacteria 985
125 Ga0105246_10032255 3300011119 Bacteria 3473
126 Ga0157373_10006775 3300013100 Bacteria 8531
127 Ga0157370_10036194 3300013104 Bacteria 4792
128 Ga0157370_10166932 3300013104 Bacteria 2047
129 Ga0157369_10045092 3300013105 Bacteria 4797
130 Ga0157369_10057990 3300013105 Bacteria 4177
131 Ga0157369_10061485 3300013105 Bacteria 4048
132 Ga0157369_10221098 3300013105 Bacteria 1983
133 Ga0157369_10382148 3300013105 Bacteria 1461
134 Ga0157378_10040234 3300013297 Bacteria 4145
135 Ga0163162_10012217 3300013306 Bacteria 8382
136 Ga0157372_10067334 3300013307 Bacteria 4024
137 Ga0157372_10491559 3300013307 Bacteria 1431
138 Ga0157372_10664334 3300013307 Bacteria 1213
139 Ga0157375_10069440 3300013308 Bacteria 3529
140 Ga0157375_10079934 3300013308 Bacteria 3306
141 Ga0157375_10183150 3300013308 Bacteria 2247
142 Ga0157375_10642742 3300013308 Bacteria 1218
143 Ga0157380_10054643 3300014326 Bacteria 3170
144 Ga0157380_10063919 3300014326 Bacteria 2952
145 Ga0157376_10064269 3300014969 Bacteria 3094
146 Ga0163161_10031627 3300017792 Bacteria 3772
147 Ga0197907_10637809 3300020069 Bacteria 2688
148 Ga0206351_10371412 3300020077 Bacteria 3554
149 Ga0206352_10518047 3300020078 Bacteria 2589
150 Ga0206353_10783437 3300020082 Bacteria 1959
151 Ga0206353_11910123 3300020082 Bacteria 4880
152 Ga0154015_1549829 3300020610 Bacteria 1535
153 Ga0213875_10010623 3300021388 Bacteria 4608
154 Ga0213875_10080578 3300021388 Bacteria 1519
155 Ga0224712_10004042 3300022467 Bacteria 3908
156 Ga0224712_10017337 3300022467 Bacteria 2386
157 Ga0224712_10017915 3300022467 Bacteria 2357
158 Ga0224712_10036793 3300022467 Bacteria 1817
159 Ga0209129_1000028 3300025258 Bacteria 405451
160 Ga0209025_1003151 3300025294 Bacteria 16083
161 Ga0209051_1004679 3300025303 Bacteria 8329
162 Ga0207697_10008829 3300025315 Bacteria 4386
163 Ga0207655_1003071 3300025728 Bacteria 12716
164 Ga0207655_1014475 3300025728 Bacteria 4455
165 Ga0207653_10056021 3300025885 Bacteria 1321
166 Ga0207692_10001309 3300025898 Bacteria 9269
167 Ga0207692_10002505 3300025898 Bacteria 7049
168 Ga0207692_10006717 3300025898 Bacteria 4676
169 Ga0207647_10009366 3300025904 Bacteria 6960
170 Ga0207685_10000471 3300025905 Bacteria 6792
171 Ga0207685_10015929 3300025905 Bacteria 2394
172 Ga0207699_10011968 3300025906 Bacteria 4399
173 Ga0207705_10002068 3300025909 Bacteria 15607
174 Ga0207684_10004857 3300025910 Bacteria 12575
175 Ga0207684_10013152 3300025910 Bacteria 7162
176 Ga0207654_10014637 3300025911 Bacteria 4055
177 Ga0207654_10072508 3300025911 Bacteria 2050
178 Ga0207707_10187374 3300025912 Bacteria 1806
179 Ga0207707_10218598 3300025912 Bacteria 1659
180 Ga0207695_10002003 3300025913 Bacteria 31428
181 Ga0207695_10046995 3300025913 Bacteria 4572
182 Ga0207671_10000058 3300025914 Bacteria 180670
183 Ga0207693_10011663 3300025915 Bacteria 7110
184 Ga0207693_10033882 3300025915 Bacteria 4029
185 Ga0207693_10038097 3300025915 Bacteria 3787
186 Ga0207693_10230113 3300025915 Bacteria 1456
187 Ga0207663_10009041 3300025916 Bacteria 5246
188 Ga0207663_10027398 3300025916 Bacteria 3321
189 Ga0207663_10101258 3300025916 Bacteria 1935
190 Ga0207663_10159467 3300025916 Bacteria 1591
191 Ga0207660_10046373 3300025917 Bacteria 3066
192 Ga0207657_10043793 3300025919 Bacteria 3939
193 Ga0207649_10152505 3300025920 Bacteria 1593
194 Ga0207652_10031197 3300025921 Bacteria 4474
195 Ga0207652_10087142 3300025921 Bacteria 2738
196 Ga0207652_10105461 3300025921 Bacteria 2494
197 Ga0207646_10004327 3300025922 Bacteria 15494
198 Ga0207646_10004858 3300025922 Bacteria 14400
199 Ga0207694_10000381 3300025924 Bacteria 41347
200 Ga0207687_10251453 3300025927 Bacteria 1405
201 Ga0207700_10011176 3300025928 Bacteria 5714
202 Ga0207700_10044107 3300025928 Bacteria 3281
203 Ga0207700_10051354 3300025928 Bacteria 3077
204 Ga0207664_10002215 3300025929 Bacteria 12806
205 Ga0207664_10019285 3300025929 Bacteria 5037
206 Ga0207664_10036713 3300025929 Bacteria 3787
207 Ga0207664_10295946 3300025929 Bacteria 1423
208 Ga0207690_10040175 3300025932 Bacteria 3057
209 Ga0207686_10037267 3300025934 Bacteria 2933
210 Ga0207709_10086412 3300025935 Bacteria 2036
211 Ga0207709_10104050 3300025935 Bacteria 1883
212 Ga0207665_10000684 3300025939 Bacteria 22908
213 Ga0207665_10053459 3300025939 Bacteria 2722
214 Ga0207665_10081885 3300025939 Bacteria 2223
215 Ga0207661_10077003 3300025944 Bacteria 2741
216 Ga0207661_10168222 3300025944 Bacteria 1907
217 Ga0207667_10051368 3300025949 Bacteria 4347
218 Ga0207712_10146129 3300025961 Bacteria 1820
219 Ga0207640_10035302 3300025981 Bacteria 3128
220 Ga0207658_10584728 3300025986 Bacteria 1002
221 Ga0207677_10303844 3300026023 Bacteria 1319
222 Ga0207677_10376479 3300026023 Bacteria 1197
223 Ga0207678_10007142 3300026067 Bacteria 9911
224 Ga0207678_10090279 3300026067 Bacteria 2619
225 Ga0207702_10036078 3300026078 Bacteria 4135
226 Ga0207702_10141806 3300026078 Bacteria 2175
227 Ga0207674_10097606 3300026116 Bacteria 2922
228 Ga0207698_10114099 3300026142 Bacteria 2272
229 Ga0209974_10003298 3300027876 Bacteria 5831
230 Ga0268266_10075702 3300028379 Bacteria 2924
231 Ga0265337_1000062 3300028556 Bacteria 49473
232 Ga0265326_10001770 3300028558 Bacteria 7454
233 Ga0265334_10000617 3300028573 Bacteria 17873
234 Ga0265318_10006124 3300028577 Bacteria 5574
235 Ga0265323_10004066 3300028653 Bacteria 6340
236 Ga0265322_10002801 3300028654 Bacteria 5325
237 Ga0265336_10004360 3300028666 Bacteria 5361
238 Ga0307517_10002661 3300028786 Bacteria 28533
239 Ga0265338_10000791 3300028800 Bacteria 53584
240 Ga0265338_10004616 3300028800 Bacteria 18517
241 Ga0265338_10008739 3300028800 Bacteria 12245
242 Ga0265324_10003326 3300029957 Bacteria 7711
243 Ga0265763_1000364 3300030763 Bacteria 2643
244 Ga0265332_10003177 3300031238 Bacteria 7996
245 Ga0265320_10002446 3300031240 Bacteria 12935
246 Ga0265325_10001888 3300031241 Bacteria 14470
247 Ga0265340_10001077 3300031247 Bacteria 15545
248 Ga0265316_10023843 3300031344 Bacteria 5138
249 Ga0307508_10027108 3300031616 Bacteria 5190
250 Ga0316575_10003736 3300031665 Bacteria 5287
251 Ga0316575_10017790 3300031665 Bacteria 2703
252 Ga0316579_10001601 3300031691 Bacteria 8279
253 Ga0316579_10004925 3300031691 Bacteria 5345
254 Ga0316579_10029819 3300031691 Bacteria 2490
255 Ga0265314_10013530 3300031711 Bacteria 6587
256 Ga0265342_10001259 3300031712 Bacteria 23936
257 Ga0316576_10000619 3300031727 Bacteria 17094
258 Ga0316576_10010066 3300031727 Bacteria 6125
259 Ga0316576_10013973 3300031727 Bacteria 5354
