F481212

General Info

Members Datasets Scaffolds Average Seq Length
796 577 545 272

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0085191|Ga0496114_0085191_1426_2382
Length 318
Sequence MRLFARAPGGWLYRGHLPLAQGKAKWPDSHLGSIMTMTEAETAAVNLLTGPMRGKRGLVMGLANNRSIAWGIAKAARQAGAEIALTYQGEPLERRVRPLAAELDALVVGECDVTDKASLDRVFAEIERVWGTLDFVVHCIAFSDKDELTGRYVDTSEENFKTSLLISCYSFTAVAQRAEKLMTNGGSLLTLTYYGAEKWMPHYNVMGVAKAALEASVRYLAADLGEKNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIDEVGESAVFLLSPMGRGVTGEILHVDAGYHIVGMKNPNAPDIADIIKKP

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
12 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
13 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
21 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
22 2519899620 Rhizobium sp. Pop5 Isolate Nodule
23 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
24 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
25 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
26 2534681786 Brucella suis 92/29 Isolate Unclassified
27 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
28 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
29 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
30 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
31 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
32 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
33 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
34 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
35 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
36 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
37 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
38 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
39 2643221558 Rhizobium sp. Root149 Isolate Unclassified
40 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
41 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
42 2643221719 Rhizobium sp. Root274 Isolate Unclassified
43 2643221733 Bosea sp. Root381 Isolate Unclassified
44 2643221734 Bosea sp. Root670 Isolate Unclassified
45 2643221736 Bosea sp. Root483D1 Isolate Unclassified
46 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
47 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
48 2718217882 Rhizobium sp. N741 Isolate Nodule
49 2718217927 Rhizobium sp. N324 Isolate Nodule
50 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
51 2718218009 Rhizobium sp. N561 Isolate Nodule
52 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
53 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
54 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
55 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
56 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
57 2718218363 Rhizobium sp. N113 Isolate Nodule
58 2718218365 Rhizobium sp. N731 Isolate Nodule
59 2718218366 Rhizobium sp. N621 Isolate Nodule
60 2718218423 Rhizobium sp. N941 Isolate Nodule
61 2721755514 Rhizobium sp. N6212 Isolate Nodule
62 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
63 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
64 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
65 2721755809 Rhizobium sp. N541 Isolate Nodule
66 2721755810 Rhizobium sp. N871 Isolate Nodule
67 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
68 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
69 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
70 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
71 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
72 2728369365 Rhizobium sp. N1341 Isolate Nodule
73 2728369397 Rhizobium sp. N1314 Isolate Nodule
74 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
75 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
76 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
77 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
78 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
79 2751185800 Brucella pituitosa AA2 Isolate Unclassified
80 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
81 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
82 2773857925 Microvirga vignae BR3299 Isolate Unclassified
83 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
84 2791355256 Rhizobium sp. M10 Isolate Nodule
85 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
86 2791355260 Rhizobium sp. L9 Isolate Nodule
87 2791355261 Rhizobium sp. J15 Isolate Nodule
88 2791355262 Rhizobium sp. M1 Isolate Nodule
89 2791355263 Rhizobium chutanense C5 Isolate Nodule
90 2791355264 Rhizobium sp. S9 Isolate Nodule
91 2791355265 Rhizobium sp. H4 Isolate Nodule
92 2791355266 Rhizobium sp. L43 Isolate Nodule
93 2791355267 Rhizobium sp. L18 Isolate Nodule
94 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
95 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
96 2802429633 Rhizobium anhuiense J3 Isolate Nodule
97 2802429634 Rhizobium anhuiense S10 Isolate Nodule
98 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
99 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
100 2802429637 Rhizobium anhuiense C15 Isolate Nodule
101 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
102 2818991467 Bosea vestrisii 3192 Isolate Unclassified
103 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
104 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
105 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
106 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
107 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
108 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
109 2838048938 Rhizobium pisi 27/80 Isolate Nodule
110 2838061910 Rhizobium phaseoli L15 Isolate Nodule
111 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
112 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
113 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
114 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
115 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
116 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
117 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
118 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
119 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
120 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
121 2841760612 Bosea sp. Tri-49 Isolate Nodule
122 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
123 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
124 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
125 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
126 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
127 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
128 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
129 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
130 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
131 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
132 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
133 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
134 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
135 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
136 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
137 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
138 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
139 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
140 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
141 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
142 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
143 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
144 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
145 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
146 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
147 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
148 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
149 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
150 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
151 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
152 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
153 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
154 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
155 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
156 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
157 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
158 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
159 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
160 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
161 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
162 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
163 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
164 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
165 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
166 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
167 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
168 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
169 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
170 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
171 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
172 2844104063 Bosea sp. Tri-39 Isolate Nodule
173 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
174 2851182111 Bosea sp. Tri-44 Isolate Nodule
175 2851246043 Bosea sp. Tri-54 Isolate Nodule
176 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
177 2854911287 Brucella lupini LUP21 Isolate Unclassified
178 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
179 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
180 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
181 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
182 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
183 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
184 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
185 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
186 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
187 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
188 2902330777 Methylobacterium sp. 2A Isolate Unclassified
189 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
190 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
191 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
192 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
193 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
194 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
195 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
196 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
197 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
198 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
199 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
200 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
201 2933599457 Rhizobium phaseoli M3 Isolate Nodule
202 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
203 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
204 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
205 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
206 2936381700 Rhizobium chutanense C16 Isolate Unclassified
207 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
208 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
209 2996893221 Rhizobium sp. R635 Isolate Nodule
210 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
211 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
212 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
213 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
214 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
215 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
216 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
217 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
218 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
219 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
220 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
221 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
222 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
223 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
224 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
225 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
226 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
227 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
228 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
229 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
230 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
231 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
232 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
233 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
234 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
235 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
236 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
237 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
238 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
239 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
240 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
241 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
242 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
243 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
244 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
245 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
246 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
247 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
248 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
249 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
250 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
251 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
252 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
253 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
254 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
255 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
256 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
257 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
258 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
259 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
260 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
261 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
262 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
263 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
264 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
265 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
