F481190
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 796 | 393 | 791 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10020344|Ga0213876_100203443 |
| Length | 308 |
| Sequence | MLTDPGGASAPAAITSETTSIASPVALVPRGSASTTWRRFRRNRGAVIGLGIIAVYVAMALFANLLAPYDPLDGQLVLKLQPPSAAHWLGTDELGRDLLSRLLYGARSSLEIQVTAVAFSLCVGVVWGLVSGYFGGPLDEASMRVADVLLAFPSILLAISIVAILGNGLFSIVLAVGAVSVPQFARLVRGLVLGIRETDYVEAARAIGESHFSILSRYILPNTTAPIIVQTTLRMATVLLVASGLNFLGLGVVPPTPEWGSMLSNAREYMFQSIHVTLIPGLAITLVVIGFNLVGDGLRDALDPRMRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 2 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 3 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 4 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 138 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 139 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 140 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 239 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 254 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 255 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 256 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 257 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 258 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 259 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 260 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 261 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 375 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 378 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 379 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 381 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 382 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 383 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 384 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 387 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 388 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 390 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 393 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.37 |
| Metatranscriptomes | 0 |
| Isolates | 0.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.03 |
| Nodule | 0.13 |
| Rhizoplane | 3.77 |
| Rhizosphere | 86.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000204 | 3300001979 | Bacteria | 24594 |
| 2 | JGI24743J22301_10004626 | 3300001991 | Bacteria | 2254 |
| 3 | JGI24738J21930_10004260 | 3300002075 | Bacteria | 3523 |
| 4 | JGI25155J39150_1000023 | 3300002704 | Bacteria | 136961 |
| 5 | JGI25156J39149_1000029 | 3300002705 | Bacteria | 126505 |
| 6 | JGI25156J39149_1000094 | 3300002705 | Bacteria | 65145 |
| 7 | JGI25162J39368_1000587 | 3300002737 | Bacteria | 26590 |
| 8 | JGI25162J39368_1001199 | 3300002737 | Bacteria | 15163 |
| 9 | JGI25154J39366_1000067 | 3300002738 | Bacteria | 100452 |
| 10 | JGI25157J39369_1000043 | 3300002741 | Bacteria | 122537 |
| 11 | JGI25159J45721_1007086 | 3300002987 | Bacteria | 3263 |
| 12 | JGI25406J46586_10036843 | 3300003203 | Bacteria | 1771 |
| 13 | JGI25406J46586_10061084 | 3300003203 | Bacteria | 1217 |
| 14 | JGI25165J46597_1000341 | 3300003214 | Bacteria | 53973 |
| 15 | JGI25165J46597_1000736 | 3300003214 | Bacteria | 25593 |
| 16 | JGI25153J46596_10000156 | 3300003215 | Bacteria | 68489 |
| 17 | JGI25153J46596_10001297 | 3300003215 | Bacteria | 14964 |
| 18 | rootL2_10045651 | 3300003322 | Bacteria | 7783 |
| 19 | rootH1_10014150 | 3300003323 | Bacteria | 1490 |
| 20 | JGI25160J50197_1000046 | 3300003354 | Bacteria | 141352 |
| 21 | JGI25161J50226_1000031 | 3300003374 | Bacteria | 141352 |
| 22 | Ga0055543_1000008 | 3300004625 | Bacteria | 202062 |
| 23 | Ga0065165_1000336 | 3300005262 | Bacteria | 76934 |
| 24 | Ga0065715_10110124 | 3300005293 | Bacteria | 2635 |
| 25 | Ga0070658_10020740 | 3300005327 | Bacteria | 5265 |
| 26 | Ga0070658_10039894 | 3300005327 | Bacteria | 3788 |
| 27 | Ga0070658_10313008 | 3300005327 | Bacteria | 1340 |
| 28 | Ga0070683_100009813 | 3300005329 | Bacteria | 8203 |
| 29 | Ga0070683_100129967 | 3300005329 | Bacteria | 2383 |
| 30 | Ga0070683_100153607 | 3300005329 | Bacteria | 2182 |
| 31 | Ga0070690_100001347 | 3300005330 | Bacteria | 12768 |
| 32 | Ga0070670_100043042 | 3300005331 | Bacteria | 3883 |
| 33 | Ga0068869_100040311 | 3300005334 | Bacteria | 3339 |
| 34 | Ga0068869_100096304 | 3300005334 | Bacteria | 2233 |
| 35 | Ga0070666_10012643 | 3300005335 | Bacteria | 5332 |
| 36 | Ga0070682_100028510 | 3300005337 | Bacteria | 3358 |
| 37 | Ga0068868_100000669 | 3300005338 | Bacteria | 23003 |
| 38 | Ga0068868_100043148 | 3300005338 | Bacteria | 3522 |
| 39 | Ga0068868_100069325 | 3300005338 | Bacteria | 2810 |
| 40 | Ga0070660_100005700 | 3300005339 | Bacteria | 8630 |
| 41 | Ga0070689_100003750 | 3300005340 | Bacteria | 10171 |
| 42 | Ga0070691_10016189 | 3300005341 | Bacteria | 3425 |
| 43 | Ga0070687_100075695 | 3300005343 | Bacteria | 1821 |
| 44 | Ga0070687_100167740 | 3300005343 | Bacteria | 1304 |
| 45 | Ga0070661_100026778 | 3300005344 | Bacteria | 4149 |
| 46 | Ga0070661_100033844 | 3300005344 | Bacteria | 3704 |
| 47 | Ga0070692_10014580 | 3300005345 | Bacteria | 3697 |
| 48 | Ga0070692_10106324 | 3300005345 | Bacteria | 1546 |
| 49 | Ga0070668_100054343 | 3300005347 | Bacteria | 3089 |
| 50 | Ga0070675_100021763 | 3300005354 | Bacteria | 5122 |
| 51 | Ga0070675_100073527 | 3300005354 | Bacteria | 2838 |
| 52 | Ga0070675_100258171 | 3300005354 | Bacteria | 1526 |
| 53 | Ga0070675_100370959 | 3300005354 | Bacteria | 1272 |
| 54 | Ga0070671_100018593 | 3300005355 | Bacteria | 5646 |
| 55 | Ga0070674_100109701 | 3300005356 | Bacteria | 2024 |
| 56 | Ga0070673_100002342 | 3300005364 | Bacteria | 11514 |
| 57 | Ga0070673_100018676 | 3300005364 | Bacteria | 4960 |
| 58 | Ga0070688_100019491 | 3300005365 | Bacteria | 3931 |
| 59 | Ga0070688_100081964 | 3300005365 | Bacteria | 2090 |
| 60 | Ga0070659_100055975 | 3300005366 | Bacteria | 3109 |
| 61 | Ga0070667_100026883 | 3300005367 | Bacteria | 4788 |
| 62 | Ga0070667_100038389 | 3300005367 | Bacteria | 4014 |
| 63 | Ga0070709_10115790 | 3300005434 | Bacteria | 1808 |
| 64 | Ga0070713_100000036 | 3300005436 | Bacteria | 85712 |
| 65 | Ga0070713_100050023 | 3300005436 | Bacteria | 3450 |
| 66 | Ga0070711_100028417 | 3300005439 | Bacteria | 3680 |
| 67 | Ga0070705_100060963 | 3300005440 | Bacteria | 2240 |
| 68 | Ga0070700_100092879 | 3300005441 | Bacteria | 1973 |
| 69 | Ga0070700_100246084 | 3300005441 | Bacteria | 1280 |
| 70 | Ga0070694_100009080 | 3300005444 | Bacteria | 6096 |
| 71 | Ga0070708_100036594 | 3300005445 | Bacteria | 4281 |
| 72 | Ga0070708_100183921 | 3300005445 | Bacteria | 1954 |
| 73 | Ga0070708_100294083 | 3300005445 | Bacteria | 1529 |
| 74 | Ga0070663_100054465 | 3300005455 | Bacteria | 2859 |
| 75 | Ga0070678_100085124 | 3300005456 | Bacteria | 2408 |
| 76 | Ga0070678_100089113 | 3300005456 | Bacteria | 2361 |
| 77 | Ga0070662_100038551 | 3300005457 | Bacteria | 3395 |
| 78 | Ga0070662_100212076 | 3300005457 | Bacteria | 1541 |
| 79 | Ga0070681_10112325 | 3300005458 | Bacteria | 2664 |
| 80 | Ga0070681_10292201 | 3300005458 | Bacteria | 1540 |
| 81 | Ga0068867_100040031 | 3300005459 | Bacteria | 3419 |
| 82 | Ga0070685_10003867 | 3300005466 | Bacteria | 7579 |
| 83 | Ga0070706_100085393 | 3300005467 | Bacteria | 2925 |
| 84 | Ga0070706_100094120 | 3300005467 | Bacteria | 2780 |
| 85 | Ga0070707_100036625 | 3300005468 | Bacteria | 4682 |
| 86 | Ga0070707_100080325 | 3300005468 | Bacteria | 3147 |
| 87 | Ga0070707_100096428 | 3300005468 | Bacteria | 2864 |
| 88 | Ga0070707_100225521 | 3300005468 | Bacteria | 1825 |
| 89 | Ga0070707_100258449 | 3300005468 | Bacteria | 1694 |
| 90 | Ga0070707_100315862 | 3300005468 | Bacteria | 1518 |
| 91 | Ga0070707_100496225 | 3300005468 | Bacteria | 1182 |
| 92 | Ga0070698_100021151 | 3300005471 | Bacteria | 6816 |
| 93 | Ga0070698_100036486 | 3300005471 | Bacteria | 5077 |
| 94 | Ga0070698_100106581 | 3300005471 | Bacteria | 2771 |
| 95 | Ga0070698_100151996 | 3300005471 | Bacteria | 2262 |
| 96 | Ga0070699_100025033 | 3300005518 | Bacteria | 5146 |
| 97 | Ga0070699_100054379 | 3300005518 | Bacteria | 3465 |
| 98 | Ga0070679_100273763 | 3300005530 | Bacteria | 1642 |
| 99 | Ga0070684_100010496 | 3300005535 | Bacteria | 7339 |
| 100 | Ga0070684_100331425 | 3300005535 | Bacteria | 1399 |
| 101 | Ga0070684_100404710 | 3300005535 | Bacteria | 1258 |
| 102 | Ga0070697_100001084 | 3300005536 | Bacteria | 20576 |
| 103 | Ga0070697_100025425 | 3300005536 | Bacteria | 4723 |
| 104 | Ga0070697_100062748 | 3300005536 | Bacteria | 3033 |
| 105 | Ga0068853_100031620 | 3300005539 | Bacteria | 4477 |
| 106 | Ga0068853_100054451 | 3300005539 | Bacteria | 3448 |
| 107 | Ga0070672_100042335 | 3300005543 | Bacteria | 3506 |
| 108 | Ga0070686_100110246 | 3300005544 | Bacteria | 1874 |
| 109 | Ga0070686_100197939 | 3300005544 | Bacteria | 1438 |
| 110 | Ga0070693_100010955 | 3300005547 | Bacteria | 4557 |
| 111 | Ga0070693_100093523 | 3300005547 | Bacteria | 1817 |
| 112 | Ga0070665_100016632 | 3300005548 | Bacteria | 7372 |
| 113 | Ga0070665_100565817 | 3300005548 | Bacteria | 1149 |
| 114 | Ga0070704_100007424 | 3300005549 | Bacteria | 6529 |
| 115 | Ga0070704_100042576 | 3300005549 | Bacteria | 3142 |
| 116 | Ga0068855_100187365 | 3300005563 | Bacteria | 2336 |
| 117 | Ga0070664_100094432 | 3300005564 | Bacteria | 2593 |
| 118 | Ga0068857_100013049 | 3300005577 | Bacteria | 7238 |
| 119 | Ga0068854_100044994 | 3300005578 | Bacteria | 3136 |
| 120 | Ga0068856_100289279 | 3300005614 | Bacteria | 1655 |
| 121 | Ga0070702_100139704 | 3300005615 | Bacteria | 1541 |
| 122 | Ga0070702_100187347 | 3300005615 | Bacteria | 1359 |
| 123 | Ga0068852_100491542 | 3300005616 | Bacteria | 1221 |
| 124 | Ga0068859_100052600 | 3300005617 | Bacteria | 4094 |
| 125 | Ga0068859_100053441 | 3300005617 | Bacteria | 4063 |
| 126 | Ga0068864_100035018 | 3300005618 | Bacteria | 4272 |
| 127 | Ga0068866_10001490 | 3300005718 | Bacteria | 9968 |
| 128 | Ga0068866_10021578 | 3300005718 | Bacteria | 2968 |
| 129 | Ga0068861_100006306 | 3300005719 | Bacteria | 8074 |
| 130 | Ga0068863_100029706 | 3300005841 | Bacteria | 5219 |
| 131 | Ga0068858_100247312 | 3300005842 | Bacteria | 1693 |
| 132 | Ga0068860_100036412 | 3300005843 | Bacteria | 4715 |
| 133 | Ga0068862_100004772 | 3300005844 | Bacteria | 11408 |
| 134 | Ga0081455_10022903 | 3300005937 | Bacteria | 5824 |
| 135 | Ga0081455_10049099 | 3300005937 | Bacteria | 3640 |
| 136 | Ga0081538_10098811 | 3300005981 | Bacteria | 1477 |
| 137 | Ga0081540_1018683 | 3300005983 | Bacteria | 4243 |
| 138 | Ga0081539_10000977 | 3300005985 | Bacteria | 53347 |
| 139 | Ga0081539_10003664 | 3300005985 | Bacteria | 18487 |
| 140 | Ga0081539_10027690 | 3300005985 | Bacteria | 3583 |
| 141 | Ga0081539_10071160 | 3300005985 | Bacteria | 1864 |
| 142 | Ga0081539_10126197 | 3300005985 | Bacteria | 1264 |
| 143 | Ga0075365_10000130 | 3300006038 | Bacteria | 23021 |
| 144 | Ga0075363_100056935 | 3300006048 | Bacteria | 2097 |
| 145 | Ga0075432_10000854 | 3300006058 | Bacteria | 9586 |
| 146 | Ga0075432_10015501 | 3300006058 | Bacteria | 2599 |
| 147 | Ga0070715_10024930 | 3300006163 | Bacteria | 2364 |
| 148 | Ga0070715_10152427 | 3300006163 | Bacteria | 1134 |
| 149 | Ga0070712_100121253 | 3300006175 | Bacteria | 1967 |
| 150 | Ga0070712_100368939 | 3300006175 | Bacteria | 1179 |
| 151 | Ga0075362_10016131 | 3300006177 | Bacteria | 3054 |
| 152 | Ga0075367_10000511 | 3300006178 | Bacteria | 14626 |
| 153 | Ga0075369_10000560 | 3300006186 | Bacteria | 11734 |
| 154 | Ga0097621_100073500 | 3300006237 | Bacteria | 2830 |
| 155 | Ga0097621_100195092 | 3300006237 | Bacteria | 1755 |
| 156 | Ga0068871_100042611 | 3300006358 | Bacteria | 3645 |
| 157 | Ga0068871_100051187 | 3300006358 | Bacteria | 3343 |
| 158 | Ga0068871_100086639 | 3300006358 | Bacteria | 2602 |
| 159 | Ga0068871_100273574 | 3300006358 | Bacteria | 1476 |
| 160 | Ga0075428_100023025 | 3300006844 | Bacteria | 6894 |
| 161 | Ga0075428_100230313 | 3300006844 | Bacteria | 1999 |
| 162 | Ga0075430_100075051 | 3300006846 | Bacteria | 2835 |
| 163 | Ga0075431_100012616 | 3300006847 | Bacteria | 8531 |
| 164 | Ga0075431_100029626 | 3300006847 | Bacteria | 5636 |
| 165 | Ga0075431_100171554 | 3300006847 | Bacteria | 2228 |
| 166 | Ga0075431_100278718 | 3300006847 | Bacteria | 1693 |
| 167 | Ga0075431_100598722 | 3300006847 | Bacteria | 1086 |
| 168 | Ga0075433_10002380 | 3300006852 | Bacteria | 14292 |
| 169 | Ga0075433_10083595 | 3300006852 | Bacteria | 2818 |
| 170 | Ga0075433_10272201 | 3300006852 | Bacteria | 1501 |
| 171 | Ga0075434_100002270 | 3300006871 | Bacteria | 16813 |
| 172 | Ga0075434_100012752 | 3300006871 | Bacteria | 7978 |
| 173 | Ga0075434_100015902 | 3300006871 | Bacteria | 7226 |
| 174 | Ga0075434_100360142 | 3300006871 | Bacteria | 1476 |
| 175 | Ga0068865_100025852 | 3300006881 | Bacteria | 3866 |
| 176 | Ga0075436_100112983 | 3300006914 | Bacteria | 1897 |
| 177 | Ga0097620_100052599 | 3300006931 | Bacteria | 4094 |
| 178 | Ga0097620_100053439 | 3300006931 | Bacteria | 4063 |
| 179 | Ga0075435_100079873 | 3300007076 | Bacteria | 2685 |
| 180 | Ga0075435_100281523 | 3300007076 | Bacteria | 1420 |
| 181 | Ga0099794_10002875 | 3300007265 | Bacteria | 6461 |
| 182 | Ga0105240_10290719 | 3300009093 | Bacteria | 1874 |
| 183 | Ga0111539_10009437 | 3300009094 | Bacteria | 12313 |
| 184 | Ga0111539_10038039 | 3300009094 | Bacteria | 5804 |
| 185 | Ga0111539_10065086 | 3300009094 | Bacteria | 4310 |
| 186 | Ga0105245_10004428 | 3300009098 | Bacteria | 12428 |
| 187 | Ga0105245_10030005 | 3300009098 | Bacteria | 4808 |
| 188 | Ga0105247_10011633 | 3300009101 | Bacteria | 5301 |
| 189 | Ga0114129_10010122 | 3300009147 | Bacteria | 13443 |
| 190 | Ga0114129_10012145 | 3300009147 | Bacteria | 12262 |