260 Ga0316576_10023125 3300031727 Bacteria 4326
261 Ga0316576_10037117 3300031727 Bacteria 3486
262 Ga0316576_10049870 3300031727 Bacteria 3042
263 Ga0316578_10026319 3300031728 Bacteria 3280
264 Ga0316578_10037145 3300031728 Bacteria 2805
265 Ga0316578_10042526 3300031728 Bacteria 2635
266 Ga0316578_10065362 3300031728 Bacteria 2147
267 Ga0307516_10095028 3300031730 Bacteria 2804
268 Ga0307405_10085975 3300031731 Bacteria 2069
269 Ga0307405_10112544 3300031731 Bacteria 1847
270 Ga0316577_10001710 3300031733 Bacteria 10540
271 Ga0307413_10102483 3300031824 Bacteria 1895
272 Ga0307410_10012272 3300031852 Bacteria 4946
273 Ga0307410_10042246 3300031852 Bacteria 3012
274 Ga0307410_10138914 3300031852 Bacteria 1795
275 Ga0307406_10124083 3300031901 Bacteria 1801
276 Ga0307409_100067222 3300031995 Bacteria 2829
277 Ga0307416_100148441 3300032002 Bacteria 2146
278 Ga0307414_10022085 3300032004 Bacteria 4006
279 Ga0307411_10040747 3300032005 Bacteria 2949
280 Ga0316583_10005301 3300032133 Bacteria 4625
281 Ga0316583_10012746 3300032133 Bacteria 3034
282 Ga0316585_10033320 3300032137 Bacteria 1625
283 Ga0316580_10004989 3300032139 Bacteria 3861
284 Ga0316580_10011578 3300032139 Bacteria 2678
285 Ga0316580_10055853 3300032139 Bacteria 1214
286 Ga0307507_10000013 3300033179 Bacteria 242708
287 Ga0316592_1009638 3300033524 Bacteria 1935
288 Ga0316596_1013265 3300033541 Bacteria 2033
289 Ga0373929_0004683 3300035085 Bacteria 2452
290 Ga0373934_0004394 3300035086 Bacteria 5210
291 Ga0373934_0006110 3300035086 Bacteria 4459
292 Ga0373934_0009651 3300035086 Bacteria 3619
293 Ga0373934_0010048 3300035086 Bacteria 3552
294 Ga0373934_0022483 3300035086 Bacteria 2433
295 Ga0373923_0008296 3300035111 Bacteria 3697
296 Ga0373923_0013429 3300035111 Bacteria 3054
297 Ga0373923_0098638 3300035111 Bacteria 1286
298 Ga0373932_0014339 3300035112 Bacteria 1991
299 Ga0373939_0003585 3300035114 Bacteria 3646
300 Ga0373941_0004222 3300035115 Bacteria 3303
301 Ga0373953_0004403 3300035117 Bacteria 4488
302 Ga0373953_0004727 3300035117 Bacteria 4364
303 Ga0373953_0039468 3300035117 Bacteria 1871
304 Ga0373954_0001318 3300035118 Bacteria 10011
305 Ga0373954_0014475 3300035118 Bacteria 3517
306 Ga0373956_0000040 3300035119 Bacteria 42243
307 Ga0373956_0005998 3300035119 Bacteria 4863
308 Ga0373957_0001325 3300035120 Bacteria 6656
309 Ga0373957_0011966 3300035120 Bacteria 2910
310 Ga0373957_0014745 3300035120 Bacteria 2677
311 Ga0373955_0000063 3300035172 Bacteria 42266
312 Ga0373955_0005374 3300035172 Bacteria 5751
313 Ga0373955_0006265 3300035172 Bacteria 5414
314 Ga0316574_0002423 3300035398 Bacteria 9359
315 Ga0316574_0004590 3300035398 Bacteria 7257
316 Ga0316574_0007027 3300035398 Bacteria 6135
317 Ga0316574_0019685 3300035398 Bacteria 3986
318 Ga0316574_0026311 3300035398 Bacteria 3497
319 Ga0316574_0038767 3300035398 Bacteria 2926
320 Ga0373924_0000316 3300035410 Bacteria 14851
321 Ga0373924_0018295 3300035410 Bacteria 2698
322 Ga0373931_0104102 3300035691 Bacteria 1600
323 Ga0373935_0202164 3300035692 Bacteria 1373
324 Ga0373933_0000171 3300035724 Bacteria 42450
325 Ga0373933_0024965 3300035724 Bacteria 3424
326 Ga0373933_0047696 3300035724 Bacteria 2548
327 Ga0373933_0105020 3300035724 Bacteria 1756
328 Ga0373937_0000360 3300036401 Bacteria 42294
329 Ga0373937_0001805 3300036401 Bacteria 17978
330 Ga0373937_0034585 3300036401 Bacteria 4596
331 Ga0373937_0124052 3300036401 Bacteria 2408
332 Ga0373937_0422886 3300036401 Bacteria 1265
333 Ga0373937_0520833 3300036401 Bacteria 1130
334 Ga0316582_0001095 3300036647 Bacteria 11424
335 Ga0316582_0055139 3300036647 Bacteria 2532
336 Ga0316584_0001482 3300036712 Bacteria 14115
337 Ga0316584_0003347 3300036712 Bacteria 10393
338 Ga0316584_0058376 3300036712 Bacteria 2889
339 Ga0316584_0090985 3300036712 Bacteria 2284
340 Ga0373925_0000252 3300037068 Bacteria 56554
341 Ga0373925_0002375 3300037068 Bacteria 15100
342 Ga0373925_0171236 3300037068 Bacteria 1714
343 Ga0395899_0001148 3300037312 Bacteria 23414
344 Ga0395899_0013612 3300037312 Bacteria 6219
345 Ga0395899_0108449 3300037312 Bacteria 1998
346 Ga0395900_0122693 3300037418 Bacteria 2665
347 Ga0395900_0126945 3300037418 Bacteria 2616
348 Ga0395900_0139307 3300037418 Bacteria 2485
349 Ga0395898_0012396 3300037466 Bacteria 8813
350 Ga0395898_0081668 3300037466 Bacteria 3116
351 Ga0395898_0135195 3300037466 Bacteria 2361
352 Ga0395898_0315521 3300037466 Bacteria 1491
353 Ga0395898_0365667 3300037466 Bacteria 1375
354 Ga0395905_0643574 3300037471 Bacteria 962
355 Ga0316581_0015677 3300037588 Bacteria 2168
356 Ga0316581_0051905 3300037588 Bacteria 1257
357 Ga0436364_0825611 3300037853 Bacteria 26882
358 Ga0395901_0007102 3300038443 Bacteria 11318
359 Ga0395901_0061373 3300038443 Bacteria 3911
360 Ga0395901_0087305 3300038443 Bacteria 3261
361 Ga0395901_0114531 3300038443 Bacteria 2832
362 Ga0395901_0318306 3300038443 Bacteria 1610
363 Ga0395901_0355295 3300038443 Bacteria 1512
364 Ga0395901_0441080 3300038443 Bacteria 1333
365 Ga0400485_08773 3300038735 Bacteria 119523
366 Ga0400488_22539 3300038741 Bacteria 1392
367 Ga0400486_15822 3300038742 Unclassified 1236
368 Ga0436363_0748014 3300039450 Bacteria 889
369 Ga0439436_0002263 3300041404 Bacteria 5763
370 Ga0439438_003044 3300041405 Bacteria 6897
371 Ga0439439_0000126 3300041406 Bacteria 10708
372 Ga0439466_0003961 3300041411 Bacteria 5712
373 Ga0451851_0114374 3300041507 Bacteria 1175
374 Ga0439433_0000308 3300041999 Bacteria 8460
375 Ga0439432_006621 3300042006 Bacteria 4127
376 Ga0439449_0005661 3300042007 Bacteria 4779
377 Ga0439452_001706 3300042010 Bacteria 8634
378 Ga0439457_012413 3300042014 Bacteria 1920
379 Ga0439457_021427 3300042014 Bacteria 1433
380 Ga0439462_0007577 3300042015 Bacteria 2720
381 Ga0439462_0033890 3300042015 Bacteria 1355
382 Ga0439463_024944 3300042016 Bacteria 1499
383 Ga0450919_000659 3300042121 Bacteria 4353
384 Ga0450920_006673 3300042122 Bacteria 2079
385 Ga0450906_012335 3300042145 Bacteria 1585
386 Ga0450907_008278 3300042146 Bacteria 1730
387 Ga0450908_004100 3300042184 Bacteria 2815
388 Ga0450909_004276 3300042185 Bacteria 2036
389 Ga0439434_0000119 3300042435 Bacteria 20788
390 Ga0450918_005596 3300042531 Bacteria 2254
391 Ga0466969_0000444 3300044656 Bacteria 22697
392 Ga0466969_0004927 3300044656 Bacteria 7115
393 Ga0466969_0007535 3300044656 Bacteria 5785
394 Ga0466969_0030025 3300044656 Bacteria 2771
395 Ga0466965_0010674 3300044683 Bacteria 4292
396 Ga0466966_0011039 3300044684 Bacteria 5996
397 Ga0466966_0042947 3300044684 Bacteria 2899