266 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
267 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
268 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
269 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
270 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
271 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
272 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
273 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
274 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
275 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
276 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
277 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
278 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
279 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
280 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
281 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
283 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
285 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
286 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
287 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
289 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
290 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
291 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
293 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
294 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
318 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
320 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
321 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
324 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
325 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
326 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
327 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
328 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
329 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
330 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
331 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
332 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
333 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
334 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
335 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
336 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
337 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
338 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
339 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
340 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
341 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
342 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
343 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
344 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
345 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
346 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
347 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
348 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
349 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
350 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
351 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
352 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
353 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
354 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
355 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
356 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
357 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
358 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
359 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
360 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
361 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
362 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
363 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
364 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
365 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
366 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
367 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
368 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
369 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
370 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
371 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
372 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
373 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
374 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
375 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
376 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
377 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
378 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
379 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
380 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
381 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
382 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
383 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
384 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
385 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
386 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
387 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
388 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
389 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
390 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
391 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
392 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
393 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
394 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
395 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
396 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
397 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
398 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
399 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
400 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
401 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
402 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
403 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
404 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
405 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
406 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
407 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
408 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
409 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
410 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
411 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
412 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
413 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
414 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
415 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
416 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
417 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
418 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
419 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
420 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
421 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
422 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
423 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
424 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
425 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
426 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
427 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
428 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
429 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
430 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
431 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
432 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
433 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
434 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
435 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
436 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
437 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
438 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
439 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
440 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
441 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
442 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
443 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
444 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
445 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
446 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
447 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
448 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
449 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
450 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
451 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
452 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
453 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
454 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
455 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
456 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
457 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
458 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
459 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
460 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
461 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
462 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
463 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
464 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
465 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
466 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
467 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
468 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
469 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
470 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
471 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
472 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
473 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
474 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
477 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
489 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
490 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
491 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
492 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
493 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
494 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
495 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
498 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
499 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
500 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
501 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
502 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
503 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
504 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
505 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
506 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
507 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
508 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
509 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
510 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
511 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
512 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
513 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
514 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
515 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
516 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
517 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
518 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
519 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
520 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
521 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
522 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
523 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
524 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
525 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
526 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
527 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
528 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
529 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
530 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
531 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
532 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
533 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
534 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
535 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
536 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
537 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
538 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
539 641522639 Methylobacterium sp. 4-46 Isolate Nodule
540 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
541 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
542 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
543 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
544 8005275841 Rhizobium sp. N4311 Isolate Nodule
545 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
546 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
547 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
548 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
549 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
550 8005382845 Rhizobium sp. R634 Isolate Nodule
551 8005395548 Rhizobium sp. R339 Isolate Nodule
552 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
553 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
554 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
555 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
556 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
557 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
558 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
559 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
560 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
561 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