| 191 | Ga0114129_10029708 | 3300009147 | Bacteria | 7739 |
| 192 | Ga0114129_10057876 | 3300009147 | Bacteria | 5423 |
| 193 | Ga0114129_10136284 | 3300009147 | Bacteria | 3368 |
| 194 | Ga0114129_10941376 | 3300009147 | Bacteria | 1092 |
| 195 | Ga0105243_10071310 | 3300009148 | Bacteria | 2809 |
| 196 | Ga0105243_10107201 | 3300009148 | Bacteria | 2330 |
| 197 | Ga0105242_10079910 | 3300009176 | Bacteria | 2732 |
| 198 | Ga0105248_10514000 | 3300009177 | Bacteria | 1350 |
| 199 | Ga0105237_10292414 | 3300009545 | Bacteria | 1632 |
| 200 | Ga0105238_10017601 | 3300009551 | Bacteria | 7264 |
| 201 | Ga0105238_10063471 | 3300009551 | Bacteria | 3694 |
| 202 | Ga0105238_10444174 | 3300009551 | Bacteria | 1293 |
| 203 | Ga0105249_10029668 | 3300009553 | Bacteria | 4940 |
| 204 | Ga0105249_10145392 | 3300009553 | Bacteria | 2277 |
| 205 | Ga0123342_1003902 | 3300009766 | Bacteria | 23396 |
| 206 | Ga0105239_10074705 | 3300010375 | Bacteria | 3726 |
| 207 | Ga0105239_10127648 | 3300010375 | Bacteria | 2827 |
| 208 | Ga0105246_10465977 | 3300011119 | Bacteria | 1065 |
| 209 | Ga0157373_10016259 | 3300013100 | Bacteria | 5430 |
| 210 | Ga0157371_10011550 | 3300013102 | Bacteria | 6791 |
| 211 | Ga0157371_10292843 | 3300013102 | Bacteria | 1177 |
| 212 | Ga0157369_10578062 | 3300013105 | Bacteria | 1160 |
| 213 | Ga0157374_10001150 | 3300013296 | Bacteria | 22525 |
| 214 | Ga0157378_10049462 | 3300013297 | Bacteria | 3740 |
| 215 | Ga0163162_10085182 | 3300013306 | Bacteria | 3237 |
| 216 | Ga0157372_10063768 | 3300013307 | Bacteria | 4133 |
| 217 | Ga0157372_10502152 | 3300013307 | Bacteria | 1414 |
| 218 | Ga0157375_10001887 | 3300013308 | Bacteria | 18022 |
| 219 | Ga0157375_10038171 | 3300013308 | Bacteria | 4610 |
| 220 | Ga0157375_10437285 | 3300013308 | Bacteria | 1474 |
| 221 | Ga0163163_10337282 | 3300014325 | Bacteria | 1562 |
| 222 | Ga0157377_10017469 | 3300014745 | Bacteria | 3710 |
| 223 | Ga0157377_10023180 | 3300014745 | Bacteria | 3288 |
| 224 | Ga0157377_10038837 | 3300014745 | Bacteria | 2630 |
| 225 | Ga0157379_10025961 | 3300014968 | Bacteria | 5209 |
| 226 | Ga0157379_10158099 | 3300014968 | Bacteria | 2045 |
| 227 | Ga0157376_10028053 | 3300014969 | Bacteria | 4471 |
| 228 | Ga0157376_10104162 | 3300014969 | Bacteria | 2486 |
| 229 | Ga0213872_10050912 | 3300021361 | Bacteria | 1880 |
| 230 | Ga0213876_10020344 | 3300021384 | Bacteria | 3507 |
| 231 | Ga0213871_10008183 | 3300021441 | Bacteria | 2295 |
| 232 | Ga0209435_100011 | 3300025206 | Bacteria | 413027 |
| 233 | Ga0209437_100036 | 3300025233 | Bacteria | 469153 |
| 234 | Ga0209437_100086 | 3300025233 | Bacteria | 254578 |
| 235 | Ga0209646_1000024 | 3300025246 | Bacteria | 413027 |
| 236 | Ga0209026_1000030 | 3300025250 | Bacteria | 329811 |
| 237 | Ga0209148_1010860 | 3300025254 | Bacteria | 1711 |
| 238 | Ga0209759_1000011 | 3300025256 | Bacteria | 413027 |
| 239 | Ga0209233_1000166 | 3300025261 | Bacteria | 152270 |
| 240 | Ga0209233_1000465 | 3300025261 | Bacteria | 25645 |
| 241 | Ga0209130_1000088 | 3300025284 | Bacteria | 152927 |
| 242 | Ga0209758_1000119 | 3300025297 | Bacteria | 195545 |
| 243 | Ga0209050_1007002 | 3300025298 | Bacteria | 6484 |
| 244 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 245 | Ga0207426_1019449 | 3300025302 | Bacteria | 2373 |
| 246 | Ga0209051_1028456 | 3300025303 | Bacteria | 2207 |
| 247 | Ga0209257_1000562 | 3300025304 | Bacteria | 63202 |
| 248 | Ga0207656_10019302 | 3300025321 | Bacteria | 2696 |
| 249 | Ga0207642_10025587 | 3300025899 | Bacteria | 2390 |
| 250 | Ga0207688_10002539 | 3300025901 | Bacteria | 9854 |
| 251 | Ga0207688_10027800 | 3300025901 | Bacteria | 3111 |
| 252 | Ga0207680_10030975 | 3300025903 | Bacteria | 3025 |
| 253 | Ga0207699_10101575 | 3300025906 | Bacteria | 1826 |
| 254 | Ga0207645_10014930 | 3300025907 | Bacteria | 5178 |
| 255 | Ga0207645_10064195 | 3300025907 | Bacteria | 2346 |
| 256 | Ga0207643_10018189 | 3300025908 | Bacteria | 3849 |
| 257 | Ga0207705_10051097 | 3300025909 | Bacteria | 2976 |
| 258 | Ga0207684_10009022 | 3300025910 | Bacteria | 8839 |
| 259 | Ga0207684_10011036 | 3300025910 | Bacteria | 7914 |
| 260 | Ga0207684_10013657 | 3300025910 | Bacteria | 7016 |
| 261 | Ga0207684_10125841 | 3300025910 | Bacteria | 2199 |
| 262 | Ga0207684_10292974 | 3300025910 | Bacteria | 1403 |
| 263 | Ga0207684_10299998 | 3300025910 | Bacteria | 1385 |
| 264 | Ga0207684_10360300 | 3300025910 | Bacteria | 1251 |
| 265 | Ga0207707_10442111 | 3300025912 | Unclassified | 1113 |
| 266 | Ga0207695_10332327 | 3300025913 | Bacteria | 1408 |
| 267 | Ga0207693_10012669 | 3300025915 | Bacteria | 6810 |
| 268 | Ga0207693_10015531 | 3300025915 | Bacteria | 6109 |
| 269 | Ga0207662_10031121 | 3300025918 | Bacteria | 3100 |
| 270 | Ga0207657_10002490 | 3300025919 | Bacteria | 19913 |
| 271 | Ga0207652_10265262 | 3300025921 | Bacteria | 1549 |
| 272 | Ga0207646_10003155 | 3300025922 | Bacteria | 18879 |
| 273 | Ga0207646_10036457 | 3300025922 | Bacteria | 4439 |
| 274 | Ga0207646_10037854 | 3300025922 | Bacteria | 4347 |
| 275 | Ga0207646_10047624 | 3300025922 | Bacteria | 3845 |
| 276 | Ga0207646_10059172 | 3300025922 | Bacteria | 3422 |
| 277 | Ga0207646_10093658 | 3300025922 | Bacteria | 2690 |
| 278 | Ga0207646_10109980 | 3300025922 | Bacteria | 2473 |
| 279 | Ga0207646_10245154 | 3300025922 | Bacteria | 1618 |
| 280 | Ga0207681_10222444 | 3300025923 | Bacteria | 1461 |
| 281 | Ga0207694_10011943 | 3300025924 | Bacteria | 6547 |
| 282 | Ga0207650_10035282 | 3300025925 | Bacteria | 3630 |
| 283 | Ga0207650_10061325 | 3300025925 | Bacteria | 2808 |
| 284 | Ga0207659_10096303 | 3300025926 | Bacteria | 2221 |
| 285 | Ga0207659_10139981 | 3300025926 | Bacteria | 1877 |
| 286 | Ga0207659_10242435 | 3300025926 | Bacteria | 1459 |
| 287 | Ga0207687_10000492 | 3300025927 | Bacteria | 26647 |
| 288 | Ga0207687_10007965 | 3300025927 | Bacteria | 6936 |
| 289 | Ga0207687_10078826 | 3300025927 | Bacteria | 2373 |
| 290 | Ga0207687_10208828 | 3300025927 | Bacteria | 1531 |
| 291 | Ga0207700_10000098 | 3300025928 | Bacteria | 53371 |
| 292 | Ga0207700_10113101 | 3300025928 | Bacteria | 2188 |
| 293 | Ga0207644_10011954 | 3300025931 | Bacteria | 5756 |
| 294 | Ga0207644_10150226 | 3300025931 | Bacteria | 1802 |
| 295 | Ga0207690_10035464 | 3300025932 | Bacteria | 3222 |
| 296 | Ga0207706_10022001 | 3300025933 | Bacteria | 5723 |
| 297 | Ga0207686_10006732 | 3300025934 | Bacteria | 6190 |
| 298 | Ga0207686_10163666 | 3300025934 | Bacteria | 1562 |
| 299 | Ga0207709_10032353 | 3300025935 | Bacteria | 3062 |
| 300 | Ga0207709_10053080 | 3300025935 | Bacteria | 2493 |
| 301 | Ga0207709_10226263 | 3300025935 | Bacteria | 1352 |
| 302 | Ga0207670_10007955 | 3300025936 | Bacteria | 5955 |
| 303 | Ga0207669_10012998 | 3300025937 | Bacteria | 4117 |
| 304 | Ga0207669_10277156 | 3300025937 | Bacteria | 1263 |
| 305 | Ga0207704_10021981 | 3300025938 | Bacteria | 3409 |
| 306 | Ga0207704_10256863 | 3300025938 | Bacteria | 1315 |
| 307 | Ga0207665_10012130 | 3300025939 | Bacteria | 5656 |
| 308 | Ga0207691_10033166 | 3300025940 | Bacteria | 4809 |
| 309 | Ga0207691_10069787 | 3300025940 | Bacteria | 3174 |
| 310 | Ga0207711_10000323 | 3300025941 | Bacteria | 51404 |
| 311 | Ga0207689_10038040 | 3300025942 | Bacteria | 3987 |
| 312 | Ga0207661_10052167 | 3300025944 | Bacteria | 3266 |
| 313 | Ga0207661_10052715 | 3300025944 | Bacteria | 3251 |
| 314 | Ga0207679_10134058 | 3300025945 | Bacteria | 1991 |
| 315 | Ga0207679_10149599 | 3300025945 | Bacteria | 1898 |
| 316 | Ga0207667_10255036 | 3300025949 | Bacteria | 1794 |
| 317 | Ga0207651_10002690 | 3300025960 | Bacteria | 8510 |
| 318 | Ga0207651_10034092 | 3300025960 | Bacteria | 3292 |
| 319 | Ga0207640_10029429 | 3300025981 | Bacteria | 3371 |
| 320 | Ga0207640_10367500 | 3300025981 | Bacteria | 1161 |
| 321 | Ga0207658_10011876 | 3300025986 | Bacteria | 5936 |
| 322 | Ga0207658_10027377 | 3300025986 | Bacteria | 4004 |
| 323 | Ga0207677_10000457 | 3300026023 | Bacteria | 27426 |
| 324 | Ga0207677_10008588 | 3300026023 | Bacteria | 5716 |
| 325 | Ga0207677_10034416 | 3300026023 | Bacteria | 3280 |
| 326 | Ga0207677_10048876 | 3300026023 | Bacteria | 2850 |
| 327 | Ga0207703_10005665 | 3300026035 | Bacteria | 10030 |
| 328 | Ga0207639_10081289 | 3300026041 | Bacteria | 2566 |
| 329 | Ga0207639_10262055 | 3300026041 | Bacteria | 1512 |
| 330 | Ga0207678_10026970 | 3300026067 | Bacteria | 5010 |
| 331 | Ga0207708_10039834 | 3300026075 | Bacteria | 3581 |
| 332 | Ga0207708_10048709 | 3300026075 | Bacteria | 3226 |
| 333 | Ga0207708_10083849 | 3300026075 | Bacteria | 2450 |
| 334 | Ga0207702_10099356 | 3300026078 | Bacteria | 2565 |
| 335 | Ga0207702_10143054 | 3300026078 | Bacteria | 2167 |
| 336 | Ga0207641_10025247 | 3300026088 | Bacteria | 4900 |
| 337 | Ga0207648_10073677 | 3300026089 | Bacteria | 2976 |
| 338 | Ga0207648_10148672 | 3300026089 | Bacteria | 2067 |
| 339 | Ga0207676_10000704 | 3300026095 | Bacteria | 26333 |
| 340 | Ga0207674_10020614 | 3300026116 | Bacteria | 7117 |
| 341 | Ga0207674_10089188 | 3300026116 | Bacteria | 3076 |
| 342 | Ga0207675_100011563 | 3300026118 | Bacteria | 8254 |
| 343 | Ga0207683_10021675 | 3300026121 | Bacteria | 5506 |
| 344 | Ga0207683_10108070 | 3300026121 | Bacteria | 2489 |
| 345 | Ga0207683_10181390 | 3300026121 | Bacteria | 1909 |
| 346 | Ga0207698_10027960 | 3300026142 | Bacteria | 4013 |
| 347 | Ga0207698_10064662 | 3300026142 | Bacteria | 2868 |
| 348 | Ga0207698_10410288 | 3300026142 | Bacteria | 1297 |
| 349 | Ga0209588_1004368 | 3300027671 | Bacteria | 3982 |
| 350 | Ga0207428_10002320 | 3300027907 | Bacteria | 19050 |
| 351 | Ga0207428_10018781 | 3300027907 | Bacteria | 5899 |
| 352 | Ga0207428_10104395 | 3300027907 | Bacteria | 2187 |
| 353 | Ga0268266_10167571 | 3300028379 | Bacteria | 1991 |
| 354 | Ga0268266_10543283 | 3300028379 | Bacteria | 1113 |
| 355 | Ga0268265_10004310 | 3300028380 | Bacteria | 9919 |
| 356 | Ga0268264_10005778 | 3300028381 | Bacteria | 10490 |
| 357 | Ga0268264_10285602 | 3300028381 | Bacteria | 1548 |
| 358 | Ga0268264_10347628 | 3300028381 | Bacteria | 1410 |
| 359 | Ga0307515_10266394 | 3300028794 | Bacteria | 1441 |
| 360 | Ga0265330_10050509 | 3300031235 | Bacteria | 1824 |
| 361 | Ga0265328_10043977 | 3300031239 | Bacteria | 1643 |
| 362 | Ga0265340_10079294 | 3300031247 | Bacteria | 1548 |
| 363 | Ga0265327_10074678 | 3300031251 | Bacteria | 1688 |
| 364 | Ga0265316_10034575 | 3300031344 | Bacteria | 4104 |
| 365 | Ga0307408_100233817 | 3300031548 | Bacteria | 1507 |
| 366 | Ga0265314_10048196 | 3300031711 | Bacteria | 2992 |
| 367 | Ga0265314_10080258 | 3300031711 | Bacteria | 2154 |
| 368 | Ga0265342_10051659 | 3300031712 | Bacteria | 2452 |
| 369 | Ga0307405_10475755 | 3300031731 | Bacteria | 996 |
| 370 | Ga0307413_10102061 | 3300031824 | Bacteria | 1898 |
| 371 | Ga0307410_10100712 | 3300031852 | Bacteria | 2070 |
| 372 | Ga0307410_10154128 | 3300031852 | Bacteria | 1714 |
| 373 | Ga0307410_10198896 | 3300031852 | Bacteria | 1529 |
| 374 | Ga0307406_10301164 | 3300031901 | Bacteria | 1232 |
| 375 | Ga0307406_10381919 | 3300031901 | Bacteria | 1111 |
| 376 | Ga0307409_100157590 | 3300031995 | Bacteria | 1981 |
| 377 | Ga0307409_100434292 | 3300031995 | Bacteria | 1263 |
| 378 | Ga0307416_100022715 | 3300032002 | Bacteria | 4535 |
| 379 | Ga0307416_100227590 | 3300032002 | Bacteria | 1795 |
| 380 | Ga0307414_10082633 | 3300032004 | Bacteria | 2356 |
| 381 | Ga0307411_10053923 | 3300032005 | Bacteria | 2637 |
| 382 | Ga0307415_100303186 | 3300032126 | Bacteria | 1324 |
| 383 | Ga0307415_100338116 | 3300032126 | Bacteria | 1262 |
| 384 | Ga0373948_0006165 | 3300034817 | Bacteria | 1973 |
| 385 | Ga0373958_0008572 | 3300034819 | Bacteria | 1661 |
| 386 | Ga0373934_0019550 | 3300035086 | Bacteria | 2601 |
| 387 | Ga0373944_0014893 | 3300035089 | Bacteria | 2176 |
| 388 | Ga0373939_0002495 | 3300035114 | Bacteria | 4337 |
| 389 | Ga0373945_0011628 | 3300035116 | Bacteria | 2912 |
| 390 | Ga0373945_0026139 | 3300035116 | Bacteria | 2033 |
| 391 | Ga0373953_0029257 | 3300035117 | Bacteria | 2129 |
| 392 | Ga0373954_0014406 | 3300035118 | Bacteria | 3525 |
| 393 | Ga0373954_0047352 | 3300035118 | Bacteria | 2012 |
| 394 | Ga0373956_0017966 | 3300035119 | Bacteria | 2990 |
| 395 | Ga0373956_0058894 | 3300035119 | Bacteria | 1737 |
| 396 | Ga0373957_0022350 | 3300035120 | Bacteria | 2253 |
| 397 | Ga0373960_0009426 | 3300035121 | Bacteria | 2364 |
| 398 | Ga0373943_0017068 | 3300035170 | Bacteria | 3319 |
| 399 | Ga0373955_0014540 | 3300035172 | Bacteria | 3831 |
| 400 | Ga0373955_0035471 | 3300035172 | Bacteria | 2642 |
| 401 | Ga0373924_0039681 | 3300035410 | Bacteria | 1924 |
| 402 | Ga0373931_0026999 | 3300035691 | Bacteria | 2927 |
| 403 | Ga0373935_0029554 | 3300035692 | Bacteria | 3392 |
| 404 | Ga0373927_0006704 | 3300035695 | Bacteria | 7834 |
| 405 | Ga0373927_0011563 | 3300035695 | Bacteria | 5880 |
| 406 | Ga0373927_0013114 | 3300035695 | Bacteria | 5512 |
| 407 | Ga0373933_0027325 | 3300035724 | Bacteria | 3285 |
| 408 | Ga0373947_0019642 | 3300035725 | Bacteria | 3897 |
| 409 | Ga0373937_0032263 | 3300036401 | Bacteria | 4750 |
| 410 | Ga0373937_0051695 | 3300036401 | Bacteria | 3766 |
| 411 | Ga0373925_0012185 | 3300037068 | Bacteria | 6224 |
| 412 | Ga0373925_0035772 | 3300037068 | Bacteria | 3666 |
| 413 | Ga0395905_0008475 | 3300037471 | Bacteria | 10138 |
| 414 | Ga0395901_0156856 | 3300038443 | Bacteria | 2391 |
| 415 | Ga0436365_0199037 | 3300039437 | Bacteria | 29795 |
| 416 | Ga0436360_0631597 | 3300039438 | Bacteria | 3145 |
| 417 | Ga0436361_0319848 | 3300039447 | Bacteria | 3815 |
| 418 | Ga0436363_0406837 | 3300039450 | Bacteria | 1493 |
| 419 | Ga0436363_1110042 | 3300039450 | Bacteria | 1908 |