398 Ga0466966_0232193 3300044684 Bacteria 1113
399 Ga0466961_0002494 3300044693 Bacteria 11416
400 Ga0466961_0006039 3300044693 Bacteria 7680
401 Ga0466961_0061557 3300044693 Bacteria 2385
402 Ga0466961_0095918 3300044693 Bacteria 1870
403 Ga0466961_0097712 3300044693 Bacteria 1851
404 Ga0466961_0137051 3300044693 Bacteria 1533
405 Ga0466963_0047291 3300044694 Bacteria 2839
406 Ga0466963_0077350 3300044694 Bacteria 2248
407 Ga0466963_0186584 3300044694 Bacteria 1448
408 Ga0466963_0296832 3300044694 Bacteria 1136
409 Ga0466971_0007825 3300044719 Bacteria 4656
410 Ga0466970_0006563 3300044765 Bacteria 5814
411 Ga0466970_0037270 3300044765 Bacteria 2577
412 Ga0466957_0127521 3300044842 Bacteria 1627
413 Ga0466959_0032472 3300045049 Bacteria 3864
414 Ga0466959_0067108 3300045049 Bacteria 2601
415 Ga0466959_0231449 3300045049 Bacteria 1279
416 Ga0466958_0044204 3300045836 Bacteria 2684
417 Ga0466958_0235035 3300045836 Bacteria 1171
418 Ga0466958_0299901 3300045836 Bacteria 1032
419 Ga0466967_0142711 3300045976 Bacteria 2232
420 Ga0466967_0476259 3300045976 Bacteria 1223
421 Ga0495592_0000299 3300046454 Bacteria 42284
422 Ga0495592_0009165 3300046454 Bacteria 7448
423 Ga0495592_0025745 3300046454 Bacteria 4466
424 Ga0495592_0030439 3300046454 Bacteria 4082
425 Ga0495592_0031185 3300046454 Bacteria 4029
426 Ga0495592_0053550 3300046454 Bacteria 2992
427 Ga0495603_0035937 3300046455 Bacteria 2975
428 Ga0495629_0013776 3300046459 Bacteria 5834
429 Ga0495629_0025230 3300046459 Bacteria 4228
430 Ga0495629_0030363 3300046459 Bacteria 3832
431 Ga0495629_0215364 3300046459 Bacteria 1326
432 Ga0495638_0033840 3300046460 Bacteria 3265
433 Ga0495641_0039972 3300046461 Bacteria 2183
434 Ga0495651_0000241 3300046462 Bacteria 42284
435 Ga0495651_0000309 3300046462 Bacteria 37974
436 Ga0495651_0004408 3300046462 Bacteria 10781
437 Ga0495651_0010722 3300046462 Bacteria 7046
438 Ga0495651_0012229 3300046462 Bacteria 6611
439 Ga0495651_0013308 3300046462 Bacteria 6363
440 Ga0495651_0026409 3300046462 Bacteria 4523
441 Ga0495651_0041197 3300046462 Bacteria 3588
442 Ga0495651_0191946 3300046462 Bacteria 1437
443 Ga0495653_0002292 3300046463 Bacteria 15172
444 Ga0495653_0002736 3300046463 Bacteria 14046
445 Ga0495653_0014980 3300046463 Bacteria 6323
446 Ga0495653_0075291 3300046463 Bacteria 2512
447 Ga0495653_0105249 3300046463 Bacteria 2037
448 Ga0495580_0086963 3300046472 Bacteria 2177
449 Ga0495580_0100811 3300046472 Bacteria 2008
450 Ga0495582_0118456 3300046473 Bacteria 1491
451 Ga0495662_0000975 3300046476 Bacteria 13985
452 Ga0495662_0017245 3300046476 Bacteria 3495
453 Ga0495662_0092918 3300046476 Bacteria 1472
454 Ga0495664_0014188 3300046477 Bacteria 4513
455 Ga0495664_0022280 3300046477 Bacteria 3670
456 Ga0495664_0045332 3300046477 Bacteria 2607
457 Ga0495664_0146803 3300046477 Bacteria 1430
458 Ga0495585_0009703 3300046492 Bacteria 5763
459 Ga0495594_0030506 3300046499 Bacteria 2918
460 Ga0495594_0032773 3300046499 Bacteria 2822
461 Ga0495594_0088851 3300046499 Bacteria 1730
462 Ga0495608_0000207 3300046511 Bacteria 42312
463 Ga0495608_0003475 3300046511 Bacteria 11280
464 Ga0495608_0020182 3300046511 Bacteria 4580
465 Ga0495608_0068076 3300046511 Bacteria 2328
466 Ga0495608_0260967 3300046511 Bacteria 1078
467 Ga0495618_0020179 3300046514 Bacteria 4103
468 Ga0495618_0045109 3300046514 Bacteria 2780
469 Ga0495618_0071561 3300046514 Bacteria 2206
470 Ga0495618_0185099 3300046514 Bacteria 1322
471 Ga0495628_0001668 3300046516 Bacteria 20258
472 Ga0495628_0007199 3300046516 Bacteria 9633
473 Ga0495628_0007372 3300046516 Bacteria 9521
474 Ga0495628_0026074 3300046516 Bacteria 4772
475 Ga0495628_0060538 3300046516 Bacteria 2970
476 Ga0495628_0350485 3300046516 Bacteria 1085
477 Ga0495630_0027541 3300046517 Bacteria 4217
478 Ga0495630_0045761 3300046517 Bacteria 3270
479 Ga0495630_0146538 3300046517 Bacteria 1795
480 Ga0495630_0269746 3300046517 Bacteria 1300
481 Ga0495631_0139098 3300046518 Bacteria 1043
482 Ga0495632_0039896 3300046519 Bacteria 2367
483 Ga0495643_0013159 3300046522 Bacteria 4964
484 Ga0495666_0003481 3300046526 Bacteria 7944
485 Ga0495666_0020201 3300046526 Bacteria 3302
486 Ga0495652_0001515 3300046529 Bacteria 25519
487 Ga0495652_0002781 3300046529 Bacteria 17682
488 Ga0495652_0025794 3300046529 Bacteria 5195
489 Ga0495652_0044703 3300046529 Bacteria 3812
490 Ga0495652_0045022 3300046529 Bacteria 3797
491 Ga0495652_0046962 3300046529 Bacteria 3705
492 Ga0495652_0081309 3300046529 Bacteria 2672
493 Ga0495652_0116062 3300046529 Bacteria 2144
494 Ga0495665_0001217 3300046531 Bacteria 13741
495 Ga0495665_0013863 3300046531 Bacteria 4354
496 Ga0495640_0001311 3300046533 Bacteria 19571
497 Ga0495640_0007237 3300046533 Bacteria 8740
498 Ga0495640_0036480 3300046533 Bacteria 3473
499 Ga0495640_0051466 3300046533 Bacteria 2831
500 Ga0495640_0071012 3300046533 Bacteria 2337
501 Ga0495640_0076838 3300046533 Bacteria 2227
502 Ga0495586_0029026 3300046535 Bacteria 2961
503 Ga0495586_0054470 3300046535 Bacteria 2168
504 Ga0495586_0203222 3300046535 Bacteria 1123
505 Ga0495587_0000191 3300046536 Bacteria 45229
506 Ga0495587_0050974 3300046536 Bacteria 2448
507 Ga0495587_0077313 3300046536 Bacteria 1932
508 Ga0495587_0229813 3300046536 Bacteria 1045
509 Ga0495645_0001962 3300046543 Bacteria 13972
510 Ga0495645_0008928 3300046543 Bacteria 7002
511 Ga0495645_0022576 3300046543 Bacteria 4553
512 Ga0495645_0028614 3300046543 Bacteria 4050
513 Ga0495645_0046692 3300046543 Bacteria 3156
514 Ga0495645_0113716 3300046543 Bacteria 1913
515 Ga0495622_0037509 3300046557 Bacteria 2258
516 Ga0495622_0158688 3300046557 Bacteria 1021
517 Ga0495633_0029838 3300046558 Bacteria 2652
518 Ga0495667_0000185 3300046559 Bacteria 42312
519 Ga0495667_0000283 3300046559 Bacteria 32986
520 Ga0495667_0004600 3300046559 Bacteria 9331
521 Ga0495667_0009107 3300046559 Bacteria 6740
522 Ga0495667_0013581 3300046559 Bacteria 5508
523 Ga0495667_0044426 3300046559 Bacteria 2943
524 Ga0495634_0006347 3300046642 Bacteria 8990
525 Ga0495634_0010296 3300046642 Bacteria 6853
526 Ga0495634_0014116 3300046642 Bacteria 5767
527 Ga0495634_0036901 3300046642 Bacteria 3340
528 Ga0495625_0034328 3300046660 Bacteria 3745
529 Ga0495635_0001167 3300046663 Bacteria 17512
530 Ga0495635_0001677 3300046663 Bacteria 14902
531 Ga0495635_0015596 3300046663 Bacteria 5310
532 Ga0495635_0035602 3300046663 Bacteria 3451
533 Ga0495635_0108302 3300046663 Bacteria 1898
534 Ga0495588_0104517 3300046674 Bacteria 1490
535 Ga0495657_0000329 3300046675 Bacteria 43563