562 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
563 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
564 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
565 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
566 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
567 8018176218 Rhizobium sp. N122 Isolate Nodule
568 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
569 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
570 8024501048 Rhizobium sp. H4 Isolate Nodule
571 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
572 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
573 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
574 8056382006 Rhizobium croatiense 13T Isolate Nodule
575 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
576 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
577 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.22
Metatranscriptomes 0.25
Isolates 31.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.7
Nodule 22.74
Rhizoplane 5.65
Rhizosphere 45.23
Stem 0
Stem Tuber 0.13
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10038588 3300001979 Bacteria 1464
2 JGI25152J39213_1002002 3300002773 Bacteria 8037
3 JGI25152J39213_1002028 3300002773 Bacteria 7987
4 JGI25159J45721_1014032 3300002987 Bacteria 1826
5 JGI25151J46595_10000303 3300003187 Bacteria 53941
6 JGI25151J46595_10002252 3300003187 Bacteria 11849
7 JGI25151J46595_10059451 3300003187 Bacteria 1230
8 JGI25160J50197_1000632 3300003354 Bacteria 19645
9 JGI25160J50197_1009521 3300003354 Bacteria 3595
10 Ga0055526_1017156 3300003771 Bacteria 2785
11 Ga0055526_1019043 3300003771 Bacteria 2521
12 Ga0055524_1000301 3300003775 Bacteria 47463
13 Ga0055524_1005464 3300003775 Bacteria 5671
14 Ga0055536_1002732 3300003781 Bacteria 9771
15 Ga0055528_1000562 3300003790 Bacteria 28222
16 Ga0055528_1001379 3300003790 Bacteria 14923
17 Ga0055530_10024672 3300003791 Bacteria 1697
18 Ga0055540_1001427 3300003792 Bacteria 14243
19 Ga0055540_1003227 3300003792 Bacteria 7999
20 Ga0055531_10018157 3300003794 Bacteria 2920
21 Ga0065165_1000398 3300005262 Bacteria 70154
22 Ga0065165_1003160 3300005262 Bacteria 12116
23 Ga0065165_1013285 3300005262 Bacteria 3285
24 Ga0065165_1038017 3300005262 Bacteria 1454
25 Ga0070670_100000542 3300005331 Bacteria 30025
26 Ga0070689_100046922 3300005340 Bacteria 3330
27 Ga0070687_100073935 3300005343 Bacteria 1839
28 Ga0070668_100165822 3300005347 Bacteria 1795
29 Ga0070669_100085749 3300005353 Bacteria 2352
30 Ga0070669_100204872 3300005353 Bacteria 1554
31 Ga0070675_100079050 3300005354 Bacteria 2740
32 Ga0070675_100118824 3300005354 Bacteria 2244
33 Ga0070671_100054978 3300005355 Bacteria 3311
34 Ga0070667_100073488 3300005367 Bacteria 2915
35 Ga0070709_10094349 3300005434 Bacteria 1980
36 Ga0070711_100150078 3300005439 Bacteria 1757
37 Ga0070707_100128401 3300005468 Bacteria 2464
38 Ga0070665_100021623 3300005548 Bacteria 6469
39 Ga0068855_100442190 3300005563 Bacteria 1420
40 Ga0070664_100108914 3300005564 Bacteria 2416
41 Ga0068852_100212746 3300005616 Bacteria 1835
42 Ga0068864_100284181 3300005618 Bacteria 1545
43 Ga0068862_100174599 3300005844 Bacteria 1925
44 Ga0081455_10079527 3300005937 Bacteria 2691
45 Ga0081540_1027252 3300005983 Bacteria 3242
46 Ga0070717_10185456 3300006028 Bacteria 1815
47 Ga0075365_10034058 3300006038 Bacteria 3287
48 Ga0075368_10048594 3300006042 Bacteria 1681
49 Ga0075363_100091237 3300006048 Bacteria 1677
50 Ga0075364_10001118 3300006051 Bacteria 14320
51 Ga0075364_10183372 3300006051 Bacteria 1417
52 Ga0070716_100291713 3300006173 Bacteria 1130
53 Ga0075362_10001028 3300006177 Bacteria 8594
54 Ga0075362_10002948 3300006177 Bacteria 5842
55 Ga0075367_10002778 3300006178 Bacteria 8106
56 Ga0075367_10022321 3300006178 Bacteria 3548
57 Ga0075367_10026404 3300006178 Bacteria 3294
58 Ga0075369_10001472 3300006186 Bacteria 8024
59 Ga0075366_10028409 3300006195 Bacteria 3283
60 Ga0075366_10124206 3300006195 Bacteria 1556
61 Ga0075370_10021829 3300006353 Bacteria 3509
62 Ga0075370_10085566 3300006353 Bacteria 1815
63 Ga0075428_100135539 3300006844 Bacteria 2677
64 Ga0075430_100016323 3300006846 Bacteria 6321
65 Ga0075431_100006517 3300006847 Bacteria 11591
66 Ga0075434_100022860 3300006871 Bacteria 6087
67 Ga0075429_100119383 3300006880 Bacteria 2304
68 Ga0075436_100222322 3300006914 Bacteria 1340
69 Ga0079104_1000010 3300006946 Bacteria 366021
70 Ga0099794_10060589 3300007265 Bacteria 1838
71 Ga0099795_10003216 3300007788 Bacteria 4014
72 Ga0099795_10050017 3300007788 Bacteria 1518
73 Ga0105240_10468523 3300009093 Bacteria 1406
74 Ga0105240_10686679 3300009093 Bacteria 1119
75 Ga0105240_10732816 3300009093 Bacteria 1076
76 Ga0105245_10060298 3300009098 Bacteria 3417
77 Ga0105245_10543347 3300009098 Bacteria 1183
78 Ga0114129_10284552 3300009147 Bacteria 2208
79 Ga0105243_10263313 3300009148 Bacteria 1545
80 Ga0105242_10227555 3300009176 Bacteria 1670
81 Ga0105238_10029504 3300009551 Bacteria 5587
82 Ga0105249_10177056 3300009553 Bacteria 2072
83 Ga0105249_10638021 3300009553 Bacteria 1122
84 Ga0099796_10002042 3300010159 Bacteria 4306
85 Ga0099796_10014722 3300010159 Bacteria 2268
86 Ga0157322_1000400 3300012490 Bacteria 1560
87 Ga0157369_10242575 3300013105 Bacteria 1882
88 Ga0171462_1008 3300013250 Bacteria 384318
89 Ga0163163_10002439 3300014325 Bacteria 15729
90 Ga0163163_10216929 3300014325 Bacteria 1962
91 Ga0213872_10031632 3300021361 Bacteria 2426
92 Ga0213872_10035992 3300021361 Bacteria 2263
93 Ga0213874_10010172 3300021377 Bacteria 2350
94 Ga0213876_10189799 3300021384 Bacteria 1093
95 Ga0213876_10194887 3300021384 Bacteria 1077
96 Ga0213875_10032240 3300021388 Bacteria 2477
97 Ga0207425_1003676 3300025245 Bacteria 4827
98 Ga0207425_1023553 3300025245 Bacteria 1288
99 Ga0209148_1000581 3300025254 Bacteria 33684
100 Ga0209129_1000078 3300025258 Bacteria 192880
101 Ga0209129_1000890 3300025258 Bacteria 18372
102 Ga0209129_1008361 3300025258 Bacteria 2893
103 Ga0209455_1003117 3300025272 Bacteria 6037
104 Ga0209673_1000015 3300025273 Bacteria 530618
105 Ga0209673_1004050 3300025273 Bacteria 8105
106 Ga0209673_1004249 3300025273 Bacteria 7788
107 Ga0209673_1005147 3300025273 Bacteria 6690
108 Ga0209673_1011868 3300025273 Bacteria 3556
109 Ga0209130_1000102 3300025284 Bacteria 139255
110 Ga0209130_1013995 3300025284 Bacteria 2032
111 Ga0209130_1014104 3300025284 Bacteria 2018
112 Ga0209675_1000455 3300025291 Bacteria 31451
113 Ga0209676_1010999 3300025292 Bacteria 3700
114 Ga0209676_1034253 3300025292 Bacteria 1503
115 Ga0209025_1000010 3300025294 Bacteria 986612
116 Ga0209025_1000205 3300025294 Bacteria 141452
117 Ga0209025_1000489 3300025294 Bacteria 76167
118 Ga0209025_1002113 3300025294 Bacteria 22404
119 Ga0209025_1004509 3300025294 Bacteria 12028
120 Ga0209025_1040110 3300025294 Bacteria 2030
121 Ga0209025_1049095 3300025294 Bacteria 1703
122 Ga0209564_1000015 3300025295 Bacteria 615324
123 Ga0209564_1000048 3300025295 Bacteria 364806
124 Ga0209564_1001741 3300025295 Bacteria 20415
125 Ga0209564_1006052 3300025295 Bacteria 6665
126 Ga0209758_1003154 3300025297 Bacteria 15486
127 Ga0209758_1017506 3300025297 Bacteria 3563
128 Ga0209758_1024309 3300025297 Bacteria 2704
129 Ga0209758_1033968 3300025297 Bacteria 2037
130 Ga0209050_1001561 3300025298 Bacteria 23872
131 Ga0209050_1003278 3300025298 Bacteria 12155
132 Ga0209256_1000041 3300025299 Bacteria 364827
133 Ga0209256_1000782 3300025299 Bacteria 41037
134 Ga0209256_1000860 3300025299 Bacteria 37820
135 Ga0209256_1005355 3300025299 Bacteria 7431
136 Ga0209256_1031813 3300025299 Bacteria 1438
137 Ga0207426_1000063 3300025302 Bacteria 358920
138 Ga0207426_1002969 3300025302 Bacteria 9924
139 Ga0209051_1000205 3300025303 Bacteria 104781
140 Ga0209257_1000453 3300025304 Bacteria 76813
141 Ga0209257_1004468 3300025304 Bacteria 10819
142 Ga0207647_10128057 3300025904 Bacteria 1493
143 Ga0207685_10111887 3300025905 Bacteria 1185
144 Ga0207685_10188555 3300025905 Bacteria 961
145 Ga0207699_10019962 3300025906 Bacteria 3583
146 Ga0207645_10029088 3300025907 Bacteria 3563
147 Ga0207695_10116202 3300025913 Bacteria 2649
148 Ga0207695_10172868 3300025913 Bacteria 2085
149 Ga0207693_10048330 3300025915 Bacteria 3341
150 Ga0207663_10318516 3300025916 Bacteria 1168
151 Ga0207662_10005962 3300025918 Bacteria 6547
152 Ga0207646_10045898 3300025922 Bacteria 3921
153 Ga0207650_10013995 3300025925 Bacteria 5570
154 Ga0207659_10085196 3300025926 Bacteria 2347
155 Ga0207687_10110216 3300025927 Bacteria 2041
156 Ga0207664_10019155 3300025929 Bacteria 5053
157 Ga0207664_10324118 3300025929 Bacteria 1360
158 Ga0207706_10001347 3300025933 Bacteria 24537
159 Ga0207706_10175525 3300025933 Bacteria 1882
160 Ga0207706_10195313 3300025933 Bacteria 1775
161 Ga0207686_10182885 3300025934 Bacteria 1488
162 Ga0207711_10062095 3300025941 Bacteria 3223
163 Ga0207711_10103564 3300025941 Bacteria 2520
164 Ga0207679_10180526 3300025945 Bacteria 1746
165 Ga0207712_10160940 3300025961 Bacteria 1744
166 Ga0207668_10172619 3300025972 Bacteria 1697
167 Ga0207658_10402248 3300025986 Bacteria 1204
168 Ga0207648_10101657 3300026089 Bacteria 2519
169 Ga0209281_1000078 3300027111 Bacteria 261622
170 Ga0209179_1001135 3300027512 Bacteria 3116
171 Ga0209813_10066442 3300027866 Bacteria 1163
172 Ga0207428_10231072 3300027907 Bacteria 1384
173 Ga0268266_10060772 3300028379 Bacteria 3258
174 Ga0268265_10071557 3300028380 Bacteria 2701
175 Ga0307515_10000937 3300028794 Bacteria 66983
176 Ga0307515_10019978 3300028794 Bacteria 11998
177 Ga0265330_10031701 3300031235 Bacteria 2369
178 Ga0265330_10063942 3300031235 Bacteria 1599
179 Ga0265328_10004877 3300031239 Bacteria 5777
180 Ga0265325_10001335 3300031241 Bacteria 17486
181 Ga0265325_10019979 3300031241 Bacteria 3696
182 Ga0265325_10040691 3300031241 Bacteria 2440
183 Ga0265339_10003516 3300031249 Bacteria 10949
184 Ga0265339_10019214 3300031249 Bacteria 4014
185 Ga0265331_10000151 3300031250 Bacteria 89218
186 Ga0265331_10056886 3300031250 Bacteria 1856
187 Ga0265331_10166267 3300031250 Bacteria 999
188 Ga0265316_10080306 3300031344 Bacteria 2501
189 Ga0265316_10114603 3300031344 Bacteria 2039
190 Ga0307513_10031802 3300031456 Bacteria 5968
191 Ga0307513_10256537 3300031456 Bacteria 1541
192 Ga0307513_10473897 3300031456 Bacteria 973
193 Ga0265313_10000712 3300031595 Bacteria 34316
194 Ga0265313_10000794 3300031595 Bacteria 31959
195 Ga0265313_10001809 3300031595 Bacteria 19560
196 Ga0265313_10025244 3300031595 Bacteria 3155
197 Ga0307514_10151087 3300031649 Bacteria 1558
198 Ga0316575_10051352 3300031665 Bacteria 1642
199 Ga0265314_10022034 3300031711 Bacteria 4885
200 Ga0265314_10051925 3300031711 Bacteria 2853
201 Ga0265342_10021079 3300031712 Bacteria 4168
202 Ga0265342_10039308 3300031712 Bacteria 2876
203 Ga0265342_10099150 3300031712 Bacteria 1662
204 Ga0316576_10009732 3300031727 Bacteria 6220
205 Ga0307516_10187651 3300031730 Bacteria 1796
206 Ga0316577_10082511 3300031733 Bacteria 1798
207 Ga0307412_10294449 3300031911 Bacteria 1280
208 Ga0307409_100443129 3300031995 Bacteria 1252
209 Ga0307416_100185203 3300032002 Bacteria 1956
210 Ga0307416_100199289 3300032002 Bacteria 1898
211 Ga0373923_0022493 3300035111 Bacteria 2473
212 Ga0373936_0006442 3300035113 Bacteria 4427
213 Ga0373945_0002293 3300035116 Bacteria 5988
214 Ga0373954_0002657 3300035118 Bacteria 7519
215 Ga0373957_0004968 3300035120 Bacteria 4095
216 Ga0373943_0008895 3300035170 Bacteria 4499
217 Ga0373943_0044486 3300035170 Bacteria 2161
218 Ga0373943_0084340 3300035170 Bacteria 1635
219 Ga0316574_0000488 3300035398 Bacteria 16036
220 Ga0373924_0005190 3300035410 Bacteria 4598
221 Ga0373935_0000237 3300035692 Bacteria 27173
222 Ga0373935_0114143 3300035692 Bacteria 1797
223 Ga0373927_0002396 3300035695 Bacteria 13659
224 Ga0373933_0001004 3300035724 Bacteria 17169
225 Ga0373947_0001341 3300035725 Bacteria 15139
226 Ga0373937_0002850 3300036401 Bacteria 14440
227 Ga0316582_0030813 3300036647 Bacteria 3272
228 Ga0316584_0024394 3300036712 Bacteria 4426
229 Ga0373925_0000016 3300037068 Bacteria 176830
230 Ga0373925_0083603 3300037068 Bacteria 2432
231 Ga0373925_0454811 3300037068 Bacteria 1049
232 Ga0395899_0010263 3300037312 Bacteria 7178
233 Ga0395900_0011891 3300037418 Bacteria 8898
234 Ga0395900_0138127 3300037418 Bacteria 2497
235 Ga0395905_0001094 3300037471 Bacteria 34097
236 Ga0395905_0024326 3300037471 Bacteria 5717
237 Ga0395905_0039169 3300037471 Bacteria 4446
238 Ga0436364_0590670 3300037853 Bacteria 2667
239 Ga0436364_0952715 3300037853 Bacteria 7322
240 Ga0436364_1262881 3300037853 Bacteria 1015
241 Ga0400491_28771 3300038727 Bacteria 1974
242 Ga0400486_27437 3300038742 Bacteria 2244
243 Ga0436365_0105218 3300039437 Bacteria 1881
244 Ga0436365_0287193 3300039437 Bacteria 1100
245 Ga0436365_0625173 3300039437 Bacteria 3226
246 Ga0436365_0651981 3300039437 Bacteria 6884
247 Ga0436365_1904666 3300039437 Bacteria 2119
248 Ga0436360_0035315 3300039438 Bacteria 6411
249 Ga0436360_0142398 3300039438 Bacteria 1421
250 Ga0436360_0155695 3300039438 Bacteria 1278
251 Ga0436360_0490643 3300039438 Bacteria 1884
252 Ga0436360_1158244 3300039438 Bacteria 2302
253 Ga0436360_1360831 3300039438 Bacteria 2188
254 Ga0436361_0039520 3300039447 Bacteria 2434
255 Ga0436361_0383805 3300039447 Bacteria 2643
256 Ga0436361_0440108 3300039447 Bacteria 3957
257 Ga0436361_0928537 3300039447 Bacteria 2548
258 Ga0436361_1019991 3300039447 Bacteria 1360
259 Ga0436363_0159755 3300039450 Bacteria 5310
260 Ga0436363_0519591 3300039450 Bacteria 1363
261 Ga0436362_0513677 3300039453 Bacteria 1562
262 Ga0436362_1280924 3300039453 Bacteria 1294
263 Ga0439465_0021790 3300041413 Bacteria 2011
264 Ga0451797_1381545 3300041453 Bacteria 954
265 Ga0451798_0122636 3300041458 Bacteria 2606
266 Ga0451807_1223344 3300041486 Bacteria 1546
267 Ga0451837_1231756 3300041494 Bacteria 1897
268 Ga0451846_23722 3300041502 Bacteria 1654
269 Ga0451851_0337876 3300041507 Bacteria 5314
270 Ga0451855_0876207 3300041511 Bacteria 2028
271 Ga0452271_01831 3300041916 Bacteria 1873
272 Ga0439459_0021258 3300042438 Bacteria 1244
273 Ga0466965_0025673 3300044683 Bacteria 2853
274 Ga0466966_0018794 3300044684 Bacteria 4552
275 Ga0466961_0046569 3300044693 Bacteria 2773
276 Ga0466968_0004663 3300044735 Bacteria 5131
277 Ga0466968_0021969 3300044735 Bacteria 2589
278 Ga0466968_0055764 3300044735 Bacteria 1696
279 Ga0466970_0071094 3300044765 Bacteria 1871
280 Ga0466957_0052705 3300044842 Bacteria 2478
281 Ga0466957_0210594 3300044842 Bacteria 1280
282 Ga0466960_0019074 3300044901 Bacteria 3016