| 420 | Ga0436363_1421802 | 3300039450 | Bacteria | 1019 |
| 421 | Ga0436362_0332095 | 3300039453 | Bacteria | 4525 |
| 422 | Ga0436362_0650647 | 3300039453 | Bacteria | 1721 |
| 423 | Ga0451843_0035460 | 3300041509 | Bacteria | 1226 |
| 424 | Ga0450911_000174 | 3300042115 | Bacteria | 25375 |
| 425 | Ga0439460_0040007 | 3300042461 | Bacteria | 1372 |
| 426 | Ga0451577_0052996 | 3300042876 | Bacteria | 3622 |
| 427 | Ga0453683_0026353 | 3300044673 | Bacteria | 3691 |
| 428 | Ga0466966_0113944 | 3300044684 | Bacteria | 1665 |
| 429 | Ga0466963_0296361 | 3300044694 | Bacteria | 1137 |
| 430 | Ga0453684_0007326 | 3300044712 | Bacteria | 20394 |
| 431 | Ga0466971_0087081 | 3300044719 | Bacteria | 1428 |
| 432 | Ga0466959_0024348 | 3300045049 | Bacteria | 4484 |
| 433 | Ga0466958_0124082 | 3300045836 | Bacteria | 1618 |
| 434 | Ga0466967_0036322 | 3300045976 | Bacteria | 4205 |
| 435 | Ga0495629_0058446 | 3300046459 | Bacteria | 2696 |
| 436 | Ga0495629_0136800 | 3300046459 | Bacteria | 1705 |
| 437 | Ga0495638_0000299 | 3300046460 | Bacteria | 63971 |
| 438 | Ga0495651_0213294 | 3300046462 | Bacteria | 1342 |
| 439 | Ga0495580_0025026 | 3300046472 | Bacteria | 4365 |
| 440 | Ga0495580_0160861 | 3300046472 | Bacteria | 1554 |
| 441 | Ga0495582_0016638 | 3300046473 | Bacteria | 4026 |
| 442 | Ga0495605_0042217 | 3300046474 | Bacteria | 2268 |
| 443 | Ga0495639_0004411 | 3300046475 | Bacteria | 6031 |
| 444 | Ga0495662_0013542 | 3300046476 | Bacteria | 3970 |
| 445 | Ga0495664_0008311 | 3300046477 | Bacteria | 5787 |
| 446 | Ga0495585_0002346 | 3300046492 | Bacteria | 13606 |
| 447 | Ga0495583_0039415 | 3300046506 | Bacteria | 2226 |
| 448 | Ga0495583_0058215 | 3300046506 | Bacteria | 1735 |
| 449 | Ga0495628_0142228 | 3300046516 | Bacteria | 1831 |
| 450 | Ga0495630_0175478 | 3300046517 | Bacteria | 1633 |
| 451 | Ga0495631_0001476 | 3300046518 | Bacteria | 14271 |
| 452 | Ga0495632_0043822 | 3300046519 | Bacteria | 2235 |
| 453 | Ga0495637_0065166 | 3300046520 | Bacteria | 1484 |
| 454 | Ga0495652_0100181 | 3300046529 | Bacteria | 2351 |
| 455 | Ga0495654_0015133 | 3300046530 | Bacteria | 4099 |
| 456 | Ga0495654_0097671 | 3300046530 | Bacteria | 1356 |
| 457 | Ga0495665_0135066 | 3300046531 | Bacteria | 1290 |
| 458 | Ga0495586_0113270 | 3300046535 | Bacteria | 1511 |
| 459 | Ga0495587_0077622 | 3300046536 | Bacteria | 1928 |
| 460 | Ga0495587_0119745 | 3300046536 | Bacteria | 1508 |
| 461 | Ga0495645_0018391 | 3300046543 | Bacteria | 5017 |
| 462 | Ga0495622_0015943 | 3300046557 | Bacteria | 3495 |
| 463 | Ga0495633_0138570 | 3300046558 | Bacteria | 1125 |
| 464 | Ga0495667_0122879 | 3300046559 | Bacteria | 1676 |
| 465 | Ga0495656_0000008 | 3300046615 | Bacteria | 226156 |
| 466 | Ga0495668_0028640 | 3300046616 | Bacteria | 3150 |
| 467 | Ga0495611_0012625 | 3300046648 | Bacteria | 3591 |
| 468 | Ga0495611_0012711 | 3300046648 | Bacteria | 3580 |
| 469 | Ga0495625_0090145 | 3300046660 | Bacteria | 2122 |
| 470 | Ga0495625_0224780 | 3300046660 | Bacteria | 1228 |
| 471 | Ga0495635_0028152 | 3300046663 | Bacteria | 3905 |
| 472 | Ga0495635_0062488 | 3300046663 | Bacteria | 2558 |
| 473 | Ga0495659_0001962 | 3300046664 | Bacteria | 6767 |
| 474 | Ga0495659_0115697 | 3300046664 | Bacteria | 1051 |
| 475 | Ga0495661_0122324 | 3300046665 | Bacteria | 1436 |
| 476 | Ga0495623_0121986 | 3300046679 | Bacteria | 1568 |
| 477 | Ga0495658_0049725 | 3300046683 | Bacteria | 2369 |
| 478 | Ga0495613_0112224 | 3300046689 | Bacteria | 1963 |
| 479 | Ga0495670_0144899 | 3300046691 | Bacteria | 1244 |
| 480 | Ga0495589_0111587 | 3300046794 | Bacteria | 1320 |
| 481 | Ga0495660_0068141 | 3300046810 | Bacteria | 1894 |
| 482 | Ga0495581_0007010 | 3300047315 | Bacteria | 6532 |
| 483 | Ga0495674_0333620 | 3300047319 | Bacteria | 1233 |
| 484 | Ga0495680_0029512 | 3300047322 | Bacteria | 4491 |
| 485 | Ga0495684_0014543 | 3300047471 | Bacteria | 6057 |
| 486 | Ga0495686_0105642 | 3300047472 | Bacteria | 1694 |
| 487 | Ga0495602_0116242 | 3300048088 | Bacteria | 2162 |
| 488 | Ga0496101_0087036 | 3300048904 | Bacteria | 2318 |
| 489 | Ga0496101_0110052 | 3300048904 | Bacteria | 2073 |
| 490 | Ga0496102_0321754 | 3300048905 | Bacteria | 1457 |
| 491 | Ga0496102_0351488 | 3300048905 | Bacteria | 1388 |
| 492 | Ga0496104_0131465 | 3300048907 | Bacteria | 2404 |
| 493 | Ga0496104_0140637 | 3300048907 | Bacteria | 2319 |
| 494 | Ga0496104_0162672 | 3300048907 | Bacteria | 2141 |
| 495 | Ga0496105_0174149 | 3300048908 | Bacteria | 1763 |
| 496 | Ga0496105_0272851 | 3300048908 | Bacteria | 1365 |
| 497 | Ga0496106_0086769 | 3300048909 | Bacteria | 2411 |
| 498 | Ga0496106_0135129 | 3300048909 | Bacteria | 1936 |
| 499 | Ga0496106_0221486 | 3300048909 | Bacteria | 1509 |
| 500 | Ga0496107_0140289 | 3300048910 | Bacteria | 1786 |
| 501 | Ga0496107_0248358 | 3300048910 | Bacteria | 1324 |
| 502 | Ga0496108_0027134 | 3300048911 | Bacteria | 4725 |
| 503 | Ga0496108_0180828 | 3300048911 | Bacteria | 1826 |
| 504 | Ga0496109_0024562 | 3300048912 | Bacteria | 5359 |
| 505 | Ga0496109_0025767 | 3300048912 | Bacteria | 5241 |
| 506 | Ga0496109_0128762 | 3300048912 | Bacteria | 2361 |
| 507 | Ga0496110_0005834 | 3300048913 | Bacteria | 9677 |
| 508 | Ga0496110_0196147 | 3300048913 | Bacteria | 1834 |
| 509 | Ga0496110_0237903 | 3300048913 | Bacteria | 1657 |
| 510 | Ga0496111_0058031 | 3300048914 | Bacteria | 2802 |
| 511 | Ga0496112_0028842 | 3300048915 | Bacteria | 5361 |
| 512 | Ga0496112_0036675 | 3300048915 | Bacteria | 4783 |
| 513 | Ga0496112_0098029 | 3300048915 | Bacteria | 2901 |
| 514 | Ga0496113_0021498 | 3300048916 | Bacteria | 4553 |
| 515 | Ga0496113_0116315 | 3300048916 | Bacteria | 2086 |
| 516 | Ga0496115_0205429 | 3300048918 | Bacteria | 1627 |
| 517 | Ga0496121_0029719 | 3300048924 | Bacteria | 5041 |
| 518 | Ga0496121_0055547 | 3300048924 | Bacteria | 3298 |
| 519 | Ga0496125_0011084 | 3300048928 | Bacteria | 9043 |
| 520 | Ga0496125_0041028 | 3300048928 | Bacteria | 3961 |
| 521 | Ga0496126_0327513 | 3300048929 | Bacteria | 1258 |
| 522 | Ga0501031_0004612 | 3300049568 | Bacteria | 8938 |
| 523 | Ga0501031_0009218 | 3300049568 | Bacteria | 6416 |
| 524 | Ga0501031_0021850 | 3300049568 | Bacteria | 4169 |
| 525 | Ga0501031_0024825 | 3300049568 | Bacteria | 3908 |
| 526 | Ga0501031_0029120 | 3300049568 | Bacteria | 3602 |
| 527 | Ga0501031_0110034 | 3300049568 | Bacteria | 1799 |
| 528 | Ga0501032_0002226 | 3300049569 | Bacteria | 15274 |
| 529 | Ga0501032_0002720 | 3300049569 | Bacteria | 13775 |
| 530 | Ga0501032_0005070 | 3300049569 | Bacteria | 9837 |
| 531 | Ga0501032_0012228 | 3300049569 | Bacteria | 6144 |
| 532 | Ga0501032_0236835 | 3300049569 | Bacteria | 1186 |
| 533 | Ga0501032_0291599 | 3300049569 | Bacteria | 1055 |
| 534 | Ga0501033_0002027 | 3300049570 | Bacteria | 17616 |
| 535 | Ga0501033_0172787 | 3300049570 | Bacteria | 1551 |
| 536 | Ga0501033_0181645 | 3300049570 | Bacteria | 1508 |
| 537 | Ga0501034_0003286 | 3300049571 | Bacteria | 18465 |
| 538 | Ga0501034_0012148 | 3300049571 | Bacteria | 8902 |
| 539 | Ga0501034_0019006 | 3300049571 | Bacteria | 7038 |
| 540 | Ga0501034_0091535 | 3300049571 | Bacteria | 3038 |
| 541 | Ga0501034_0126998 | 3300049571 | Bacteria | 2535 |
| 542 | Ga0501034_0269483 | 3300049571 | Bacteria | 1644 |
| 543 | Ga0501034_0344942 | 3300049571 | Bacteria | 1419 |
| 544 | Ga0501036_0006183 | 3300049572 | Bacteria | 9717 |
| 545 | Ga0501036_0009699 | 3300049572 | Bacteria | 7925 |
| 546 | Ga0501036_0010719 | 3300049572 | Bacteria | 7576 |
| 547 | Ga0501036_0022202 | 3300049572 | Bacteria | 5337 |
| 548 | Ga0501036_0025265 | 3300049572 | Bacteria | 5012 |
| 549 | Ga0501036_0117389 | 3300049572 | Bacteria | 2247 |
| 550 | Ga0501036_0169838 | 3300049572 | Bacteria | 1838 |
| 551 | Ga0501036_0190469 | 3300049572 | Bacteria | 1726 |
| 552 | Ga0501036_0262789 | 3300049572 | Bacteria | 1446 |
| 553 | Ga0501037_0008295 | 3300049573 | Bacteria | 7615 |
| 554 | Ga0501037_0022625 | 3300049573 | Bacteria | 4648 |
| 555 | Ga0501037_0028114 | 3300049573 | Bacteria | 4153 |
| 556 | Ga0501037_0028678 | 3300049573 | Bacteria | 4111 |
| 557 | Ga0501038_0001881 | 3300049574 | Bacteria | 19407 |
| 558 | Ga0501038_0008574 | 3300049574 | Bacteria | 9383 |
| 559 | Ga0501038_0021677 | 3300049574 | Bacteria | 5763 |
| 560 | Ga0501038_0026151 | 3300049574 | Bacteria | 5199 |
| 561 | Ga0501038_0048695 | 3300049574 | Bacteria | 3666 |
| 562 | Ga0501038_0176076 | 3300049574 | Bacteria | 1729 |
| 563 | Ga0501038_0189076 | 3300049574 | Bacteria | 1657 |
| 564 | Ga0501038_0316853 | 3300049574 | Bacteria | 1221 |
| 565 | Ga0501039_0000586 | 3300049575 | Bacteria | 26318 |
| 566 | Ga0501039_0010466 | 3300049575 | Bacteria | 7068 |
| 567 | Ga0501039_0091123 | 3300049575 | Bacteria | 2376 |
| 568 | Ga0501039_0215331 | 3300049575 | Bacteria | 1510 |
| 569 | Ga0501040_0003985 | 3300049576 | Bacteria | 9592 |
| 570 | Ga0501040_0055736 | 3300049576 | Bacteria | 2711 |
| 571 | Ga0501040_0073685 | 3300049576 | Bacteria | 2360 |
| 572 | Ga0501040_0163990 | 3300049576 | Bacteria | 1572 |
| 573 | Ga0501040_0168556 | 3300049576 | Bacteria | 1550 |
| 574 | Ga0501041_0015917 | 3300049577 | Bacteria | 4469 |
| 575 | Ga0501041_0018770 | 3300049577 | Bacteria | 4119 |
| 576 | Ga0501041_0083116 | 3300049577 | Bacteria | 1973 |
| 577 | Ga0501042_0007794 | 3300049578 | Bacteria | 7035 |
| 578 | Ga0501042_0051176 | 3300049578 | Bacteria | 2946 |
| 579 | Ga0501042_0060421 | 3300049578 | Bacteria | 2707 |
| 580 | Ga0501042_0119210 | 3300049578 | Bacteria | 1900 |
| 581 | Ga0501043_0002665 | 3300049579 | Bacteria | 14994 |
| 582 | Ga0501043_0005163 | 3300049579 | Bacteria | 10566 |
| 583 | Ga0501043_0007779 | 3300049579 | Bacteria | 8476 |
| 584 | Ga0501043_0012734 | 3300049579 | Bacteria | 6573 |
| 585 | Ga0501043_0020815 | 3300049579 | Bacteria | 5144 |
| 586 | Ga0501046_0001687 | 3300049580 | Bacteria | 21108 |
| 587 | Ga0501046_0012263 | 3300049580 | Bacteria | 7303 |
| 588 | Ga0501046_0035410 | 3300049580 | Bacteria | 4023 |
| 589 | Ga0501046_0097700 | 3300049580 | Bacteria | 2256 |
| 590 | Ga0501046_0107920 | 3300049580 | Bacteria | 2129 |
| 591 | Ga0501046_0181377 | 3300049580 | Bacteria | 1574 |
| 592 | Ga0501047_0008214 | 3300049581 | Bacteria | 9855 |
| 593 | Ga0501047_0009271 | 3300049581 | Bacteria | 9297 |
| 594 | Ga0501047_0030131 | 3300049581 | Bacteria | 5231 |
| 595 | Ga0501047_0059077 | 3300049581 | Bacteria | 3702 |
| 596 | Ga0501047_0134752 | 3300049581 | Bacteria | 2350 |
| 597 | Ga0501047_0267919 | 3300049581 | Bacteria | 1554 |
| 598 | Ga0501048_0001403 | 3300049582 | Bacteria | 18282 |
| 599 | Ga0501048_0005769 | 3300049582 | Bacteria | 9410 |
| 600 | Ga0501048_0011434 | 3300049582 | Bacteria | 6622 |
| 601 | Ga0501048_0013919 | 3300049582 | Bacteria | 5964 |
| 602 | Ga0501048_0033443 | 3300049582 | Bacteria | 3714 |
| 603 | Ga0501048_0056054 | 3300049582 | Bacteria | 2797 |
| 604 | Ga0501048_0330334 | 3300049582 | Bacteria | 1086 |
| 605 | Ga0501067_0000637 | 3300049583 | Bacteria | 18857 |
| 606 | Ga0501067_0007714 | 3300049583 | Bacteria | 5985 |
| 607 | Ga0501067_0009048 | 3300049583 | Bacteria | 5516 |
| 608 | Ga0501067_0015268 | 3300049583 | Bacteria | 4251 |
| 609 | Ga0501067_0045462 | 3300049583 | Bacteria | 2438 |
| 610 | Ga0501067_0062754 | 3300049583 | Bacteria | 2057 |
| 611 | Ga0501068_0009932 | 3300049584 | Bacteria | 5335 |
| 612 | Ga0501068_0011551 | 3300049584 | Bacteria | 4987 |
| 613 | Ga0501068_0013853 | 3300049584 | Bacteria | 4596 |
| 614 | Ga0501068_0020805 | 3300049584 | Bacteria | 3828 |
| 615 | Ga0501068_0082706 | 3300049584 | Bacteria | 1972 |
| 616 | Ga0501068_0139071 | 3300049584 | Bacteria | 1522 |
| 617 | Ga0501069_0000166 | 3300049585 | Bacteria | 29308 |
| 618 | Ga0501069_0003362 | 3300049585 | Bacteria | 8217 |
| 619 | Ga0501069_0053305 | 3300049585 | Bacteria | 2252 |
| 620 | Ga0501069_0081037 | 3300049585 | Bacteria | 1828 |
| 621 | Ga0501069_0119462 | 3300049585 | Bacteria | 1505 |
| 622 | Ga0501070_0001189 | 3300049586 | Bacteria | 23275 |
| 623 | Ga0501070_0016745 | 3300049586 | Bacteria | 6154 |
| 624 | Ga0501070_0052268 | 3300049586 | Bacteria | 3391 |
| 625 | Ga0501070_0120041 | 3300049586 | Bacteria | 2173 |
| 626 | Ga0501070_0134856 | 3300049586 | Bacteria | 2038 |
| 627 | Ga0501070_0136562 | 3300049586 | Bacteria | 2025 |
| 628 | Ga0501071_0002460 | 3300049587 | Bacteria | 11248 |
| 629 | Ga0501071_0008178 | 3300049587 | Bacteria | 6902 |
| 630 | Ga0501071_0010812 | 3300049587 | Bacteria | 6121 |
| 631 | Ga0501071_0036582 | 3300049587 | Bacteria | 3502 |
| 632 | Ga0501071_0079657 | 3300049587 | Bacteria | 2395 |
| 633 | Ga0501071_0087711 | 3300049587 | Bacteria | 2283 |
| 634 | Ga0501072_0008198 | 3300049588 | Bacteria | 7933 |
| 635 | Ga0501072_0024380 | 3300049588 | Bacteria | 4705 |
| 636 | Ga0501072_0096441 | 3300049588 | Bacteria | 2350 |
| 637 | Ga0501072_0133490 | 3300049588 | Bacteria | 1979 |
| 638 | Ga0501072_0235487 | 3300049588 | Bacteria | 1458 |
| 639 | Ga0501073_0001412 | 3300049589 | Bacteria | 17709 |
| 640 | Ga0501073_0002428 | 3300049589 | Bacteria | 13944 |
| 641 | Ga0501073_0007864 | 3300049589 | Bacteria | 7915 |
| 642 | Ga0501073_0012631 | 3300049589 | Bacteria | 6161 |
| 643 | Ga0501073_0019824 | 3300049589 | Bacteria | 4853 |
| 644 | Ga0501073_0027936 | 3300049589 | Bacteria | 4031 |
| 645 | Ga0501073_0030813 | 3300049589 | Bacteria | 3829 |
| 646 | Ga0501073_0067011 | 3300049589 | Bacteria | 2502 |
| 647 | Ga0501073_0094983 | 3300049589 | Bacteria | 2071 |
| 648 | Ga0501074_0002168 | 3300049590 | Bacteria | 13604 |
| 649 | Ga0501074_0004036 | 3300049590 | Bacteria | 10471 |
| 650 | Ga0501074_0007669 | 3300049590 | Bacteria | 7814 |
| 651 | Ga0501074_0009612 | 3300049590 | Bacteria | 7020 |
| 652 | Ga0501074_0028639 | 3300049590 | Bacteria | 4037 |