536 Ga0495657_0005709 3300046675 Bacteria 9800
537 Ga0495657_0007253 3300046675 Bacteria 8587
538 Ga0495657_0010759 3300046675 Bacteria 6873
539 Ga0495657_0057229 3300046675 Bacteria 2593
540 Ga0495657_0261427 3300046675 Bacteria 1040
541 Ga0495599_0000225 3300046678 Bacteria 35981
542 Ga0495599_0001405 3300046678 Bacteria 13760
543 Ga0495599_0006046 3300046678 Bacteria 7284
544 Ga0495599_0008876 3300046678 Bacteria 6120
545 Ga0495599_0021207 3300046678 Bacteria 4052
546 Ga0495599_0125120 3300046678 Bacteria 1598
547 Ga0495599_0174200 3300046678 Bacteria 1327
548 Ga0495623_0000185 3300046679 Bacteria 39309
549 Ga0495623_0024649 3300046679 Bacteria 3873
550 Ga0495623_0043554 3300046679 Bacteria 2856
551 Ga0495623_0044559 3300046679 Bacteria 2818
552 Ga0495646_0001556 3300046680 Bacteria 13654
553 Ga0495646_0002992 3300046680 Bacteria 10482
554 Ga0495646_0006118 3300046680 Bacteria 7631
555 Ga0495646_0009188 3300046680 Bacteria 6273
556 Ga0495646_0020098 3300046680 Bacteria 4222
557 Ga0495647_0120198 3300046681 Bacteria 1104
558 Ga0495658_0030749 3300046683 Bacteria 2918
559 Ga0495669_0107301 3300046684 Bacteria 1301
560 Ga0495613_0021611 3300046689 Bacteria 4794
561 Ga0495613_0046464 3300046689 Bacteria 3210
562 Ga0495613_0105355 3300046689 Bacteria 2035
563 Ga0495624_0103922 3300046690 Bacteria 1748
564 Ga0495624_0144155 3300046690 Bacteria 1458
565 Ga0495670_0000729 3300046691 Bacteria 15723
566 Ga0495589_0034177 3300046794 Bacteria 2553
567 Ga0495600_0000637 3300046809 Bacteria 18124
568 Ga0495600_0003215 3300046809 Bacteria 9556
569 Ga0495600_0009542 3300046809 Bacteria 5999
570 Ga0495600_0030533 3300046809 Bacteria 3491
571 Ga0495600_0034785 3300046809 Bacteria 3271
572 Ga0495600_0038962 3300046809 Bacteria 3094
573 Ga0495600_0048501 3300046809 Bacteria 2770
574 Ga0495600_0102377 3300046809 Bacteria 1866
575 Ga0495600_0276266 3300046809 Bacteria 1064
576 Ga0495660_0035980 3300046810 Bacteria 2763
577 Ga0495581_0016540 3300047315 Bacteria 4286
578 Ga0495581_0063026 3300047315 Bacteria 2142
579 Ga0495604_0000314 3300047317 Bacteria 43563
580 Ga0495604_0003425 3300047317 Bacteria 12652
581 Ga0495604_0011275 3300047317 Bacteria 7096
582 Ga0495604_0040681 3300047317 Bacteria 3648
583 Ga0495604_0050504 3300047317 Bacteria 3229
584 Ga0495604_0050731 3300047317 Bacteria 3220
585 Ga0495604_0054343 3300047317 Bacteria 3090
586 Ga0495604_0072687 3300047317 Bacteria 2599
587 Ga0495674_0039783 3300047319 Bacteria 4211
588 Ga0495674_0132229 3300047319 Bacteria 2102
589 Ga0495674_0155413 3300047319 Bacteria 1916
590 Ga0495674_0309270 3300047319 Bacteria 1289
591 Ga0495676_0000425 3300047321 Bacteria 34173
592 Ga0495676_0212357 3300047321 Bacteria 1338
593 Ga0495680_0000542 3300047322 Bacteria 42450
594 Ga0495680_0014486 3300047322 Bacteria 6827
595 Ga0495680_0043737 3300047322 Bacteria 3544
596 Ga0495680_0057935 3300047322 Bacteria 2994
597 Ga0495680_0105115 3300047322 Bacteria 2100
598 Ga0495683_0079939 3300047323 Bacteria 1596
599 Ga0495675_0000531 3300047444 Bacteria 24718
600 Ga0495675_0003326 3300047444 Bacteria 9673
601 Ga0495675_0011556 3300047444 Bacteria 5542
602 Ga0495675_0036672 3300047444 Bacteria 3126
603 Ga0495675_0040227 3300047444 Bacteria 2978
604 Ga0495675_0049593 3300047444 Bacteria 2668
605 Ga0495685_000466 3300047447 Bacteria 12609
606 Ga0495684_0008000 3300047471 Bacteria 8173
607 Ga0495684_0018773 3300047471 Bacteria 5328
608 Ga0495684_0027989 3300047471 Bacteria 4328
609 Ga0495684_0052346 3300047471 Bacteria 3115
610 Ga0495686_0018015 3300047472 Bacteria 4748
611 Ga0495593_0043665 3300047673 Bacteria 2400
612 Ga0495602_0001433 3300048088 Bacteria 23672
613 Ga0495602_0054386 3300048088 Bacteria 3534
614 Ga0495602_0065233 3300048088 Bacteria 3143
615 Ga0495602_0156280 3300048088 Bacteria 1785
616 Ga0495602_0211502 3300048088 Bacteria 1471
617 Ga0495602_0357530 3300048088 Bacteria 1052
618 Ga0495614_0108485 3300048089 Bacteria 1218
619 Ga0496100_0073624 3300048903 Bacteria 2287
620 Ga0496100_0376934 3300048903 Bacteria 1077
621 Ga0496102_0088629 3300048905 Bacteria 2861
622 Ga0496102_0339238 3300048905 Bacteria 1415
623 Ga0496103_0184061 3300048906 Bacteria 1343
624 Ga0496104_0001893 3300048907 Bacteria 18124
625 Ga0496105_0000206 3300048908 Bacteria 39356
626 Ga0496105_0178447 3300048908 Bacteria 1739
627 Ga0496105_0308931 3300048908 Bacteria 1270
628 Ga0496106_0032187 3300048909 Bacteria 3909
629 Ga0496106_0053470 3300048909 Bacteria 3050
630 Ga0496108_0158450 3300048911 Bacteria 1955
631 Ga0496108_0272281 3300048911 Bacteria 1474
632 Ga0496109_0006674 3300048912 Bacteria 9715
633 Ga0496109_0103515 3300048912 Bacteria 2642
634 Ga0496109_0371292 3300048912 Bacteria 1351
635 Ga0496110_0020492 3300048913 Bacteria 5583
636 Ga0496110_0112899 3300048913 Bacteria 2443
637 Ga0496110_0140131 3300048913 Bacteria 2186
638 Ga0496111_0111397 3300048914 Bacteria 2016
639 Ga0496112_0000167 3300048915 Bacteria 41911
640 Ga0496112_0176770 3300048915 Bacteria 2099
641 Ga0496113_0007390 3300048916 Bacteria 7065
642 Ga0496113_0107132 3300048916 Bacteria 2171
643 Ga0496114_0065150 3300048917 Bacteria 3052
644 Ga0496115_0005213 3300048918 Bacteria 9452
645 Ga0496115_0070182 3300048918 Bacteria 2840
646 Ga0496118_0028519 3300048921 Bacteria 4698
647 Ga0496118_0046848 3300048921 Bacteria 3358
648 Ga0496122_0000620 3300048925 Bacteria 72751
649 Ga0496122_0000873 3300048925 Bacteria 56711
650 Ga0496123_0000142 3300048926 Bacteria 146932
651 Ga0496124_0000461 3300048927 Bacteria 70566
652 Ga0496124_0076251 3300048927 Bacteria 2768
653 Ga0496125_0000075 3300048928 Bacteria 234414
654 Ga0496125_0005705 3300048928 Bacteria 13723
655 Ga0496125_0202499 3300048928 Bacteria 1298
656 Ga0496126_0013022 3300048929 Bacteria 8488
657 Ga0496126_0068439 3300048929 Bacteria 3170
658 Ga0501310_000181 3300049130 Bacteria 6160
659 Ga0501031_0002573 3300049568 Bacteria 11553
660 Ga0501031_0042163 3300049568 Bacteria 2979
661 Ga0501031_0068604 3300049568 Bacteria 2310
662 Ga0501031_0141937 3300049568 Bacteria 1570
663 Ga0501031_0254244 3300049568 Bacteria 1142
664 Ga0501032_0001327 3300049569 Bacteria 19740
665 Ga0501032_0014617 3300049569 Bacteria 5560
666 Ga0501032_0021442 3300049569 Bacteria 4491
667 Ga0501032_0069207 3300049569 Bacteria 2355
668 Ga0501032_0084105 3300049569 Bacteria 2115
669 Ga0501033_0011673 3300049570 Bacteria 6717
670 Ga0501034_0000051 3300049571 Bacteria 210960
671 Ga0501034_0038590 3300049571 Bacteria 4836
672 Ga0501034_0053382 3300049571 Bacteria 4069
673 Ga0501034_0143842 3300049571 Bacteria 2363