283 Ga0466959_0081508 3300045049 Bacteria 2332
284 Ga0466967_0258050 3300045976 Bacteria 1667
285 Ga0495617_040451 3300046452 Bacteria 1559
286 Ga0495592_0000044 3300046454 Bacteria 118749
287 Ga0495629_0004823 3300046459 Bacteria 10120
288 Ga0495629_0009106 3300046459 Bacteria 7271
289 Ga0495638_0001240 3300046460 Bacteria 24046
290 Ga0495638_0018174 3300046460 Bacteria 4672
291 Ga0495638_0020458 3300046460 Bacteria 4372
292 Ga0495651_0000702 3300046462 Bacteria 26046
293 Ga0495653_0000022 3300046463 Bacteria 169653
294 Ga0495580_0104535 3300046472 Bacteria 1968
295 Ga0495605_0001499 3300046474 Bacteria 15218
296 Ga0495662_0005807 3300046476 Bacteria 6176
297 Ga0495664_0000013 3300046477 Bacteria 204282
298 Ga0495584_0148254 3300046491 Bacteria 1192
299 Ga0495585_0006098 3300046492 Bacteria 7531
300 Ga0495607_0080284 3300046501 Bacteria 1794
301 Ga0495606_0000735 3300046507 Bacteria 50674
302 Ga0495606_0013694 3300046507 Bacteria 6389
303 Ga0495608_0000004 3300046511 Bacteria 355027
304 Ga0495610_0017832 3300046512 Bacteria 4034
305 Ga0495610_0051883 3300046512 Bacteria 1993
306 Ga0495616_0066679 3300046513 Bacteria 1751
307 Ga0495618_0000032 3300046514 Bacteria 104874
308 Ga0495628_0000014 3300046516 Bacteria 205818
309 Ga0495630_0041250 3300046517 Bacteria 3446
310 Ga0495631_0003302 3300046518 Bacteria 8872
311 Ga0495632_0001827 3300046519 Bacteria 17144
312 Ga0495632_0064874 3300046519 Bacteria 1765
313 Ga0495632_0077828 3300046519 Bacteria 1585
314 Ga0495643_0014814 3300046522 Bacteria 4629
315 Ga0495643_0024787 3300046522 Bacteria 3400
316 Ga0495644_0062946 3300046523 Bacteria 1394
317 Ga0495644_0069622 3300046523 Bacteria 1322
318 Ga0495648_0058489 3300046524 Bacteria 2305
319 Ga0495648_0083713 3300046524 Bacteria 1807
320 Ga0495652_0000002 3300046529 Bacteria 946606
321 Ga0495654_0000043 3300046530 Bacteria 161913
322 Ga0495654_0117174 3300046530 Bacteria 1209
323 Ga0495665_0083756 3300046531 Bacteria 1677
324 Ga0495640_0000001 3300046533 Bacteria 853827
325 Ga0495587_0000004 3300046536 Bacteria 358433
326 Ga0495609_0038934 3300046538 Bacteria 2142
327 Ga0495597_0018562 3300046542 Bacteria 3263
328 Ga0495645_0000001 3300046543 Bacteria 657910
329 Ga0495633_0019384 3300046558 Bacteria 3441
330 Ga0495667_0000009 3300046559 Bacteria 223329
331 Ga0495667_0223198 3300046559 Bacteria 1202
332 Ga0495668_0045735 3300046616 Bacteria 2433
333 Ga0495668_0093152 3300046616 Bacteria 1650
334 Ga0495634_0000033 3300046642 Bacteria 109811
335 Ga0495611_0001703 3300046648 Bacteria 10675
336 Ga0495625_0001629 3300046660 Bacteria 26456
337 Ga0495625_0065206 3300046660 Bacteria 2568
338 Ga0495625_0121722 3300046660 Bacteria 1775
339 Ga0495625_0238739 3300046660 Bacteria 1184
340 Ga0495625_0276969 3300046660 Bacteria 1080
341 Ga0495635_0000003 3300046663 Bacteria 390055
342 Ga0495635_0024436 3300046663 Bacteria 4211
343 Ga0495657_0000342 3300046675 Bacteria 43000
344 Ga0495657_0010927 3300046675 Bacteria 6810
345 Ga0495599_0000030 3300046678 Bacteria 113715
346 Ga0495623_0000059 3300046679 Bacteria 67952
347 Ga0495646_0000031 3300046680 Bacteria 87445
348 Ga0495658_0019943 3300046683 Bacteria 3508
349 Ga0495658_0203005 3300046683 Bacteria 1236
350 Ga0495613_0056989 3300046689 Bacteria 2869
351 Ga0495613_0155921 3300046689 Bacteria 1627
352 Ga0495613_0182091 3300046689 Bacteria 1487
353 Ga0495624_0049159 3300046690 Bacteria 2675
354 Ga0495624_0241314 3300046690 Bacteria 1093
355 Ga0495589_0052813 3300046794 Bacteria 2007
356 Ga0495600_0000141 3300046809 Bacteria 41270
357 Ga0495660_0014676 3300046810 Bacteria 4531
358 Ga0495660_0030408 3300046810 Bacteria 3042
359 Ga0495581_0044426 3300047315 Bacteria 2569
360 Ga0495604_0000002 3300047317 Bacteria 530904
361 Ga0495674_0000004 3300047319 Bacteria 531855
362 Ga0495674_0029168 3300047319 Bacteria 5027
363 Ga0495672_0091192 3300047320 Bacteria 1673
364 Ga0495676_0103135 3300047321 Bacteria 2107
365 Ga0495680_0000481 3300047322 Bacteria 44868
366 Ga0495675_0000048 3300047444 Bacteria 81486
367 Ga0495673_0127281 3300047469 Bacteria 1004
368 Ga0495684_0000019 3300047471 Bacteria 153938
369 Ga0495686_0002404 3300047472 Bacteria 17766
370 Ga0495686_0007045 3300047472 Bacteria 8483
371 Ga0495686_0048876 3300047472 Bacteria 2665
372 Ga0495593_0004544 3300047673 Bacteria 8244
373 Ga0495602_0000001 3300048088 Bacteria 510904
374 Ga0496100_0132243 3300048903 Bacteria 1759
375 Ga0496100_0264393 3300048903 Bacteria 1277
376 Ga0496102_0032062 3300048905 Bacteria 4720
377 Ga0496103_0075448 3300048906 Bacteria 2115
378 Ga0496104_0000279 3300048907 Bacteria 45192
379 Ga0496104_0003012 3300048907 Bacteria 14510
380 Ga0496104_0004500 3300048907 Bacteria 12143
381 Ga0496104_0132578 3300048907 Bacteria 2393
382 Ga0496104_0186545 3300048907 Bacteria 1985
383 Ga0496104_0212217 3300048907 Bacteria 1847
384 Ga0496104_0248348 3300048907 Bacteria 1692
385 Ga0496104_0721171 3300048907 Bacteria 904
386 Ga0496105_0000157 3300048908 Bacteria 45010
387 Ga0496105_0012292 3300048908 Bacteria 6779
388 Ga0496105_0029645 3300048908 Bacteria 4479
389 Ga0496105_0054783 3300048908 Bacteria 3292
390 Ga0496105_0215063 3300048908 Bacteria 1566
391 Ga0496106_0388219 3300048909 Bacteria 1122
392 Ga0496106_0499124 3300048909 Bacteria 978
393 Ga0496108_0000660 3300048911 Bacteria 26581
394 Ga0496108_0016400 3300048911 Bacteria 6042
395 Ga0496108_0110081 3300048911 Bacteria 2355
396 Ga0496109_0001413 3300048912 Bacteria 19914
397 Ga0496110_0003358 3300048913 Bacteria 12220
398 Ga0496110_0074823 3300048913 Bacteria 3008
399 Ga0496110_0180659 3300048913 Bacteria 1916
400 Ga0496111_0015710 3300048914 Bacteria 5204
401 Ga0496111_0040270 3300048914 Bacteria 3352
402 Ga0496111_0103413 3300048914 Bacteria 2095
403 Ga0496112_0004414 3300048915 Bacteria 11908
404 Ga0496112_0065812 3300048915 Bacteria 3577
405 Ga0496113_0000962 3300048916 Bacteria 15335
406 Ga0496113_0001231 3300048916 Bacteria 14077
407 Ga0496113_0041718 3300048916 Bacteria 3388
408 Ga0496114_0079890 3300048917 Bacteria 2762
409 Ga0496114_0085191 3300048917 Bacteria 2676
410 Ga0496114_0187487 3300048917 Bacteria 1808
411 Ga0496115_0044472 3300048918 Bacteria 3542
412 Ga0496115_0061848 3300048918 Bacteria 3019
413 Ga0496115_0062241 3300048918 Bacteria 3010
414 Ga0496117_0043973 3300048920 Bacteria 3239
415 Ga0496117_0106597 3300048920 Bacteria 1758
416 Ga0496118_0115127 3300048921 Bacteria 1771
417 Ga0496119_0002278 3300048922 Bacteria 21258
418 Ga0496119_0004297 3300048922 Bacteria 14250
419 Ga0496121_0003328 3300048924 Bacteria 23071
420 Ga0496121_0063606 3300048924 Bacteria 3013
421 Ga0496121_0344420 3300048924 Bacteria 995
422 Ga0496122_0000009 3300048925 Bacteria 584024
423 Ga0496122_0002395 3300048925 Bacteria 26758
424 Ga0496122_0028078 3300048925 Bacteria 4789
425 Ga0496123_0000020 3300048926 Bacteria 388748
426 Ga0496123_0001113 3300048926 Bacteria 40258
427 Ga0496123_0023664 3300048926 Bacteria 4695
428 Ga0496123_0039673 3300048926 Bacteria 3290
429 Ga0496124_0019616 3300048927 Bacteria 6284
430 Ga0496126_0378672 3300048929 Bacteria 1152
431 Ga0495678_019461 3300049459 Bacteria 3028
432 Ga0495678_038298 3300049459 Bacteria 1941
433 Ga0495682_0033242 3300049460 Bacteria 1904
434 Ga0501031_0003014 3300049568 Bacteria 10776
435 Ga0501031_0013828 3300049568 Bacteria 5259
436 Ga0501032_0007950 3300049569 Bacteria 7727
437 Ga0501032_0200303 3300049569 Bacteria 1303
438 Ga0501032_0348440 3300049569 Bacteria 954
439 Ga0501033_0014832 3300049570 Bacteria 5915
440 Ga0501033_0156667 3300049570 Bacteria 1641
441 Ga0501034_0005192 3300049571 Bacteria 14287
442 Ga0501034_0033286 3300049571 Bacteria 5230
443 Ga0501034_0067353 3300049571 Bacteria 3593
444 Ga0501036_0015930 3300049572 Bacteria 6278
445 Ga0501036_0024001 3300049572 Bacteria 5140
446 Ga0501036_0129261 3300049572 Bacteria 2133
447 Ga0501036_0399187 3300049572 Bacteria 1147
448 Ga0501037_0020581 3300049573 Bacteria 4871
449 Ga0501038_0029665 3300049574 Bacteria 4844
450 Ga0501038_0060578 3300049574 Bacteria 3239
451 Ga0501038_0111717 3300049574 Bacteria 2263
452 Ga0501038_0241206 3300049574 Bacteria 1435
453 Ga0501038_0349409 3300049574 Bacteria 1152
454 Ga0501039_0146552 3300049575 Bacteria 1855
455 Ga0501039_0184153 3300049575 Bacteria 1642
456 Ga0501039_0425894 3300049575 Bacteria 1042
457 Ga0501039_0473785 3300049575 Bacteria 983
458 Ga0501039_0653633 3300049575 Bacteria 823
459 Ga0501040_0234747 3300049576 Bacteria 1306
460 Ga0501041_0167395 3300049577 Bacteria 1375
461 Ga0501041_0299155 3300049577 Bacteria 1014
462 Ga0501042_0035912 3300049578 Bacteria 3516
463 Ga0501043_0078041 3300049579 Bacteria 2602
464 Ga0501043_0103588 3300049579 Bacteria 2236
465 Ga0501043_0216773 3300049579 Bacteria 1482
466 Ga0501043_0561765 3300049579 Bacteria 847
467 Ga0501047_0028205 3300049581 Bacteria 5410
468 Ga0501047_0059714 3300049581 Bacteria 3682
469 Ga0501047_0093977 3300049581 Bacteria 2878
470 Ga0501047_0133218 3300049581 Bacteria 2365
471 Ga0501048_0168027 3300049582 Bacteria 1553
472 Ga0501048_0234513 3300049582 Bacteria 1302
473 Ga0501070_0030259 3300049586 Bacteria 4536
474 Ga0501070_0376347 3300049586 Bacteria 1150
475 Ga0501076_0116514 3300049592 Bacteria 2162
476 Ga0501077_0210446 3300049593 Bacteria 1236
477 Ga0501252_003607 3300049682 Bacteria 1605
478 Ga0501079_0094184 3300049741 Bacteria 2321
479 Ga0501081_0120948 3300049743 Bacteria 1865
480 Ga0501083_0009958 3300049744 Bacteria 6709
481 Ga0501035_0027776 3300049822 Bacteria 5171
482 Ga0501035_0029853 3300049822 Bacteria 4972
483 Ga0501035_0075411 3300049822 Bacteria 2983
484 Ga0501035_0681413 3300049822 Bacteria 831
485 Ga0501044_0018297 3300049823 Bacteria 7508
486 Ga0501044_0023395 3300049823 Bacteria 6571
487 Ga0501044_0145259 3300049823 Bacteria 2358
488 Ga0501044_0248416 3300049823 Bacteria 1721
489 Ga0501045_0025760 3300049824 Bacteria 4228
490 nmdc:mga03683_66893_c1 3300050489 Bacteria 1529
491 nmdc:mga03n38_67206_c1 3300050490 Bacteria 1649
492 nmdc:mga00v17_173_c1 3300050491 Bacteria 26281
493 nmdc:mga00v17_206253_c1 3300050491 Bacteria 1271
494 nmdc:mga0k408_23721_c1 3300050493 Bacteria 3464
495 nmdc:mga0k408_8569_c2 3300050493 Bacteria 3412
496 nmdc:mga06z11_148602_c1 3300050494 Bacteria 1330
497 nmdc:mga04h51_46804_c1 3300050495 Bacteria 1435
498 nmdc:mga05p37_178323_c1 3300050507 Bacteria 2587
499 nmdc:mga05p37_421650_c1 3300050507 Bacteria 1553
500 nmdc:mga09592_318460_c1 3300050508 Bacteria 1348
501 nmdc:mga0qj67_39196_c1 3300050509 Bacteria 3720
502 nmdc:mga06r32_119903_c1 3300050510 Bacteria 2594
503 nmdc:mga06r32_20319_c1 3300050510 Bacteria 6112
504 nmdc:mga08y16_202023_c1 3300050511 Bacteria 2059
505 nmdc:mga08y16_329958_c1 3300050511 Bacteria 1570
506 nmdc:mga08y16_5270_c1 3300050511 Bacteria 13511
507 nmdc:mga08y16_562999_c1 3300050511 Bacteria 1152
508 nmdc:mga0n895_312488_c1 3300050512 Bacteria 1592
509 nmdc:mga0n895_31431_c1 3300050512 Bacteria 5084
510 nmdc:mga08x19_322254_c1 3300050514 Bacteria 1075
511 Ga0495601_0000002 3300053077 Bacteria 528704
512 Ga0495601_0158394 3300053077 Bacteria 1479
513 Ga0495612_0000012 3300053078 Bacteria 223883
514 Ga0495595_0000012 3300053084 Bacteria 174322
515 Ga0495595_0010272 3300053084 Bacteria 3889
516 Ga0495619_0000003 3300053085 Bacteria 515784
517 Ga0495619_0142300 3300053085 Bacteria 1652
518 Ga0500651_0107014 3300053093 Bacteria 1709
519 Ga0500566_0041152 3300053094 Bacteria 2670
520 Ga0500555_001333 3300053103 Bacteria 7751
521 Ga0500556_0000309 3300053104 Bacteria 37060
522 Ga0500569_002559 3300053109 Bacteria 3604
523 Ga0500594_0000625 3300053118 Bacteria 7580
524 Ga0500595_013588 3300053119 Bacteria 3116
525 Ga0500608_059978 3300053122 Bacteria 1819
526 Ga0500608_147995 3300053122 Bacteria 1033
527 Ga0500618_001273 3300053125 Bacteria 11665
528 Ga0500642_0000947 3300053130 Bacteria 8400
529 Ga0500652_000105 3300053131 Bacteria 33099
530 Ga0500658_0001970 3300053134 Bacteria 8022
531 Ga0500559_0005715 3300053136 Bacteria 5687
532 Ga0500568_0000004 3300053139 Bacteria 621666
533 Ga0500568_0003545 3300053139 Bacteria 8640
534 Ga0500568_0007333 3300053139 Bacteria 5421
535 Ga0500604_0002662 3300053151 Bacteria 4856
536 Ga0500616_0001268 3300053153 Bacteria 25214
537 Ga0500616_0015761 3300053153 Bacteria 4314
538 Ga0500622_0001477 3300053156 Bacteria 18714
539 Ga0500622_0069663 3300053156 Bacteria 1781
540 Ga0500636_0012487 3300053177 Bacteria 4979
541 Ga0500645_012308 3300053730 Bacteria 2767
542 Ga0500609_000446 3300053731 Bacteria 6137
543 Ga0501084_0248976 3300054114 Bacteria 1500
544 Ga0501082_0000656 3300060353 Bacteria 30514
545 Ga0466962_0110923 3300061719 Bacteria 1321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0653633 Ga0501039_0653633_108_794 221
2 3300025915 Ga0207693_10048330 Ga0207693_100483303 239
3 3300012490 Ga0157322_1000400 Ga0157322_10004002 247
4 3300049582 Ga0501048_0234513 Ga0501048_0234513_388_1272 254
5 3300049579 Ga0501043_0561765 Ga0501043_0561765_38_805 255
6 3300005937 Ga0081455_10079527 Ga0081455_100795272 257
7 3300006846 Ga0075430_100016323 Ga0075430_1000163234 257
8 3300006847 Ga0075431_100006517 Ga0075431_1000065178 257
9 3300006880 Ga0075429_100119383 Ga0075429_1001193832 257
10 3300025961 Ga0207712_10160940 Ga0207712_101609401 257
11 3300049581 Ga0501047_0093977 Ga0501047_0093977_22_798 257
12 3300049822 Ga0501035_0681413 Ga0501035_0681413_35_808 257
13 3300050511 nmdc:mga08y16_329958_c1 nmdc:mga08y16_329958_c1_775_1554 257
14 3300041453 Ga0451797_1381545 Ga0451797_1381545_71_847 258
15 iso_pu_bacteria 2713897090 2715499501 258
16 iso_pu_bacteria 2855020534 2855021436 258
17 iso_pu_bacteria 2899259804 2899262164 258
18 iso_pu_bacteria 2919679072 2919679739 258
19 3300049569 Ga0501032_0348440 Ga0501032_0348440_146_925 259
20 3300049575 Ga0501039_0146552 Ga0501039_0146552_39_818 259
21 3300005983 Ga0081540_1027252 Ga0081540_10272524 261
22 3300009147 Ga0114129_10284552 Ga0114129_102845523 261
23 3300048907 Ga0496104_0186545 Ga0496104_0186545_855_1673 261
24 3300048918 Ga0496115_0044472 Ga0496115_0044472_112_930 261
25 3300050514 nmdc:mga08x19_322254_c1 nmdc:mga08x19_322254_c1_91_909 261
26 iso_pu_bacteria 2671180139 2671692049 261
27 iso_pu_bacteria 2738543031 2739350644 261
28 3300037068 Ga0373925_0454811 Ga0373925_0454811_245_1039 262
29 3300046559 Ga0495667_0223198 Ga0495667_0223198_29_823 262
30 3300009553 Ga0105249_10638021 Ga0105249_106380211 263
31 3300038742 Ga0400486_27437 Ga0400486_27437_357_1157 263
32 3300053094 Ga0500566_0041152 Ga0500566_0041152_1198_1992 264
33 3300053119 Ga0500595_013588 Ga0500595_013588_2075_2869 264
34 3300053131 Ga0500652_000105 Ga0500652_000105_32176_32970 264