| 653 | Ga0501074_0051376 | 3300049590 | Bacteria | 2975 |
| 654 | Ga0501075_0005483 | 3300049591 | Bacteria | 8677 |
| 655 | Ga0501075_0021321 | 3300049591 | Bacteria | 4722 |
| 656 | Ga0501075_0023412 | 3300049591 | Bacteria | 4522 |
| 657 | Ga0501075_0046501 | 3300049591 | Bacteria | 3260 |
| 658 | Ga0501075_0047564 | 3300049591 | Bacteria | 3223 |
| 659 | Ga0501076_0003442 | 3300049592 | Bacteria | 11104 |
| 660 | Ga0501076_0010477 | 3300049592 | Bacteria | 6881 |
| 661 | Ga0501076_0018387 | 3300049592 | Bacteria | 5327 |
| 662 | Ga0501076_0027168 | 3300049592 | Bacteria | 4440 |
| 663 | Ga0501076_0116666 | 3300049592 | Bacteria | 2160 |
| 664 | Ga0501076_0143803 | 3300049592 | Bacteria | 1938 |
| 665 | Ga0501076_0267740 | 3300049592 | Bacteria | 1399 |
| 666 | Ga0501077_0037610 | 3300049593 | Bacteria | 3082 |
| 667 | Ga0501077_0109314 | 3300049593 | Bacteria | 1752 |
| 668 | Ga0501079_0004089 | 3300049741 | Bacteria | 10802 |
| 669 | Ga0501079_0005076 | 3300049741 | Bacteria | 9777 |
| 670 | Ga0501079_0045594 | 3300049741 | Bacteria | 3383 |
| 671 | Ga0501079_0051651 | 3300049741 | Bacteria | 3174 |
| 672 | Ga0501079_0063412 | 3300049741 | Bacteria | 2851 |
| 673 | Ga0501079_0315064 | 3300049741 | Bacteria | 1225 |
| 674 | Ga0501080_0001509 | 3300049742 | Bacteria | 19649 |
| 675 | Ga0501080_0005191 | 3300049742 | Bacteria | 11605 |
| 676 | Ga0501080_0006194 | 3300049742 | Bacteria | 10735 |
| 677 | Ga0501080_0038807 | 3300049742 | Bacteria | 4445 |
| 678 | Ga0501080_0131803 | 3300049742 | Bacteria | 2314 |
| 679 | Ga0501080_0146262 | 3300049742 | Bacteria | 2184 |
| 680 | Ga0501080_0205514 | 3300049742 | Bacteria | 1806 |
| 681 | Ga0501080_0213813 | 3300049742 | Bacteria | 1767 |
| 682 | Ga0501080_0287125 | 3300049742 | Bacteria | 1495 |
| 683 | Ga0501080_0384048 | 3300049742 | Bacteria | 1265 |
| 684 | Ga0501081_0007210 | 3300049743 | Bacteria | 7231 |
| 685 | Ga0501081_0009622 | 3300049743 | Bacteria | 6300 |
| 686 | Ga0501081_0022534 | 3300049743 | Bacteria | 4215 |
| 687 | Ga0501081_0034615 | 3300049743 | Bacteria | 3437 |
| 688 | Ga0501083_0000158 | 3300049744 | Bacteria | 45063 |
| 689 | Ga0501083_0006389 | 3300049744 | Bacteria | 8353 |
| 690 | Ga0501083_0020202 | 3300049744 | Bacteria | 4634 |
| 691 | Ga0501083_0023722 | 3300049744 | Bacteria | 4254 |
| 692 | Ga0501083_0024915 | 3300049744 | Bacteria | 4143 |
| 693 | Ga0501083_0056051 | 3300049744 | Bacteria | 2641 |
| 694 | Ga0501083_0153724 | 3300049744 | Bacteria | 1506 |
| 695 | Ga0501035_0001547 | 3300049822 | Bacteria | 23435 |
| 696 | Ga0501035_0014966 | 3300049822 | Bacteria | 7158 |
| 697 | Ga0501035_0021456 | 3300049822 | Bacteria | 5938 |
| 698 | Ga0501035_0021507 | 3300049822 | Bacteria | 5930 |
| 699 | Ga0501035_0039139 | 3300049822 | Bacteria | 4292 |
| 700 | Ga0501035_0139660 | 3300049822 | Bacteria | 2107 |
| 701 | Ga0501035_0237650 | 3300049822 | Bacteria | 1551 |
| 702 | Ga0501035_0497170 | 3300049822 | Bacteria | 1004 |
| 703 | Ga0501044_0004749 | 3300049823 | Bacteria | 15190 |
| 704 | Ga0501044_0012589 | 3300049823 | Bacteria | 9160 |
| 705 | Ga0501044_0018357 | 3300049823 | Bacteria | 7495 |
| 706 | Ga0501044_0025282 | 3300049823 | Bacteria | 6293 |
| 707 | Ga0501044_0211839 | 3300049823 | Bacteria | 1892 |
| 708 | Ga0501045_0002062 | 3300049824 | Bacteria | 13563 |
| 709 | Ga0501045_0019068 | 3300049824 | Bacteria | 4885 |
| 710 | Ga0501045_0074839 | 3300049824 | Bacteria | 2494 |
| 711 | Ga0501045_0106724 | 3300049824 | Bacteria | 2075 |
| 712 | Ga0501045_0144747 | 3300049824 | Bacteria | 1767 |
| 713 | Ga0501045_0185672 | 3300049824 | Bacteria | 1549 |
| 714 | nmdc:mga05p37_150533_c1 | 3300050507 | Bacteria | 2846 |
| 715 | nmdc:mga05p37_18686_c1 | 3300050507 | Bacteria | 8376 |
| 716 | nmdc:mga05p37_423629_c1 | 3300050507 | Bacteria | 1548 |
| 717 | nmdc:mga05p37_4695_c1 | 3300050507 | Bacteria | 15953 |
| 718 | nmdc:mga05p37_7863_c1 | 3300050507 | Bacteria | 12588 |
| 719 | nmdc:mga05p37_96687_c1 | 3300050507 | Bacteria | 3639 |
| 720 | nmdc:mga09592_5246_c1 | 3300050508 | Bacteria | 10525 |
| 721 | nmdc:mga0qj67_6731_c1 | 3300050509 | Bacteria | 8443 |
| 722 | nmdc:mga0qj67_98562_c1 | 3300050509 | Bacteria | 2354 |
| 723 | nmdc:mga06r32_162377_c1 | 3300050510 | Bacteria | 2216 |
| 724 | nmdc:mga06r32_16871_c1 | 3300050510 | Bacteria | 6661 |
| 725 | nmdc:mga06r32_200856_c1 | 3300050510 | Bacteria | 1981 |
| 726 | nmdc:mga06r32_53930_c1 | 3300050510 | Bacteria | 3854 |
| 727 | nmdc:mga06r32_97066_c1 | 3300050510 | Bacteria | 2887 |
| 728 | nmdc:mga08y16_191120_c1 | 3300050511 | Bacteria | 2124 |
| 729 | nmdc:mga08y16_32962_c1 | 3300050511 | Bacteria | 5444 |
| 730 | nmdc:mga0n895_120821_c1 | 3300050512 | Bacteria | 2641 |
| 731 | nmdc:mga0n895_18116_c1 | 3300050512 | Bacteria | 6511 |
| 732 | nmdc:mga0n895_20008_c1 | 3300050512 | Bacteria | 6233 |
| 733 | nmdc:mga0n895_57789_c1 | 3300050512 | Bacteria | 3824 |
| 734 | nmdc:mga0rr50_66097_c1 | 3300050513 | Bacteria | 2742 |
| 735 | nmdc:mga08x19_152229_c1 | 3300050514 | Bacteria | 1567 |
| 736 | nmdc:mga08x19_71853_c1 | 3300050514 | Bacteria | 2256 |
| 737 | nmdc:mga0a205_161975_c1 | 3300050515 | Bacteria | 2133 |
| 738 | nmdc:mga0a205_23580_c1 | 3300050515 | Bacteria | 5837 |
| 739 | nmdc:mga0a205_36052_c1 | 3300050515 | Bacteria | 4752 |
| 740 | nmdc:mga0a205_73310_c1 | 3300050515 | Bacteria | 3308 |
| 741 | nmdc:mga0a205_76424_c1 | 3300050515 | Bacteria | 3236 |
| 742 | Ga0495601_0143533 | 3300053077 | Bacteria | 1558 |
| 743 | Ga0495612_0007186 | 3300053078 | Bacteria | 4556 |
| 744 | Ga0495619_0025307 | 3300053085 | Bacteria | 3810 |
| 745 | Ga0495619_0127838 | 3300053085 | Bacteria | 1745 |
| 746 | Ga0500651_0066760 | 3300053093 | Bacteria | 2240 |
| 747 | Ga0500566_0102525 | 3300053094 | Bacteria | 1567 |
| 748 | Ga0500641_0012760 | 3300053096 | Bacteria | 3075 |
| 749 | Ga0500557_033666 | 3300053105 | Bacteria | 1569 |
| 750 | Ga0500595_000923 | 3300053119 | Bacteria | 16670 |
| 751 | Ga0500618_000075 | 3300053125 | Bacteria | 80931 |
| 752 | Ga0500618_027464 | 3300053125 | Bacteria | 1354 |
| 753 | Ga0500642_0014769 | 3300053130 | Bacteria | 2915 |
| 754 | Ga0500568_0001239 | 3300053139 | Bacteria | 16933 |
| 755 | Ga0500568_0015778 | 3300053139 | Bacteria | 3373 |
| 756 | Ga0500573_0047454 | 3300053140 | Bacteria | 2474 |
| 757 | Ga0500573_0097520 | 3300053140 | Bacteria | 1656 |
| 758 | Ga0500573_0236828 | 3300053140 | Bacteria | 948 |
| 759 | Ga0500577_0067149 | 3300053142 | Bacteria | 1397 |
| 760 | Ga0500604_0020246 | 3300053151 | Bacteria | 1870 |
| 761 | Ga0500616_0002241 | 3300053153 | Bacteria | 16523 |
| 762 | Ga0500616_0015018 | 3300053153 | Bacteria | 4437 |
| 763 | Ga0500616_0041725 | 3300053153 | Bacteria | 2460 |
| 764 | Ga0500622_0049006 | 3300053156 | Bacteria | 2179 |
| 765 | Ga0500609_001315 | 3300053731 | Bacteria | 3661 |
| 766 | Ga0501084_0000888 | 3300054114 | Bacteria | 23116 |
| 767 | Ga0501084_0004046 | 3300054114 | Bacteria | 11944 |
| 768 | Ga0501084_0018632 | 3300054114 | Bacteria | 5778 |
| 769 | Ga0501084_0093239 | 3300054114 | Bacteria | 2528 |
| 770 | Ga0501084_0132751 | 3300054114 | Bacteria | 2096 |
| 771 | Ga0501084_0136175 | 3300054114 | Bacteria | 2067 |
| 772 | Ga0501084_0205853 | 3300054114 | Bacteria | 1660 |
| 773 | Ga0501084_0298786 | 3300054114 | Bacteria | 1360 |
| 774 | Ga0590075_021824 | 3300059424 | Bacteria | 1600 |
| 775 | Ga0590077_006279 | 3300059426 | Bacteria | 2437 |
| 776 | Ga0501082_0001437 | 3300060353 | Bacteria | 20929 |
| 777 | Ga0501082_0010225 | 3300060353 | Bacteria | 8079 |
| 778 | Ga0501082_0012592 | 3300060353 | Bacteria | 7269 |
| 779 | Ga0501082_0034485 | 3300060353 | Bacteria | 4362 |
| 780 | Ga0501082_0034527 | 3300060353 | Bacteria | 4359 |
| 781 | Ga0501082_0085352 | 3300060353 | Bacteria | 2723 |
| 782 | Ga0501082_0089372 | 3300060353 | Bacteria | 2660 |
| 783 | Ga0501082_0099324 | 3300060353 | Bacteria | 2516 |
| 784 | Ga0501082_0112012 | 3300060353 | Bacteria | 2362 |
| 785 | Ga0501082_0555290 | 3300060353 | Bacteria | 1004 |
| 786 | Ga0530510_0000656 | 3300061734 | Bacteria | 22356 |
| 787 | Ga0530510_0012132 | 3300061734 | Bacteria | 6048 |
| 788 | Ga0530510_0013307 | 3300061734 | Bacteria | 5783 |
| 789 | Ga0530510_0014497 | 3300061734 | Bacteria | 5559 |
| 790 | Ga0530510_0080185 | 3300061734 | Bacteria | 2375 |
| 791 | Ga0530510_0199064 | 3300061734 | Bacteria | 1487 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042461 | Ga0439460_0040007 | Ga0439460_0040007_26_820 | 181 |
| 2 | 3300050507 | nmdc:mga05p37_423629_c1 | nmdc:mga05p37_423629_c1_14_808 | 181 |
| 3 | 3300049569 | Ga0501032_0291599 | Ga0501032_0291599_14_691 | 182 |
| 4 | 3300049570 | Ga0501033_0172787 | Ga0501033_0172787_14_691 | 182 |
| 5 | 3300049580 | Ga0501046_0107920 | Ga0501046_0107920_14_691 | 182 |
| 6 | 3300049585 | Ga0501069_0119462 | Ga0501069_0119462_44_838 | 186 |
| 7 | 3300049593 | Ga0501077_0109314 | Ga0501077_0109314_366_1139 | 193 |
| 8 | 3300048910 | Ga0496107_0248358 | Ga0496107_0248358_409_1290 | 195 |
| 9 | 3300006871 | Ga0075434_100012752 | Ga0075434_1000127522 | 200 |
| 10 | 3300007076 | Ga0075435_100079873 | Ga0075435_1000798732 | 200 |
| 11 | 3300025922 | Ga0207646_10037854 | Ga0207646_100378543 | 200 |
| 12 | 3300050512 | nmdc:mga0n895_120821_c1 | nmdc:mga0n895_120821_c1_1201_1989 | 200 |
| 13 | 3300050513 | nmdc:mga0rr50_66097_c1 | nmdc:mga0rr50_66097_c1_1361_2149 | 200 |
| 14 | 3300050515 | nmdc:mga0a205_161975_c1 | nmdc:mga0a205_161975_c1_101_889 | 200 |
| 15 | 3300005614 | Ga0068856_100289279 | Ga0068856_1002892792 | 202 |
| 16 | 3300001991 | JGI24743J22301_10004626 | JGI24743J22301_100046262 | 203 |
| 17 | 3300002075 | JGI24738J21930_10004260 | JGI24738J21930_100042602 | 203 |
| 18 | 3300005327 | Ga0070658_10020740 | Ga0070658_100207403 | 203 |
| 19 | 3300005329 | Ga0070683_100129967 | Ga0070683_1001299672 | 203 |
| 20 | 3300005334 | Ga0068869_100040311 | Ga0068869_1000403113 | 203 |
| 21 | 3300005337 | Ga0070682_100028510 | Ga0070682_1000285102 | 203 |
| 22 | 3300005338 | Ga0068868_100043148 | Ga0068868_1000431482 | 203 |
| 23 | 3300005339 | Ga0070660_100005700 | Ga0070660_1000057006 | 203 |
| 24 | 3300005341 | Ga0070691_10016189 | Ga0070691_100161893 | 203 |
| 25 | 3300005343 | Ga0070687_100167740 | Ga0070687_1001677402 | 203 |
| 26 | 3300005344 | Ga0070661_100033844 | Ga0070661_1000338442 | 203 |
| 27 | 3300005345 | Ga0070692_10014580 | Ga0070692_100145802 | 203 |
| 28 | 3300005354 | Ga0070675_100073527 | Ga0070675_1000735272 | 203 |
| 29 | 3300005364 | Ga0070673_100018676 | Ga0070673_1000186764 | 203 |
| 30 | 3300005366 | Ga0070659_100055975 | Ga0070659_1000559752 | 203 |
| 31 | 3300005441 | Ga0070700_100092879 | Ga0070700_1000928792 | 203 |
| 32 | 3300005456 | Ga0070678_100089113 | Ga0070678_1000891132 | 203 |
| 33 | 3300005457 | Ga0070662_100038551 | Ga0070662_1000385512 | 203 |
| 34 | 3300005458 | Ga0070681_10292201 | Ga0070681_102922012 | 203 |
| 35 | 3300005459 | Ga0068867_100040031 | Ga0068867_1000400313 | 203 |
| 36 | 3300005530 | Ga0070679_100273763 | Ga0070679_1002737632 | 203 |
| 37 | 3300005539 | Ga0068853_100031620 | Ga0068853_1000316205 | 203 |
| 38 | 3300005543 | Ga0070672_100042335 | Ga0070672_1000423353 | 203 |
| 39 | 3300005563 | Ga0068855_100187365 | Ga0068855_1001873652 | 203 |
| 40 | 3300005578 | Ga0068854_100044994 | Ga0068854_1000449942 | 203 |
| 41 | 3300005718 | Ga0068866_10021578 | Ga0068866_100215783 | 203 |
| 42 | 3300006237 | Ga0097621_100073500 | Ga0097621_1000735002 | 203 |
| 43 | 3300006881 | Ga0068865_100025852 | Ga0068865_1000258523 | 203 |
| 44 | 3300009148 | Ga0105243_10071310 | Ga0105243_100713102 | 203 |
| 45 | 3300009545 | Ga0105237_10292414 | Ga0105237_102924142 | 203 |
| 46 | 3300009551 | Ga0105238_10063471 | Ga0105238_100634713 | 203 |
| 47 | 3300010375 | Ga0105239_10074705 | Ga0105239_100747054 | 203 |
| 48 | 3300013105 | Ga0157369_10578062 | Ga0157369_105780622 | 203 |
| 49 | 3300013307 | Ga0157372_10063768 | Ga0157372_100637682 | 203 |
| 50 | 3300013308 | Ga0157375_10038171 | Ga0157375_100381714 | 203 |
| 51 | 3300014745 | Ga0157377_10017469 | Ga0157377_100174692 | 203 |
| 52 | 3300025321 | Ga0207656_10019302 | Ga0207656_100193023 | 203 |
| 53 | 3300025901 | Ga0207688_10027800 | Ga0207688_100278003 | 203 |
| 54 | 3300025909 | Ga0207705_10051097 | Ga0207705_100510973 | 203 |
| 55 | 3300025912 | Ga0207707_10442111 | Ga0207707_104421112 | 203 |
| 56 | 3300025919 | Ga0207657_10002490 | Ga0207657_1000249014 | 203 |
| 57 | 3300025921 | Ga0207652_10265262 | Ga0207652_102652622 | 203 |
| 58 | 3300025926 | Ga0207659_10096303 | Ga0207659_100963032 | 203 |
| 59 | 3300025927 | Ga0207687_10078826 | Ga0207687_100788262 | 203 |
| 60 | 3300025932 | Ga0207690_10035464 | Ga0207690_100354643 | 203 |
| 61 | 3300025933 | Ga0207706_10022001 | Ga0207706_100220013 | 203 |
| 62 | 3300025935 | Ga0207709_10032353 | Ga0207709_100323533 | 203 |
| 63 | 3300025937 | Ga0207669_10012998 | Ga0207669_100129984 | 203 |
| 64 | 3300025938 | Ga0207704_10021981 | Ga0207704_100219812 | 203 |
| 65 | 3300025940 | Ga0207691_10069787 | Ga0207691_100697873 | 203 |
| 66 | 3300025944 | Ga0207661_10052715 | Ga0207661_100527153 | 203 |
| 67 | 3300025945 | Ga0207679_10134058 | Ga0207679_101340582 | 203 |
| 68 | 3300025949 | Ga0207667_10255036 | Ga0207667_102550362 | 203 |
| 69 | 3300025960 | Ga0207651_10034092 | Ga0207651_100340923 | 203 |
| 70 | 3300025981 | Ga0207640_10029429 | Ga0207640_100294292 | 203 |
| 71 | 3300026023 | Ga0207677_10048876 | Ga0207677_100488762 | 203 |
| 72 | 3300026041 | Ga0207639_10081289 | Ga0207639_100812893 | 203 |
| 73 | 3300026075 | Ga0207708_10048709 | Ga0207708_100487092 | 203 |
| 74 | 3300026089 | Ga0207648_10073677 | Ga0207648_100736772 | 203 |
| 75 | 3300026121 | Ga0207683_10108070 | Ga0207683_101080702 | 203 |