674 Ga0501036_0015257 3300049572 Bacteria 6415
675 Ga0501036_0041519 3300049572 Bacteria 3891
676 Ga0501037_0009947 3300049573 Bacteria 6975
677 Ga0501037_0022718 3300049573 Bacteria 4637
678 Ga0501037_0041764 3300049573 Bacteria 3372
679 Ga0501038_0017992 3300049574 Bacteria 6383
680 Ga0501038_0027326 3300049574 Bacteria 5077
681 Ga0501039_0025005 3300049575 Bacteria 4586
682 Ga0501039_0189230 3300049575 Bacteria 1619
683 Ga0501040_0060191 3300049576 Bacteria 2609
684 Ga0501041_0015790 3300049577 Bacteria 4486
685 Ga0501042_0017985 3300049578 Bacteria 4888
686 Ga0501042_0044058 3300049578 Bacteria 3179
687 Ga0501043_0003001 3300049579 Bacteria 14058
688 Ga0501043_0074202 3300049579 Bacteria 2672
689 Ga0501046_0035613 3300049580 Bacteria 4010
690 Ga0501046_0083355 3300049580 Bacteria 2468
691 Ga0501046_0158007 3300049580 Bacteria 1707
692 Ga0501047_0040947 3300049581 Bacteria 4479
693 Ga0501047_0052193 3300049581 Bacteria 3951
694 Ga0501048_0057858 3300049582 Bacteria 2748
695 Ga0501048_0383465 3300049582 Bacteria 1004
696 Ga0501068_0005007 3300049584 Bacteria 7216
697 Ga0501069_0002977 3300049585 Bacteria 8716
698 Ga0501070_0002137 3300049586 Bacteria 17354
699 Ga0501070_0005900 3300049586 Bacteria 10446
700 Ga0501070_0006718 3300049586 Bacteria 9795
701 Ga0501070_0022798 3300049586 Bacteria 5241
702 Ga0501071_0010291 3300049587 Bacteria 6263
703 Ga0501072_0022655 3300049588 Bacteria 4872
704 Ga0501074_0004401 3300049590 Bacteria 10069
705 Ga0501074_0092146 3300049590 Bacteria 2170
706 Ga0501075_0146021 3300049591 Bacteria 1803
707 Ga0501076_0022984 3300049592 Bacteria 4799
708 Ga0501077_0095069 3300049593 Bacteria 1889
709 Ga0501079_0004198 3300049741 Bacteria 10678
710 Ga0501079_0070199 3300049741 Bacteria 2704
711 Ga0501080_0000119 3300049742 Bacteria 55135
712 Ga0501080_0002163 3300049742 Bacteria 17078
713 Ga0501080_0124170 3300049742 Bacteria 2391
714 Ga0501083_0004154 3300049744 Bacteria 10198
715 Ga0501035_0012256 3300049822 Bacteria 7926
716 Ga0501035_0044225 3300049822 Bacteria 4010
717 Ga0501035_0214696 3300049822 Bacteria 1645
718 Ga0501044_0004271 3300049823 Bacteria 16034
719 Ga0501044_0055482 3300049823 Bacteria 4069
720 Ga0501044_0079040 3300049823 Bacteria 3333
721 Ga0501044_0120285 3300049823 Bacteria 2628
722 Ga0501044_0197219 3300049823 Bacteria 1972
723 Ga0501045_0150889 3300049824 Bacteria 1729
724 nmdc:mga05p37_12932_c1 3300050507 Bacteria 9983
725 nmdc:mga05p37_153290_c1 3300050507 Bacteria 2817
726 nmdc:mga05p37_6208_c1 3300050507 Bacteria 14074
727 nmdc:mga06r32_10297_c1 3300050510 Bacteria 8434
728 nmdc:mga0n895_153072_c1 3300050512 Bacteria 2337
729 nmdc:mga0rr50_16872_c1 3300050513 Bacteria 4863
730 nmdc:mga0rr50_225248_c1 3300050513 Bacteria 1550
731 nmdc:mga08x19_55153_c1 3300050514 Bacteria 2560
732 nmdc:mga08x19_8111_c1 3300050514 Bacteria 6239
733 nmdc:mga0a205_107549_c1 3300050515 Bacteria 2687
734 nmdc:mga0a205_118779_c1 3300050515 Bacteria 2543
735 Ga0495601_0001810 3300053077 Bacteria 11870
736 Ga0495601_0032184 3300053077 Bacteria 3263
737 Ga0495601_0040127 3300053077 Bacteria 2931
738 Ga0495601_0054474 3300053077 Bacteria 2530
739 Ga0495601_0127344 3300053077 Bacteria 1657
740 Ga0495601_0132446 3300053077 Bacteria 1624
741 Ga0495601_0223291 3300053077 Bacteria 1230
742 Ga0495612_0005046 3300053078 Bacteria 5466
743 Ga0495612_0024462 3300053078 Bacteria 2424
744 Ga0495612_0115233 3300053078 Bacteria 1153
745 Ga0500610_0036913 3300053079 Bacteria 2514
746 Ga0495655_0005559 3300053083 Bacteria 2236
747 Ga0495595_0011713 3300053084 Bacteria 3671
748 Ga0495595_0018802 3300053084 Bacteria 2990
749 Ga0495619_0012376 3300053085 Bacteria 5371
750 Ga0495619_0061440 3300053085 Bacteria 2500
751 Ga0500578_0035850 3300053086 Bacteria 3187
752 Ga0500646_0044019 3300053090 Bacteria 1266
753 Ga0500654_047586 3300053099 Bacteria 2351
754 Ga0500553_039878 3300053101 Bacteria 2307
755 Ga0500569_014781 3300053109 Bacteria 1940
756 Ga0500628_001072 3300053129 Bacteria 4782
757 Ga0500652_016116 3300053131 Bacteria 2712
758 Ga0500658_0008435 3300053134 Bacteria 3807
759 Ga0500561_0001133 3300053137 Bacteria 4311
760 Ga0500579_061228 3300053143 Bacteria 2233
761 Ga0500600_0034402 3300053149 Bacteria 2957
762 Ga0500616_0008784 3300053153 Bacteria 6222
763 Ga0500634_0032354 3300053161 Bacteria 2852
764 Ga0500587_001155 3300053739 Bacteria 3649
765 Ga0501084_0009397 3300054114 Bacteria 8090
766 Ga0501082_0025428 3300060353 Bacteria 5102
767 Ga0466962_0010674 3300061719 Bacteria 4418
768 Ga0466962_0024791 3300061719 Bacteria 2880
769 Ga0466962_0079618 3300061719 Bacteria 1566
770 2515857960 2515154155 Bacteria 7985436
771 2644082866 2643221613 Bacteria 4622396
772 2644665823 2643221721 Bacteria 4486924
773 2676473393 2675903058 Bacteria 6822861
774 2729907569 2728369276 Bacteria 5610032
775 2731908434 2731639228 Bacteria 4187555
776 2768643317 2767802112 Bacteria 6465194
777 2799184643 2799112218 Bacteria 4315149
778 2808875031 2808606365 Bacteria 4301966
779 2816424019 2816332119 Bacteria 8120218
780 2827631903 2827628540 Bacteria 6858585
781 2835189687 2835188231 Bacteria 3476928
782 2837269393 2837268691 Bacteria 7850704
783 2839987129 2839986021 Bacteria 3685650
784 2848552899 2848551377 Bacteria 3720646
785 2862710274 2862705112 Bacteria 6563286
786 2867350017 2867346516 Bacteria 7608576
787 2867371542 2867369537 Bacteria 6501581
788 2868092102 2868088558 Bacteria 7609351
789 2884994741 2884994152 Bacteria 4492978
790 2887444361 2887443736 Bacteria 4426037
791 2932433921 2932431166 Bacteria 4215299
792 2935893215 2935890801 Bacteria 4593001
793 2990046716 2990044586 Bacteria 6603797
794 2990089774 2990088156 Bacteria 6657676
795 2995466194 2995463766 Bacteria 8577691
796 3006321598 3006321560 Bacteria 8247479
797 8008487421 8008485437 Bacteria 7198341
798 8025526429 8025524527 Bacteria 7197316
799 8056061560 8056060235 Bacteria 7259403
800 8056672678 8056667051 Bacteria 6953971
801 Ga0068855_100050084
802 JGI24740J21852_10008298
803 JGI24739J22299_10017776
804 JGI24739J22299_10018374
805 JGI24737J22298_10007355
806 JGI24738J21930_10023679
807 JGI25152J39213_1000165
808 rootH2_10060078
809 JGI25160J50197_1018483
810 JGI25404J52841_10010151
811 Ga0070658_10006268
812 Ga0070658_10021938
813 Ga0070683_100081204
814 Ga0070683_100213351
815 Ga0070680_100234315
816 Ga0070682_100005228
817 Ga0070682_100065954
818 Ga0070682_100311752
819 Ga0070660_100017404
820 Ga0070691_10011679
821 Ga0070674_100035129
822 Ga0070674_100287225
823 Ga0070659_100044672