35 3300003771 Ga0055526_1019043 Ga0055526_10190432 265
36 3300003775 Ga0055524_1005464 Ga0055524_10054644 265
37 3300003790 Ga0055528_1000562 Ga0055528_10005623 265
38 3300003790 Ga0055528_1001379 Ga0055528_10013795 265
39 3300005340 Ga0070689_100046922 Ga0070689_1000469222 265
40 3300005343 Ga0070687_100073935 Ga0070687_1000739352 265
41 3300005353 Ga0070669_100085749 Ga0070669_1000857492 265
42 3300005367 Ga0070667_100073488 Ga0070667_1000734883 265
43 3300005616 Ga0068852_100212746 Ga0068852_1002127461 265
44 3300006844 Ga0075428_100135539 Ga0075428_1001355393 265
45 3300007788 Ga0099795_10050017 Ga0099795_100500172 265
46 3300009551 Ga0105238_10029504 Ga0105238_100295047 265
47 3300010159 Ga0099796_10014722 Ga0099796_100147222 265
48 3300013105 Ga0157369_10242575 Ga0157369_102425752 265
49 3300025299 Ga0209256_1031813 Ga0209256_10318132 265
50 3300025927 Ga0207687_10110216 Ga0207687_101102163 265
51 3300025934 Ga0207686_10182885 Ga0207686_101828851 265
52 3300025941 Ga0207711_10103564 Ga0207711_101035642 265
53 3300025986 Ga0207658_10402248 Ga0207658_104022481 265
54 3300031344 Ga0265316_10114603 Ga0265316_101146032 265
55 3300031456 Ga0307513_10031802 Ga0307513_100318026 265
56 3300031712 Ga0265342_10099150 Ga0265342_100991501 265
57 3300031911 Ga0307412_10294449 Ga0307412_102944492 265
58 3300035111 Ga0373923_0022493 Ga0373923_0022493_11_811 265
59 3300036647 Ga0316582_0030813 Ga0316582_0030813_2357_3157 265
60 3300046460 Ga0495638_0001240 Ga0495638_0001240_11271_12068 265
61 3300046474 Ga0495605_0001499 Ga0495605_0001499_13350_14147 265
62 3300046491 Ga0495584_0148254 Ga0495584_0148254_382_1179 265
63 3300046492 Ga0495585_0006098 Ga0495585_0006098_5682_6479 265
64 3300046518 Ga0495631_0003302 Ga0495631_0003302_7625_8422 265
65 3300046519 Ga0495632_0001827 Ga0495632_0001827_5978_6775 265
66 3300046519 Ga0495632_0064874 Ga0495632_0064874_574_1371 265
67 3300046522 Ga0495643_0024787 Ga0495643_0024787_1664_2461 265
68 3300046530 Ga0495654_0117174 Ga0495654_0117174_206_1003 265
69 3300046538 Ga0495609_0038934 Ga0495609_0038934_481_1278 265
70 3300046616 Ga0495668_0093152 Ga0495668_0093152_494_1291 265
71 3300046648 Ga0495611_0001703 Ga0495611_0001703_7409_8206 265
72 3300046660 Ga0495625_0001629 Ga0495625_0001629_3052_3849 265
73 3300046660 Ga0495625_0121722 Ga0495625_0121722_545_1342 265
74 3300046660 Ga0495625_0238739 Ga0495625_0238739_177_974 265
75 3300046810 Ga0495660_0030408 Ga0495660_0030408_1053_1850 265
76 3300048907 Ga0496104_0721171 Ga0496104_0721171_81_884 265
77 3300048929 Ga0496126_0378672 Ga0496126_0378672_325_1122 265
78 3300049460 Ga0495682_0033242 Ga0495682_0033242_666_1463 265
79 3300049571 Ga0501034_0005192 Ga0501034_0005192_12170_12973 265
80 3300049574 Ga0501038_0241206 Ga0501038_0241206_231_1037 265
81 3300050495 nmdc:mga04h51_46804_c1 nmdc:mga04h51_46804_c1_274_1077 265
82 3300050507 nmdc:mga05p37_178323_c1 nmdc:mga05p37_178323_c1_1056_1859 265
83 3300050507 nmdc:mga05p37_421650_c1 nmdc:mga05p37_421650_c1_92_895 265
84 3300050508 nmdc:mga09592_318460_c1 nmdc:mga09592_318460_c1_411_1214 265
85 3300050510 nmdc:mga06r32_119903_c1 nmdc:mga06r32_119903_c1_1377_2180 265
86 3300050512 nmdc:mga0n895_312488_c1 nmdc:mga0n895_312488_c1_762_1580 265
87 3300053109 Ga0500569_002559 Ga0500569_002559_1591_2388 265
88 3300053118 Ga0500594_0000625 Ga0500594_0000625_4751_5548 265
89 3300053130 Ga0500642_0000947 Ga0500642_0000947_6492_7307 265
90 3300053139 Ga0500568_0003545 Ga0500568_0003545_5608_6405 265
91 3300053153 Ga0500616_0001268 Ga0500616_0001268_18432_19229 265
92 3300053156 Ga0500622_0069663 Ga0500622_0069663_14_811 265
93 3300005354 Ga0070675_100079050 Ga0070675_1000790503 266
94 3300005355 Ga0070671_100054978 Ga0070671_1000549783 266
95 3300025926 Ga0207659_10085196 Ga0207659_100851962 266
96 3300038727 Ga0400491_28771 Ga0400491_28771_995_1804 266
97 iso_pu_bacteria 2919450847 2919455188 266
98 iso_pu_bacteria 2595698237 2596373992 267
99 iso_pu_bacteria 2889306138 2889308256 267
100 iso_pu_bacteria 2902330777 2902335839 267
101 iso_pu_bacteria 2902405164 2902409065 267
102 iso_pu_bacteria 2928125067 2928129408 267
103 iso_pu_bacteria 8054563764 8054568261 267
104 3300009098 Ga0105245_10543347 Ga0105245_105433472 268
105 3300048922 Ga0496119_0002278 Ga0496119_0002278_4146_4961 268
106 3300048925 Ga0496122_0002395 Ga0496122_0002395_14362_15177 268
107 3300048926 Ga0496123_0001113 Ga0496123_0001113_25869_26684 268
108 3300053104 Ga0500556_0000309 Ga0500556_0000309_9530_10345 268
109 3300053730 Ga0500645_012308 Ga0500645_012308_896_1711 268
110 iso_pu_bacteria 2509276021 2509388193 268
111 iso_pu_bacteria 2509276033 2509443785 268
112 iso_pu_bacteria 2510065019 2510131698 268
113 iso_pu_bacteria 2510461076 2510897991 268
114 iso_pu_bacteria 2510917026 2511174622 268
115 iso_pu_bacteria 2513237084 2513571274 268
116 iso_pu_bacteria 2513237085 2513579192 268
117 iso_pu_bacteria 2513237093 2513632369 268
118 iso_pu_bacteria 2513237103 2513711695 268
119 iso_pu_bacteria 2513237144 2513907902 268
120 iso_pu_bacteria 2513237146 2513927562 268
121 iso_pu_bacteria 2513237162 2514024918 268
122 iso_pu_bacteria 2515075009 2515110634 268
123 iso_pu_bacteria 2515154113 2515638704 268
124 iso_pu_bacteria 2515154114 2515645915 268
125 iso_pu_bacteria 2515154116 2515661981 268
126 iso_pu_bacteria 2515154134 2515742885 268
127 iso_pu_bacteria 2516653077 2517039336 268
128 iso_pu_bacteria 2516653085 2517079555 268
129 iso_pu_bacteria 2517093000 2517093505 268
130 iso_pu_bacteria 2517287029 2517405208 268
131 iso_pu_bacteria 2519899620 2520379949 268
132 iso_pu_bacteria 2523231067 2523466384 268
133 iso_pu_bacteria 2524023209 2524457701 268
134 iso_pu_bacteria 2529292951 2530647600 268
135 iso_pu_bacteria 2534681786 2535484184 268
136 iso_pu_bacteria 2534681796 2535515278 268
137 iso_pu_bacteria 2585427526 2585528501 268
138 iso_pu_bacteria 2585427528 2585539900 268
139 iso_pu_bacteria 2585427593 2585837881 268
140 iso_pu_bacteria 2585427633 2585994688 268
141 iso_pu_bacteria 2585427634 2585999173 268
142 iso_pu_bacteria 2599185170 2599418992 268
143 iso_pu_bacteria 2599185236 2599719369 268
144 iso_pu_bacteria 2600254933 2600374894 268
145 iso_pu_bacteria 2615840624 2616295868 268
146 iso_pu_bacteria 2643221558 2643810359 268
147 iso_pu_bacteria 2643221634 2644190786 268
148 iso_pu_bacteria 2643221653 2644297328 268
149 iso_pu_bacteria 2643221719 2644655581 268
150 iso_pu_bacteria 2643221734 2644736247 268
151 iso_pu_bacteria 2643221736 2644745714 268
152 iso_pu_bacteria 2718217882 2719179768 268
153 iso_pu_bacteria 2718217927 2719384377 268
154 iso_pu_bacteria 2718217997 2719664120 268
155 iso_pu_bacteria 2718218009 2719730438 268
156 iso_pu_bacteria 2718218199 2720490539 268
157 iso_pu_bacteria 2718218232 2720611920 268
158 iso_pu_bacteria 2718218233 2720618774 268
159 iso_pu_bacteria 2718218235 2720630174 268
160 iso_pu_bacteria 2718218269 2720773869 268
161 iso_pu_bacteria 2718218363 2721145861 268
162 iso_pu_bacteria 2718218365 2721157398 268
163 iso_pu_bacteria 2718218366 2721162740 268
164 iso_pu_bacteria 2718218423 2721398091 268
165 iso_pu_bacteria 2721755514 2722838910 268
166 iso_pu_bacteria 2721755556 2723025539 268
167 iso_pu_bacteria 2721755684 2723559124 268
168 iso_pu_bacteria 2721755685 2723565729 268
169 iso_pu_bacteria 2721755809 2724036901 268
170 iso_pu_bacteria 2721755810 2724043194 268
171 iso_pu_bacteria 2721755819 2724088476 268
172 iso_pu_bacteria 2721755822 2724102994 268
173 iso_pu_bacteria 2721755823 2724108855 268
174 iso_pu_bacteria 2724679232 2725950729 268
175 iso_pu_bacteria 2728369352 2730106475 268
176 iso_pu_bacteria 2728369365 2730163005 268
177 iso_pu_bacteria 2728369397 2730297030 268
178 iso_pu_bacteria 2738541317 2738945804 268
179 iso_pu_bacteria 2738541333 2739034760 268
180 iso_pu_bacteria 2751185800 2753358773 268
181 iso_pu_bacteria 2758568016 2758641005 268
182 iso_pu_bacteria 2765235942 2766065018 268
183 iso_pu_bacteria 2773857925 2774870469 268
184 iso_pu_bacteria 2791355253 2793283673 268
185 iso_pu_bacteria 2791355256 2793295017 268
186 iso_pu_bacteria 2791355259 2793315229 268
187 iso_pu_bacteria 2791355260 2793320085 268
188 iso_pu_bacteria 2791355261 2793328289 268
189 iso_pu_bacteria 2791355262 2793332633 268
190 iso_pu_bacteria 2791355263 2793342911 268
191 iso_pu_bacteria 2791355264 2793350583 268
192 iso_pu_bacteria 2791355265 2793353183 268
193 iso_pu_bacteria 2791355266 2793360987 268
194 iso_pu_bacteria 2791355267 2793364889 268
195 iso_pu_bacteria 2802429605 2805927382 268
196 iso_pu_bacteria 2802429606 2805936420 268
197 iso_pu_bacteria 2802429633 2806044056 268
198 iso_pu_bacteria 2802429634 2806052127 268
199 iso_pu_bacteria 2802429635 2806058428 268
200 iso_pu_bacteria 2802429636 2806066924 268
201 iso_pu_bacteria 2802429637 2806074666 268
202 iso_pu_bacteria 2818991461 2819684520 268
203 iso_pu_bacteria 2818991467 2819719740 268
204 iso_pu_bacteria 2829745981 2829748116 268
205 iso_pu_bacteria 2837651117 2837652370 268
206 iso_pu_bacteria 2838016132 2838021789 268
207 iso_pu_bacteria 2838022645 2838026514 268
208 iso_pu_bacteria 2838035591 2838037320 268
209 iso_pu_bacteria 2838042994 2838047294 268
210 iso_pu_bacteria 2838048938 2838054758 268
211 iso_pu_bacteria 2838061910 2838067512 268
212 iso_pu_bacteria 2838068647 2838074050 268
213 iso_pu_bacteria 2838661181 2838663493 268
214 iso_pu_bacteria 2838668709 2838673399 268
215 iso_pu_bacteria 2838680041 2838680798 268
216 iso_pu_bacteria 2838686498 2838692541 268
217 iso_pu_bacteria 2838694306 2838695169 268
218 iso_pu_bacteria 2838701080 2838705918 268
219 iso_pu_bacteria 2838707686 2838708545 268
220 iso_pu_bacteria 2838729681 2838732613 268
221 iso_pu_bacteria 2838742623 2838745508 268
222 iso_pu_bacteria 2841760612 2841765664 268
223 iso_pu_bacteria 2841851746 2841855152 268
224 iso_pu_bacteria 2841864319 2841866602 268
225 iso_pu_bacteria 2841911363 2841914050 268
226 iso_pu_bacteria 2841917233 2841921520 268
227 iso_pu_bacteria 2842077413 2842080221 268
228 iso_pu_bacteria 2842110456 2842112423 268
229 iso_pu_bacteria 2842118031 2842120840 268
230 iso_pu_bacteria 2842146304 2842150770 268
231 iso_pu_bacteria 2842156927 2842161818 268
232 iso_pu_bacteria 2842163707 2842169193 268
233 iso_pu_bacteria 2842180545 2842185435 268
234 iso_pu_bacteria 2842192696 2842193106 268
235 iso_pu_bacteria 2842198810 2842203154 268
236 iso_pu_bacteria 2842205361 2842206732 268
237 iso_pu_bacteria 2842217011 2842218575 268
238 iso_pu_bacteria 2842229732 2842233373 268
239 iso_pu_bacteria 2842237096 2842237957 268
240 iso_pu_bacteria 2842243621 2842248623 268
241 iso_pu_bacteria 2842250916 2842255609 268
242 iso_pu_bacteria 2842257432 2842261766 268
243 iso_pu_bacteria 2842264693 2842267240 268
244 iso_pu_bacteria 2842271015 2842277170 268
245 iso_pu_bacteria 2842278818 2842280575 268
246 iso_pu_bacteria 2842285085 2842289526 268
247 iso_pu_bacteria 2842291075 2842293880 268
248 iso_pu_bacteria 2842298080 2842300684 268
249 iso_pu_bacteria 2842304105 2842306272 268
250 iso_pu_bacteria 2842311132 2842315950 268
251 iso_pu_bacteria 2842317721 2842322315 268
252 iso_pu_bacteria 2842341865 2842342853 268
253 iso_pu_bacteria 2842357229 2842358198 268
254 iso_pu_bacteria 2842363717 2842369479 268
255 iso_pu_bacteria 2842370503 2842371261 268
256 iso_pu_bacteria 2842377471 2842380276 268
257 iso_pu_bacteria 2842384541 2842387348 268
258 iso_pu_bacteria 2842395702 2842400764 268
259 iso_pu_bacteria 2842402390 2842406874 268
260 iso_pu_bacteria 2842409023 2842413629 268
261 iso_pu_bacteria 2842415677 2842420408 268
262 iso_pu_bacteria 2842422224 2842427678 268
263 iso_pu_bacteria 2842428310 2842431509 268
264 iso_pu_bacteria 2842434925 2842437844 268
265 iso_pu_bacteria 2842441272 2842444658 268
266 iso_pu_bacteria 2842447887 2842450415 268
267 iso_pu_bacteria 2842462802 2842465514 268
268 iso_pu_bacteria 2842469257 2842472324 268
269 iso_pu_bacteria 2842489311 2842495182 268
270 iso_pu_bacteria 2842495871 2842501023 268
271 iso_pu_bacteria 2842509118 2842509388 268
272 iso_pu_bacteria 2844104063 2844107274 268
273 iso_pu_bacteria 2844454524 2844455767 268
274 iso_pu_bacteria 2851182111 2851183965 268
275 iso_pu_bacteria 2851246043 2851249314 268
276 iso_pu_bacteria 2854896431 2854898469 268
277 iso_pu_bacteria 2854911287 2854914351 268
278 iso_pu_bacteria 2854916844 2854917755 268
279 iso_pu_bacteria 2857516855 2857524051 268
280 iso_pu_bacteria 2861691609 2861693981 268
281 iso_pu_bacteria 2882456835 2882456869 268
282 iso_pu_bacteria 2884298095 2884299408 268
283 iso_pu_bacteria 2894817345 2894817906 268
284 iso_pu_bacteria 2913308742 2913310513 268
285 iso_pu_bacteria 2915650412 2915651233 268
286 iso_pu_bacteria 2917554339 2917555742 268
287 iso_pu_bacteria 2917699015 2917704354 268
288 iso_pu_bacteria 2919171160 2919171863 268
289 iso_pu_bacteria 2933016740 2933023269 268
290 iso_pu_bacteria 2933570622 2933573341 268
291 iso_pu_bacteria 2933586486 2933587752 268
292 iso_pu_bacteria 2933599457 2933604438 268
293 iso_pu_bacteria 2935894831 2935895692 268
294 iso_pu_bacteria 2935901341 2935907351 268
295 iso_pu_bacteria 2936367885 2936368717 268
296 iso_pu_bacteria 2936375103 2936379374 268
297 iso_pu_bacteria 2936381700 2936383853 268
298 iso_pu_bacteria 2939669807 2939673220 268
299 iso_pu_bacteria 2989771324 2989774142 268
300 iso_pu_bacteria 2996893221 2996893651 268
301 iso_pu_bacteria 3005409236 3005411410 268
302 iso_pu_bacteria 639633055 639646892 268
303 iso_pu_bacteria 8001845381 8001848152 268
304 iso_pu_bacteria 8002285264 8002288112 268
305 iso_pu_bacteria 8005246636 8005247082 268
306 iso_pu_bacteria 8005275841 8005279092 268
307 iso_pu_bacteria 8005282627 8005283820 268
308 iso_pu_bacteria 8005289223 8005291912 268
309 iso_pu_bacteria 8005301065 8005304044 268
310 iso_pu_bacteria 8005307578 8005308869 268
311 iso_pu_bacteria 8005376324 8005377224 268
312 iso_pu_bacteria 8005382845 8005387089 268
313 iso_pu_bacteria 8005395548 8005401850 268
314 iso_pu_bacteria 8005430974 8005436007 268
315 iso_pu_bacteria 8005460587 8005461276 268
316 iso_pu_bacteria 8005497431 8005498867 268
317 iso_pu_bacteria 8005542996 8005543960 268
318 iso_pu_bacteria 8005556819 8005559252 268
319 iso_pu_bacteria 8005563573 8005569833 268
320 iso_pu_bacteria 8005570704 8005577136 268
321 iso_pu_bacteria 8005619151 8005620053 268
322 iso_pu_bacteria 8005626139 8005628659 268
323 iso_pu_bacteria 8005668836 8005670280 268
324 iso_pu_bacteria 8005688590 8005690469 268
325 iso_pu_bacteria 8005695170 8005698993 268