| 76 | 3300026142 | Ga0207698_10064662 | Ga0207698_100646622 | 203 |
| 77 | 3300048904 | Ga0496101_0087036 | Ga0496101_0087036_917_1828 | 203 |
| 78 | 3300048907 | Ga0496104_0162672 | Ga0496104_0162672_1004_1915 | 203 |
| 79 | 3300048909 | Ga0496106_0135129 | Ga0496106_0135129_712_1623 | 203 |
| 80 | 3300048912 | Ga0496109_0024562 | Ga0496109_0024562_1237_2148 | 203 |
| 81 | 3300003323 | rootH1_10014150 | rootH1_100141503 | 206 |
| 82 | 3300005467 | Ga0070706_100094120 | Ga0070706_1000941203 | 206 |
| 83 | 3300005518 | Ga0070699_100025033 | Ga0070699_1000250333 | 206 |
| 84 | 3300025910 | Ga0207684_10009022 | Ga0207684_100090222 | 206 |
| 85 | 3300006847 | Ga0075431_100171554 | Ga0075431_1001715543 | 207 |
| 86 | 3300025907 | Ga0207645_10014930 | Ga0207645_100149304 | 207 |
| 87 | 3300050510 | nmdc:mga06r32_162377_c1 | nmdc:mga06r32_162377_c1_373_1281 | 207 |
| 88 | 3300005468 | Ga0070707_100080325 | Ga0070707_1000803254 | 208 |
| 89 | 3300025910 | Ga0207684_10125841 | Ga0207684_101258413 | 208 |
| 90 | 3300009147 | Ga0114129_10136284 | Ga0114129_101362841 | 209 |
| 91 | 3300048907 | Ga0496104_0140637 | Ga0496104_0140637_409_1191 | 210 |
| 92 | 3300053140 | Ga0500573_0047454 | Ga0500573_0047454_538_1314 | 210 |
| 93 | 3300053140 | Ga0500573_0097520 | Ga0500573_0097520_853_1629 | 210 |
| 94 | 3300053125 | Ga0500618_027464 | Ga0500618_027464_516_1298 | 212 |
| 95 | 3300053140 | Ga0500573_0236828 | Ga0500573_0236828_146_937 | 212 |
| 96 | 3300009094 | Ga0111539_10038039 | Ga0111539_100380393 | 213 |
| 97 | 3300009101 | Ga0105247_10011633 | Ga0105247_100116333 | 213 |
| 98 | 3300009553 | Ga0105249_10145392 | Ga0105249_101453922 | 213 |
| 99 | 3300013308 | Ga0157375_10437285 | Ga0157375_104372852 | 213 |
| 100 | 3300014968 | Ga0157379_10158099 | Ga0157379_101580992 | 213 |
| 101 | 3300014969 | Ga0157376_10028053 | Ga0157376_100280532 | 213 |
| 102 | 3300048904 | Ga0496101_0110052 | Ga0496101_0110052_973_1869 | 213 |
| 103 | 3300048910 | Ga0496107_0140289 | Ga0496107_0140289_133_1029 | 213 |
| 104 | 3300048916 | Ga0496113_0021498 | Ga0496113_0021498_2866_3762 | 213 |
| 105 | 3300050508 | nmdc:mga09592_5246_c1 | nmdc:mga09592_5246_c1_5317_6105 | 213 |
| 106 | 3300013102 | Ga0157371_10011550 | Ga0157371_100115502 | 214 |
| 107 | 3300049574 | Ga0501038_0316853 | Ga0501038_0316853_22_819 | 214 |
| 108 | 3300049576 | Ga0501040_0168556 | Ga0501040_0168556_736_1533 | 214 |
| 109 | 3300049741 | Ga0501079_0315064 | Ga0501079_0315064_368_1165 | 214 |
| 110 | 3300005445 | Ga0070708_100036594 | Ga0070708_1000365943 | 215 |
| 111 | 3300005467 | Ga0070706_100085393 | Ga0070706_1000853932 | 215 |
| 112 | 3300005468 | Ga0070707_100096428 | Ga0070707_1000964282 | 215 |
| 113 | 3300005468 | Ga0070707_100258449 | Ga0070707_1002584492 | 215 |
| 114 | 3300005471 | Ga0070698_100036486 | Ga0070698_1000364864 | 215 |
| 115 | 3300005471 | Ga0070698_100151996 | Ga0070698_1001519962 | 215 |
| 116 | 3300005518 | Ga0070699_100054379 | Ga0070699_1000543793 | 215 |
| 117 | 3300005536 | Ga0070697_100001084 | Ga0070697_1000010848 | 215 |
| 118 | 3300005536 | Ga0070697_100025425 | Ga0070697_1000254253 | 215 |
| 119 | 3300009147 | Ga0114129_10012145 | Ga0114129_1001214511 | 215 |
| 120 | 3300025910 | Ga0207684_10011036 | Ga0207684_100110365 | 215 |
| 121 | 3300025910 | Ga0207684_10013657 | Ga0207684_100136572 | 215 |
| 122 | 3300025922 | Ga0207646_10003155 | Ga0207646_1000315517 | 215 |
| 123 | 3300025922 | Ga0207646_10047624 | Ga0207646_100476242 | 215 |
| 124 | 3300025922 | Ga0207646_10093658 | Ga0207646_100936582 | 215 |
| 125 | 3300042876 | Ga0451577_0052996 | Ga0451577_0052996_33_821 | 215 |
| 126 | 3300044673 | Ga0453683_0026353 | Ga0453683_0026353_2176_2964 | 215 |
| 127 | 3300044712 | Ga0453684_0007326 | Ga0453684_0007326_3262_4050 | 215 |
| 128 | 3300049572 | Ga0501036_0010719 | Ga0501036_0010719_3810_4601 | 215 |
| 129 | 3300050507 | nmdc:mga05p37_7863_c1 | nmdc:mga05p37_7863_c1_490_1278 | 215 |
| 130 | 3300005329 | Ga0070683_100153607 | Ga0070683_1001536072 | 216 |
| 131 | 3300005354 | Ga0070675_100258171 | Ga0070675_1002581712 | 216 |
| 132 | 3300005455 | Ga0070663_100054465 | Ga0070663_1000544652 | 216 |
| 133 | 3300005457 | Ga0070662_100212076 | Ga0070662_1002120762 | 216 |
| 134 | 3300005535 | Ga0070684_100331425 | Ga0070684_1003314252 | 216 |
| 135 | 3300005535 | Ga0070684_100404710 | Ga0070684_1004047102 | 216 |
| 136 | 3300005564 | Ga0070664_100094432 | Ga0070664_1000944322 | 216 |
| 137 | 3300005577 | Ga0068857_100013049 | Ga0068857_1000130496 | 216 |
| 138 | 3300005615 | Ga0070702_100139704 | Ga0070702_1001397041 | 216 |
| 139 | 3300005617 | Ga0068859_100052600 | Ga0068859_1000526002 | 216 |
| 140 | 3300006058 | Ga0075432_10015501 | Ga0075432_100155013 | 216 |
| 141 | 3300006852 | Ga0075433_10272201 | Ga0075433_102722012 | 216 |
| 142 | 3300006871 | Ga0075434_100360142 | Ga0075434_1003601422 | 216 |
| 143 | 3300006931 | Ga0097620_100052599 | Ga0097620_1000525992 | 216 |
| 144 | 3300009094 | Ga0111539_10065086 | Ga0111539_100650863 | 216 |
| 145 | 3300025908 | Ga0207643_10018189 | Ga0207643_100181892 | 216 |
| 146 | 3300025925 | Ga0207650_10061325 | Ga0207650_100613253 | 216 |
| 147 | 3300025931 | Ga0207644_10150226 | Ga0207644_101502262 | 216 |
| 148 | 3300025935 | Ga0207709_10053080 | Ga0207709_100530802 | 216 |
| 149 | 3300025940 | Ga0207691_10033166 | Ga0207691_100331662 | 216 |
| 150 | 3300025942 | Ga0207689_10038040 | Ga0207689_100380404 | 216 |
| 151 | 3300025945 | Ga0207679_10149599 | Ga0207679_101495992 | 216 |
| 152 | 3300026075 | Ga0207708_10039834 | Ga0207708_100398343 | 216 |
| 153 | 3300026089 | Ga0207648_10148672 | Ga0207648_101486721 | 216 |
| 154 | 3300026116 | Ga0207674_10020614 | Ga0207674_100206142 | 216 |
| 155 | 3300026116 | Ga0207674_10089188 | Ga0207674_100891882 | 216 |
| 156 | 3300026121 | Ga0207683_10021675 | Ga0207683_100216752 | 216 |
| 157 | 3300027907 | Ga0207428_10104395 | Ga0207428_101043952 | 216 |
| 158 | 3300048908 | Ga0496105_0174149 | Ga0496105_0174149_705_1616 | 216 |
| 159 | 3300049568 | Ga0501031_0009218 | Ga0501031_0009218_1888_2682 | 216 |
| 160 | 3300049568 | Ga0501031_0021850 | Ga0501031_0021850_1998_2795 | 216 |
| 161 | 3300049568 | Ga0501031_0029120 | Ga0501031_0029120_1370_2164 | 216 |
| 162 | 3300049569 | Ga0501032_0005070 | Ga0501032_0005070_3200_3997 | 216 |
| 163 | 3300049569 | Ga0501032_0012228 | Ga0501032_0012228_5057_5851 | 216 |
| 164 | 3300049571 | Ga0501034_0019006 | Ga0501034_0019006_3875_4672 | 216 |
| 165 | 3300049571 | Ga0501034_0091535 | Ga0501034_0091535_806_1600 | 216 |
| 166 | 3300049572 | Ga0501036_0009699 | Ga0501036_0009699_5913_6710 | 216 |
| 167 | 3300049572 | Ga0501036_0022202 | Ga0501036_0022202_859_1653 | 216 |
| 168 | 3300049573 | Ga0501037_0008295 | Ga0501037_0008295_5913_6710 | 216 |
| 169 | 3300049573 | Ga0501037_0028678 | Ga0501037_0028678_1879_2673 | 216 |
| 170 | 3300049574 | Ga0501038_0001881 | Ga0501038_0001881_17175_17969 | 216 |
| 171 | 3300049574 | Ga0501038_0008574 | Ga0501038_0008574_4203_5000 | 216 |
| 172 | 3300049574 | Ga0501038_0189076 | Ga0501038_0189076_503_1297 | 216 |
| 173 | 3300049575 | Ga0501039_0215331 | Ga0501039_0215331_236_1030 | 216 |
| 174 | 3300049578 | Ga0501042_0060421 | Ga0501042_0060421_1886_2683 | 216 |
| 175 | 3300049579 | Ga0501043_0005163 | Ga0501043_0005163_3194_3991 | 216 |
| 176 | 3300049579 | Ga0501043_0007779 | Ga0501043_0007779_1852_2646 | 216 |
| 177 | 3300049579 | Ga0501043_0012734 | Ga0501043_0012734_3576_4370 | 216 |
| 178 | 3300049580 | Ga0501046_0012263 | Ga0501046_0012263_4012_4809 | 216 |
| 179 | 3300049580 | Ga0501046_0035410 | Ga0501046_0035410_1571_2365 | 216 |
| 180 | 3300049581 | Ga0501047_0030131 | Ga0501047_0030131_2721_3518 | 216 |
| 181 | 3300049581 | Ga0501047_0059077 | Ga0501047_0059077_1026_1820 | 216 |
| 182 | 3300049581 | Ga0501047_0267919 | Ga0501047_0267919_361_1155 | 216 |
| 183 | 3300049582 | Ga0501048_0005769 | Ga0501048_0005769_8218_9012 | 216 |
| 184 | 3300049582 | Ga0501048_0011434 | Ga0501048_0011434_3473_4267 | 216 |
| 185 | 3300049582 | Ga0501048_0013919 | Ga0501048_0013919_2084_2881 | 216 |
| 186 | 3300049583 | Ga0501067_0007714 | Ga0501067_0007714_5014_5808 | 216 |
| 187 | 3300049583 | Ga0501067_0015268 | Ga0501067_0015268_1575_2369 | 216 |
| 188 | 3300049584 | Ga0501068_0009932 | Ga0501068_0009932_3172_3966 | 216 |
| 189 | 3300049584 | Ga0501068_0011551 | Ga0501068_0011551_2973_3770 | 216 |
| 190 | 3300049584 | Ga0501068_0020805 | Ga0501068_0020805_353_1147 | 216 |
| 191 | 3300049585 | Ga0501069_0000166 | Ga0501069_0000166_21085_21879 | 216 |
| 192 | 3300049586 | Ga0501070_0016745 | Ga0501070_0016745_3746_4540 | 216 |
| 193 | 3300049586 | Ga0501070_0134856 | Ga0501070_0134856_336_1133 | 216 |
| 194 | 3300049587 | Ga0501071_0010812 | Ga0501071_0010812_2267_3061 | 216 |
| 195 | 3300049587 | Ga0501071_0079657 | Ga0501071_0079657_1571_2365 | 216 |
| 196 | 3300049588 | Ga0501072_0024380 | Ga0501072_0024380_1748_2542 | 216 |
| 197 | 3300049588 | Ga0501072_0235487 | Ga0501072_0235487_113_907 | 216 |
| 198 | 3300049589 | Ga0501073_0001412 | Ga0501073_0001412_4093_4890 | 216 |
| 199 | 3300049589 | Ga0501073_0012631 | Ga0501073_0012631_3951_4745 | 216 |
| 200 | 3300049589 | Ga0501073_0030813 | Ga0501073_0030813_1153_1947 | 216 |
| 201 | 3300049590 | Ga0501074_0007669 | Ga0501074_0007669_3473_4267 | 216 |
| 202 | 3300049590 | Ga0501074_0009612 | Ga0501074_0009612_4382_5179 | 216 |
| 203 | 3300049590 | Ga0501074_0028639 | Ga0501074_0028639_537_1331 | 216 |
| 204 | 3300049592 | Ga0501076_0003442 | Ga0501076_0003442_7275_8072 | 216 |
| 205 | 3300049741 | Ga0501079_0004089 | Ga0501079_0004089_7857_8654 | 216 |
| 206 | 3300049741 | Ga0501079_0005076 | Ga0501079_0005076_1913_2707 | 216 |
| 207 | 3300049742 | Ga0501080_0005191 | Ga0501080_0005191_5960_6754 | 216 |
| 208 | 3300049742 | Ga0501080_0006194 | Ga0501080_0006194_6140_6937 | 216 |
| 209 | 3300049742 | Ga0501080_0146262 | Ga0501080_0146262_365_1159 | 216 |
| 210 | 3300049744 | Ga0501083_0006389 | Ga0501083_0006389_3747_4544 | 216 |
| 211 | 3300049744 | Ga0501083_0056051 | Ga0501083_0056051_1571_2365 | 216 |
| 212 | 3300049822 | Ga0501035_0001547 | Ga0501035_0001547_19095_19892 | 216 |
| 213 | 3300049822 | Ga0501035_0021456 | Ga0501035_0021456_1444_2238 | 216 |
| 214 | 3300049823 | Ga0501044_0004749 | Ga0501044_0004749_4779_5576 | 216 |
| 215 | 3300049823 | Ga0501044_0012589 | Ga0501044_0012589_1154_1948 | 216 |
| 216 | 3300049824 | Ga0501045_0002062 | Ga0501045_0002062_6005_6799 | 216 |
| 217 | 3300049824 | Ga0501045_0144747 | Ga0501045_0144747_762_1556 | 216 |
| 218 | 3300050511 | nmdc:mga08y16_32962_c1 | nmdc:mga08y16_32962_c1_2438_3349 | 216 |
| 219 | 3300050515 | nmdc:mga0a205_73310_c1 | nmdc:mga0a205_73310_c1_2194_3105 | 216 |
| 220 | 3300054114 | Ga0501084_0000888 | Ga0501084_0000888_11063_11860 | 216 |
| 221 | 3300054114 | Ga0501084_0093239 | Ga0501084_0093239_382_1176 | 216 |
| 222 | 3300060353 | Ga0501082_0010225 | Ga0501082_0010225_897_1694 | 216 |
| 223 | 3300060353 | Ga0501082_0012592 | Ga0501082_0012592_2544_3338 | 216 |
| 224 | 3300005544 | Ga0070686_100197939 | Ga0070686_1001979392 | 217 |
| 225 | 3300006358 | Ga0068871_100273574 | Ga0068871_1002735742 | 217 |
| 226 | 3300013100 | Ga0157373_10016259 | Ga0157373_100162592 | 217 |
| 227 | 3300013307 | Ga0157372_10502152 | Ga0157372_105021522 | 217 |
| 228 | 3300025923 | Ga0207681_10222444 | Ga0207681_102224442 | 217 |
| 229 | 3300026067 | Ga0207678_10026970 | Ga0207678_100269702 | 217 |
| 230 | 3300049584 | Ga0501068_0082706 | Ga0501068_0082706_654_1565 | 217 |
| 231 | 3300049585 | Ga0501069_0053305 | Ga0501069_0053305_358_1269 | 217 |
| 232 | 3300049587 | Ga0501071_0008178 | Ga0501071_0008178_2790_3701 | 217 |
| 233 | 3300049572 | Ga0501036_0190469 | Ga0501036_0190469_731_1573 | 218 |
| 234 | 3300061734 | Ga0530510_0000656 | Ga0530510_0000656_10738_11637 | 218 |
| 235 | 3300005329 | Ga0070683_100009813 | Ga0070683_1000098136 | 219 |
| 236 | 3300005338 | Ga0068868_100069325 | Ga0068868_1000693252 | 219 |
| 237 | 3300005354 | Ga0070675_100370959 | Ga0070675_1003709592 | 219 |
| 238 | 3300005365 | Ga0070688_100081964 | Ga0070688_1000819642 | 219 |
| 239 | 3300005440 | Ga0070705_100060963 | Ga0070705_1000609631 | 219 |
| 240 | 3300005441 | Ga0070700_100246084 | Ga0070700_1002460842 | 219 |
| 241 | 3300005535 | Ga0070684_100010496 | Ga0070684_1000104963 | 219 |
| 242 | 3300005616 | Ga0068852_100491542 | Ga0068852_1004915422 | 219 |
| 243 | 3300009098 | Ga0105245_10030005 | Ga0105245_100300053 | 219 |
| 244 | 3300013102 | Ga0157371_10292843 | Ga0157371_102928432 | 219 |
| 245 | 3300014745 | Ga0157377_10038837 | Ga0157377_100388373 | 219 |
| 246 | 3300025901 | Ga0207688_10002539 | Ga0207688_100025392 | 219 |
| 247 | 3300025926 | Ga0207659_10242435 | Ga0207659_102424352 | 219 |
| 248 | 3300025927 | Ga0207687_10007965 | Ga0207687_100079652 | 219 |
| 249 | 3300025944 | Ga0207661_10052167 | Ga0207661_100521672 | 219 |
| 250 | 3300026023 | Ga0207677_10008588 | Ga0207677_100085885 | 219 |
| 251 | 3300026075 | Ga0207708_10083849 | Ga0207708_100838493 | 219 |
| 252 | 3300026121 | Ga0207683_10181390 | Ga0207683_101813902 | 219 |
| 253 | 3300026142 | Ga0207698_10410288 | Ga0207698_104102882 | 219 |
| 254 | 3300048905 | Ga0496102_0351488 | Ga0496102_0351488_142_1047 | 219 |
| 255 | 3300048911 | Ga0496108_0027134 | Ga0496108_0027134_2427_3332 | 219 |
| 256 | 3300048912 | Ga0496109_0025767 | Ga0496109_0025767_1837_2742 | 219 |
| 257 | 3300048913 | Ga0496110_0005834 | Ga0496110_0005834_1621_2526 | 219 |
| 258 | 3300048914 | Ga0496111_0058031 | Ga0496111_0058031_1012_1917 | 219 |
| 259 | 3300048915 | Ga0496112_0098029 | Ga0496112_0098029_1335_2240 | 219 |
| 260 | 3300010375 | Ga0105239_10127648 | Ga0105239_101276483 | 220 |
| 261 | 3300046660 | Ga0495625_0224780 | Ga0495625_0224780_73_960 | 220 |