824 Ga0070709_10006680
825 Ga0070709_10016013
826 Ga0070709_10034956
827 Ga0070709_10125992
828 Ga0070714_100060895
829 Ga0070714_100077143
830 Ga0070714_100109057
831 Ga0070714_100137288
832 Ga0070714_100239149
833 Ga0070714_100239428
834 Ga0070713_100033715
835 Ga0070713_100068025
836 Ga0070713_100113238
837 Ga0070713_100184567
838 Ga0070710_10048013
839 Ga0070710_10082821
840 Ga0070711_100039936
841 Ga0070711_100233178
842 Ga0070705_100015445
843 Ga0070705_100249688
844 Ga0070708_100013731
845 Ga0070663_100080682
846 Ga0070678_100164582
847 Ga0070678_100252684
848 Ga0070681_10336124
849 Ga0070706_100003693
850 Ga0070706_100027028
851 Ga0070706_100051000
852 Ga0070707_100011627
853 Ga0070707_100015326
854 Ga0070698_100000926
855 Ga0070698_100009552
856 Ga0070698_100035328
857 Ga0070679_100064354
858 Ga0070679_100338784
859 Ga0070679_100604459
860 Ga0070684_100107708
861 Ga0070684_100153945
862 Ga0070684_100178754
863 Ga0070696_100014395
864 Ga0070696_100070067
865 Ga0070696_100094166
866 Ga0070693_100138432
867 Ga0070665_100027413
868 Ga0070704_100132356
869 Ga0068857_100215937
870 Ga0068854_100073281
871 Ga0068856_100075337
872 Ga0068856_100223031
873 Ga0068856_100354629
874 Ga0070702_100009738
875 Ga0068852_100144356
876 Ga0068851_10109569
877 Ga0068863_100023280
878 Ga0081455_10088919
879 Ga0081540_1040499
880 Ga0070717_10023373
881 Ga0070717_10046013
882 Ga0070717_10062242
883 Ga0070715_10004152
884 Ga0070715_10017749
885 Ga0070716_100015285
886 Ga0070716_100035223
887 Ga0070716_100047627
888 Ga0070712_100107040
889 Ga0097621_100176707
890 Ga0068871_100113288
891 Ga0075428_100067123
892 Ga0075428_100188677
893 Ga0075430_100007169
894 Ga0075431_100004096
895 Ga0075433_10088980
896 Ga0075434_100037823
897 Ga0075429_100007666
898 Ga0075436_100010207
899 Ga0075436_100044832
900 Ga0075436_100064277
901 Ga0075435_100080382
902 Ga0099794_10051910
903 Ga0105244_10017621
904 Ga0105240_10597729
905 Ga0105240_10634057
906 Ga0105245_10400397
907 Ga0114129_10003686
908 Ga0114129_10007477
909 Ga0114129_10209998
910 Ga0105243_10008338
911 Ga0105243_10059805
912 Ga0105243_10082521
913 Ga0105243_10241678
914 Ga0105243_10288724
915 Ga0105241_10008019
916 Ga0105241_10131033
917 Ga0105241_10249048
918 Ga0105242_10223404
919 Ga0105238_10440531
920 Ga0105238_10469152
921 Ga0105249_10011959
922 Ga0105239_10488489
923 Ga0105239_10679274
924 Ga0105239_10954702
925 Ga0105246_10032255
926 Ga0157373_10006775
927 Ga0157370_10036194
928 Ga0157370_10166932
929 Ga0157369_10045092
930 Ga0157369_10057990
931 Ga0157369_10061485
932 Ga0157369_10221098
933 Ga0157369_10382148
934 Ga0157378_10040234
935 Ga0163162_10012217
936 Ga0157372_10067334
937 Ga0157372_10491559
938 Ga0157372_10664334
939 Ga0157375_10069440
940 Ga0157375_10079934
941 Ga0157375_10183150
942 Ga0157375_10642742
943 Ga0157380_10054643
944 Ga0157380_10063919
945 Ga0157376_10064269
946 Ga0163161_10031627
947 Ga0197907_10637809
948 Ga0206351_10371412
949 Ga0206352_10518047
950 Ga0206353_10783437
951 Ga0206353_11910123
952 Ga0154015_1549829
953 Ga0213875_10010623
954 Ga0213875_10080578
955 Ga0224712_10004042
956 Ga0224712_10017337
957 Ga0224712_10017915
958 Ga0224712_10036793
959 Ga0209129_1000028
960 Ga0209025_1003151
961 Ga0209051_1004679
962 Ga0207697_10008829
963 Ga0207655_1003071
964 Ga0207655_1014475
965 Ga0207653_10056021
966 Ga0207692_10001309
967 Ga0207692_10002505
968 Ga0207692_10006717
969 Ga0207647_10009366
970 Ga0207685_10000471
971 Ga0207685_10015929
972 Ga0207699_10011968
973 Ga0207705_10002068
974 Ga0207684_10004857
975 Ga0207684_10013152
976 Ga0207654_10014637
977 Ga0207654_10072508
978 Ga0207707_10187374
979 Ga0207707_10218598
980 Ga0207695_10002003
981 Ga0207695_10046995
982 Ga0207671_10000058
983 Ga0207693_10011663
984 Ga0207693_10033882
985 Ga0207693_10038097
986 Ga0207693_10230113
987 Ga0207663_10009041
988 Ga0207663_10027398
989 Ga0207663_10101258
990 Ga0207663_10159467
991 Ga0207660_10046373
992 Ga0207657_10043793
993 Ga0207649_10152505
994 Ga0207652_10031197
995 Ga0207652_10087142
996 Ga0207652_10105461
997 Ga0207646_10004327
998 Ga0207646_10004858
999 Ga0207694_10000381
1000 Ga0207687_10251453
1001 Ga0207700_10011176
1002 Ga0207700_10044107
1003 Ga0207700_10051354
1004 Ga0207664_10002215
1005 Ga0207664_10019285
1006 Ga0207664_10036713
1007 Ga0207664_10295946
1008 Ga0207690_10040175
1009 Ga0207686_10037267
1010 Ga0207709_10086412
1011 Ga0207709_10104050
1012 Ga0207665_10000684
1013 Ga0207665_10053459
1014 Ga0207665_10081885
1015 Ga0207661_10077003
1016 Ga0207661_10168222
1017 Ga0207667_10051368
1018 Ga0207712_10146129
1019 Ga0207640_10035302
1020 Ga0207658_10584728
1021 Ga0207677_10303844
1022 Ga0207677_10376479
1023 Ga0207678_10007142
1024 Ga0207678_10090279
1025 Ga0207702_10036078
1026 Ga0207702_10141806
1027 Ga0207674_10097606
1028 Ga0207698_10114099
1029 Ga0209974_10003298
1030 Ga0268266_10075702
1031 Ga0265337_1000062
1032 Ga0265326_10001770
1033 Ga0265334_10000617
1034 Ga0265318_10006124
1035 Ga0265323_10004066
1036 Ga0265322_10002801
1037 Ga0265336_10004360
1038 Ga0307517_10002661
1039 Ga0265338_10000791
1040 Ga0265338_10004616
1041 Ga0265338_10008739
1042 Ga0265324_10003326
1043 Ga0265763_1000364
1044 Ga0265332_10003177
1045 Ga0265320_10002446
1046 Ga0265325_10001888
1047 Ga0265340_10001077
1048 Ga0265316_10023843
1049 Ga0307508_10027108
1050 Ga0316575_10003736
1051 Ga0316575_10017790
1052 Ga0316579_10001601
1053 Ga0316579_10004925
1054 Ga0316579_10029819
1055 Ga0265314_10013530
1056 Ga0265342_10001259
1057 Ga0316576_10000619
1058 Ga0316576_10010066
1059 Ga0316576_10013973
1060 Ga0316576_10023125
1061 Ga0316576_10037117
1062 Ga0316576_10049870
1063 Ga0316578_10026319
1064 Ga0316578_10037145
1065 Ga0316578_10042526
1066 Ga0316578_10065362
1067 Ga0307516_10095028
1068 Ga0307405_10085975
1069 Ga0307405_10112544
1070 Ga0316577_10001710
1071 Ga0307413_10102483
1072 Ga0307410_10012272
1073 Ga0307410_10042246
1074 Ga0307410_10138914
1075 Ga0307406_10124083
1076 Ga0307409_100067222
1077 Ga0307416_100148441
1078 Ga0307414_10022085
1079 Ga0307411_10040747
1080 Ga0316583_10005301
1081 Ga0316583_10012746
1082 Ga0316585_10033320
1083 Ga0316580_10004989
1084 Ga0316580_10011578
1085 Ga0316580_10055853
1086 Ga0307507_10000013
1087 Ga0316592_1009638
1088 Ga0316596_1013265
1089 Ga0373929_0004683
1090 Ga0373934_0004394
1091 Ga0373934_0006110
1092 Ga0373934_0009651
1093 Ga0373934_0010048
1094 Ga0373934_0022483
1095 Ga0373923_0008296
1096 Ga0373923_0013429
1097 Ga0373923_0098638
1098 Ga0373932_0014339
1099 Ga0373939_0003585
1100 Ga0373941_0004222