326 iso_pu_bacteria 8018127388 8018133325 268
327 iso_pu_bacteria 8018150411 8018151835 268
328 iso_pu_bacteria 8018163183 8018167032 268
329 iso_pu_bacteria 8018176218 8018180463 268
330 iso_pu_bacteria 8023680758 8023684008 268
331 iso_pu_bacteria 8024479707 8024480508 268
332 iso_pu_bacteria 8024501048 8024502559 268
333 iso_pu_bacteria 8055431914 8055433088 268
334 iso_pu_bacteria 8056375014 8056379088 268
335 iso_pu_bacteria 8056382006 8056386161 268
336 iso_pu_bacteria 8056875544 8056879299 268
337 iso_pu_bacteria 8057529695 8057532147 268
338 iso_pu_bacteria 8057874678 8057881164 268
339 3300007265 Ga0099794_10060589 Ga0099794_100605891 269
340 3300025284 Ga0209130_1013995 Ga0209130_10139953 269
341 3300028794 Ga0307515_10000937 Ga0307515_1000093766 269
342 3300046524 Ga0495648_0083713 Ga0495648_0083713_234_1043 269
343 3300049572 Ga0501036_0129261 Ga0501036_0129261_529_1413 269
344 3300049577 Ga0501041_0299155 Ga0501041_0299155_40_855 269
345 3300053085 Ga0495619_0142300 Ga0495619_0142300_129_1073 269
346 iso_pu_bacteria 2643221733 2644732737 269
347 3300014325 Ga0163163_10216929 Ga0163163_102169291 270
348 3300021377 Ga0213874_10010172 Ga0213874_100101723 270
349 3300025904 Ga0207647_10128057 Ga0207647_101280571 270
350 3300025929 Ga0207664_10324118 Ga0207664_103241182 270
351 3300026089 Ga0207648_10101657 Ga0207648_101016572 270
352 3300031239 Ga0265328_10004877 Ga0265328_100048774 270
353 3300031250 Ga0265331_10000151 Ga0265331_1000015125 270
354 3300039438 Ga0436360_1158244 Ga0436360_1158244_649_1515 270
355 3300039450 Ga0436363_0159755 Ga0436363_0159755_4091_4957 270
356 3300048903 Ga0496100_0132243 Ga0496100_0132243_798_1610 270
357 3300048907 Ga0496104_0003012 Ga0496104_0003012_2729_3541 270
358 3300048909 Ga0496106_0499124 Ga0496106_0499124_12_824 270
359 3300048914 Ga0496111_0103413 Ga0496111_0103413_264_1076 270
360 3300048915 Ga0496112_0065812 Ga0496112_0065812_2380_3192 270
361 3300048916 Ga0496113_0041718 Ga0496113_0041718_1026_1838 270
362 3300049586 Ga0501070_0376347 Ga0501070_0376347_305_1117 270
363 3300049822 Ga0501035_0075411 Ga0501035_0075411_508_1320 270
364 3300050511 nmdc:mga08y16_202023_c1 nmdc:mga08y16_202023_c1_527_1408 270
365 iso_pu_bacteria 2545555834 2545673812 270
366 iso_pu_bacteria 2891088606 2891090316 270
367 iso_pu_bacteria 641522639 641642014 270
368 iso_pu_bacteria 643348564 643598452 270
369 3300005354 Ga0070675_100118824 Ga0070675_1001188242 271
370 3300005564 Ga0070664_100108914 Ga0070664_1001089143 271
371 3300006048 Ga0075363_100091237 Ga0075363_1000912372 271
372 3300006051 Ga0075364_10183372 Ga0075364_101833721 271
373 3300006177 Ga0075362_10001028 Ga0075362_100010284 271
374 3300006178 Ga0075367_10026404 Ga0075367_100264044 271
375 3300006195 Ga0075366_10124206 Ga0075366_101242061 271
376 3300009098 Ga0105245_10060298 Ga0105245_100602983 271
377 3300025933 Ga0207706_10175525 Ga0207706_101755252 271
378 3300025945 Ga0207679_10180526 Ga0207679_101805263 271
379 3300031241 Ga0265325_10040691 Ga0265325_100406912 271
380 3300031250 Ga0265331_10166267 Ga0265331_101662671 271
381 3300031595 Ga0265313_10001809 Ga0265313_1000180910 271
382 3300035170 Ga0373943_0084340 Ga0373943_0084340_448_1263 271
383 3300035692 Ga0373935_0114143 Ga0373935_0114143_504_1319 271
384 3300039437 Ga0436365_0105218 Ga0436365_0105218_442_1341 271
385 3300044735 Ga0466968_0004663 Ga0466968_0004663_153_977 271
386 3300044901 Ga0466960_0019074 Ga0466960_0019074_1535_2359 271
387 3300046460 Ga0495638_0018174 Ga0495638_0018174_2870_3685 271
388 3300046460 Ga0495638_0020458 Ga0495638_0020458_1213_2091 271
389 3300046472 Ga0495580_0104535 Ga0495580_0104535_720_1535 271
390 3300046689 Ga0495613_0056989 Ga0495613_0056989_671_1486 271
391 3300047469 Ga0495673_0127281 Ga0495673_0127281_96_911 271
392 3300050490 nmdc:mga03n38_67206_c1 nmdc:mga03n38_67206_c1_88_903 271
393 3300050493 nmdc:mga0k408_8569_c2 nmdc:mga0k408_8569_c2_2254_3069 271
394 3300050494 nmdc:mga06z11_148602_c1 nmdc:mga06z11_148602_c1_100_915 271
395 3300050511 nmdc:mga08y16_5270_c1 nmdc:mga08y16_5270_c1_8035_8850 271
396 iso_pu_bacteria 2738541281 2738747584 271
397 iso_pu_bacteria 2738543032 2739356820 271
398 iso_pu_bacteria 2842698319 2842702817 271
399 3300001979 JGI24740J21852_10038588 JGI24740J21852_100385882 272
400 3300002773 JGI25152J39213_1002002 JGI25152J39213_10020022 272
401 3300002773 JGI25152J39213_1002028 JGI25152J39213_10020284 272
402 3300002987 JGI25159J45721_1014032 JGI25159J45721_10140322 272
403 3300003187 JGI25151J46595_10000303 JGI25151J46595_1000030319 272
404 3300003187 JGI25151J46595_10002252 JGI25151J46595_1000225211 272
405 3300003187 JGI25151J46595_10059451 JGI25151J46595_100594512 272
406 3300003354 JGI25160J50197_1000632 JGI25160J50197_10006327 272
407 3300003354 JGI25160J50197_1009521 JGI25160J50197_10095214 272
408 3300003771 Ga0055526_1017156 Ga0055526_10171562 272
409 3300003775 Ga0055524_1000301 Ga0055524_100030116 272
410 3300003781 Ga0055536_1002732 Ga0055536_10027324 272
411 3300003791 Ga0055530_10024672 Ga0055530_100246721 272
412 3300003792 Ga0055540_1001427 Ga0055540_100142711 272
413 3300003792 Ga0055540_1003227 Ga0055540_10032272 272
414 3300003794 Ga0055531_10018157 Ga0055531_100181572 272
415 3300005262 Ga0065165_1000398 Ga0065165_10003982 272
416 3300005262 Ga0065165_1003160 Ga0065165_10031604 272
417 3300005262 Ga0065165_1013285 Ga0065165_10132852 272
418 3300005262 Ga0065165_1038017 Ga0065165_10380172 272
419 3300005331 Ga0070670_100000542 Ga0070670_10000054229 272
420 3300005347 Ga0070668_100165822 Ga0070668_1001658222 272
421 3300005353 Ga0070669_100204872 Ga0070669_1002048722 272
422 3300005434 Ga0070709_10094349 Ga0070709_100943493 272
423 3300005439 Ga0070711_100150078 Ga0070711_1001500781 272
424 3300005468 Ga0070707_100128401 Ga0070707_1001284012 272
425 3300005548 Ga0070665_100021623 Ga0070665_1000216234 272
426 3300005563 Ga0068855_100442190 Ga0068855_1004421901 272
427 3300005618 Ga0068864_100284181 Ga0068864_1002841812 272
428 3300005844 Ga0068862_100174599 Ga0068862_1001745992 272
429 3300006028 Ga0070717_10185456 Ga0070717_101854562 272
430 3300006038 Ga0075365_10034058 Ga0075365_100340583 272
431 3300006042 Ga0075368_10048594 Ga0075368_100485942 272
432 3300006051 Ga0075364_10001118 Ga0075364_100011182 272
433 3300006173 Ga0070716_100291713 Ga0070716_1002917132 272
434 3300006177 Ga0075362_10002948 Ga0075362_100029482 272
435 3300006178 Ga0075367_10002778 Ga0075367_100027783 272
436 3300006178 Ga0075367_10022321 Ga0075367_100223214 272
437 3300006186 Ga0075369_10001472 Ga0075369_100014724 272
438 3300006195 Ga0075366_10028409 Ga0075366_100284094 272
439 3300006353 Ga0075370_10021829 Ga0075370_100218293 272
440 3300006353 Ga0075370_10085566 Ga0075370_100855663 272
441 3300006871 Ga0075434_100022860 Ga0075434_1000228605 272
442 3300006914 Ga0075436_100222322 Ga0075436_1002223222 272
443 3300006946 Ga0079104_1000010 Ga0079104_1000010402 272
444 3300007788 Ga0099795_10003216 Ga0099795_100032164 272
445 3300009093 Ga0105240_10468523 Ga0105240_104685232 272
446 3300009093 Ga0105240_10686679 Ga0105240_106866792 272
447 3300009093 Ga0105240_10732816 Ga0105240_107328161 272
448 3300009148 Ga0105243_10263313 Ga0105243_102633132 272
449 3300009176 Ga0105242_10227555 Ga0105242_102275552 272
450 3300009553 Ga0105249_10177056 Ga0105249_101770563 272
451 3300010159 Ga0099796_10002042 Ga0099796_100020423 272
452 3300013250 Ga0171462_1008 Ga0171462_100818 272
453 3300014325 Ga0163163_10002439 Ga0163163_100024396 272
454 3300021361 Ga0213872_10031632 Ga0213872_100316322 272
455 3300021361 Ga0213872_10035992 Ga0213872_100359922 272
456 3300021384 Ga0213876_10189799 Ga0213876_101897991 272
457 3300021384 Ga0213876_10194887 Ga0213876_101948871 272
458 3300021388 Ga0213875_10032240 Ga0213875_100322403 272
459 3300025245 Ga0207425_1003676 Ga0207425_10036764 272
460 3300025245 Ga0207425_1023553 Ga0207425_10235532 272
461 3300025254 Ga0209148_1000581 Ga0209148_100058123 272
462 3300025258 Ga0209129_1000078 Ga0209129_100007811 272
463 3300025258 Ga0209129_1000890 Ga0209129_10008906 272
464 3300025258 Ga0209129_1008361 Ga0209129_10083612 272
465 3300025272 Ga0209455_1003117 Ga0209455_10031171 272
466 3300025273 Ga0209673_1000015 Ga0209673_1000015217 272
467 3300025273 Ga0209673_1004050 Ga0209673_10040501 272
468 3300025273 Ga0209673_1004249 Ga0209673_10042495 272
469 3300025273 Ga0209673_1005147 Ga0209673_10051474 272
470 3300025273 Ga0209673_1011868 Ga0209673_10118682 272
471 3300025284 Ga0209130_1000102 Ga0209130_100010264 272
472 3300025284 Ga0209130_1014104 Ga0209130_10141042 272
473 3300025291 Ga0209675_1000455 Ga0209675_100045526 272
474 3300025292 Ga0209676_1010999 Ga0209676_10109992 272
475 3300025292 Ga0209676_1034253 Ga0209676_10342532 272
476 3300025294 Ga0209025_1000010 Ga0209025_1000010631 272
477 3300025294 Ga0209025_1000205 Ga0209025_10002053 272
478 3300025294 Ga0209025_1000489 Ga0209025_100048942 272
479 3300025294 Ga0209025_1002113 Ga0209025_100211323 272
480 3300025294 Ga0209025_1004509 Ga0209025_10045097 272
481 3300025294 Ga0209025_1040110 Ga0209025_10401103 272
482 3300025294 Ga0209025_1049095 Ga0209025_10490953 272
483 3300025295 Ga0209564_1000015 Ga0209564_1000015394 272
484 3300025295 Ga0209564_1000048 Ga0209564_1000048290 272
485 3300025295 Ga0209564_1001741 Ga0209564_10017419 272
486 3300025295 Ga0209564_1006052 Ga0209564_10060522 272
487 3300025297 Ga0209758_1003154 Ga0209758_10031546 272
488 3300025297 Ga0209758_1017506 Ga0209758_10175063 272
489 3300025297 Ga0209758_1024309 Ga0209758_10243093 272
490 3300025297 Ga0209758_1033968 Ga0209758_10339682 272
491 3300025298 Ga0209050_1001561 Ga0209050_10015617 272
492 3300025298 Ga0209050_1003278 Ga0209050_10032782 272
493 3300025299 Ga0209256_1000041 Ga0209256_1000041290 272
494 3300025299 Ga0209256_1000782 Ga0209256_100078216 272
495 3300025299 Ga0209256_1000860 Ga0209256_100086024 272
496 3300025299 Ga0209256_1005355 Ga0209256_10053552 272
497 3300025302 Ga0207426_1000063 Ga0207426_10000636 272
498 3300025302 Ga0207426_1002969 Ga0207426_10029696 272
499 3300025303 Ga0209051_1000205 Ga0209051_100020516 272
500 3300025304 Ga0209257_1000453 Ga0209257_100045345 272
501 3300025304 Ga0209257_1004468 Ga0209257_10044686 272
502 3300025905 Ga0207685_10111887 Ga0207685_101118871 272
503 3300025905 Ga0207685_10188555 Ga0207685_101885551 272
504 3300025906 Ga0207699_10019962 Ga0207699_100199621 272
505 3300025907 Ga0207645_10029088 Ga0207645_100290883 272
506 3300025913 Ga0207695_10116202 Ga0207695_101162022 272
507 3300025913 Ga0207695_10172868 Ga0207695_101728683 272
508 3300025916 Ga0207663_10318516 Ga0207663_103185162 272
509 3300025918 Ga0207662_10005962 Ga0207662_100059623 272
510 3300025922 Ga0207646_10045898 Ga0207646_100458983 272
511 3300025925 Ga0207650_10013995 Ga0207650_100139953 272
512 3300025929 Ga0207664_10019155 Ga0207664_100191553 272
513 3300025933 Ga0207706_10001347 Ga0207706_1000134715 272
514 3300025933 Ga0207706_10195313 Ga0207706_101953132 272
515 3300025941 Ga0207711_10062095 Ga0207711_100620954 272
516 3300025972 Ga0207668_10172619 Ga0207668_101726192 272
517 3300027111 Ga0209281_1000078 Ga0209281_1000078278 272
518 3300027512 Ga0209179_1001135 Ga0209179_10011353 272
519 3300027866 Ga0209813_10066442 Ga0209813_100664421 272
520 3300027907 Ga0207428_10231072 Ga0207428_102310721 272
521 3300028379 Ga0268266_10060772 Ga0268266_100607722 272
522 3300028380 Ga0268265_10071557 Ga0268265_100715572 272
523 3300028794 Ga0307515_10019978 Ga0307515_100199788 272
524 3300031235 Ga0265330_10031701 Ga0265330_100317012 272
525 3300031235 Ga0265330_10063942 Ga0265330_100639422 272
526 3300031241 Ga0265325_10001335 Ga0265325_100013353 272
527 3300031241 Ga0265325_10019979 Ga0265325_100199794 272
528 3300031249 Ga0265339_10003516 Ga0265339_100035167 272
529 3300031249 Ga0265339_10019214 Ga0265339_100192142 272
530 3300031250 Ga0265331_10056886 Ga0265331_100568862 272
531 3300031344 Ga0265316_10080306 Ga0265316_100803064 272
532 3300031456 Ga0307513_10256537 Ga0307513_102565372 272
533 3300031456 Ga0307513_10473897 Ga0307513_104738971 272
534 3300031595 Ga0265313_10000712 Ga0265313_1000071223 272
535 3300031595 Ga0265313_10000794 Ga0265313_1000079423 272
536 3300031595 Ga0265313_10025244 Ga0265313_100252444 272
537 3300031649 Ga0307514_10151087 Ga0307514_101510873 272
538 3300031665 Ga0316575_10051352 Ga0316575_100513521 272
539 3300031711 Ga0265314_10022034 Ga0265314_100220343 272
540 3300031711 Ga0265314_10051925 Ga0265314_100519252 272
541 3300031712 Ga0265342_10021079 Ga0265342_100210792 272
542 3300031712 Ga0265342_10039308 Ga0265342_100393082 272
543 3300031727 Ga0316576_10009732 Ga0316576_100097324 272
544 3300031730 Ga0307516_10187651 Ga0307516_101876513 272
545 3300031733 Ga0316577_10082511 Ga0316577_100825112 272
546 3300031995 Ga0307409_100443129 Ga0307409_1004431292 272
547 3300032002 Ga0307416_100185203 Ga0307416_1001852033 272
548 3300032002 Ga0307416_100199289 Ga0307416_1001992892 272
549 3300035113 Ga0373936_0006442 Ga0373936_0006442_3049_3870 272
550 3300035116 Ga0373945_0002293 Ga0373945_0002293_4239_5060 272
551 3300035118 Ga0373954_0002657 Ga0373954_0002657_265_1086 272
552 3300035120 Ga0373957_0004968 Ga0373957_0004968_1397_2218 272
553 3300035170 Ga0373943_0008895 Ga0373943_0008895_1489_2310 272
554 3300035170 Ga0373943_0044486 Ga0373943_0044486_753_1571 272
555 3300035398 Ga0316574_0000488 Ga0316574_0000488_12510_13331 272
556 3300035410 Ga0373924_0005190 Ga0373924_0005190_657_1478 272
557 3300035692 Ga0373935_0000237 Ga0373935_0000237_21078_21899 272
558 3300035695 Ga0373927_0002396 Ga0373927_0002396_7248_8069 272
559 3300035724 Ga0373933_0001004 Ga0373933_0001004_1663_2484 272
560 3300035725 Ga0373947_0001341 Ga0373947_0001341_14285_15106 272
561 3300036401 Ga0373937_0002850 Ga0373937_0002850_10037_10858 272
562 3300036712 Ga0316584_0024394 Ga0316584_0024394_3084_3905 272
563 3300037068 Ga0373925_0000016 Ga0373925_0000016_66817_67638 272
564 3300037068 Ga0373925_0083603 Ga0373925_0083603_686_1504 272
565 3300037312 Ga0395899_0010263 Ga0395899_0010263_1695_2522 272
566 3300037418 Ga0395900_0011891 Ga0395900_0011891_129_956 272
567 3300037418 Ga0395900_0138127 Ga0395900_0138127_803_1621 272
568 3300037471 Ga0395905_0001094 Ga0395905_0001094_6715_7533 272
569 3300037471 Ga0395905_0024326 Ga0395905_0024326_1576_2400 272
570 3300037471 Ga0395905_0039169 Ga0395905_0039169_2931_3749 272
571 3300037853 Ga0436364_0590670 Ga0436364_0590670_812_1639 272
572 3300037853 Ga0436364_0952715 Ga0436364_0952715_1283_2110 272
573 3300037853 Ga0436364_1262881 Ga0436364_1262881_28_852 272