| 262 | 3300048905 | Ga0496102_0321754 | Ga0496102_0321754_52_879 | 220 |
| 263 | 3300048909 | Ga0496106_0086769 | Ga0496106_0086769_618_1445 | 220 |
| 264 | 3300048913 | Ga0496110_0196147 | Ga0496110_0196147_597_1424 | 220 |
| 265 | 3300048915 | Ga0496112_0036675 | Ga0496112_0036675_157_984 | 220 |
| 266 | 3300048916 | Ga0496113_0116315 | Ga0496113_0116315_118_945 | 220 |
| 267 | 3300050507 | nmdc:mga05p37_150533_c1 | nmdc:mga05p37_150533_c1_132_959 | 220 |
| 268 | 3300050515 | nmdc:mga0a205_76424_c1 | nmdc:mga0a205_76424_c1_262_1089 | 220 |
| 269 | 3300046664 | Ga0495659_0115697 | Ga0495659_0115697_50_865 | 222 |
| 270 | 3300050509 | nmdc:mga0qj67_98562_c1 | nmdc:mga0qj67_98562_c1_84_986 | 223 |
| 271 | 3300050510 | nmdc:mga06r32_97066_c1 | nmdc:mga06r32_97066_c1_866_1768 | 223 |
| 272 | 3300039450 | Ga0436363_1421802 | Ga0436363_1421802_83_988 | 224 |
| 273 | 3300005981 | Ga0081538_10098811 | Ga0081538_100988112 | 225 |
| 274 | 3300009147 | Ga0114129_10941376 | Ga0114129_109413762 | 225 |
| 275 | 3300005985 | Ga0081539_10003664 | Ga0081539_1000366418 | 226 |
| 276 | 3300006844 | Ga0075428_100230313 | Ga0075428_1002303132 | 226 |
| 277 | 3300039450 | Ga0436363_1110042 | Ga0436363_1110042_461_1324 | 226 |
| 278 | 3300003203 | JGI25406J46586_10036843 | JGI25406J46586_100368432 | 227 |
| 279 | 3300032004 | Ga0307414_10082633 | Ga0307414_100826333 | 227 |
| 280 | 3300032126 | Ga0307415_100303186 | Ga0307415_1003031861 | 227 |
| 281 | 3300014325 | Ga0163163_10337282 | Ga0163163_103372822 | 228 |
| 282 | 3300025935 | Ga0207709_10226263 | Ga0207709_102262632 | 228 |
| 283 | 3300046615 | Ga0495656_0000008 | Ga0495656_0000008_4335_5201 | 228 |
| 284 | 3300046664 | Ga0495659_0001962 | Ga0495659_0001962_4750_5616 | 228 |
| 285 | 3300049587 | Ga0501071_0087711 | Ga0501071_0087711_287_1174 | 228 |
| 286 | 3300005445 | Ga0070708_100183921 | Ga0070708_1001839212 | 229 |
| 287 | 3300005367 | Ga0070667_100038389 | Ga0070667_1000383892 | 230 |
| 288 | 3300005983 | Ga0081540_1018683 | Ga0081540_10186833 | 230 |
| 289 | 3300025981 | Ga0207640_10367500 | Ga0207640_103675001 | 230 |
| 290 | 3300025986 | Ga0207658_10027377 | Ga0207658_100273772 | 230 |
| 291 | 3300028381 | Ga0268264_10347628 | Ga0268264_103476281 | 230 |
| 292 | 3300031824 | Ga0307413_10102061 | Ga0307413_101020611 | 230 |
| 293 | 3300032005 | Ga0307411_10053923 | Ga0307411_100539232 | 230 |
| 294 | 3300042115 | Ga0450911_000174 | Ga0450911_000174_11080_11937 | 230 |
| 295 | 3300048924 | Ga0496121_0029719 | Ga0496121_0029719_1525_2382 | 230 |
| 296 | 3300048928 | Ga0496125_0011084 | Ga0496125_0011084_2183_3040 | 230 |
| 297 | 3300038443 | Ga0395901_0156856 | Ga0395901_0156856_882_1778 | 231 |
| 298 | 3300048928 | Ga0496125_0041028 | Ga0496125_0041028_85_942 | 231 |
| 299 | 3300049743 | Ga0501081_0022534 | Ga0501081_0022534_18_950 | 231 |
| 300 | 3300061734 | Ga0530510_0012132 | Ga0530510_0012132_4036_4935 | 231 |
| 301 | 3300005468 | Ga0070707_100225521 | Ga0070707_1002255211 | 232 |
| 302 | 3300025910 | Ga0207684_10299998 | Ga0207684_102999981 | 232 |
| 303 | 3300025922 | Ga0207646_10245154 | Ga0207646_102451541 | 232 |
| 304 | 3300031852 | Ga0307410_10198896 | Ga0307410_101988962 | 232 |
| 305 | 3300049583 | Ga0501067_0009048 | Ga0501067_0009048_1256_2146 | 232 |
| 306 | 3300046648 | Ga0495611_0012711 | Ga0495611_0012711_377_1273 | 234 |
| 307 | 3300049576 | Ga0501040_0073685 | Ga0501040_0073685_309_1262 | 234 |
| 308 | 3300049591 | Ga0501075_0023412 | Ga0501075_0023412_2325_3278 | 234 |
| 309 | 3300049592 | Ga0501076_0027168 | Ga0501076_0027168_20_973 | 234 |
| 310 | 3300049824 | Ga0501045_0074839 | Ga0501045_0074839_330_1283 | 234 |
| 311 | 3300053125 | Ga0500618_000075 | Ga0500618_000075_39169_40017 | 234 |
| 312 | 3300025302 | Ga0207426_1019449 | Ga0207426_10194492 | 235 |
| 313 | 3300031548 | Ga0307408_100233817 | Ga0307408_1002338172 | 235 |
| 314 | 3300005844 | Ga0068862_100004772 | Ga0068862_10000477211 | 236 |
| 315 | 3300028380 | Ga0268265_10004310 | Ga0268265_100043108 | 236 |
| 316 | 3300037471 | Ga0395905_0008475 | Ga0395905_0008475_8925_9764 | 236 |
| 317 | 3300049742 | Ga0501080_0384048 | Ga0501080_0384048_120_1073 | 236 |
| 318 | 3300034817 | Ga0373948_0006165 | Ga0373948_0006165_113_1009 | 237 |
| 319 | 3300034819 | Ga0373958_0008572 | Ga0373958_0008572_492_1388 | 237 |
| 320 | 3300035114 | Ga0373939_0002495 | Ga0373939_0002495_2408_3304 | 237 |
| 321 | 3300035121 | Ga0373960_0009426 | Ga0373960_0009426_196_1092 | 237 |
| 322 | 3300035691 | Ga0373931_0026999 | Ga0373931_0026999_1004_1900 | 237 |
| 323 | 3300046506 | Ga0495583_0039415 | Ga0495583_0039415_911_1807 | 237 |
| 324 | 3300046520 | Ga0495637_0065166 | Ga0495637_0065166_349_1245 | 237 |
| 325 | 3300046665 | Ga0495661_0122324 | Ga0495661_0122324_254_1150 | 237 |
| 326 | 3300049569 | Ga0501032_0002720 | Ga0501032_0002720_8583_9488 | 237 |
| 327 | 3300049573 | Ga0501037_0028114 | Ga0501037_0028114_458_1363 | 237 |
| 328 | 3300049574 | Ga0501038_0021677 | Ga0501038_0021677_2037_2942 | 237 |
| 329 | 3300049579 | Ga0501043_0020815 | Ga0501043_0020815_3013_3918 | 237 |
| 330 | 3300049581 | Ga0501047_0009271 | Ga0501047_0009271_5382_6287 | 237 |
| 331 | 3300049584 | Ga0501068_0139071 | Ga0501068_0139071_49_957 | 237 |
| 332 | 3300049586 | Ga0501070_0052268 | Ga0501070_0052268_2233_3138 | 237 |
| 333 | 3300049822 | Ga0501035_0021507 | Ga0501035_0021507_2234_3139 | 237 |
| 334 | 3300053139 | Ga0500568_0015778 | Ga0500568_0015778_2080_3003 | 237 |
| 335 | iso_pu_bacteria | 8056207758 | 8056213110 | 237 |
| 336 | 3300025298 | Ga0209050_1007002 | Ga0209050_10070022 | 238 |
| 337 | 3300025303 | Ga0209051_1028456 | Ga0209051_10284562 | 238 |
| 338 | 3300025304 | Ga0209257_1000562 | Ga0209257_100056260 | 238 |
| 339 | 3300048913 | Ga0496110_0237903 | Ga0496110_0237903_511_1374 | 238 |
| 340 | 3300005547 | Ga0070693_100093523 | Ga0070693_1000935232 | 239 |
| 341 | 3300046472 | Ga0495580_0025026 | Ga0495580_0025026_612_1520 | 239 |
| 342 | 3300005344 | Ga0070661_100026778 | Ga0070661_1000267783 | 240 |
| 343 | 3300005345 | Ga0070692_10106324 | Ga0070692_101063242 | 240 |
| 344 | 3300005347 | Ga0070668_100054343 | Ga0070668_1000543432 | 240 |
| 345 | 3300005354 | Ga0070675_100021763 | Ga0070675_1000217635 | 240 |
| 346 | 3300005356 | Ga0070674_100109701 | Ga0070674_1001097012 | 240 |
| 347 | 3300005444 | Ga0070694_100009080 | Ga0070694_1000090806 | 240 |
| 348 | 3300005456 | Ga0070678_100085124 | Ga0070678_1000851243 | 240 |
| 349 | 3300005471 | Ga0070698_100021151 | Ga0070698_1000211516 | 240 |
| 350 | 3300005547 | Ga0070693_100010955 | Ga0070693_1000109553 | 240 |
| 351 | 3300005549 | Ga0070704_100007424 | Ga0070704_1000074245 | 240 |
| 352 | 3300005718 | Ga0068866_10001490 | Ga0068866_100014909 | 240 |
| 353 | 3300005719 | Ga0068861_100006306 | Ga0068861_1000063064 | 240 |
| 354 | 3300006058 | Ga0075432_10000854 | Ga0075432_100008548 | 240 |
| 355 | 3300006358 | Ga0068871_100042611 | Ga0068871_1000426114 | 240 |
| 356 | 3300006846 | Ga0075430_100075051 | Ga0075430_1000750512 | 240 |
| 357 | 3300006847 | Ga0075431_100029626 | Ga0075431_1000296265 | 240 |
| 358 | 3300006852 | Ga0075433_10002380 | Ga0075433_1000238011 | 240 |
| 359 | 3300006871 | Ga0075434_100002270 | Ga0075434_10000227019 | 240 |
| 360 | 3300006871 | Ga0075434_100015902 | Ga0075434_1000159025 | 240 |
| 361 | 3300009094 | Ga0111539_10009437 | Ga0111539_1000943710 | 240 |
| 362 | 3300009147 | Ga0114129_10010122 | Ga0114129_1001012214 | 240 |
| 363 | 3300009147 | Ga0114129_10029708 | Ga0114129_100297082 | 240 |
| 364 | 3300009148 | Ga0105243_10107201 | Ga0105243_101072012 | 240 |
| 365 | 3300009553 | Ga0105249_10029668 | Ga0105249_100296682 | 240 |
| 366 | 3300013297 | Ga0157378_10049462 | Ga0157378_100494622 | 240 |
| 367 | 3300014745 | Ga0157377_10023180 | Ga0157377_100231803 | 240 |
| 368 | 3300025899 | Ga0207642_10025587 | Ga0207642_100255873 | 240 |
| 369 | 3300025907 | Ga0207645_10064195 | Ga0207645_100641952 | 240 |
| 370 | 3300025926 | Ga0207659_10139981 | Ga0207659_101399812 | 240 |
| 371 | 3300025927 | Ga0207687_10208828 | Ga0207687_102088282 | 240 |
| 372 | 3300025934 | Ga0207686_10006732 | Ga0207686_100067324 | 240 |
| 373 | 3300025937 | Ga0207669_10277156 | Ga0207669_102771562 | 240 |
| 374 | 3300026023 | Ga0207677_10034416 | Ga0207677_100344164 | 240 |
| 375 | 3300026118 | Ga0207675_100011563 | Ga0207675_1000115636 | 240 |
| 376 | 3300027907 | Ga0207428_10002320 | Ga0207428_100023206 | 240 |
| 377 | 3300027907 | Ga0207428_10018781 | Ga0207428_100187813 | 240 |
| 378 | 3300028381 | Ga0268264_10285602 | Ga0268264_102856022 | 240 |
| 379 | 3300046558 | Ga0495633_0138570 | Ga0495633_0138570_220_1107 | 240 |
| 380 | 3300046794 | Ga0495589_0111587 | Ga0495589_0111587_136_1044 | 240 |
| 381 | 3300047472 | Ga0495686_0105642 | Ga0495686_0105642_309_1220 | 240 |
| 382 | 3300050507 | nmdc:mga05p37_18686_c1 | nmdc:mga05p37_18686_c1_2763_3659 | 240 |
| 383 | 3300050507 | nmdc:mga05p37_4695_c1 | nmdc:mga05p37_4695_c1_9125_10021 | 240 |
| 384 | 3300050507 | nmdc:mga05p37_96687_c1 | nmdc:mga05p37_96687_c1_82_978 | 240 |
| 385 | 3300050509 | nmdc:mga0qj67_6731_c1 | nmdc:mga0qj67_6731_c1_1079_1975 | 240 |
| 386 | 3300050510 | nmdc:mga06r32_53930_c1 | nmdc:mga06r32_53930_c1_14_910 | 240 |
| 387 | 3300050511 | nmdc:mga08y16_191120_c1 | nmdc:mga08y16_191120_c1_413_1309 | 240 |
| 388 | 3300050512 | nmdc:mga0n895_18116_c1 | nmdc:mga0n895_18116_c1_3872_4768 | 240 |
| 389 | 3300050512 | nmdc:mga0n895_20008_c1 | nmdc:mga0n895_20008_c1_990_1886 | 240 |
| 390 | 3300050515 | nmdc:mga0a205_36052_c1 | nmdc:mga0a205_36052_c1_3146_4042 | 240 |
| 391 | 3300053096 | Ga0500641_0012760 | Ga0500641_0012760_209_1120 | 240 |
| 392 | 3300053142 | Ga0500577_0067149 | Ga0500577_0067149_48_935 | 240 |
| 393 | 3300031251 | Ga0265327_10074678 | Ga0265327_100746782 | 241 |
| 394 | 3300031852 | Ga0307410_10154128 | Ga0307410_101541282 | 241 |
| 395 | 3300045976 | Ga0466967_0036322 | Ga0466967_0036322_2650_3555 | 241 |
| 396 | 3300046460 | Ga0495638_0000299 | Ga0495638_0000299_4430_5320 | 241 |
| 397 | 3300046474 | Ga0495605_0042217 | Ga0495605_0042217_1054_1944 | 241 |
| 398 | 3300046492 | Ga0495585_0002346 | Ga0495585_0002346_456_1346 | 241 |
| 399 | 3300046506 | Ga0495583_0058215 | Ga0495583_0058215_561_1451 | 241 |
| 400 | 3300046518 | Ga0495631_0001476 | Ga0495631_0001476_12336_13226 | 241 |
| 401 | 3300046519 | Ga0495632_0043822 | Ga0495632_0043822_1083_1973 | 241 |
| 402 | 3300046530 | Ga0495654_0097671 | Ga0495654_0097671_450_1340 | 241 |
| 403 | 3300046616 | Ga0495668_0028640 | Ga0495668_0028640_847_1737 | 241 |
| 404 | 3300046648 | Ga0495611_0012625 | Ga0495611_0012625_972_1862 | 241 |
| 405 | 3300046660 | Ga0495625_0090145 | Ga0495625_0090145_276_1166 | 241 |
| 406 | 3300046691 | Ga0495670_0144899 | Ga0495670_0144899_128_1018 | 241 |
| 407 | 3300046810 | Ga0495660_0068141 | Ga0495660_0068141_22_912 | 241 |
| 408 | 3300049580 | Ga0501046_0181377 | Ga0501046_0181377_445_1335 | 241 |
| 409 | 3300049742 | Ga0501080_0213813 | Ga0501080_0213813_436_1347 | 241 |
| 410 | 3300050514 | nmdc:mga08x19_152229_c1 | nmdc:mga08x19_152229_c1_567_1442 | 241 |
| 411 | 3300053105 | Ga0500557_033666 | Ga0500557_033666_467_1357 | 241 |
| 412 | 3300053139 | Ga0500568_0001239 | Ga0500568_0001239_15476_16366 | 241 |
| 413 | 3300053151 | Ga0500604_0020246 | Ga0500604_0020246_553_1464 | 241 |
| 414 | 3300053153 | Ga0500616_0015018 | Ga0500616_0015018_985_1875 | 241 |
| 415 | 3300006844 | Ga0075428_100023025 | Ga0075428_1000230256 | 242 |
| 416 | 3300006847 | Ga0075431_100012616 | Ga0075431_1000126167 | 242 |
| 417 | 3300031731 | Ga0307405_10475755 | Ga0307405_104757551 | 242 |
| 418 | 3300031995 | Ga0307409_100434292 | Ga0307409_1004342922 | 242 |
| 419 | 3300035089 | Ga0373944_0014893 | Ga0373944_0014893_580_1482 | 242 |
| 420 | 3300046459 | Ga0495629_0058446 | Ga0495629_0058446_1756_2649 | 242 |
| 421 | 3300046476 | Ga0495662_0013542 | Ga0495662_0013542_1487_2380 | 242 |
| 422 | 3300046529 | Ga0495652_0100181 | Ga0495652_0100181_892_1785 | 242 |
| 423 | 3300046536 | Ga0495587_0119745 | Ga0495587_0119745_165_1058 | 242 |
| 424 | 3300046557 | Ga0495622_0015943 | Ga0495622_0015943_2073_2966 | 242 |
| 425 | 3300046663 | Ga0495635_0062488 | Ga0495635_0062488_412_1305 | 242 |
| 426 | 3300049576 | Ga0501040_0163990 | Ga0501040_0163990_289_1176 | 242 |
| 427 | 3300049822 | Ga0501035_0497170 | Ga0501035_0497170_12_872 | 242 |
| 428 | 3300050510 | nmdc:mga06r32_16871_c1 | nmdc:mga06r32_16871_c1_498_1400 | 242 |
| 429 | 3300050515 | nmdc:mga0a205_23580_c1 | nmdc:mga0a205_23580_c1_2749_3651 | 242 |
| 430 | 3300053085 | Ga0495619_0127838 | Ga0495619_0127838_230_1123 | 242 |
| 431 | 3300003203 | JGI25406J46586_10061084 | JGI25406J46586_100610842 | 243 |
| 432 | 3300003215 | JGI25153J46596_10000156 | JGI25153J46596_1000015613 | 243 |
| 433 | 3300003215 | JGI25153J46596_10001297 | JGI25153J46596_100012972 | 243 |
| 434 | 3300005985 | Ga0081539_10000977 | Ga0081539_1000097752 | 243 |
| 435 | 3300005985 | Ga0081539_10126197 | Ga0081539_101261972 | 243 |
| 436 | 3300006847 | Ga0075431_100598722 | Ga0075431_1005987221 | 243 |
| 437 | 3300025297 | Ga0209758_1000119 | Ga0209758_1000119166 | 243 |
| 438 | 3300025922 | Ga0207646_10109980 | Ga0207646_101099802 | 243 |
| 439 | 3300031235 | Ga0265330_10050509 | Ga0265330_100505092 | 243 |
| 440 | 3300031239 | Ga0265328_10043977 | Ga0265328_100439772 | 243 |
| 441 | 3300031247 | Ga0265340_10079294 | Ga0265340_100792942 | 243 |
| 442 | 3300031344 | Ga0265316_10034575 | Ga0265316_100345754 | 243 |
| 443 | 3300031711 | Ga0265314_10080258 | Ga0265314_100802582 | 243 |
| 444 | 3300031712 | Ga0265342_10051659 | Ga0265342_100516592 | 243 |
| 445 | 3300049568 | Ga0501031_0004612 | Ga0501031_0004612_5214_6104 | 243 |