1101 Ga0373953_0004403
1102 Ga0373953_0004727
1103 Ga0373953_0039468
1104 Ga0373954_0001318
1105 Ga0373954_0014475
1106 Ga0373956_0000040
1107 Ga0373956_0005998
1108 Ga0373957_0001325
1109 Ga0373957_0011966
1110 Ga0373957_0014745
1111 Ga0373955_0000063
1112 Ga0373955_0005374
1113 Ga0373955_0006265
1114 Ga0316574_0002423
1115 Ga0316574_0004590
1116 Ga0316574_0007027
1117 Ga0316574_0019685
1118 Ga0316574_0026311
1119 Ga0316574_0038767
1120 Ga0373924_0000316
1121 Ga0373924_0018295
1122 Ga0373931_0104102
1123 Ga0373935_0202164
1124 Ga0373933_0000171
1125 Ga0373933_0024965
1126 Ga0373933_0047696
1127 Ga0373933_0105020
1128 Ga0373937_0000360
1129 Ga0373937_0001805
1130 Ga0373937_0034585
1131 Ga0373937_0124052
1132 Ga0373937_0422886
1133 Ga0373937_0520833
1134 Ga0316582_0001095
1135 Ga0316582_0055139
1136 Ga0316584_0001482
1137 Ga0316584_0003347
1138 Ga0316584_0058376
1139 Ga0316584_0090985
1140 Ga0373925_0000252
1141 Ga0373925_0002375
1142 Ga0373925_0171236
1143 Ga0395899_0001148
1144 Ga0395899_0013612
1145 Ga0395899_0108449
1146 Ga0395900_0122693
1147 Ga0395900_0126945
1148 Ga0395900_0139307
1149 Ga0395898_0012396
1150 Ga0395898_0081668
1151 Ga0395898_0135195
1152 Ga0395898_0315521
1153 Ga0395898_0365667
1154 Ga0395905_0643574
1155 Ga0316581_0015677
1156 Ga0316581_0051905
1157 Ga0436364_0825611
1158 Ga0395901_0007102
1159 Ga0395901_0061373
1160 Ga0395901_0087305
1161 Ga0395901_0114531
1162 Ga0395901_0318306
1163 Ga0395901_0355295
1164 Ga0395901_0441080
1165 Ga0400485_08773
1166 Ga0400488_22539
1167 Ga0400486_15822
1168 Ga0436363_0748014
1169 Ga0439436_0002263
1170 Ga0439438_003044
1171 Ga0439439_0000126
1172 Ga0439466_0003961
1173 Ga0451851_0114374
1174 Ga0439433_0000308
1175 Ga0439432_006621
1176 Ga0439449_0005661
1177 Ga0439452_001706
1178 Ga0439457_012413
1179 Ga0439457_021427
1180 Ga0439462_0007577
1181 Ga0439462_0033890
1182 Ga0439463_024944
1183 Ga0450919_000659
1184 Ga0450920_006673
1185 Ga0450906_012335
1186 Ga0450907_008278
1187 Ga0450908_004100
1188 Ga0450909_004276
1189 Ga0439434_0000119
1190 Ga0450918_005596
1191 Ga0466969_0000444
1192 Ga0466969_0004927
1193 Ga0466969_0007535
1194 Ga0466969_0030025
1195 Ga0466965_0010674
1196 Ga0466966_0011039
1197 Ga0466966_0042947
1198 Ga0466966_0232193
1199 Ga0466961_0002494
1200 Ga0466961_0006039
1201 Ga0466961_0061557
1202 Ga0466961_0095918
1203 Ga0466961_0097712
1204 Ga0466961_0137051
1205 Ga0466963_0047291
1206 Ga0466963_0077350
1207 Ga0466963_0186584
1208 Ga0466963_0296832
1209 Ga0466971_0007825
1210 Ga0466970_0006563
1211 Ga0466970_0037270
1212 Ga0466957_0127521
1213 Ga0466959_0032472
1214 Ga0466959_0067108
1215 Ga0466959_0231449
1216 Ga0466958_0044204
1217 Ga0466958_0235035
1218 Ga0466958_0299901
1219 Ga0466967_0142711
1220 Ga0466967_0476259
1221 Ga0495592_0000299
1222 Ga0495592_0009165
1223 Ga0495592_0025745
1224 Ga0495592_0030439
1225 Ga0495592_0031185
1226 Ga0495592_0053550
1227 Ga0495603_0035937
1228 Ga0495629_0013776
1229 Ga0495629_0025230
1230 Ga0495629_0030363
1231 Ga0495629_0215364
1232 Ga0495638_0033840
1233 Ga0495641_0039972
1234 Ga0495651_0000241
1235 Ga0495651_0000309
1236 Ga0495651_0004408
1237 Ga0495651_0010722
1238 Ga0495651_0012229
1239 Ga0495651_0013308
1240 Ga0495651_0026409
1241 Ga0495651_0041197
1242 Ga0495651_0191946
1243 Ga0495653_0002292
1244 Ga0495653_0002736
1245 Ga0495653_0014980
1246 Ga0495653_0075291
1247 Ga0495653_0105249
1248 Ga0495580_0086963
1249 Ga0495580_0100811
1250 Ga0495582_0118456
1251 Ga0495662_0000975
1252 Ga0495662_0017245
1253 Ga0495662_0092918
1254 Ga0495664_0014188
1255 Ga0495664_0022280
1256 Ga0495664_0045332
1257 Ga0495664_0146803
1258 Ga0495585_0009703
1259 Ga0495594_0030506
1260 Ga0495594_0032773
1261 Ga0495594_0088851
1262 Ga0495608_0000207
1263 Ga0495608_0003475
1264 Ga0495608_0020182
1265 Ga0495608_0068076
1266 Ga0495608_0260967
1267 Ga0495618_0020179
1268 Ga0495618_0045109
1269 Ga0495618_0071561
1270 Ga0495618_0185099
1271 Ga0495628_0001668
1272 Ga0495628_0007199
1273 Ga0495628_0007372
1274 Ga0495628_0026074
1275 Ga0495628_0060538
1276 Ga0495628_0350485
1277 Ga0495630_0027541
1278 Ga0495630_0045761
1279 Ga0495630_0146538
1280 Ga0495630_0269746
1281 Ga0495631_0139098
1282 Ga0495632_0039896
1283 Ga0495643_0013159
1284 Ga0495666_0003481
1285 Ga0495666_0020201
1286 Ga0495652_0001515
1287 Ga0495652_0002781
1288 Ga0495652_0025794
1289 Ga0495652_0044703
1290 Ga0495652_0045022
1291 Ga0495652_0046962
1292 Ga0495652_0081309
1293 Ga0495652_0116062
1294 Ga0495665_0001217
1295 Ga0495665_0013863
1296 Ga0495640_0001311
1297 Ga0495640_0007237
1298 Ga0495640_0036480
1299 Ga0495640_0051466
1300 Ga0495640_0071012
1301 Ga0495640_0076838
1302 Ga0495586_0029026
1303 Ga0495586_0054470
1304 Ga0495586_0203222
1305 Ga0495587_0000191
1306 Ga0495587_0050974
1307 Ga0495587_0077313
1308 Ga0495587_0229813
1309 Ga0495645_0001962
1310 Ga0495645_0008928
1311 Ga0495645_0022576
1312 Ga0495645_0028614
1313 Ga0495645_0046692
1314 Ga0495645_0113716
1315 Ga0495622_0037509
1316 Ga0495622_0158688
1317 Ga0495633_0029838
1318 Ga0495667_0000185
1319 Ga0495667_0000283
1320 Ga0495667_0004600
1321 Ga0495667_0009107
1322 Ga0495667_0013581
1323 Ga0495667_0044426
1324 Ga0495634_0006347
1325 Ga0495634_0010296
1326 Ga0495634_0014116
1327 Ga0495634_0036901
1328 Ga0495625_0034328
1329 Ga0495635_0001167
1330 Ga0495635_0001677
1331 Ga0495635_0015596
1332 Ga0495635_0035602
1333 Ga0495635_0108302
1334 Ga0495588_0104517
1335 Ga0495657_0000329
1336 Ga0495657_0005709
1337 Ga0495657_0007253
1338 Ga0495657_0010759
1339 Ga0495657_0057229
1340 Ga0495657_0261427
1341 Ga0495599_0000225
1342 Ga0495599_0001405
1343 Ga0495599_0006046
1344 Ga0495599_0008876
1345 Ga0495599_0021207
1346 Ga0495599_0125120
1347 Ga0495599_0174200
1348 Ga0495623_0000185
1349 Ga0495623_0024649
1350 Ga0495623_0043554
1351 Ga0495623_0044559
1352 Ga0495646_0001556
1353 Ga0495646_0002992
1354 Ga0495646_0006118
1355 Ga0495646_0009188
1356 Ga0495646_0020098
1357 Ga0495647_0120198
1358 Ga0495658_0030749
1359 Ga0495669_0107301
1360 Ga0495613_0021611
1361 Ga0495613_0046464
1362 Ga0495613_0105355
1363 Ga0495624_0103922
1364 Ga0495624_0144155
1365 Ga0495670_0000729
1366 Ga0495589_0034177
1367 Ga0495600_0000637
1368 Ga0495600_0003215
1369 Ga0495600_0009542
1370 Ga0495600_0030533
1371 Ga0495600_0034785
1372 Ga0495600_0038962
1373 Ga0495600_0048501
1374 Ga0495600_0102377
1375 Ga0495600_0276266
1376 Ga0495660_0035980
1377 Ga0495581_0016540
1378 Ga0495581_0063026
1379 Ga0495604_0000314
1380 Ga0495604_0003425
1381 Ga0495604_0011275
1382 Ga0495604_0040681
1383 Ga0495604_0050504
1384 Ga0495604_0050731
1385 Ga0495604_0054343
1386 Ga0495604_0072687
1387 Ga0495674_0039783
1388 Ga0495674_0132229
1389 Ga0495674_0155413
1390 Ga0495674_0309270
1391 Ga0495676_0000425
1392 Ga0495676_0212357
1393 Ga0495680_0000542
1394 Ga0495680_0014486
1395 Ga0495680_0043737
1396 Ga0495680_0057935
1397 Ga0495680_0105115
1398 Ga0495683_0079939
1399 Ga0495675_0000531
1400 Ga0495675_0003326
1401 Ga0495675_0011556
1402 Ga0495675_0036672
1403 Ga0495675_0040227
1404 Ga0495675_0049593
1405 Ga0495685_000466
1406 Ga0495684_0008000
1407 Ga0495684_0018773
1408 Ga0495684_0027989
1409 Ga0495684_0052346
1410 Ga0495686_0018015
1411 Ga0495593_0043665
1412 Ga0495602_0001433
1413 Ga0495602_0054386
1414 Ga0495602_0065233
1415 Ga0495602_0156280
1416 Ga0495602_0211502
1417 Ga0495602_0357530
1418 Ga0495614_0108485
1419 Ga0496100_0073624
1420 Ga0496100_0376934
1421 Ga0496102_0088629
1422 Ga0496102_0339238
1423 Ga0496103_0184061
1424 Ga0496104_0001893
1425 Ga0496105_0000206
1426 Ga0496105_0178447
1427 Ga0496105_0308931
1428 Ga0496106_0032187
1429 Ga0496106_0053470
1430 Ga0496108_0158450
1431 Ga0496108_0272281
1432 Ga0496109_0006674
1433 Ga0496109_0103515
1434 Ga0496109_0371292
1435 Ga0496110_0020492
1436 Ga0496110_0112899
1437 Ga0496110_0140131
1438 Ga0496111_0111397
1439 Ga0496112_0000167
1440 Ga0496112_0176770
1441 Ga0496113_0007390
1442 Ga0496113_0107132
1443 Ga0496114_0065150
1444 Ga0496115_0005213
1445 Ga0496115_0070182
1446 Ga0496118_0028519
1447 Ga0496118_0046848
1448 Ga0496122_0000620
1449 Ga0496122_0000873
1450 Ga0496123_0000142
1451 Ga0496124_0000461
1452 Ga0496124_0076251
1453 Ga0496125_0000075
1454 Ga0496125_0005705
1455 Ga0496125_0202499
1456 Ga0496126_0013022
1457 Ga0496126_0068439
1458 Ga0501310_000181
1459 Ga0501031_0002573
1460 Ga0501031_0042163
1461 Ga0501031_0068604
1462 Ga0501031_0141937
1463 Ga0501031_0254244
1464 Ga0501032_0001327
1465 Ga0501032_0014617
1466 Ga0501032_0021442
1467 Ga0501032_0069207
1468 Ga0501032_0084105
1469 Ga0501033_0011673
1470 Ga0501034_0000051
1471 Ga0501034_0038590
1472 Ga0501034_0053382
1473 Ga0501034_0143842
1474 Ga0501036_0015257
1475 Ga0501036_0041519
1476 Ga0501037_0009947
1477 Ga0501037_0022718
1478 Ga0501037_0041764
1479 Ga0501038_0017992
1480 Ga0501038_0027326
1481 Ga0501039_0025005
1482 Ga0501039_0189230
1483 Ga0501040_0060191
1484 Ga0501041_0015790
1485 Ga0501042_0017985
1486 Ga0501042_0044058
1487 Ga0501043_0003001
1488 Ga0501043_0074202
1489 Ga0501046_0035613
1490 Ga0501046_0083355
1491 Ga0501046_0158007
1492 Ga0501047_0040947
1493 Ga0501047_0052193
1494 Ga0501048_0057858
1495 Ga0501048_0383465
1496 Ga0501068_0005007
1497 Ga0501069_0002977
1498 Ga0501070_0002137
1499 Ga0501070_0005900
1500 Ga0501070_0006718
1501 Ga0501070_0022798
1502 Ga0501071_0010291
1503 Ga0501072_0022655
1504 Ga0501074_0004401
1505 Ga0501074_0092146
1506 Ga0501075_0146021
1507 Ga0501076_0022984
1508 Ga0501077_0095069
1509 Ga0501079_0004198
1510 Ga0501079_0070199
1511 Ga0501080_0000119
1512 Ga0501080_0002163
1513 Ga0501080_0124170
1514 Ga0501083_0004154
1515 Ga0501035_0012256
1516 Ga0501035_0044225
1517 Ga0501035_0214696
1518 Ga0501044_0004271
1519 Ga0501044_0055482
1520 Ga0501044_0079040
1521 Ga0501044_0120285
1522 Ga0501044_0197219
1523 Ga0501045_0150889
1524 nmdc:mga05p37_12932_c1
1525 nmdc:mga05p37_153290_c1
1526 nmdc:mga05p37_6208_c1
1527 nmdc:mga06r32_10297_c1
1528 nmdc:mga0n895_153072_c1
1529 nmdc:mga0rr50_16872_c1
1530 nmdc:mga0rr50_225248_c1
1531 nmdc:mga08x19_55153_c1
1532 nmdc:mga08x19_8111_c1
1533 nmdc:mga0a205_107549_c1
1534 nmdc:mga0a205_118779_c1
1535 Ga0495601_0001810
1536 Ga0495601_0032184
1537 Ga0495601_0040127
1538 Ga0495601_0054474
1539 Ga0495601_0127344
1540 Ga0495601_0132446
1541 Ga0495601_0223291
1542 Ga0495612_0005046
1543 Ga0495612_0024462
1544 Ga0495612_0115233
1545 Ga0500610_0036913
1546 Ga0495655_0005559
1547 Ga0495595_0011713
1548 Ga0495595_0018802
1549 Ga0495619_0012376
1550 Ga0495619_0061440
1551 Ga0500578_0035850
1552 Ga0500646_0044019
1553 Ga0500654_047586
1554 Ga0500553_039878
1555 Ga0500569_014781
1556 Ga0500628_001072
1557 Ga0500652_016116
1558 Ga0500658_0008435
1559 Ga0500561_0001133
1560 Ga0500579_061228
1561 Ga0500600_0034402
1562 Ga0500616_0008784
1563 Ga0500634_0032354
1564 Ga0500587_001155
1565 Ga0501084_0009397
1566 Ga0501082_0025428
1567 Ga0466962_0010674
1568 Ga0466962_0024791
1569 Ga0466962_0079618
1570 2515857960
1571 2644082866
1572 2644665823
1573 2676473393
1574 2729907569
1575 2731908434
1576 2768643317
1577 2799184643
1578 2808875031
1579 2816424019
1580 2827631903
1581 2835189687
1582 2837269393
1583 2839987129
1584 2848552899
1585 2862710274
1586 2867350017
1587 2867371542
1588 2868092102
1589 2884994741
1590 2887444361
1591 2932433921
1592 2935893215
1593 2990046716
1594 2990089774
1595 2995466194
1596 3006321598
1597 8008487421
1598 8025526429
1599 8056061560
1600 8056672678

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18075

FtsX_ECD

FtsX extracellular domain

56

167

0.96

PF02687

FtsX

FtsX-like permease family

189

310

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n8n-assembly1.cif.gz_A crystal structure of mycobacterial ftsx extracellular domain 0.7933 58 161
6tpi-assembly1.cif.gz_B envc bound to the ftsx periplasmic domain 0.7744 58 161
4n8n-assembly2.cif.gz_B crystal structure of mycobacterial ftsx extracellular domain 0.7738 54 161
6tpi-assembly1.cif.gz_C envc bound to the ftsx periplasmic domain 0.7473 57 161
4n8n-assembly2.cif.gz_B crystal structure of mycobacterial ftsx extracellular domain 0.7469 54 161
ID Description Score Start End Superfamily
af_P0AC30_96_208_3.30.70.3040 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7784 45 161 3.30.70.3040
af_P9WG19_44_157_3.30.70.3040 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7771 49 164 3.30.70.3040
4n8oB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7528 56 161 3.30.70.3040
af_P0AC30_96_208_3.30.70.3040 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7419 45 161 3.30.70.3040
4n8oB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7396 56 161 3.30.70.3040
ID Description Score Start End GO Terms
AF-A0A7K0BXI7-F1-model_v4 FtsX extracellular domain-containing protein 0.8692 55 161 GO:0016020
AF-A0A7X7I3M1-F1-model_v4 Cell division protein FtsX 0.8277 1 301 GO:0005886
GO:0051301
AF-A0A2M9A8N2-F1-model_v4 Cell division protein FtsX 0.8202 2 302 GO:0005886
GO:0051301
AF-A0A7X7I3M1-F1-model_v4 Cell division protein FtsX 0.82 1 301 GO:0005886
GO:0051301
AF-A0A7X8EPL0-F1-model_v4 Cell division protein FtsX 0.8097 3 303 GO:0005886
GO:0051301

Map