574 3300039437 Ga0436365_0287193 Ga0436365_0287193_54_881 272
575 3300039437 Ga0436365_0625173 Ga0436365_0625173_1490_2308 272
576 3300039437 Ga0436365_0651981 Ga0436365_0651981_818_1636 272
577 3300039437 Ga0436365_1904666 Ga0436365_1904666_1159_1977 272
578 3300039438 Ga0436360_0035315 Ga0436360_0035315_4012_4893 272
579 3300039438 Ga0436360_0142398 Ga0436360_0142398_77_895 272
580 3300039438 Ga0436360_0155695 Ga0436360_0155695_380_1216 272
581 3300039438 Ga0436360_0490643 Ga0436360_0490643_234_1082 272
582 3300039438 Ga0436360_1360831 Ga0436360_1360831_133_969 272
583 3300039447 Ga0436361_0039520 Ga0436361_0039520_436_1287 272
584 3300039447 Ga0436361_0383805 Ga0436361_0383805_1459_2277 272
585 3300039447 Ga0436361_0440108 Ga0436361_0440108_2983_3831 272
586 3300039447 Ga0436361_0928537 Ga0436361_0928537_864_1700 272
587 3300039447 Ga0436361_1019991 Ga0436361_1019991_343_1191 272
588 3300039450 Ga0436363_0519591 Ga0436363_0519591_298_1116 272
589 3300039453 Ga0436362_0513677 Ga0436362_0513677_167_1015 272
590 3300039453 Ga0436362_1280924 Ga0436362_1280924_215_1051 272
591 3300041413 Ga0439465_0021790 Ga0439465_0021790_131_949 272
592 3300041458 Ga0451798_0122636 Ga0451798_0122636_756_1574 272
593 3300041486 Ga0451807_1223344 Ga0451807_1223344_30_848 272
594 3300041494 Ga0451837_1231756 Ga0451837_1231756_38_856 272
595 3300041502 Ga0451846_23722 Ga0451846_23722_400_1218 272
596 3300041507 Ga0451851_0337876 Ga0451851_0337876_4389_5207 272
597 3300041511 Ga0451855_0876207 Ga0451855_0876207_1045_1863 272
598 3300041916 Ga0452271_01831 Ga0452271_01831_655_1473 272
599 3300042438 Ga0439459_0021258 Ga0439459_0021258_346_1170 272
600 3300044683 Ga0466965_0025673 Ga0466965_0025673_1520_2338 272
601 3300044684 Ga0466966_0018794 Ga0466966_0018794_1036_1902 272
602 3300044693 Ga0466961_0046569 Ga0466961_0046569_313_1179 272
603 3300044735 Ga0466968_0021969 Ga0466968_0021969_622_1440 272
604 3300044735 Ga0466968_0055764 Ga0466968_0055764_237_1061 272
605 3300044765 Ga0466970_0071094 Ga0466970_0071094_815_1633 272
606 3300044842 Ga0466957_0052705 Ga0466957_0052705_932_1756 272
607 3300044842 Ga0466957_0210594 Ga0466957_0210594_76_900 272
608 3300045049 Ga0466959_0081508 Ga0466959_0081508_1323_2189 272
609 3300045976 Ga0466967_0258050 Ga0466967_0258050_545_1369 272
610 3300046452 Ga0495617_040451 Ga0495617_040451_362_1180 272
611 3300046454 Ga0495592_0000044 Ga0495592_0000044_35302_36123 272
612 3300046459 Ga0495629_0004823 Ga0495629_0004823_177_998 272
613 3300046459 Ga0495629_0009106 Ga0495629_0009106_564_1382 272
614 3300046462 Ga0495651_0000702 Ga0495651_0000702_14173_14994 272
615 3300046463 Ga0495653_0000022 Ga0495653_0000022_17184_18005 272
616 3300046476 Ga0495662_0005807 Ga0495662_0005807_762_1583 272
617 3300046477 Ga0495664_0000013 Ga0495664_0000013_173251_174072 272
618 3300046501 Ga0495607_0080284 Ga0495607_0080284_224_1042 272
619 3300046507 Ga0495606_0000735 Ga0495606_0000735_39627_40445 272
620 3300046507 Ga0495606_0013694 Ga0495606_0013694_3515_4333 272
621 3300046511 Ga0495608_0000004 Ga0495608_0000004_323981_324802 272
622 3300046512 Ga0495610_0017832 Ga0495610_0017832_2442_3284 272
623 3300046512 Ga0495610_0051883 Ga0495610_0051883_189_1007 272
624 3300046513 Ga0495616_0066679 Ga0495616_0066679_600_1418 272
625 3300046514 Ga0495618_0000032 Ga0495618_0000032_3613_4434 272
626 3300046516 Ga0495628_0000014 Ga0495628_0000014_31754_32575 272
627 3300046517 Ga0495630_0041250 Ga0495630_0041250_442_1263 272
628 3300046519 Ga0495632_0077828 Ga0495632_0077828_388_1206 272
629 3300046522 Ga0495643_0014814 Ga0495643_0014814_2755_3573 272
630 3300046523 Ga0495644_0062946 Ga0495644_0062946_188_1006 272
631 3300046523 Ga0495644_0069622 Ga0495644_0069622_106_924 272
632 3300046524 Ga0495648_0058489 Ga0495648_0058489_327_1145 272
633 3300046529 Ga0495652_0000002 Ga0495652_0000002_178365_179186 272
634 3300046530 Ga0495654_0000043 Ga0495654_0000043_123738_124556 272
635 3300046531 Ga0495665_0083756 Ga0495665_0083756_728_1549 272
636 3300046533 Ga0495640_0000001 Ga0495640_0000001_272369_273190 272
637 3300046536 Ga0495587_0000004 Ga0495587_0000004_327465_328286 272
638 3300046542 Ga0495597_0018562 Ga0495597_0018562_768_1586 272
639 3300046543 Ga0495645_0000001 Ga0495645_0000001_30304_31125 272
640 3300046558 Ga0495633_0019384 Ga0495633_0019384_2166_2984 272
641 3300046559 Ga0495667_0000009 Ga0495667_0000009_35353_36174 272
642 3300046616 Ga0495668_0045735 Ga0495668_0045735_499_1317 272
643 3300046642 Ga0495634_0000033 Ga0495634_0000033_6872_7693 272
644 3300046660 Ga0495625_0065206 Ga0495625_0065206_1672_2505 272
645 3300046660 Ga0495625_0276969 Ga0495625_0276969_170_988 272
646 3300046663 Ga0495635_0000003 Ga0495635_0000003_30161_30982 272
647 3300046663 Ga0495635_0024436 Ga0495635_0024436_2167_2985 272
648 3300046675 Ga0495657_0000342 Ga0495657_0000342_12078_12899 272
649 3300046675 Ga0495657_0010927 Ga0495657_0010927_2692_3510 272
650 3300046678 Ga0495599_0000030 Ga0495599_0000030_82638_83459 272
651 3300046679 Ga0495623_0000059 Ga0495623_0000059_30202_31023 272
652 3300046680 Ga0495646_0000031 Ga0495646_0000031_30220_31041 272
653 3300046683 Ga0495658_0019943 Ga0495658_0019943_210_1028 272
654 3300046683 Ga0495658_0203005 Ga0495658_0203005_46_867 272
655 3300046689 Ga0495613_0155921 Ga0495613_0155921_31_849 272
656 3300046689 Ga0495613_0182091 Ga0495613_0182091_66_887 272
657 3300046690 Ga0495624_0049159 Ga0495624_0049159_1259_2077 272
658 3300046690 Ga0495624_0241314 Ga0495624_0241314_184_1005 272
659 3300046794 Ga0495589_0052813 Ga0495589_0052813_411_1229 272
660 3300046809 Ga0495600_0000141 Ga0495600_0000141_10286_11107 272
661 3300046810 Ga0495660_0014676 Ga0495660_0014676_1950_2768 272
662 3300047315 Ga0495581_0044426 Ga0495581_0044426_1342_2163 272
663 3300047317 Ga0495604_0000002 Ga0495604_0000002_499883_500704 272
664 3300047319 Ga0495674_0000004 Ga0495674_0000004_499216_500037 272
665 3300047319 Ga0495674_0029168 Ga0495674_0029168_2740_3558 272
666 3300047320 Ga0495672_0091192 Ga0495672_0091192_610_1431 272
667 3300047321 Ga0495676_0103135 Ga0495676_0103135_358_1176 272
668 3300047322 Ga0495680_0000481 Ga0495680_0000481_13823_14644 272
669 3300047444 Ga0495675_0000048 Ga0495675_0000048_50573_51394 272
670 3300047471 Ga0495684_0000019 Ga0495684_0000019_122913_123734 272
671 3300047472 Ga0495686_0002404 Ga0495686_0002404_8021_8839 272
672 3300047472 Ga0495686_0007045 Ga0495686_0007045_6923_7741 272
673 3300047472 Ga0495686_0048876 Ga0495686_0048876_499_1341 272
674 3300047673 Ga0495593_0004544 Ga0495593_0004544_3796_4617 272
675 3300048088 Ga0495602_0000001 Ga0495602_0000001_30203_31024 272
676 3300048903 Ga0496100_0264393 Ga0496100_0264393_360_1187 272
677 3300048905 Ga0496102_0032062 Ga0496102_0032062_1139_1966 272
678 3300048906 Ga0496103_0075448 Ga0496103_0075448_133_957 272
679 3300048907 Ga0496104_0000279 Ga0496104_0000279_36867_37724 272
680 3300048907 Ga0496104_0004500 Ga0496104_0004500_8616_9443 272
681 3300048907 Ga0496104_0132578 Ga0496104_0132578_943_1791 272
682 3300048907 Ga0496104_0212217 Ga0496104_0212217_950_1798 272
683 3300048907 Ga0496104_0248348 Ga0496104_0248348_95_931 272
684 3300048908 Ga0496105_0000157 Ga0496105_0000157_13471_14328 272
685 3300048908 Ga0496105_0012292 Ga0496105_0012292_603_1451 272
686 3300048908 Ga0496105_0029645 Ga0496105_0029645_1877_2704 272
687 3300048908 Ga0496105_0054783 Ga0496105_0054783_2347_3195 272
688 3300048908 Ga0496105_0215063 Ga0496105_0215063_603_1439 272
689 3300048909 Ga0496106_0388219 Ga0496106_0388219_103_948 272
690 3300048911 Ga0496108_0000660 Ga0496108_0000660_12650_13477 272
691 3300048911 Ga0496108_0016400 Ga0496108_0016400_1440_2288 272
692 3300048911 Ga0496108_0110081 Ga0496108_0110081_1097_1915 272
693 3300048912 Ga0496109_0001413 Ga0496109_0001413_5907_6734 272
694 3300048913 Ga0496110_0003358 Ga0496110_0003358_1105_1953 272
695 3300048913 Ga0496110_0074823 Ga0496110_0074823_1513_2340 272
696 3300048913 Ga0496110_0180659 Ga0496110_0180659_106_942 272
697 3300048914 Ga0496111_0015710 Ga0496111_0015710_149_997 272
698 3300048914 Ga0496111_0040270 Ga0496111_0040270_39_866 272
699 3300048915 Ga0496112_0004414 Ga0496112_0004414_296_1123 272
700 3300048916 Ga0496113_0000962 Ga0496113_0000962_7152_8000 272
701 3300048916 Ga0496113_0001231 Ga0496113_0001231_7442_8269 272
702 3300048917 Ga0496114_0079890 Ga0496114_0079890_1770_2609 272
703 3300048917 Ga0496114_0085191 Ga0496114_0085191_1426_2382 272
704 3300048917 Ga0496114_0187487 Ga0496114_0187487_706_1524 272
705 3300048918 Ga0496115_0061848 Ga0496115_0061848_2129_2977 272
706 3300048918 Ga0496115_0062241 Ga0496115_0062241_1011_1829 272
707 3300048920 Ga0496117_0043973 Ga0496117_0043973_1470_2309 272
708 3300048920 Ga0496117_0106597 Ga0496117_0106597_680_1519 272
709 3300048921 Ga0496118_0115127 Ga0496118_0115127_169_987 272
710 3300048922 Ga0496119_0004297 Ga0496119_0004297_2158_3006 272
711 3300048924 Ga0496121_0003328 Ga0496121_0003328_4922_5740 272
712 3300048924 Ga0496121_0063606 Ga0496121_0063606_1922_2740 272
713 3300048924 Ga0496121_0344420 Ga0496121_0344420_119_955 272
714 3300048925 Ga0496122_0000009 Ga0496122_0000009_337910_338728 272
715 3300048925 Ga0496122_0028078 Ga0496122_0028078_926_1765 272
716 3300048926 Ga0496123_0000020 Ga0496123_0000020_142362_143180 272
717 3300048926 Ga0496123_0023664 Ga0496123_0023664_2179_3018 272
718 3300048926 Ga0496123_0039673 Ga0496123_0039673_1299_2117 272
719 3300048927 Ga0496124_0019616 Ga0496124_0019616_4229_5047 272
720 3300049459 Ga0495678_019461 Ga0495678_019461_666_1484 272
721 3300049459 Ga0495678_038298 Ga0495678_038298_592_1410 272
722 3300049568 Ga0501031_0003014 Ga0501031_0003014_3540_4367 272
723 3300049568 Ga0501031_0013828 Ga0501031_0013828_3209_4027 272
724 3300049569 Ga0501032_0007950 Ga0501032_0007950_6840_7667 272
725 3300049569 Ga0501032_0200303 Ga0501032_0200303_216_1037 272
726 3300049570 Ga0501033_0014832 Ga0501033_0014832_24_851 272
727 3300049570 Ga0501033_0156667 Ga0501033_0156667_419_1237 272
728 3300049571 Ga0501034_0033286 Ga0501034_0033286_821_1648 272
729 3300049571 Ga0501034_0067353 Ga0501034_0067353_305_1123 272
730 3300049572 Ga0501036_0015930 Ga0501036_0015930_3133_3951 272
731 3300049572 Ga0501036_0024001 Ga0501036_0024001_2520_3344 272
732 3300049572 Ga0501036_0399187 Ga0501036_0399187_241_1062 272
733 3300049573 Ga0501037_0020581 Ga0501037_0020581_225_1052 272
734 3300049574 Ga0501038_0029665 Ga0501038_0029665_3574_4401 272
735 3300049574 Ga0501038_0060578 Ga0501038_0060578_1219_2037 272
736 3300049574 Ga0501038_0111717 Ga0501038_0111717_1267_2085 272
737 3300049574 Ga0501038_0349409 Ga0501038_0349409_272_1096 272
738 3300049575 Ga0501039_0184153 Ga0501039_0184153_451_1278 272
739 3300049575 Ga0501039_0425894 Ga0501039_0425894_172_990 272
740 3300049575 Ga0501039_0473785 Ga0501039_0473785_21_857 272
741 3300049576 Ga0501040_0234747 Ga0501040_0234747_465_1289 272
742 3300049577 Ga0501041_0167395 Ga0501041_0167395_39_863 272
743 3300049578 Ga0501042_0035912 Ga0501042_0035912_71_895 272
744 3300049579 Ga0501043_0078041 Ga0501043_0078041_757_1575 272
745 3300049579 Ga0501043_0103588 Ga0501043_0103588_130_951 272
746 3300049579 Ga0501043_0216773 Ga0501043_0216773_491_1315 272
747 3300049581 Ga0501047_0028205 Ga0501047_0028205_4031_4849 272
748 3300049581 Ga0501047_0059714 Ga0501047_0059714_1827_2645 272
749 3300049581 Ga0501047_0133218 Ga0501047_0133218_250_1077 272
750 3300049582 Ga0501048_0168027 Ga0501048_0168027_548_1372 272
751 3300049586 Ga0501070_0030259 Ga0501070_0030259_2781_3608 272
752 3300049592 Ga0501076_0116514 Ga0501076_0116514_805_1629 272
753 3300049593 Ga0501077_0210446 Ga0501077_0210446_46_864 272
754 3300049682 Ga0501252_003607 Ga0501252_003607_662_1486 272
755 3300049741 Ga0501079_0094184 Ga0501079_0094184_1416_2240 272
756 3300049743 Ga0501081_0120948 Ga0501081_0120948_926_1744 272
757 3300049744 Ga0501083_0009958 Ga0501083_0009958_4416_5240 272
758 3300049822 Ga0501035_0027776 Ga0501035_0027776_1348_2166 272
759 3300049822 Ga0501035_0029853 Ga0501035_0029853_294_1121 272
760 3300049823 Ga0501044_0018297 Ga0501044_0018297_3363_4190 272
761 3300049823 Ga0501044_0023395 Ga0501044_0023395_3399_4217 272
762 3300049823 Ga0501044_0145259 Ga0501044_0145259_271_1089 272
763 3300049823 Ga0501044_0248416 Ga0501044_0248416_315_1136 272
764 3300049824 Ga0501045_0025760 Ga0501045_0025760_2911_3735 272
765 3300050489 nmdc:mga03683_66893_c1 nmdc:mga03683_66893_c1_159_977 272
766 3300050491 nmdc:mga00v17_173_c1 nmdc:mga00v17_173_c1_24613_25431 272
767 3300050491 nmdc:mga00v17_206253_c1 nmdc:mga00v17_206253_c1_11_829 272
768 3300050493 nmdc:mga0k408_23721_c1 nmdc:mga0k408_23721_c1_1801_2619 272
769 3300050509 nmdc:mga0qj67_39196_c1 nmdc:mga0qj67_39196_c1_2586_3413 272
770 3300050510 nmdc:mga06r32_20319_c1 nmdc:mga06r32_20319_c1_903_1730 272
771 3300050511 nmdc:mga08y16_562999_c1 nmdc:mga08y16_562999_c1_80_910 272
772 3300050512 nmdc:mga0n895_31431_c1 nmdc:mga0n895_31431_c1_2217_3035 272
773 3300053077 Ga0495601_0000002 Ga0495601_0000002_346809_347630 272
774 3300053077 Ga0495601_0158394 Ga0495601_0158394_83_907 272
775 3300053078 Ga0495612_0000012 Ga0495612_0000012_192911_193732 272
776 3300053084 Ga0495595_0000012 Ga0495595_0000012_151498_152319 272
777 3300053084 Ga0495595_0010272 Ga0495595_0010272_171_995 272
778 3300053085 Ga0495619_0000003 Ga0495619_0000003_35325_36146 272
779 3300053093 Ga0500651_0107014 Ga0500651_0107014_101_940 272
780 3300053103 Ga0500555_001333 Ga0500555_001333_2668_3492 272
781 3300053122 Ga0500608_059978 Ga0500608_059978_86_904 272
782 3300053122 Ga0500608_147995 Ga0500608_147995_67_909 272
783 3300053125 Ga0500618_001273 Ga0500618_001273_5011_5829 272
784 3300053134 Ga0500658_0001970 Ga0500658_0001970_222_1040 272
785 3300053136 Ga0500559_0005715 Ga0500559_0005715_1969_2787 272
786 3300053139 Ga0500568_0000004 Ga0500568_0000004_577026_577847 272
787 3300053139 Ga0500568_0007333 Ga0500568_0007333_739_1575 272
788 3300053151 Ga0500604_0002662 Ga0500604_0002662_1197_2033 272
789 3300053153 Ga0500616_0015761 Ga0500616_0015761_897_1715 272
790 3300053156 Ga0500622_0001477 Ga0500622_0001477_7054_7872 272
791 3300053177 Ga0500636_0012487 Ga0500636_0012487_3382_4224 272
792 3300053731 Ga0500609_000446 Ga0500609_000446_239_1075 272
793 3300054114 Ga0501084_0248976 Ga0501084_0248976_513_1337 272
794 3300060353 Ga0501082_0000656 Ga0501082_0000656_1500_2324 272
795 3300061719 Ga0466962_0110923 Ga0466962_0110923_114_938 272
796 iso_pu_bacteria 3003665799 3003670461 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

61

299

0.99

PF00106

adh_short

short chain dehydrogenase

58

250

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grk-assembly2.cif.gz_G crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis 0.9852 6 259
4eit-assembly2.cif.gz_F crystal structure of an enoyl-(acyl carrier protein) reductase from bartonella henselae 0.9833 6 262
4eit-assembly1.cif.gz_A crystal structure of an enoyl-(acyl carrier protein) reductase from bartonella henselae 0.9824 6 262
4eit-assembly1.cif.gz_B crystal structure of an enoyl-(acyl carrier protein) reductase from bartonella henselae 0.9818 4 261
3grk-assembly2.cif.gz_G crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis 0.9812 6 259
ID Description Score Start End Superfamily
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9859 6 259 3.40.50.720
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.982 6 259 3.40.50.720
2p91C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9695 8 259 3.40.50.720
2p91A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9676 6 259 3.40.50.720
af_P0AEK4_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9669 6 263 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4S0LJD8-F1-model_v4 deleted 0.9907 51 193
AF-A0A1E3GBS4-F1-model_v4 deleted 0.9863 8 258
AF-A0A363U0T3-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase FabI (EC 1.3.1.10) 0.9853 6 168 GO:0004318
GO:0006633
AF-A0A2U8BT02-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9848 8 263 GO:0004318
GO:0006633
AF-A0A357X796-F1-model_v4 deleted 0.9848 5 191

Feature Viewer

pLDDT pTM Quality
91.68 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map