| 446 | 3300049572 | Ga0501036_0025265 | Ga0501036_0025265_814_1704 | 243 |
| 447 | 3300049572 | Ga0501036_0262789 | Ga0501036_0262789_495_1394 | 243 |
| 448 | 3300049574 | Ga0501038_0176076 | Ga0501038_0176076_191_1081 | 243 |
| 449 | 3300049576 | Ga0501040_0003985 | Ga0501040_0003985_5159_6049 | 243 |
| 450 | 3300049577 | Ga0501041_0083116 | Ga0501041_0083116_788_1678 | 243 |
| 451 | 3300049578 | Ga0501042_0007794 | Ga0501042_0007794_5141_6031 | 243 |
| 452 | 3300049580 | Ga0501046_0097700 | Ga0501046_0097700_493_1392 | 243 |
| 453 | 3300049582 | Ga0501048_0001403 | Ga0501048_0001403_2436_3326 | 243 |
| 454 | 3300049583 | Ga0501067_0062754 | Ga0501067_0062754_929_1828 | 243 |
| 455 | 3300049587 | Ga0501071_0002460 | Ga0501071_0002460_3473_4363 | 243 |
| 456 | 3300049588 | Ga0501072_0008198 | Ga0501072_0008198_1715_2605 | 243 |
| 457 | 3300049589 | Ga0501073_0094983 | Ga0501073_0094983_894_1784 | 243 |
| 458 | 3300049590 | Ga0501074_0051376 | Ga0501074_0051376_982_1872 | 243 |
| 459 | 3300049591 | Ga0501075_0005483 | Ga0501075_0005483_3225_4115 | 243 |
| 460 | 3300049592 | Ga0501076_0010477 | Ga0501076_0010477_3287_4177 | 243 |
| 461 | 3300049741 | Ga0501079_0051651 | Ga0501079_0051651_777_1667 | 243 |
| 462 | 3300049742 | Ga0501080_0131803 | Ga0501080_0131803_735_1634 | 243 |
| 463 | 3300049742 | Ga0501080_0287125 | Ga0501080_0287125_529_1419 | 243 |
| 464 | 3300049743 | Ga0501081_0034615 | Ga0501081_0034615_971_1861 | 243 |
| 465 | 3300049744 | Ga0501083_0023722 | Ga0501083_0023722_96_995 | 243 |
| 466 | 3300049822 | Ga0501035_0039139 | Ga0501035_0039139_2310_3200 | 243 |
| 467 | 3300049824 | Ga0501045_0019068 | Ga0501045_0019068_1646_2536 | 243 |
| 468 | 3300053153 | Ga0500616_0002241 | Ga0500616_0002241_7248_8159 | 243 |
| 469 | 3300054114 | Ga0501084_0018632 | Ga0501084_0018632_2569_3459 | 243 |
| 470 | 3300060353 | Ga0501082_0034485 | Ga0501082_0034485_3271_4161 | 243 |
| 471 | 3300060353 | Ga0501082_0099324 | Ga0501082_0099324_1402_2301 | 243 |
| 472 | 3300005468 | Ga0070707_100315862 | Ga0070707_1003158622 | 244 |
| 473 | 3300005549 | Ga0070704_100042576 | Ga0070704_1000425763 | 244 |
| 474 | 3300005985 | Ga0081539_10027690 | Ga0081539_100276903 | 244 |
| 475 | 3300006852 | Ga0075433_10083595 | Ga0075433_100835952 | 244 |
| 476 | 3300025922 | Ga0207646_10036457 | Ga0207646_100364573 | 244 |
| 477 | 3300031995 | Ga0307409_100157590 | Ga0307409_1001575902 | 244 |
| 478 | 3300047319 | Ga0495674_0333620 | Ga0495674_0333620_50_1009 | 244 |
| 479 | 3300049575 | Ga0501039_0091123 | Ga0501039_0091123_945_1898 | 244 |
| 480 | 3300049591 | Ga0501075_0046501 | Ga0501075_0046501_1916_2869 | 244 |
| 481 | 3300006914 | Ga0075436_100112983 | Ga0075436_1001129832 | 245 |
| 482 | 3300007076 | Ga0075435_100281523 | Ga0075435_1002815232 | 245 |
| 483 | 3300007265 | Ga0099794_10002875 | Ga0099794_100028757 | 245 |
| 484 | 3300021384 | Ga0213876_10020344 | Ga0213876_100203443 | 245 |
| 485 | 3300025910 | Ga0207684_10292974 | Ga0207684_102929742 | 245 |
| 486 | 3300027671 | Ga0209588_1004368 | Ga0209588_10043683 | 245 |
| 487 | 3300039437 | Ga0436365_0199037 | Ga0436365_0199037_21712_22638 | 245 |
| 488 | 3300050514 | nmdc:mga08x19_71853_c1 | nmdc:mga08x19_71853_c1_404_1294 | 245 |
| 489 | 3300005985 | Ga0081539_10071160 | Ga0081539_100711601 | 246 |
| 490 | 3300031852 | Ga0307410_10100712 | Ga0307410_101007122 | 246 |
| 491 | 3300031901 | Ga0307406_10301164 | Ga0307406_103011642 | 246 |
| 492 | 3300032002 | Ga0307416_100022715 | Ga0307416_1000227153 | 246 |
| 493 | 3300032126 | Ga0307415_100338116 | Ga0307415_1003381162 | 246 |
| 494 | 3300044694 | Ga0466963_0296361 | Ga0466963_0296361_27_953 | 246 |
| 495 | 3300049578 | Ga0501042_0119210 | Ga0501042_0119210_874_1779 | 246 |
| 496 | 3300049592 | Ga0501076_0116666 | Ga0501076_0116666_459_1364 | 246 |
| 497 | 3300059424 | Ga0590075_021824 | Ga0590075_021824_146_1051 | 246 |
| 498 | 3300059426 | Ga0590077_006279 | Ga0590077_006279_232_1137 | 246 |
| 499 | 3300061734 | Ga0530510_0013307 | Ga0530510_0013307_2990_3886 | 246 |
| 500 | 3300021441 | Ga0213871_10008183 | Ga0213871_100081832 | 247 |
| 501 | 3300025254 | Ga0209148_1010860 | Ga0209148_10108602 | 247 |
| 502 | 3300032002 | Ga0307416_100227590 | Ga0307416_1002275902 | 247 |
| 503 | 3300039438 | Ga0436360_0631597 | Ga0436360_0631597_1499_2425 | 247 |
| 504 | 3300039453 | Ga0436362_0332095 | Ga0436362_0332095_1640_2566 | 247 |
| 505 | 3300039453 | Ga0436362_0650647 | Ga0436362_0650647_426_1379 | 247 |
| 506 | 3300049582 | Ga0501048_0330334 | Ga0501048_0330334_10_924 | 247 |
| 507 | 3300006847 | Ga0075431_100278718 | Ga0075431_1002787182 | 248 |
| 508 | 3300025922 | Ga0207646_10059172 | Ga0207646_100591723 | 248 |
| 509 | 3300031711 | Ga0265314_10048196 | Ga0265314_100481963 | 248 |
| 510 | 3300049568 | Ga0501031_0110034 | Ga0501031_0110034_461_1369 | 248 |
| 511 | 3300049569 | Ga0501032_0002226 | Ga0501032_0002226_12896_13804 | 248 |
| 512 | 3300049570 | Ga0501033_0002027 | Ga0501033_0002027_7004_7912 | 248 |
| 513 | 3300049571 | Ga0501034_0003286 | Ga0501034_0003286_5572_6480 | 248 |
| 514 | 3300049572 | Ga0501036_0006183 | Ga0501036_0006183_3872_4780 | 248 |
| 515 | 3300049573 | Ga0501037_0022625 | Ga0501037_0022625_1850_2758 | 248 |
| 516 | 3300049574 | Ga0501038_0026151 | Ga0501038_0026151_1880_2788 | 248 |
| 517 | 3300049575 | Ga0501039_0000586 | Ga0501039_0000586_20022_20930 | 248 |
| 518 | 3300049579 | Ga0501043_0002665 | Ga0501043_0002665_7004_7912 | 248 |
| 519 | 3300049580 | Ga0501046_0001687 | Ga0501046_0001687_14550_15458 | 248 |
| 520 | 3300049581 | Ga0501047_0008214 | Ga0501047_0008214_3573_4481 | 248 |
| 521 | 3300049582 | Ga0501048_0033443 | Ga0501048_0033443_2389_3297 | 248 |
| 522 | 3300049583 | Ga0501067_0000637 | Ga0501067_0000637_16949_17857 | 248 |
| 523 | 3300049584 | Ga0501068_0013853 | Ga0501068_0013853_1589_2497 | 248 |
| 524 | 3300049585 | Ga0501069_0003362 | Ga0501069_0003362_4455_5363 | 248 |
| 525 | 3300049586 | Ga0501070_0001189 | Ga0501070_0001189_12303_13211 | 248 |
| 526 | 3300049589 | Ga0501073_0002428 | Ga0501073_0002428_1044_1952 | 248 |
| 527 | 3300049590 | Ga0501074_0002168 | Ga0501074_0002168_6507_7415 | 248 |
| 528 | 3300049592 | Ga0501076_0267740 | Ga0501076_0267740_131_1039 | 248 |
| 529 | 3300049741 | Ga0501079_0063412 | Ga0501079_0063412_157_1065 | 248 |
| 530 | 3300049742 | Ga0501080_0001509 | Ga0501080_0001509_13170_14078 | 248 |
| 531 | 3300049744 | Ga0501083_0000158 | Ga0501083_0000158_39925_40833 | 248 |
| 532 | 3300049822 | Ga0501035_0014966 | Ga0501035_0014966_2164_3072 | 248 |
| 533 | 3300049823 | Ga0501044_0025282 | Ga0501044_0025282_3787_4695 | 248 |
| 534 | 3300050510 | nmdc:mga06r32_200856_c1 | nmdc:mga06r32_200856_c1_537_1448 | 248 |
| 535 | 3300054114 | Ga0501084_0004046 | Ga0501084_0004046_889_1797 | 248 |
| 536 | 3300060353 | Ga0501082_0001437 | Ga0501082_0001437_16968_17876 | 248 |
| 537 | 3300021361 | Ga0213872_10050912 | Ga0213872_100509122 | 249 |
| 538 | 3300039447 | Ga0436361_0319848 | Ga0436361_0319848_187_1119 | 249 |
| 539 | 3300053731 | Ga0500609_001315 | Ga0500609_001315_711_1622 | 249 |
| 540 | 3300005468 | Ga0070707_100496225 | Ga0070707_1004962251 | 250 |
| 541 | 3300009147 | Ga0114129_10057876 | Ga0114129_100578764 | 250 |
| 542 | iso_pu_bacteria | 2510917028 | 2511184805 | 250 |
| 543 | 3300005471 | Ga0070698_100106581 | Ga0070698_1001065812 | 251 |
| 544 | 3300035695 | Ga0373927_0006704 | Ga0373927_0006704_1396_2304 | 251 |
| 545 | 3300039450 | Ga0436363_0406837 | Ga0436363_0406837_470_1378 | 252 |
| 546 | 3300044684 | Ga0466966_0113944 | Ga0466966_0113944_534_1433 | 252 |
| 547 | 3300044719 | Ga0466971_0087081 | Ga0466971_0087081_175_1074 | 252 |
| 548 | 3300045049 | Ga0466959_0024348 | Ga0466959_0024348_335_1234 | 252 |
| 549 | 3300045836 | Ga0466958_0124082 | Ga0466958_0124082_328_1227 | 252 |
| 550 | 3300005293 | Ga0065715_10110124 | Ga0065715_101101243 | 253 |
| 551 | 3300005327 | Ga0070658_10313008 | Ga0070658_103130082 | 253 |
| 552 | 3300005330 | Ga0070690_100001347 | Ga0070690_10000134711 | 253 |
| 553 | 3300005331 | Ga0070670_100043042 | Ga0070670_1000430423 | 253 |
| 554 | 3300005334 | Ga0068869_100096304 | Ga0068869_1000963042 | 253 |
| 555 | 3300005335 | Ga0070666_10012643 | Ga0070666_100126434 | 253 |
| 556 | 3300005338 | Ga0068868_100000669 | Ga0068868_10000066911 | 253 |
| 557 | 3300005340 | Ga0070689_100003750 | Ga0070689_10000375011 | 253 |
| 558 | 3300005343 | Ga0070687_100075695 | Ga0070687_1000756952 | 253 |
| 559 | 3300005355 | Ga0070671_100018593 | Ga0070671_1000185934 | 253 |
| 560 | 3300005364 | Ga0070673_100002342 | Ga0070673_10000234210 | 253 |
| 561 | 3300005365 | Ga0070688_100019491 | Ga0070688_1000194913 | 253 |
| 562 | 3300005367 | Ga0070667_100026883 | Ga0070667_1000268833 | 253 |
| 563 | 3300005434 | Ga0070709_10115790 | Ga0070709_101157902 | 253 |
| 564 | 3300005436 | Ga0070713_100050023 | Ga0070713_1000500232 | 253 |
| 565 | 3300005439 | Ga0070711_100028417 | Ga0070711_1000284173 | 253 |
| 566 | 3300005458 | Ga0070681_10112325 | Ga0070681_101123252 | 253 |
| 567 | 3300005466 | Ga0070685_10003867 | Ga0070685_100038673 | 253 |
| 568 | 3300005544 | Ga0070686_100110246 | Ga0070686_1001102462 | 253 |
| 569 | 3300005548 | Ga0070665_100016632 | Ga0070665_1000166324 | 253 |
| 570 | 3300005615 | Ga0070702_100187347 | Ga0070702_1001873472 | 253 |
| 571 | 3300005617 | Ga0068859_100053441 | Ga0068859_1000534414 | 253 |
| 572 | 3300005618 | Ga0068864_100035018 | Ga0068864_1000350182 | 253 |
| 573 | 3300005841 | Ga0068863_100029706 | Ga0068863_1000297064 | 253 |
| 574 | 3300005842 | Ga0068858_100247312 | Ga0068858_1002473122 | 253 |
| 575 | 3300005843 | Ga0068860_100036412 | Ga0068860_1000364124 | 253 |
| 576 | 3300005937 | Ga0081455_10049099 | Ga0081455_100490993 | 253 |
| 577 | 3300006163 | Ga0070715_10024930 | Ga0070715_100249302 | 253 |
| 578 | 3300006175 | Ga0070712_100121253 | Ga0070712_1001212532 | 253 |
| 579 | 3300006237 | Ga0097621_100195092 | Ga0097621_1001950922 | 253 |
| 580 | 3300006358 | Ga0068871_100051187 | Ga0068871_1000511873 | 253 |
| 581 | 3300006358 | Ga0068871_100086639 | Ga0068871_1000866392 | 253 |
| 582 | 3300006931 | Ga0097620_100053439 | Ga0097620_1000534394 | 253 |
| 583 | 3300009098 | Ga0105245_10004428 | Ga0105245_100044284 | 253 |
| 584 | 3300009176 | Ga0105242_10079910 | Ga0105242_100799103 | 253 |
| 585 | 3300009177 | Ga0105248_10514000 | Ga0105248_105140002 | 253 |
| 586 | 3300009551 | Ga0105238_10444174 | Ga0105238_104441742 | 253 |
| 587 | 3300011119 | Ga0105246_10465977 | Ga0105246_104659771 | 253 |
| 588 | 3300013296 | Ga0157374_10001150 | Ga0157374_1000115018 | 253 |
| 589 | 3300013306 | Ga0163162_10085182 | Ga0163162_100851822 | 253 |
| 590 | 3300013308 | Ga0157375_10001887 | Ga0157375_100018873 | 253 |
| 591 | 3300014968 | Ga0157379_10025961 | Ga0157379_100259612 | 253 |
| 592 | 3300014969 | Ga0157376_10104162 | Ga0157376_101041622 | 253 |
| 593 | 3300025903 | Ga0207680_10030975 | Ga0207680_100309753 | 253 |
| 594 | 3300025906 | Ga0207699_10101575 | Ga0207699_101015752 | 253 |
| 595 | 3300025915 | Ga0207693_10012669 | Ga0207693_100126692 | 253 |
| 596 | 3300025915 | Ga0207693_10015531 | Ga0207693_100155314 | 253 |
| 597 | 3300025918 | Ga0207662_10031121 | Ga0207662_100311212 | 253 |
| 598 | 3300025925 | Ga0207650_10035282 | Ga0207650_100352823 | 253 |
| 599 | 3300025927 | Ga0207687_10000492 | Ga0207687_100004925 | 253 |
| 600 | 3300025928 | Ga0207700_10113101 | Ga0207700_101131012 | 253 |
| 601 | 3300025931 | Ga0207644_10011954 | Ga0207644_100119543 | 253 |
| 602 | 3300025934 | Ga0207686_10163666 | Ga0207686_101636662 | 253 |
| 603 | 3300025936 | Ga0207670_10007955 | Ga0207670_100079554 | 253 |
| 604 | 3300025938 | Ga0207704_10256863 | Ga0207704_102568632 | 253 |
| 605 | 3300025939 | Ga0207665_10012130 | Ga0207665_100121303 | 253 |
| 606 | 3300025941 | Ga0207711_10000323 | Ga0207711_1000032332 | 253 |
| 607 | 3300025960 | Ga0207651_10002690 | Ga0207651_1000269010 | 253 |
| 608 | 3300025986 | Ga0207658_10011876 | Ga0207658_100118763 | 253 |
| 609 | 3300026023 | Ga0207677_10000457 | Ga0207677_100004573 | 253 |
| 610 | 3300026035 | Ga0207703_10005665 | Ga0207703_100056659 | 253 |
| 611 | 3300026078 | Ga0207702_10099356 | Ga0207702_100993562 | 253 |
| 612 | 3300026088 | Ga0207641_10025247 | Ga0207641_100252472 | 253 |
| 613 | 3300026095 | Ga0207676_10000704 | Ga0207676_1000070411 | 253 |
| 614 | 3300026142 | Ga0207698_10027960 | Ga0207698_100279602 | 253 |
| 615 | 3300028379 | Ga0268266_10167571 | Ga0268266_101675712 | 253 |
| 616 | 3300028381 | Ga0268264_10005778 | Ga0268264_100057785 | 253 |
| 617 | 3300035086 | Ga0373934_0019550 | Ga0373934_0019550_719_1621 | 253 |
| 618 | 3300035116 | Ga0373945_0011628 | Ga0373945_0011628_300_1202 | 253 |
| 619 | 3300035116 | Ga0373945_0026139 | Ga0373945_0026139_1059_1961 | 253 |
| 620 | 3300035117 | Ga0373953_0029257 | Ga0373953_0029257_321_1223 | 253 |
| 621 | 3300035118 | Ga0373954_0014406 | Ga0373954_0014406_903_1805 | 253 |
| 622 | 3300035118 | Ga0373954_0047352 | Ga0373954_0047352_913_1815 | 253 |
| 623 | 3300035119 | Ga0373956_0017966 | Ga0373956_0017966_2008_2910 | 253 |
| 624 | 3300035119 | Ga0373956_0058894 | Ga0373956_0058894_232_1134 | 253 |
| 625 | 3300035120 | Ga0373957_0022350 | Ga0373957_0022350_1188_2090 | 253 |
| 626 | 3300035170 | Ga0373943_0017068 | Ga0373943_0017068_2039_2941 | 253 |
| 627 | 3300035172 | Ga0373955_0014540 | Ga0373955_0014540_1848_2750 | 253 |
| 628 | 3300035172 | Ga0373955_0035471 | Ga0373955_0035471_372_1274 | 253 |
| 629 | 3300035410 | Ga0373924_0039681 | Ga0373924_0039681_323_1225 | 253 |
| 630 | 3300035692 | Ga0373935_0029554 | Ga0373935_0029554_1833_2735 | 253 |
| 631 | 3300035695 | Ga0373927_0011563 | Ga0373927_0011563_974_1876 | 253 |
| 632 | 3300035695 | Ga0373927_0013114 | Ga0373927_0013114_1525_2427 | 253 |
| 633 | 3300035724 | Ga0373933_0027325 | Ga0373933_0027325_2138_3040 | 253 |
| 634 | 3300035725 | Ga0373947_0019642 | Ga0373947_0019642_1389_2291 | 253 |
| 635 | 3300036401 | Ga0373937_0032263 | Ga0373937_0032263_3282_4184 | 253 |
| 636 | 3300036401 | Ga0373937_0051695 | Ga0373937_0051695_1719_2621 | 253 |
| 637 | 3300037068 | Ga0373925_0012185 | Ga0373925_0012185_1479_2381 | 253 |
| 638 | 3300037068 | Ga0373925_0035772 | Ga0373925_0035772_675_1577 | 253 |
| 639 | 3300046459 | Ga0495629_0136800 | Ga0495629_0136800_788_1690 | 253 |
| 640 | 3300046462 | Ga0495651_0213294 | Ga0495651_0213294_409_1311 | 253 |
| 641 | 3300046472 | Ga0495580_0160861 | Ga0495580_0160861_579_1481 | 253 |
| 642 | 3300046473 | Ga0495582_0016638 | Ga0495582_0016638_281_1183 | 253 |
| 643 | 3300046475 | Ga0495639_0004411 | Ga0495639_0004411_272_1174 | 253 |
| 644 | 3300046477 | Ga0495664_0008311 | Ga0495664_0008311_2141_3043 | 253 |
| 645 | 3300046516 | Ga0495628_0142228 | Ga0495628_0142228_409_1311 | 253 |
| 646 | 3300046517 | Ga0495630_0175478 | Ga0495630_0175478_695_1597 | 253 |
| 647 | 3300046531 | Ga0495665_0135066 | Ga0495665_0135066_320_1222 | 253 |
| 648 | 3300046535 | Ga0495586_0113270 | Ga0495586_0113270_442_1344 | 253 |
| 649 | 3300046536 | Ga0495587_0077622 | Ga0495587_0077622_411_1313 | 253 |
| 650 | 3300046543 | Ga0495645_0018391 | Ga0495645_0018391_2612_3514 | 253 |
| 651 | 3300046559 | Ga0495667_0122879 | Ga0495667_0122879_85_987 | 253 |
| 652 | 3300046663 | Ga0495635_0028152 | Ga0495635_0028152_2047_2949 | 253 |
| 653 | 3300046679 | Ga0495623_0121986 | Ga0495623_0121986_600_1502 | 253 |
| 654 | 3300046683 | Ga0495658_0049725 | Ga0495658_0049725_867_1769 | 253 |
| 655 | 3300046689 | Ga0495613_0112224 | Ga0495613_0112224_72_974 | 253 |
| 656 | 3300047315 | Ga0495581_0007010 | Ga0495581_0007010_987_1889 | 253 |
| 657 | 3300047322 | Ga0495680_0029512 | Ga0495680_0029512_2714_3616 | 253 |
| 658 | 3300047471 | Ga0495684_0014543 | Ga0495684_0014543_4644_5546 | 253 |
| 659 | 3300048088 | Ga0495602_0116242 | Ga0495602_0116242_901_1803 | 253 |
| 660 | 3300048907 | Ga0496104_0131465 | Ga0496104_0131465_487_1389 | 253 |
| 661 | 3300048908 | Ga0496105_0272851 | Ga0496105_0272851_281_1183 | 253 |
| 662 | 3300048909 | Ga0496106_0221486 | Ga0496106_0221486_314_1216 | 253 |
| 663 | 3300048911 | Ga0496108_0180828 | Ga0496108_0180828_300_1202 | 253 |
| 664 | 3300048912 | Ga0496109_0128762 | Ga0496109_0128762_1049_1951 | 253 |
| 665 | 3300048915 | Ga0496112_0028842 | Ga0496112_0028842_3865_4767 | 253 |
| 666 | 3300048918 | Ga0496115_0205429 | Ga0496115_0205429_591_1493 | 253 |
| 667 | 3300049571 | Ga0501034_0012148 | Ga0501034_0012148_3880_4797 | 253 |
| 668 | 3300053077 | Ga0495601_0143533 | Ga0495601_0143533_601_1503 | 253 |
| 669 | 3300053078 | Ga0495612_0007186 | Ga0495612_0007186_683_1585 | 253 |
| 670 | 3300053085 | Ga0495619_0025307 | Ga0495619_0025307_620_1522 | 253 |
| 671 | iso_pu_bacteria | 2952252522 | 2952255968 | 253 |
| 672 | 3300006038 | Ga0075365_10000130 | Ga0075365_1000013011 | 254 |
| 673 | 3300006048 | Ga0075363_100056935 | Ga0075363_1000569352 | 254 |
| 674 | 3300006177 | Ga0075362_10016131 | Ga0075362_100161313 | 254 |
| 675 | 3300006178 | Ga0075367_10000511 | Ga0075367_100005112 | 254 |
| 676 | 3300006186 | Ga0075369_10000560 | Ga0075369_1000056014 | 254 |
| 677 | 3300009766 | Ga0123342_1003902 | Ga0123342_100390218 | 254 |
| 678 | 3300053130 | Ga0500642_0014769 | Ga0500642_0014769_1981_2892 | 254 |
| 679 | 3300002737 | JGI25162J39368_1001199 | JGI25162J39368_100119910 | 255 |
| 680 | 3300002987 | JGI25159J45721_1007086 | JGI25159J45721_10070862 | 255 |
| 681 | 3300003214 | JGI25165J46597_1000736 | JGI25165J46597_100073613 | 255 |
| 682 | 3300003354 | JGI25160J50197_1000046 | JGI25160J50197_100004691 | 255 |
| 683 | 3300003374 | JGI25161J50226_1000031 | JGI25161J50226_100003191 | 255 |
| 684 | 3300004625 | Ga0055543_1000008 | Ga0055543_1000008158 | 255 |
| 685 | 3300005262 | Ga0065165_1000336 | Ga0065165_100033631 | 255 |
| 686 | 3300005436 | Ga0070713_100000036 | Ga0070713_10000003635 | 255 |
| 687 | 3300005468 | Ga0070707_100036625 | Ga0070707_1000366254 | 255 |
| 688 | 3300005539 | Ga0068853_100054451 | Ga0068853_1000544513 | 255 |
| 689 | 3300005548 | Ga0070665_100565817 | Ga0070665_1005658172 | 255 |
| 690 | 3300005937 | Ga0081455_10022903 | Ga0081455_100229032 | 255 |
| 691 | 3300006175 | Ga0070712_100368939 | Ga0070712_1003689392 | 255 |
| 692 | 3300009551 | Ga0105238_10017601 | Ga0105238_100176013 | 255 |
| 693 | 3300025233 | Ga0209437_100086 | Ga0209437_100086200 | 255 |
| 694 | 3300025261 | Ga0209233_1000465 | Ga0209233_100046513 | 255 |
| 695 | 3300025284 | Ga0209130_1000088 | Ga0209130_100008837 | 255 |
| 696 | 3300025302 | Ga0207426_1000012 | Ga0207426_100001292 | 255 |
| 697 | 3300025910 | Ga0207684_10360300 | Ga0207684_103603002 | 255 |
| 698 | 3300025924 | Ga0207694_10011943 | Ga0207694_100119436 | 255 |
| 699 | 3300025928 | Ga0207700_10000098 | Ga0207700_100000982 | 255 |
| 700 | 3300026041 | Ga0207639_10262055 | Ga0207639_102620552 | 255 |
| 701 | 3300028379 | Ga0268266_10543283 | Ga0268266_105432832 | 255 |
| 702 | 3300028794 | Ga0307515_10266394 | Ga0307515_102663941 | 255 |
| 703 | 3300046530 | Ga0495654_0015133 | Ga0495654_0015133_2359_3267 | 255 |
| 704 | 3300048929 | Ga0496126_0327513 | Ga0496126_0327513_258_1163 | 255 |
| 705 | 3300049568 | Ga0501031_0024825 | Ga0501031_0024825_2459_3412 | 255 |
| 706 | 3300049571 | Ga0501034_0126998 | Ga0501034_0126998_68_967 | 255 |
| 707 | 3300049572 | Ga0501036_0117389 | Ga0501036_0117389_437_1390 | 255 |
| 708 | 3300049572 | Ga0501036_0169838 | Ga0501036_0169838_97_1050 | 255 |
| 709 | 3300049574 | Ga0501038_0048695 | Ga0501038_0048695_1449_2402 | 255 |
| 710 | 3300049575 | Ga0501039_0010466 | Ga0501039_0010466_854_1807 | 255 |
| 711 | 3300049576 | Ga0501040_0055736 | Ga0501040_0055736_773_1726 | 255 |
| 712 | 3300049577 | Ga0501041_0015917 | Ga0501041_0015917_831_1784 | 255 |
| 713 | 3300049577 | Ga0501041_0018770 | Ga0501041_0018770_1978_2931 | 255 |
| 714 | 3300049578 | Ga0501042_0051176 | Ga0501042_0051176_839_1792 | 255 |
| 715 | 3300049581 | Ga0501047_0134752 | Ga0501047_0134752_1309_2208 | 255 |
| 716 | 3300049582 | Ga0501048_0056054 | Ga0501048_0056054_1477_2430 | 255 |
| 717 | 3300049585 | Ga0501069_0081037 | Ga0501069_0081037_385_1284 | 255 |
| 718 | 3300049587 | Ga0501071_0036582 | Ga0501071_0036582_958_1911 | 255 |
| 719 | 3300049588 | Ga0501072_0096441 | Ga0501072_0096441_89_1042 | 255 |
| 720 | 3300049588 | Ga0501072_0133490 | Ga0501072_0133490_187_1140 | 255 |
| 721 | 3300049589 | Ga0501073_0027936 | Ga0501073_0027936_2870_3769 | 255 |
| 722 | 3300049590 | Ga0501074_0004036 | Ga0501074_0004036_1392_2345 | 255 |
| 723 | 3300049591 | Ga0501075_0021321 | Ga0501075_0021321_933_1886 | 255 |
| 724 | 3300049591 | Ga0501075_0047564 | Ga0501075_0047564_962_1915 | 255 |
| 725 | 3300049592 | Ga0501076_0018387 | Ga0501076_0018387_831_1784 | 255 |
| 726 | 3300049592 | Ga0501076_0143803 | Ga0501076_0143803_537_1490 | 255 |
| 727 | 3300049593 | Ga0501077_0037610 | Ga0501077_0037610_520_1473 | 255 |
| 728 | 3300049741 | Ga0501079_0045594 | Ga0501079_0045594_1621_2574 | 255 |
| 729 | 3300049742 | Ga0501080_0038807 | Ga0501080_0038807_820_1773 | 255 |
| 730 | 3300049742 | Ga0501080_0205514 | Ga0501080_0205514_297_1196 | 255 |
| 731 | 3300049743 | Ga0501081_0007210 | Ga0501081_0007210_1399_2352 | 255 |
| 732 | 3300049743 | Ga0501081_0009622 | Ga0501081_0009622_930_1883 | 255 |
| 733 | 3300049744 | Ga0501083_0024915 | Ga0501083_0024915_1910_2809 | 255 |
| 734 | 3300049744 | Ga0501083_0153724 | Ga0501083_0153724_264_1217 | 255 |
| 735 | 3300049822 | Ga0501035_0237650 | Ga0501035_0237650_276_1175 | 255 |
| 736 | 3300049824 | Ga0501045_0106724 | Ga0501045_0106724_314_1267 | 255 |
| 737 | 3300049824 | Ga0501045_0185672 | Ga0501045_0185672_482_1435 | 255 |
| 738 | 3300050512 | nmdc:mga0n895_57789_c1 | nmdc:mga0n895_57789_c1_2452_3351 | 255 |
| 739 | 3300054114 | Ga0501084_0136175 | Ga0501084_0136175_970_1923 | 255 |
| 740 | 3300054114 | Ga0501084_0205853 | Ga0501084_0205853_626_1579 | 255 |
| 741 | 3300054114 | Ga0501084_0298786 | Ga0501084_0298786_274_1227 | 255 |
| 742 | 3300060353 | Ga0501082_0034527 | Ga0501082_0034527_2063_3016 | 255 |
| 743 | 3300060353 | Ga0501082_0085352 | Ga0501082_0085352_97_1050 | 255 |
| 744 | 3300060353 | Ga0501082_0089372 | Ga0501082_0089372_1594_2547 | 255 |
| 745 | 3300060353 | Ga0501082_0112012 | Ga0501082_0112012_353_1252 | 255 |
| 746 | 3300060353 | Ga0501082_0555290 | Ga0501082_0555290_48_956 | 255 |
| 747 | 3300061734 | Ga0530510_0014497 | Ga0530510_0014497_3328_4281 | 255 |
| 748 | 3300061734 | Ga0530510_0080185 | Ga0530510_0080185_1025_1978 | 255 |
| 749 | 3300061734 | Ga0530510_0199064 | Ga0530510_0199064_302_1255 | 255 |
| 750 | 3300005445 | Ga0070708_100294083 | Ga0070708_1002940832 | 256 |
| 751 | 3300005536 | Ga0070697_100062748 | Ga0070697_1000627483 | 256 |
| 752 | 3300006163 | Ga0070715_10152427 | Ga0070715_101524272 | 256 |
| 753 | 3300009093 | Ga0105240_10290719 | Ga0105240_102907192 | 256 |
| 754 | 3300025913 | Ga0207695_10332327 | Ga0207695_103323272 | 256 |
| 755 | 3300031901 | Ga0307406_10381919 | Ga0307406_103819191 | 256 |
| 756 | 3300049586 | Ga0501070_0120041 | Ga0501070_0120041_271_1179 | 256 |
| 757 | 3300049589 | Ga0501073_0019824 | Ga0501073_0019824_2846_3754 | 256 |
| 758 | 3300049823 | Ga0501044_0211839 | Ga0501044_0211839_110_1018 | 256 |
| 759 | iso_pu_bacteria | 2667528174 | 2671112388 | 256 |
| 760 | iso_pu_bacteria | 2818991448 | 2819608389 | 256 |
| 761 | 3300049569 | Ga0501032_0236835 | Ga0501032_0236835_59_970 | 257 |
| 762 | 3300053153 | Ga0500616_0041725 | Ga0500616_0041725_137_1036 | 257 |
| 763 | 3300005327 | Ga0070658_10039894 | Ga0070658_100398942 | 258 |
| 764 | 3300049570 | Ga0501033_0181645 | Ga0501033_0181645_419_1330 | 258 |
| 765 | 3300049571 | Ga0501034_0269483 | Ga0501034_0269483_405_1316 | 258 |
| 766 | 3300049583 | Ga0501067_0045462 | Ga0501067_0045462_1194_2105 | 258 |
| 767 | 3300049586 | Ga0501070_0136562 | Ga0501070_0136562_498_1409 | 258 |
| 768 | 3300049589 | Ga0501073_0007864 | Ga0501073_0007864_3622_4533 | 258 |
| 769 | 3300049589 | Ga0501073_0067011 | Ga0501073_0067011_1455_2366 | 258 |
| 770 | 3300049744 | Ga0501083_0020202 | Ga0501083_0020202_3555_4466 | 258 |
| 771 | 3300049822 | Ga0501035_0139660 | Ga0501035_0139660_15_926 | 258 |
| 772 | 3300049823 | Ga0501044_0018357 | Ga0501044_0018357_6489_7400 | 258 |
| 773 | 3300053093 | Ga0500651_0066760 | Ga0500651_0066760_587_1510 | 258 |
| 774 | 3300053094 | Ga0500566_0102525 | Ga0500566_0102525_379_1302 | 258 |
| 775 | 3300053119 | Ga0500595_000923 | Ga0500595_000923_4315_5238 | 258 |
| 776 | 3300053156 | Ga0500622_0049006 | Ga0500622_0049006_1073_1996 | 258 |
| 777 | 3300054114 | Ga0501084_0132751 | Ga0501084_0132751_139_1050 | 258 |
| 778 | 3300041509 | Ga0451843_0035460 | Ga0451843_0035460_239_1144 | 259 |
| 779 | 3300048924 | Ga0496121_0055547 | Ga0496121_0055547_2171_3076 | 259 |
| 780 | 3300049571 | Ga0501034_0344942 | Ga0501034_0344942_471_1379 | 259 |
| 781 | 3300001979 | JGI24740J21852_10000204 | JGI24740J21852_1000020413 | 260 |
| 782 | 3300002704 | JGI25155J39150_1000023 | JGI25155J39150_100002371 | 260 |
| 783 | 3300002705 | JGI25156J39149_1000029 | JGI25156J39149_1000029106 | 260 |
| 784 | 3300002705 | JGI25156J39149_1000094 | JGI25156J39149_100009414 | 260 |
| 785 | 3300002737 | JGI25162J39368_1000587 | JGI25162J39368_100058712 | 260 |
| 786 | 3300002738 | JGI25154J39366_1000067 | JGI25154J39366_100006772 | 260 |
| 787 | 3300002741 | JGI25157J39369_1000043 | JGI25157J39369_100004356 | 260 |
| 788 | 3300003214 | JGI25165J46597_1000341 | JGI25165J46597_100034118 | 260 |
| 789 | 3300003322 | rootL2_10045651 | rootL2_100456512 | 260 |
| 790 | 3300025206 | Ga0209435_100011 | Ga0209435_100011304 | 260 |
| 791 | 3300025233 | Ga0209437_100036 | Ga0209437_10003648 | 260 |
| 792 | 3300025246 | Ga0209646_1000024 | Ga0209646_1000024107 | 260 |
| 793 | 3300025250 | Ga0209026_1000030 | Ga0209026_1000030107 | 260 |
| 794 | 3300025256 | Ga0209759_1000011 | Ga0209759_1000011304 | 260 |
| 795 | 3300025261 | Ga0209233_1000166 | Ga0209233_100016648 | 260 |
| 796 | 3300026078 | Ga0207702_10143054 | Ga0207702_101430542 | 260 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
124
308
0.99
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.3466 | 4 | 244 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.3381 | 4 | 244 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.2988 | 22 | 246 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.2908 | 22 | 246 |
| 4bjn-assembly4.cif.gz_H | crystal structure of the flax-rust effector avrm-a | 0.2758 | 128 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.5857 | 123 | 245 | 1.10.3720.10 |
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.5737 | 123 | 245 | 1.10.3720.10 |
| af_P45767_178_390_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.5343 | 115 | 250 | 1.10.3720.10 |
| af_P0AF01_2_224_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4678 | 120 | 250 | 1.10.3720.10 |
| af_Q2FVE9_63_269_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4269 | 19 | 247 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8NB95-F1-model_v4 | deleted | 0.7649 | 122 | 205 |
|
| AF-A0A2X3J780-F1-model_v4 | Glutathione transport system permease protein gsiD | 0.7501 | 115 | 228 |
GO:0005886
GO:0055085 |
| AF-A0A2S8NB95-F1-model_v4 | deleted | 0.7485 | 122 | 205 |
|
| AF-A0A2M8N531-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.7312 | 118 | 229 |
GO:0005886
GO:0055085 |
| AF-A0A2X3J780-F1-model_v4 | Glutathione transport system permease protein gsiD | 0.6962 | 115 | 228 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar