F481190

General Info

Members Datasets Scaffolds Average Seq Length
796 393 791 271

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10020344|Ga0213876_100203443
Length 308
Sequence MLTDPGGASAPAAITSETTSIASPVALVPRGSASTTWRRFRRNRGAVIGLGIIAVYVAMALFANLLAPYDPLDGQLVLKLQPPSAAHWLGTDELGRDLLSRLLYGARSSLEIQVTAVAFSLCVGVVWGLVSGYFGGPLDEASMRVADVLLAFPSILLAISIVAILGNGLFSIVLAVGAVSVPQFARLVRGLVLGIRETDYVEAARAIGESHFSILSRYILPNTTAPIIVQTTLRMATVLLVASGLNFLGLGVVPPTPEWGSMLSNAREYMFQSIHVTLIPGLAITLVVIGFNLVGDGLRDALDPRMRS

Samples

Sample ID Description Type Environment
1 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
2 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
3 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
4 2952252522 Salinicola sp. DM10 Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
140 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
141 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
213 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
235 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
239 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
257 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
258 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
259 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
300 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
306 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
346 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
357 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
375 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
376 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
377 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
378 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
379 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
380 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
381 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
382 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
383 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
384 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
393 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.03
Nodule 0.13
Rhizoplane 3.77
Rhizosphere 86.93
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000204 3300001979 Bacteria 24594
2 JGI24743J22301_10004626 3300001991 Bacteria 2254
3 JGI24738J21930_10004260 3300002075 Bacteria 3523
4 JGI25155J39150_1000023 3300002704 Bacteria 136961
5 JGI25156J39149_1000029 3300002705 Bacteria 126505
6 JGI25156J39149_1000094 3300002705 Bacteria 65145
7 JGI25162J39368_1000587 3300002737 Bacteria 26590
8 JGI25162J39368_1001199 3300002737 Bacteria 15163
9 JGI25154J39366_1000067 3300002738 Bacteria 100452
10 JGI25157J39369_1000043 3300002741 Bacteria 122537
11 JGI25159J45721_1007086 3300002987 Bacteria 3263
12 JGI25406J46586_10036843 3300003203 Bacteria 1771
13 JGI25406J46586_10061084 3300003203 Bacteria 1217
14 JGI25165J46597_1000341 3300003214 Bacteria 53973
15 JGI25165J46597_1000736 3300003214 Bacteria 25593
16 JGI25153J46596_10000156 3300003215 Bacteria 68489
17 JGI25153J46596_10001297 3300003215 Bacteria 14964
18 rootL2_10045651 3300003322 Bacteria 7783
19 rootH1_10014150 3300003323 Bacteria 1490
20 JGI25160J50197_1000046 3300003354 Bacteria 141352
21 JGI25161J50226_1000031 3300003374 Bacteria 141352
22 Ga0055543_1000008 3300004625 Bacteria 202062
23 Ga0065165_1000336 3300005262 Bacteria 76934
24 Ga0065715_10110124 3300005293 Bacteria 2635
25 Ga0070658_10020740 3300005327 Bacteria 5265
26 Ga0070658_10039894 3300005327 Bacteria 3788
27 Ga0070658_10313008 3300005327 Bacteria 1340
28 Ga0070683_100009813 3300005329 Bacteria 8203
29 Ga0070683_100129967 3300005329 Bacteria 2383
30 Ga0070683_100153607 3300005329 Bacteria 2182
31 Ga0070690_100001347 3300005330 Bacteria 12768
32 Ga0070670_100043042 3300005331 Bacteria 3883
33 Ga0068869_100040311 3300005334 Bacteria 3339
34 Ga0068869_100096304 3300005334 Bacteria 2233
35 Ga0070666_10012643 3300005335 Bacteria 5332
36 Ga0070682_100028510 3300005337 Bacteria 3358
37 Ga0068868_100000669 3300005338 Bacteria 23003
38 Ga0068868_100043148 3300005338 Bacteria 3522
39 Ga0068868_100069325 3300005338 Bacteria 2810
40 Ga0070660_100005700 3300005339 Bacteria 8630
41 Ga0070689_100003750 3300005340 Bacteria 10171
42 Ga0070691_10016189 3300005341 Bacteria 3425
43 Ga0070687_100075695 3300005343 Bacteria 1821
44 Ga0070687_100167740 3300005343 Bacteria 1304
45 Ga0070661_100026778 3300005344 Bacteria 4149
46 Ga0070661_100033844 3300005344 Bacteria 3704
47 Ga0070692_10014580 3300005345 Bacteria 3697
48 Ga0070692_10106324 3300005345 Bacteria 1546
49 Ga0070668_100054343 3300005347 Bacteria 3089
50 Ga0070675_100021763 3300005354 Bacteria 5122
51 Ga0070675_100073527 3300005354 Bacteria 2838
52 Ga0070675_100258171 3300005354 Bacteria 1526
53 Ga0070675_100370959 3300005354 Bacteria 1272
54 Ga0070671_100018593 3300005355 Bacteria 5646
55 Ga0070674_100109701 3300005356 Bacteria 2024
56 Ga0070673_100002342 3300005364 Bacteria 11514
57 Ga0070673_100018676 3300005364 Bacteria 4960
58 Ga0070688_100019491 3300005365 Bacteria 3931
59 Ga0070688_100081964 3300005365 Bacteria 2090
60 Ga0070659_100055975 3300005366 Bacteria 3109
61 Ga0070667_100026883 3300005367 Bacteria 4788
62 Ga0070667_100038389 3300005367 Bacteria 4014
63 Ga0070709_10115790 3300005434 Bacteria 1808
64 Ga0070713_100000036 3300005436 Bacteria 85712
65 Ga0070713_100050023 3300005436 Bacteria 3450
66 Ga0070711_100028417 3300005439 Bacteria 3680
67 Ga0070705_100060963 3300005440 Bacteria 2240
68 Ga0070700_100092879 3300005441 Bacteria 1973
69 Ga0070700_100246084 3300005441 Bacteria 1280
70 Ga0070694_100009080 3300005444 Bacteria 6096
71 Ga0070708_100036594 3300005445 Bacteria 4281
72 Ga0070708_100183921 3300005445 Bacteria 1954
73 Ga0070708_100294083 3300005445 Bacteria 1529
74 Ga0070663_100054465 3300005455 Bacteria 2859
75 Ga0070678_100085124 3300005456 Bacteria 2408
76 Ga0070678_100089113 3300005456 Bacteria 2361
77 Ga0070662_100038551 3300005457 Bacteria 3395
78 Ga0070662_100212076 3300005457 Bacteria 1541
79 Ga0070681_10112325 3300005458 Bacteria 2664
80 Ga0070681_10292201 3300005458 Bacteria 1540
81 Ga0068867_100040031 3300005459 Bacteria 3419
82 Ga0070685_10003867 3300005466 Bacteria 7579
83 Ga0070706_100085393 3300005467 Bacteria 2925
84 Ga0070706_100094120 3300005467 Bacteria 2780
85 Ga0070707_100036625 3300005468 Bacteria 4682
86 Ga0070707_100080325 3300005468 Bacteria 3147
87 Ga0070707_100096428 3300005468 Bacteria 2864
88 Ga0070707_100225521 3300005468 Bacteria 1825
89 Ga0070707_100258449 3300005468 Bacteria 1694
90 Ga0070707_100315862 3300005468 Bacteria 1518
91 Ga0070707_100496225 3300005468 Bacteria 1182
92 Ga0070698_100021151 3300005471 Bacteria 6816
93 Ga0070698_100036486 3300005471 Bacteria 5077
94 Ga0070698_100106581 3300005471 Bacteria 2771
95 Ga0070698_100151996 3300005471 Bacteria 2262
96 Ga0070699_100025033 3300005518 Bacteria 5146
97 Ga0070699_100054379 3300005518 Bacteria 3465
98 Ga0070679_100273763 3300005530 Bacteria 1642
99 Ga0070684_100010496 3300005535 Bacteria 7339
100 Ga0070684_100331425 3300005535 Bacteria 1399
101 Ga0070684_100404710 3300005535 Bacteria 1258
102 Ga0070697_100001084 3300005536 Bacteria 20576
103 Ga0070697_100025425 3300005536 Bacteria 4723
104 Ga0070697_100062748 3300005536 Bacteria 3033
105 Ga0068853_100031620 3300005539 Bacteria 4477
106 Ga0068853_100054451 3300005539 Bacteria 3448
107 Ga0070672_100042335 3300005543 Bacteria 3506
108 Ga0070686_100110246 3300005544 Bacteria 1874
109 Ga0070686_100197939 3300005544 Bacteria 1438
110 Ga0070693_100010955 3300005547 Bacteria 4557
111 Ga0070693_100093523 3300005547 Bacteria 1817
112 Ga0070665_100016632 3300005548 Bacteria 7372
113 Ga0070665_100565817 3300005548 Bacteria 1149
114 Ga0070704_100007424 3300005549 Bacteria 6529
115 Ga0070704_100042576 3300005549 Bacteria 3142
116 Ga0068855_100187365 3300005563 Bacteria 2336
117 Ga0070664_100094432 3300005564 Bacteria 2593
118 Ga0068857_100013049 3300005577 Bacteria 7238
119 Ga0068854_100044994 3300005578 Bacteria 3136
120 Ga0068856_100289279 3300005614 Bacteria 1655
121 Ga0070702_100139704 3300005615 Bacteria 1541
122 Ga0070702_100187347 3300005615 Bacteria 1359
123 Ga0068852_100491542 3300005616 Bacteria 1221
124 Ga0068859_100052600 3300005617 Bacteria 4094
125 Ga0068859_100053441 3300005617 Bacteria 4063
126 Ga0068864_100035018 3300005618 Bacteria 4272
127 Ga0068866_10001490 3300005718 Bacteria 9968
128 Ga0068866_10021578 3300005718 Bacteria 2968
129 Ga0068861_100006306 3300005719 Bacteria 8074
130 Ga0068863_100029706 3300005841 Bacteria 5219
131 Ga0068858_100247312 3300005842 Bacteria 1693
132 Ga0068860_100036412 3300005843 Bacteria 4715
133 Ga0068862_100004772 3300005844 Bacteria 11408
134 Ga0081455_10022903 3300005937 Bacteria 5824
135 Ga0081455_10049099 3300005937 Bacteria 3640
136 Ga0081538_10098811 3300005981 Bacteria 1477
137 Ga0081540_1018683 3300005983 Bacteria 4243
138 Ga0081539_10000977 3300005985 Bacteria 53347
139 Ga0081539_10003664 3300005985 Bacteria 18487
140 Ga0081539_10027690 3300005985 Bacteria 3583
141 Ga0081539_10071160 3300005985 Bacteria 1864
142 Ga0081539_10126197 3300005985 Bacteria 1264
143 Ga0075365_10000130 3300006038 Bacteria 23021
144 Ga0075363_100056935 3300006048 Bacteria 2097
145 Ga0075432_10000854 3300006058 Bacteria 9586
146 Ga0075432_10015501 3300006058 Bacteria 2599
147 Ga0070715_10024930 3300006163 Bacteria 2364
148 Ga0070715_10152427 3300006163 Bacteria 1134
149 Ga0070712_100121253 3300006175 Bacteria 1967
150 Ga0070712_100368939 3300006175 Bacteria 1179
151 Ga0075362_10016131 3300006177 Bacteria 3054
152 Ga0075367_10000511 3300006178 Bacteria 14626
153 Ga0075369_10000560 3300006186 Bacteria 11734
154 Ga0097621_100073500 3300006237 Bacteria 2830
155 Ga0097621_100195092 3300006237 Bacteria 1755
156 Ga0068871_100042611 3300006358 Bacteria 3645
157 Ga0068871_100051187 3300006358 Bacteria 3343
158 Ga0068871_100086639 3300006358 Bacteria 2602
159 Ga0068871_100273574 3300006358 Bacteria 1476
160 Ga0075428_100023025 3300006844 Bacteria 6894
161 Ga0075428_100230313 3300006844 Bacteria 1999
162 Ga0075430_100075051 3300006846 Bacteria 2835
163 Ga0075431_100012616 3300006847 Bacteria 8531
164 Ga0075431_100029626 3300006847 Bacteria 5636
165 Ga0075431_100171554 3300006847 Bacteria 2228
166 Ga0075431_100278718 3300006847 Bacteria 1693
167 Ga0075431_100598722 3300006847 Bacteria 1086
168 Ga0075433_10002380 3300006852 Bacteria 14292
169 Ga0075433_10083595 3300006852 Bacteria 2818
170 Ga0075433_10272201 3300006852 Bacteria 1501
171 Ga0075434_100002270 3300006871 Bacteria 16813
172 Ga0075434_100012752 3300006871 Bacteria 7978
173 Ga0075434_100015902 3300006871 Bacteria 7226
174 Ga0075434_100360142 3300006871 Bacteria 1476
175 Ga0068865_100025852 3300006881 Bacteria 3866
176 Ga0075436_100112983 3300006914 Bacteria 1897
177 Ga0097620_100052599 3300006931 Bacteria 4094
178 Ga0097620_100053439 3300006931 Bacteria 4063
179 Ga0075435_100079873 3300007076 Bacteria 2685
180 Ga0075435_100281523 3300007076 Bacteria 1420
181 Ga0099794_10002875 3300007265 Bacteria 6461
182 Ga0105240_10290719 3300009093 Bacteria 1874
183 Ga0111539_10009437 3300009094 Bacteria 12313
184 Ga0111539_10038039 3300009094 Bacteria 5804
185 Ga0111539_10065086 3300009094 Bacteria 4310
186 Ga0105245_10004428 3300009098 Bacteria 12428
187 Ga0105245_10030005 3300009098 Bacteria 4808
188 Ga0105247_10011633 3300009101 Bacteria 5301
189 Ga0114129_10010122 3300009147 Bacteria 13443
190 Ga0114129_10012145 3300009147 Bacteria 12262
191 Ga0114129_10029708 3300009147 Bacteria 7739
192 Ga0114129_10057876 3300009147 Bacteria 5423
193 Ga0114129_10136284 3300009147 Bacteria 3368
194 Ga0114129_10941376 3300009147 Bacteria 1092
195 Ga0105243_10071310 3300009148 Bacteria 2809
196 Ga0105243_10107201 3300009148 Bacteria 2330
197 Ga0105242_10079910 3300009176 Bacteria 2732
198 Ga0105248_10514000 3300009177 Bacteria 1350
199 Ga0105237_10292414 3300009545 Bacteria 1632
200 Ga0105238_10017601 3300009551 Bacteria 7264
201 Ga0105238_10063471 3300009551 Bacteria 3694
202 Ga0105238_10444174 3300009551 Bacteria 1293
203 Ga0105249_10029668 3300009553 Bacteria 4940
204 Ga0105249_10145392 3300009553 Bacteria 2277
205 Ga0123342_1003902 3300009766 Bacteria 23396
206 Ga0105239_10074705 3300010375 Bacteria 3726
207 Ga0105239_10127648 3300010375 Bacteria 2827
208 Ga0105246_10465977 3300011119 Bacteria 1065
209 Ga0157373_10016259 3300013100 Bacteria 5430
210 Ga0157371_10011550 3300013102 Bacteria 6791
211 Ga0157371_10292843 3300013102 Bacteria 1177
212 Ga0157369_10578062 3300013105 Bacteria 1160
213 Ga0157374_10001150 3300013296 Bacteria 22525
214 Ga0157378_10049462 3300013297 Bacteria 3740
215 Ga0163162_10085182 3300013306 Bacteria 3237
216 Ga0157372_10063768 3300013307 Bacteria 4133
217 Ga0157372_10502152 3300013307 Bacteria 1414
218 Ga0157375_10001887 3300013308 Bacteria 18022
219 Ga0157375_10038171 3300013308 Bacteria 4610
220 Ga0157375_10437285 3300013308 Bacteria 1474
221 Ga0163163_10337282 3300014325 Bacteria 1562
222 Ga0157377_10017469 3300014745 Bacteria 3710
223 Ga0157377_10023180 3300014745 Bacteria 3288
224 Ga0157377_10038837 3300014745 Bacteria 2630
225 Ga0157379_10025961 3300014968 Bacteria 5209
226 Ga0157379_10158099 3300014968 Bacteria 2045
227 Ga0157376_10028053 3300014969 Bacteria 4471
228 Ga0157376_10104162 3300014969 Bacteria 2486
229 Ga0213872_10050912 3300021361 Bacteria 1880
230 Ga0213876_10020344 3300021384 Bacteria 3507
231 Ga0213871_10008183 3300021441 Bacteria 2295
232 Ga0209435_100011 3300025206 Bacteria 413027
233 Ga0209437_100036 3300025233 Bacteria 469153
234 Ga0209437_100086 3300025233 Bacteria 254578
235 Ga0209646_1000024 3300025246 Bacteria 413027
236 Ga0209026_1000030 3300025250 Bacteria 329811
237 Ga0209148_1010860 3300025254 Bacteria 1711
238 Ga0209759_1000011 3300025256 Bacteria 413027
239 Ga0209233_1000166 3300025261 Bacteria 152270
240 Ga0209233_1000465 3300025261 Bacteria 25645
241 Ga0209130_1000088 3300025284 Bacteria 152927
242 Ga0209758_1000119 3300025297 Bacteria 195545
243 Ga0209050_1007002 3300025298 Bacteria 6484
244 Ga0207426_1000012 3300025302 Bacteria 730942
245 Ga0207426_1019449 3300025302 Bacteria 2373
246 Ga0209051_1028456 3300025303 Bacteria 2207
247 Ga0209257_1000562 3300025304 Bacteria 63202
248 Ga0207656_10019302 3300025321 Bacteria 2696
249 Ga0207642_10025587 3300025899 Bacteria 2390
250 Ga0207688_10002539 3300025901 Bacteria 9854
251 Ga0207688_10027800 3300025901 Bacteria 3111
252 Ga0207680_10030975 3300025903 Bacteria 3025
253 Ga0207699_10101575 3300025906 Bacteria 1826
254 Ga0207645_10014930 3300025907 Bacteria 5178
255 Ga0207645_10064195 3300025907 Bacteria 2346
256 Ga0207643_10018189 3300025908 Bacteria 3849
257 Ga0207705_10051097 3300025909 Bacteria 2976
258 Ga0207684_10009022 3300025910 Bacteria 8839
259 Ga0207684_10011036 3300025910 Bacteria 7914
260 Ga0207684_10013657 3300025910 Bacteria 7016
261 Ga0207684_10125841 3300025910 Bacteria 2199
262 Ga0207684_10292974 3300025910 Bacteria 1403
263 Ga0207684_10299998 3300025910 Bacteria 1385
264 Ga0207684_10360300 3300025910 Bacteria 1251
265 Ga0207707_10442111 3300025912 Unclassified 1113
266 Ga0207695_10332327 3300025913 Bacteria 1408
267 Ga0207693_10012669 3300025915 Bacteria 6810
268 Ga0207693_10015531 3300025915 Bacteria 6109
269 Ga0207662_10031121 3300025918 Bacteria 3100
270 Ga0207657_10002490 3300025919 Bacteria 19913
271 Ga0207652_10265262 3300025921 Bacteria 1549
272 Ga0207646_10003155 3300025922 Bacteria 18879
273 Ga0207646_10036457 3300025922 Bacteria 4439
274 Ga0207646_10037854 3300025922 Bacteria 4347
275 Ga0207646_10047624 3300025922 Bacteria 3845
276 Ga0207646_10059172 3300025922 Bacteria 3422
277 Ga0207646_10093658 3300025922 Bacteria 2690
278 Ga0207646_10109980 3300025922 Bacteria 2473
279 Ga0207646_10245154 3300025922 Bacteria 1618
280 Ga0207681_10222444 3300025923 Bacteria 1461
281 Ga0207694_10011943 3300025924 Bacteria 6547
282 Ga0207650_10035282 3300025925 Bacteria 3630
283 Ga0207650_10061325 3300025925 Bacteria 2808
284 Ga0207659_10096303 3300025926 Bacteria 2221
285 Ga0207659_10139981 3300025926 Bacteria 1877
286 Ga0207659_10242435 3300025926 Bacteria 1459
287 Ga0207687_10000492 3300025927 Bacteria 26647
288 Ga0207687_10007965 3300025927 Bacteria 6936
289 Ga0207687_10078826 3300025927 Bacteria 2373
290 Ga0207687_10208828 3300025927 Bacteria 1531
291 Ga0207700_10000098 3300025928 Bacteria 53371
292 Ga0207700_10113101 3300025928 Bacteria 2188
293 Ga0207644_10011954 3300025931 Bacteria 5756
294 Ga0207644_10150226 3300025931 Bacteria 1802
295 Ga0207690_10035464 3300025932 Bacteria 3222
296 Ga0207706_10022001 3300025933 Bacteria 5723
297 Ga0207686_10006732 3300025934 Bacteria 6190
298 Ga0207686_10163666 3300025934 Bacteria 1562
299 Ga0207709_10032353 3300025935 Bacteria 3062
300 Ga0207709_10053080 3300025935 Bacteria 2493
301 Ga0207709_10226263 3300025935 Bacteria 1352
302 Ga0207670_10007955 3300025936 Bacteria 5955
303 Ga0207669_10012998 3300025937 Bacteria 4117
304 Ga0207669_10277156 3300025937 Bacteria 1263
305 Ga0207704_10021981 3300025938 Bacteria 3409
306 Ga0207704_10256863 3300025938 Bacteria 1315
307 Ga0207665_10012130 3300025939 Bacteria 5656
308 Ga0207691_10033166 3300025940 Bacteria 4809
309 Ga0207691_10069787 3300025940 Bacteria 3174
310 Ga0207711_10000323 3300025941 Bacteria 51404
311 Ga0207689_10038040 3300025942 Bacteria 3987
312 Ga0207661_10052167 3300025944 Bacteria 3266
313 Ga0207661_10052715 3300025944 Bacteria 3251
314 Ga0207679_10134058 3300025945 Bacteria 1991
315 Ga0207679_10149599 3300025945 Bacteria 1898
316 Ga0207667_10255036 3300025949 Bacteria 1794
317 Ga0207651_10002690 3300025960 Bacteria 8510
318 Ga0207651_10034092 3300025960 Bacteria 3292
319 Ga0207640_10029429 3300025981 Bacteria 3371
320 Ga0207640_10367500 3300025981 Bacteria 1161
321 Ga0207658_10011876 3300025986 Bacteria 5936
322 Ga0207658_10027377 3300025986 Bacteria 4004
323 Ga0207677_10000457 3300026023 Bacteria 27426
324 Ga0207677_10008588 3300026023 Bacteria 5716
325 Ga0207677_10034416 3300026023 Bacteria 3280
326 Ga0207677_10048876 3300026023 Bacteria 2850
327 Ga0207703_10005665 3300026035 Bacteria 10030
328 Ga0207639_10081289 3300026041 Bacteria 2566
329 Ga0207639_10262055 3300026041 Bacteria 1512
330 Ga0207678_10026970 3300026067 Bacteria 5010
331 Ga0207708_10039834 3300026075 Bacteria 3581
332 Ga0207708_10048709 3300026075 Bacteria 3226
333 Ga0207708_10083849 3300026075 Bacteria 2450
334 Ga0207702_10099356 3300026078 Bacteria 2565
335 Ga0207702_10143054 3300026078 Bacteria 2167
336 Ga0207641_10025247 3300026088 Bacteria 4900
337 Ga0207648_10073677 3300026089 Bacteria 2976
338 Ga0207648_10148672 3300026089 Bacteria 2067
339 Ga0207676_10000704 3300026095 Bacteria 26333
340 Ga0207674_10020614 3300026116 Bacteria 7117
341 Ga0207674_10089188 3300026116 Bacteria 3076
342 Ga0207675_100011563 3300026118 Bacteria 8254
343 Ga0207683_10021675 3300026121 Bacteria 5506
344 Ga0207683_10108070 3300026121 Bacteria 2489
345 Ga0207683_10181390 3300026121 Bacteria 1909
346 Ga0207698_10027960 3300026142 Bacteria 4013
347 Ga0207698_10064662 3300026142 Bacteria 2868
348 Ga0207698_10410288 3300026142 Bacteria 1297
349 Ga0209588_1004368 3300027671 Bacteria 3982
350 Ga0207428_10002320 3300027907 Bacteria 19050
351 Ga0207428_10018781 3300027907 Bacteria 5899
352 Ga0207428_10104395 3300027907 Bacteria 2187
353 Ga0268266_10167571 3300028379 Bacteria 1991
354 Ga0268266_10543283 3300028379 Bacteria 1113
355 Ga0268265_10004310 3300028380 Bacteria 9919
356 Ga0268264_10005778 3300028381 Bacteria 10490
357 Ga0268264_10285602 3300028381 Bacteria 1548
358 Ga0268264_10347628 3300028381 Bacteria 1410
359 Ga0307515_10266394 3300028794 Bacteria 1441
360 Ga0265330_10050509 3300031235 Bacteria 1824
361 Ga0265328_10043977 3300031239 Bacteria 1643
362 Ga0265340_10079294 3300031247 Bacteria 1548
363 Ga0265327_10074678 3300031251 Bacteria 1688
364 Ga0265316_10034575 3300031344 Bacteria 4104
365 Ga0307408_100233817 3300031548 Bacteria 1507
366 Ga0265314_10048196 3300031711 Bacteria 2992
367 Ga0265314_10080258 3300031711 Bacteria 2154
368 Ga0265342_10051659 3300031712 Bacteria 2452
369 Ga0307405_10475755 3300031731 Bacteria 996
370 Ga0307413_10102061 3300031824 Bacteria 1898
371 Ga0307410_10100712 3300031852 Bacteria 2070
372 Ga0307410_10154128 3300031852 Bacteria 1714
373 Ga0307410_10198896 3300031852 Bacteria 1529
374 Ga0307406_10301164 3300031901 Bacteria 1232
375 Ga0307406_10381919 3300031901 Bacteria 1111
376 Ga0307409_100157590 3300031995 Bacteria 1981
377 Ga0307409_100434292 3300031995 Bacteria 1263
378 Ga0307416_100022715 3300032002 Bacteria 4535
379 Ga0307416_100227590 3300032002 Bacteria 1795
380 Ga0307414_10082633 3300032004 Bacteria 2356
381 Ga0307411_10053923 3300032005 Bacteria 2637
382 Ga0307415_100303186 3300032126 Bacteria 1324
383 Ga0307415_100338116 3300032126 Bacteria 1262
384 Ga0373948_0006165 3300034817 Bacteria 1973
385 Ga0373958_0008572 3300034819 Bacteria 1661
386 Ga0373934_0019550 3300035086 Bacteria 2601
387 Ga0373944_0014893 3300035089 Bacteria 2176
388 Ga0373939_0002495 3300035114 Bacteria 4337
389 Ga0373945_0011628 3300035116 Bacteria 2912
390 Ga0373945_0026139 3300035116 Bacteria 2033
391 Ga0373953_0029257 3300035117 Bacteria 2129
392 Ga0373954_0014406 3300035118 Bacteria 3525
393 Ga0373954_0047352 3300035118 Bacteria 2012
394 Ga0373956_0017966 3300035119 Bacteria 2990
395 Ga0373956_0058894 3300035119 Bacteria 1737
396 Ga0373957_0022350 3300035120 Bacteria 2253
397 Ga0373960_0009426 3300035121 Bacteria 2364
398 Ga0373943_0017068 3300035170 Bacteria 3319
399 Ga0373955_0014540 3300035172 Bacteria 3831
400 Ga0373955_0035471 3300035172 Bacteria 2642
401 Ga0373924_0039681 3300035410 Bacteria 1924
402 Ga0373931_0026999 3300035691 Bacteria 2927
403 Ga0373935_0029554 3300035692 Bacteria 3392
404 Ga0373927_0006704 3300035695 Bacteria 7834
405 Ga0373927_0011563 3300035695 Bacteria 5880
406 Ga0373927_0013114 3300035695 Bacteria 5512
407 Ga0373933_0027325 3300035724 Bacteria 3285
408 Ga0373947_0019642 3300035725 Bacteria 3897
409 Ga0373937_0032263 3300036401 Bacteria 4750
410 Ga0373937_0051695 3300036401 Bacteria 3766
411 Ga0373925_0012185 3300037068 Bacteria 6224
412 Ga0373925_0035772 3300037068 Bacteria 3666
413 Ga0395905_0008475 3300037471 Bacteria 10138
414 Ga0395901_0156856 3300038443 Bacteria 2391
415 Ga0436365_0199037 3300039437 Bacteria 29795
416 Ga0436360_0631597 3300039438 Bacteria 3145
417 Ga0436361_0319848 3300039447 Bacteria 3815
418 Ga0436363_0406837 3300039450 Bacteria 1493
419 Ga0436363_1110042 3300039450 Bacteria 1908
420 Ga0436363_1421802 3300039450 Bacteria 1019
421 Ga0436362_0332095 3300039453 Bacteria 4525
422 Ga0436362_0650647 3300039453 Bacteria 1721
423 Ga0451843_0035460 3300041509 Bacteria 1226
424 Ga0450911_000174 3300042115 Bacteria 25375
425 Ga0439460_0040007 3300042461 Bacteria 1372
426 Ga0451577_0052996 3300042876 Bacteria 3622
427 Ga0453683_0026353 3300044673 Bacteria 3691
428 Ga0466966_0113944 3300044684 Bacteria 1665
429 Ga0466963_0296361 3300044694 Bacteria 1137
430 Ga0453684_0007326 3300044712 Bacteria 20394
431 Ga0466971_0087081 3300044719 Bacteria 1428
432 Ga0466959_0024348 3300045049 Bacteria 4484
433 Ga0466958_0124082 3300045836 Bacteria 1618
434 Ga0466967_0036322 3300045976 Bacteria 4205
435 Ga0495629_0058446 3300046459 Bacteria 2696
436 Ga0495629_0136800 3300046459 Bacteria 1705
437 Ga0495638_0000299 3300046460 Bacteria 63971
438 Ga0495651_0213294 3300046462 Bacteria 1342
439 Ga0495580_0025026 3300046472 Bacteria 4365
440 Ga0495580_0160861 3300046472 Bacteria 1554
441 Ga0495582_0016638 3300046473 Bacteria 4026
442 Ga0495605_0042217 3300046474 Bacteria 2268
443 Ga0495639_0004411 3300046475 Bacteria 6031
444 Ga0495662_0013542 3300046476 Bacteria 3970
445 Ga0495664_0008311 3300046477 Bacteria 5787
446 Ga0495585_0002346 3300046492 Bacteria 13606
447 Ga0495583_0039415 3300046506 Bacteria 2226
448 Ga0495583_0058215 3300046506 Bacteria 1735
449 Ga0495628_0142228 3300046516 Bacteria 1831
450 Ga0495630_0175478 3300046517 Bacteria 1633
451 Ga0495631_0001476 3300046518 Bacteria 14271
452 Ga0495632_0043822 3300046519 Bacteria 2235
453 Ga0495637_0065166 3300046520 Bacteria 1484
454 Ga0495652_0100181 3300046529 Bacteria 2351
455 Ga0495654_0015133 3300046530 Bacteria 4099
456 Ga0495654_0097671 3300046530 Bacteria 1356
457 Ga0495665_0135066 3300046531 Bacteria 1290
458 Ga0495586_0113270 3300046535 Bacteria 1511
459 Ga0495587_0077622 3300046536 Bacteria 1928
460 Ga0495587_0119745 3300046536 Bacteria 1508
461 Ga0495645_0018391 3300046543 Bacteria 5017
462 Ga0495622_0015943 3300046557 Bacteria 3495
463 Ga0495633_0138570 3300046558 Bacteria 1125
464 Ga0495667_0122879 3300046559 Bacteria 1676
465 Ga0495656_0000008 3300046615 Bacteria 226156
466 Ga0495668_0028640 3300046616 Bacteria 3150
467 Ga0495611_0012625 3300046648 Bacteria 3591
468 Ga0495611_0012711 3300046648 Bacteria 3580
469 Ga0495625_0090145 3300046660 Bacteria 2122
470 Ga0495625_0224780 3300046660 Bacteria 1228
471 Ga0495635_0028152 3300046663 Bacteria 3905
472 Ga0495635_0062488 3300046663 Bacteria 2558
473 Ga0495659_0001962 3300046664 Bacteria 6767
474 Ga0495659_0115697 3300046664 Bacteria 1051
475 Ga0495661_0122324 3300046665 Bacteria 1436
476 Ga0495623_0121986 3300046679 Bacteria 1568
477 Ga0495658_0049725 3300046683 Bacteria 2369
478 Ga0495613_0112224 3300046689 Bacteria 1963
479 Ga0495670_0144899 3300046691 Bacteria 1244
480 Ga0495589_0111587 3300046794 Bacteria 1320
481 Ga0495660_0068141 3300046810 Bacteria 1894
482 Ga0495581_0007010 3300047315 Bacteria 6532
483 Ga0495674_0333620 3300047319 Bacteria 1233
484 Ga0495680_0029512 3300047322 Bacteria 4491
485 Ga0495684_0014543 3300047471 Bacteria 6057
486 Ga0495686_0105642 3300047472 Bacteria 1694
487 Ga0495602_0116242 3300048088 Bacteria 2162
488 Ga0496101_0087036 3300048904 Bacteria 2318
489 Ga0496101_0110052 3300048904 Bacteria 2073
490 Ga0496102_0321754 3300048905 Bacteria 1457
491 Ga0496102_0351488 3300048905 Bacteria 1388
492 Ga0496104_0131465 3300048907 Bacteria 2404
493 Ga0496104_0140637 3300048907 Bacteria 2319
494 Ga0496104_0162672 3300048907 Bacteria 2141
495 Ga0496105_0174149 3300048908 Bacteria 1763
496 Ga0496105_0272851 3300048908 Bacteria 1365
497 Ga0496106_0086769 3300048909 Bacteria 2411
498 Ga0496106_0135129 3300048909 Bacteria 1936
499 Ga0496106_0221486 3300048909 Bacteria 1509
500 Ga0496107_0140289 3300048910 Bacteria 1786
501 Ga0496107_0248358 3300048910 Bacteria 1324
502 Ga0496108_0027134 3300048911 Bacteria 4725
503 Ga0496108_0180828 3300048911 Bacteria 1826
504 Ga0496109_0024562 3300048912 Bacteria 5359
505 Ga0496109_0025767 3300048912 Bacteria 5241
506 Ga0496109_0128762 3300048912 Bacteria 2361
507 Ga0496110_0005834 3300048913 Bacteria 9677
508 Ga0496110_0196147 3300048913 Bacteria 1834
509 Ga0496110_0237903 3300048913 Bacteria 1657
510 Ga0496111_0058031 3300048914 Bacteria 2802
511 Ga0496112_0028842 3300048915 Bacteria 5361
512 Ga0496112_0036675 3300048915 Bacteria 4783
513 Ga0496112_0098029 3300048915 Bacteria 2901
514 Ga0496113_0021498 3300048916 Bacteria 4553
515 Ga0496113_0116315 3300048916 Bacteria 2086
516 Ga0496115_0205429 3300048918 Bacteria 1627
517 Ga0496121_0029719 3300048924 Bacteria 5041
518 Ga0496121_0055547 3300048924 Bacteria 3298
519 Ga0496125_0011084 3300048928 Bacteria 9043
520 Ga0496125_0041028 3300048928 Bacteria 3961
521 Ga0496126_0327513 3300048929 Bacteria 1258
522 Ga0501031_0004612 3300049568 Bacteria 8938
523 Ga0501031_0009218 3300049568 Bacteria 6416
524 Ga0501031_0021850 3300049568 Bacteria 4169
525 Ga0501031_0024825 3300049568 Bacteria 3908
526 Ga0501031_0029120 3300049568 Bacteria 3602
527 Ga0501031_0110034 3300049568 Bacteria 1799
528 Ga0501032_0002226 3300049569 Bacteria 15274
529 Ga0501032_0002720 3300049569 Bacteria 13775
530 Ga0501032_0005070 3300049569 Bacteria 9837
531 Ga0501032_0012228 3300049569 Bacteria 6144
532 Ga0501032_0236835 3300049569 Bacteria 1186
533 Ga0501032_0291599 3300049569 Bacteria 1055
534 Ga0501033_0002027 3300049570 Bacteria 17616
535 Ga0501033_0172787 3300049570 Bacteria 1551
536 Ga0501033_0181645 3300049570 Bacteria 1508
537 Ga0501034_0003286 3300049571 Bacteria 18465
538 Ga0501034_0012148 3300049571 Bacteria 8902
539 Ga0501034_0019006 3300049571 Bacteria 7038
540 Ga0501034_0091535 3300049571 Bacteria 3038
541 Ga0501034_0126998 3300049571 Bacteria 2535
542 Ga0501034_0269483 3300049571 Bacteria 1644
543 Ga0501034_0344942 3300049571 Bacteria 1419
544 Ga0501036_0006183 3300049572 Bacteria 9717
545 Ga0501036_0009699 3300049572 Bacteria 7925
546 Ga0501036_0010719 3300049572 Bacteria 7576
547 Ga0501036_0022202 3300049572 Bacteria 5337
548 Ga0501036_0025265 3300049572 Bacteria 5012
549 Ga0501036_0117389 3300049572 Bacteria 2247
550 Ga0501036_0169838 3300049572 Bacteria 1838
551 Ga0501036_0190469 3300049572 Bacteria 1726
552 Ga0501036_0262789 3300049572 Bacteria 1446
553 Ga0501037_0008295 3300049573 Bacteria 7615
554 Ga0501037_0022625 3300049573 Bacteria 4648
555 Ga0501037_0028114 3300049573 Bacteria 4153
556 Ga0501037_0028678 3300049573 Bacteria 4111
557 Ga0501038_0001881 3300049574 Bacteria 19407
558 Ga0501038_0008574 3300049574 Bacteria 9383
559 Ga0501038_0021677 3300049574 Bacteria 5763
560 Ga0501038_0026151 3300049574 Bacteria 5199
561 Ga0501038_0048695 3300049574 Bacteria 3666
562 Ga0501038_0176076 3300049574 Bacteria 1729
563 Ga0501038_0189076 3300049574 Bacteria 1657
564 Ga0501038_0316853 3300049574 Bacteria 1221
565 Ga0501039_0000586 3300049575 Bacteria 26318
566 Ga0501039_0010466 3300049575 Bacteria 7068
567 Ga0501039_0091123 3300049575 Bacteria 2376
568 Ga0501039_0215331 3300049575 Bacteria 1510
569 Ga0501040_0003985 3300049576 Bacteria 9592
570 Ga0501040_0055736 3300049576 Bacteria 2711
571 Ga0501040_0073685 3300049576 Bacteria 2360
572 Ga0501040_0163990 3300049576 Bacteria 1572
573 Ga0501040_0168556 3300049576 Bacteria 1550
574 Ga0501041_0015917 3300049577 Bacteria 4469
575 Ga0501041_0018770 3300049577 Bacteria 4119
576 Ga0501041_0083116 3300049577 Bacteria 1973
577 Ga0501042_0007794 3300049578 Bacteria 7035
578 Ga0501042_0051176 3300049578 Bacteria 2946
579 Ga0501042_0060421 3300049578 Bacteria 2707
580 Ga0501042_0119210 3300049578 Bacteria 1900
581 Ga0501043_0002665 3300049579 Bacteria 14994
582 Ga0501043_0005163 3300049579 Bacteria 10566
583 Ga0501043_0007779 3300049579 Bacteria 8476
584 Ga0501043_0012734 3300049579 Bacteria 6573
585 Ga0501043_0020815 3300049579 Bacteria 5144
586 Ga0501046_0001687 3300049580 Bacteria 21108
587 Ga0501046_0012263 3300049580 Bacteria 7303
588 Ga0501046_0035410 3300049580 Bacteria 4023
589 Ga0501046_0097700 3300049580 Bacteria 2256
590 Ga0501046_0107920 3300049580 Bacteria 2129
591 Ga0501046_0181377 3300049580 Bacteria 1574
592 Ga0501047_0008214 3300049581 Bacteria 9855
593 Ga0501047_0009271 3300049581 Bacteria 9297
594 Ga0501047_0030131 3300049581 Bacteria 5231
595 Ga0501047_0059077 3300049581 Bacteria 3702
596 Ga0501047_0134752 3300049581 Bacteria 2350
597 Ga0501047_0267919 3300049581 Bacteria 1554
598 Ga0501048_0001403 3300049582 Bacteria 18282
599 Ga0501048_0005769 3300049582 Bacteria 9410
600 Ga0501048_0011434 3300049582 Bacteria 6622
601 Ga0501048_0013919 3300049582 Bacteria 5964
602 Ga0501048_0033443 3300049582 Bacteria 3714
603 Ga0501048_0056054 3300049582 Bacteria 2797
604 Ga0501048_0330334 3300049582 Bacteria 1086
605 Ga0501067_0000637 3300049583 Bacteria 18857
606 Ga0501067_0007714 3300049583 Bacteria 5985
607 Ga0501067_0009048 3300049583 Bacteria 5516
608 Ga0501067_0015268 3300049583 Bacteria 4251
609 Ga0501067_0045462 3300049583 Bacteria 2438
610 Ga0501067_0062754 3300049583 Bacteria 2057
611 Ga0501068_0009932 3300049584 Bacteria 5335
612 Ga0501068_0011551 3300049584 Bacteria 4987
613 Ga0501068_0013853 3300049584 Bacteria 4596
614 Ga0501068_0020805 3300049584 Bacteria 3828
615 Ga0501068_0082706 3300049584 Bacteria 1972
616 Ga0501068_0139071 3300049584 Bacteria 1522
617 Ga0501069_0000166 3300049585 Bacteria 29308
618 Ga0501069_0003362 3300049585 Bacteria 8217
619 Ga0501069_0053305 3300049585 Bacteria 2252
620 Ga0501069_0081037 3300049585 Bacteria 1828
621 Ga0501069_0119462 3300049585 Bacteria 1505
622 Ga0501070_0001189 3300049586 Bacteria 23275
623 Ga0501070_0016745 3300049586 Bacteria 6154
624 Ga0501070_0052268 3300049586 Bacteria 3391
625 Ga0501070_0120041 3300049586 Bacteria 2173
626 Ga0501070_0134856 3300049586 Bacteria 2038
627 Ga0501070_0136562 3300049586 Bacteria 2025
628 Ga0501071_0002460 3300049587 Bacteria 11248
629 Ga0501071_0008178 3300049587 Bacteria 6902
630 Ga0501071_0010812 3300049587 Bacteria 6121
631 Ga0501071_0036582 3300049587 Bacteria 3502
632 Ga0501071_0079657 3300049587 Bacteria 2395
633 Ga0501071_0087711 3300049587 Bacteria 2283
634 Ga0501072_0008198 3300049588 Bacteria 7933
635 Ga0501072_0024380 3300049588 Bacteria 4705
636 Ga0501072_0096441 3300049588 Bacteria 2350
637 Ga0501072_0133490 3300049588 Bacteria 1979
638 Ga0501072_0235487 3300049588 Bacteria 1458
639 Ga0501073_0001412 3300049589 Bacteria 17709
640 Ga0501073_0002428 3300049589 Bacteria 13944
641 Ga0501073_0007864 3300049589 Bacteria 7915
642 Ga0501073_0012631 3300049589 Bacteria 6161
643 Ga0501073_0019824 3300049589 Bacteria 4853
644 Ga0501073_0027936 3300049589 Bacteria 4031
645 Ga0501073_0030813 3300049589 Bacteria 3829
646 Ga0501073_0067011 3300049589 Bacteria 2502
647 Ga0501073_0094983 3300049589 Bacteria 2071
648 Ga0501074_0002168 3300049590 Bacteria 13604
649 Ga0501074_0004036 3300049590 Bacteria 10471
650 Ga0501074_0007669 3300049590 Bacteria 7814
651 Ga0501074_0009612 3300049590 Bacteria 7020
652 Ga0501074_0028639 3300049590 Bacteria 4037
653 Ga0501074_0051376 3300049590 Bacteria 2975
654 Ga0501075_0005483 3300049591 Bacteria 8677
655 Ga0501075_0021321 3300049591 Bacteria 4722
656 Ga0501075_0023412 3300049591 Bacteria 4522
657 Ga0501075_0046501 3300049591 Bacteria 3260
658 Ga0501075_0047564 3300049591 Bacteria 3223
659 Ga0501076_0003442 3300049592 Bacteria 11104
660 Ga0501076_0010477 3300049592 Bacteria 6881
661 Ga0501076_0018387 3300049592 Bacteria 5327
662 Ga0501076_0027168 3300049592 Bacteria 4440
663 Ga0501076_0116666 3300049592 Bacteria 2160
664 Ga0501076_0143803 3300049592 Bacteria 1938
665 Ga0501076_0267740 3300049592 Bacteria 1399
666 Ga0501077_0037610 3300049593 Bacteria 3082
667 Ga0501077_0109314 3300049593 Bacteria 1752
668 Ga0501079_0004089 3300049741 Bacteria 10802
669 Ga0501079_0005076 3300049741 Bacteria 9777
670 Ga0501079_0045594 3300049741 Bacteria 3383
671 Ga0501079_0051651 3300049741 Bacteria 3174
672 Ga0501079_0063412 3300049741 Bacteria 2851
673 Ga0501079_0315064 3300049741 Bacteria 1225
674 Ga0501080_0001509 3300049742 Bacteria 19649
675 Ga0501080_0005191 3300049742 Bacteria 11605
676 Ga0501080_0006194 3300049742 Bacteria 10735
677 Ga0501080_0038807 3300049742 Bacteria 4445
678 Ga0501080_0131803 3300049742 Bacteria 2314
679 Ga0501080_0146262 3300049742 Bacteria 2184
680 Ga0501080_0205514 3300049742 Bacteria 1806
681 Ga0501080_0213813 3300049742 Bacteria 1767
682 Ga0501080_0287125 3300049742 Bacteria 1495
683 Ga0501080_0384048 3300049742 Bacteria 1265
684 Ga0501081_0007210 3300049743 Bacteria 7231
685 Ga0501081_0009622 3300049743 Bacteria 6300
686 Ga0501081_0022534 3300049743 Bacteria 4215
687 Ga0501081_0034615 3300049743 Bacteria 3437
688 Ga0501083_0000158 3300049744 Bacteria 45063
689 Ga0501083_0006389 3300049744 Bacteria 8353
690 Ga0501083_0020202 3300049744 Bacteria 4634
691 Ga0501083_0023722 3300049744 Bacteria 4254
692 Ga0501083_0024915 3300049744 Bacteria 4143
693 Ga0501083_0056051 3300049744 Bacteria 2641
694 Ga0501083_0153724 3300049744 Bacteria 1506
695 Ga0501035_0001547 3300049822 Bacteria 23435
696 Ga0501035_0014966 3300049822 Bacteria 7158
697 Ga0501035_0021456 3300049822 Bacteria 5938
698 Ga0501035_0021507 3300049822 Bacteria 5930
699 Ga0501035_0039139 3300049822 Bacteria 4292
700 Ga0501035_0139660 3300049822 Bacteria 2107
701 Ga0501035_0237650 3300049822 Bacteria 1551
702 Ga0501035_0497170 3300049822 Bacteria 1004
703 Ga0501044_0004749 3300049823 Bacteria 15190
704 Ga0501044_0012589 3300049823 Bacteria 9160
705 Ga0501044_0018357 3300049823 Bacteria 7495
706 Ga0501044_0025282 3300049823 Bacteria 6293
707 Ga0501044_0211839 3300049823 Bacteria 1892
708 Ga0501045_0002062 3300049824 Bacteria 13563
709 Ga0501045_0019068 3300049824 Bacteria 4885
710 Ga0501045_0074839 3300049824 Bacteria 2494
711 Ga0501045_0106724 3300049824 Bacteria 2075
712 Ga0501045_0144747 3300049824 Bacteria 1767
713 Ga0501045_0185672 3300049824 Bacteria 1549
714 nmdc:mga05p37_150533_c1 3300050507 Bacteria 2846
715 nmdc:mga05p37_18686_c1 3300050507 Bacteria 8376
716 nmdc:mga05p37_423629_c1 3300050507 Bacteria 1548
717 nmdc:mga05p37_4695_c1 3300050507 Bacteria 15953
718 nmdc:mga05p37_7863_c1 3300050507 Bacteria 12588
719 nmdc:mga05p37_96687_c1 3300050507 Bacteria 3639
720 nmdc:mga09592_5246_c1 3300050508 Bacteria 10525
721 nmdc:mga0qj67_6731_c1 3300050509 Bacteria 8443
722 nmdc:mga0qj67_98562_c1 3300050509 Bacteria 2354
723 nmdc:mga06r32_162377_c1 3300050510 Bacteria 2216
724 nmdc:mga06r32_16871_c1 3300050510 Bacteria 6661
725 nmdc:mga06r32_200856_c1 3300050510 Bacteria 1981
726 nmdc:mga06r32_53930_c1 3300050510 Bacteria 3854
727 nmdc:mga06r32_97066_c1 3300050510 Bacteria 2887
728 nmdc:mga08y16_191120_c1 3300050511 Bacteria 2124
729 nmdc:mga08y16_32962_c1 3300050511 Bacteria 5444
730 nmdc:mga0n895_120821_c1 3300050512 Bacteria 2641
731 nmdc:mga0n895_18116_c1 3300050512 Bacteria 6511
732 nmdc:mga0n895_20008_c1 3300050512 Bacteria 6233
733 nmdc:mga0n895_57789_c1 3300050512 Bacteria 3824
734 nmdc:mga0rr50_66097_c1 3300050513 Bacteria 2742
735 nmdc:mga08x19_152229_c1 3300050514 Bacteria 1567
736 nmdc:mga08x19_71853_c1 3300050514 Bacteria 2256
737 nmdc:mga0a205_161975_c1 3300050515 Bacteria 2133
738 nmdc:mga0a205_23580_c1 3300050515 Bacteria 5837
739 nmdc:mga0a205_36052_c1 3300050515 Bacteria 4752
740 nmdc:mga0a205_73310_c1 3300050515 Bacteria 3308
741 nmdc:mga0a205_76424_c1 3300050515 Bacteria 3236
742 Ga0495601_0143533 3300053077 Bacteria 1558
743 Ga0495612_0007186 3300053078 Bacteria 4556
744 Ga0495619_0025307 3300053085 Bacteria 3810
745 Ga0495619_0127838 3300053085 Bacteria 1745
746 Ga0500651_0066760 3300053093 Bacteria 2240
747 Ga0500566_0102525 3300053094 Bacteria 1567
748 Ga0500641_0012760 3300053096 Bacteria 3075
749 Ga0500557_033666 3300053105 Bacteria 1569
750 Ga0500595_000923 3300053119 Bacteria 16670
751 Ga0500618_000075 3300053125 Bacteria 80931
752 Ga0500618_027464 3300053125 Bacteria 1354
753 Ga0500642_0014769 3300053130 Bacteria 2915
754 Ga0500568_0001239 3300053139 Bacteria 16933
755 Ga0500568_0015778 3300053139 Bacteria 3373
756 Ga0500573_0047454 3300053140 Bacteria 2474
757 Ga0500573_0097520 3300053140 Bacteria 1656
758 Ga0500573_0236828 3300053140 Bacteria 948
759 Ga0500577_0067149 3300053142 Bacteria 1397
760 Ga0500604_0020246 3300053151 Bacteria 1870
761 Ga0500616_0002241 3300053153 Bacteria 16523
762 Ga0500616_0015018 3300053153 Bacteria 4437
763 Ga0500616_0041725 3300053153 Bacteria 2460
764 Ga0500622_0049006 3300053156 Bacteria 2179
765 Ga0500609_001315 3300053731 Bacteria 3661
766 Ga0501084_0000888 3300054114 Bacteria 23116
767 Ga0501084_0004046 3300054114 Bacteria 11944
768 Ga0501084_0018632 3300054114 Bacteria 5778
769 Ga0501084_0093239 3300054114 Bacteria 2528
770 Ga0501084_0132751 3300054114 Bacteria 2096
771 Ga0501084_0136175 3300054114 Bacteria 2067
772 Ga0501084_0205853 3300054114 Bacteria 1660
773 Ga0501084_0298786 3300054114 Bacteria 1360
774 Ga0590075_021824 3300059424 Bacteria 1600
775 Ga0590077_006279 3300059426 Bacteria 2437
776 Ga0501082_0001437 3300060353 Bacteria 20929
777 Ga0501082_0010225 3300060353 Bacteria 8079
778 Ga0501082_0012592 3300060353 Bacteria 7269
779 Ga0501082_0034485 3300060353 Bacteria 4362
780 Ga0501082_0034527 3300060353 Bacteria 4359
781 Ga0501082_0085352 3300060353 Bacteria 2723
782 Ga0501082_0089372 3300060353 Bacteria 2660
783 Ga0501082_0099324 3300060353 Bacteria 2516
784 Ga0501082_0112012 3300060353 Bacteria 2362
785 Ga0501082_0555290 3300060353 Bacteria 1004
786 Ga0530510_0000656 3300061734 Bacteria 22356
787 Ga0530510_0012132 3300061734 Bacteria 6048
788 Ga0530510_0013307 3300061734 Bacteria 5783
789 Ga0530510_0014497 3300061734 Bacteria 5559
790 Ga0530510_0080185 3300061734 Bacteria 2375
791 Ga0530510_0199064 3300061734 Bacteria 1487

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042461 Ga0439460_0040007 Ga0439460_0040007_26_820 181
2 3300050507 nmdc:mga05p37_423629_c1 nmdc:mga05p37_423629_c1_14_808 181
3 3300049569 Ga0501032_0291599 Ga0501032_0291599_14_691 182
4 3300049570 Ga0501033_0172787 Ga0501033_0172787_14_691 182
5 3300049580 Ga0501046_0107920 Ga0501046_0107920_14_691 182
6 3300049585 Ga0501069_0119462 Ga0501069_0119462_44_838 186
7 3300049593 Ga0501077_0109314 Ga0501077_0109314_366_1139 193
8 3300048910 Ga0496107_0248358 Ga0496107_0248358_409_1290 195
9 3300006871 Ga0075434_100012752 Ga0075434_1000127522 200
10 3300007076 Ga0075435_100079873 Ga0075435_1000798732 200
11 3300025922 Ga0207646_10037854 Ga0207646_100378543 200
12 3300050512 nmdc:mga0n895_120821_c1 nmdc:mga0n895_120821_c1_1201_1989 200
13 3300050513 nmdc:mga0rr50_66097_c1 nmdc:mga0rr50_66097_c1_1361_2149 200
14 3300050515 nmdc:mga0a205_161975_c1 nmdc:mga0a205_161975_c1_101_889 200
15 3300005614 Ga0068856_100289279 Ga0068856_1002892792 202
16 3300001991 JGI24743J22301_10004626 JGI24743J22301_100046262 203
17 3300002075 JGI24738J21930_10004260 JGI24738J21930_100042602 203
18 3300005327 Ga0070658_10020740 Ga0070658_100207403 203
19 3300005329 Ga0070683_100129967 Ga0070683_1001299672 203
20 3300005334 Ga0068869_100040311 Ga0068869_1000403113 203
21 3300005337 Ga0070682_100028510 Ga0070682_1000285102 203
22 3300005338 Ga0068868_100043148 Ga0068868_1000431482 203
23 3300005339 Ga0070660_100005700 Ga0070660_1000057006 203
24 3300005341 Ga0070691_10016189 Ga0070691_100161893 203
25 3300005343 Ga0070687_100167740 Ga0070687_1001677402 203
26 3300005344 Ga0070661_100033844 Ga0070661_1000338442 203
27 3300005345 Ga0070692_10014580 Ga0070692_100145802 203
28 3300005354 Ga0070675_100073527 Ga0070675_1000735272 203
29 3300005364 Ga0070673_100018676 Ga0070673_1000186764 203
30 3300005366 Ga0070659_100055975 Ga0070659_1000559752 203
31 3300005441 Ga0070700_100092879 Ga0070700_1000928792 203
32 3300005456 Ga0070678_100089113 Ga0070678_1000891132 203
33 3300005457 Ga0070662_100038551 Ga0070662_1000385512 203
34 3300005458 Ga0070681_10292201 Ga0070681_102922012 203
35 3300005459 Ga0068867_100040031 Ga0068867_1000400313 203
36 3300005530 Ga0070679_100273763 Ga0070679_1002737632 203
37 3300005539 Ga0068853_100031620 Ga0068853_1000316205 203
38 3300005543 Ga0070672_100042335 Ga0070672_1000423353 203
39 3300005563 Ga0068855_100187365 Ga0068855_1001873652 203
40 3300005578 Ga0068854_100044994 Ga0068854_1000449942 203
41 3300005718 Ga0068866_10021578 Ga0068866_100215783 203
42 3300006237 Ga0097621_100073500 Ga0097621_1000735002 203
43 3300006881 Ga0068865_100025852 Ga0068865_1000258523 203
44 3300009148 Ga0105243_10071310 Ga0105243_100713102 203
45 3300009545 Ga0105237_10292414 Ga0105237_102924142 203
46 3300009551 Ga0105238_10063471 Ga0105238_100634713 203
47 3300010375 Ga0105239_10074705 Ga0105239_100747054 203
48 3300013105 Ga0157369_10578062 Ga0157369_105780622 203
49 3300013307 Ga0157372_10063768 Ga0157372_100637682 203
50 3300013308 Ga0157375_10038171 Ga0157375_100381714 203
51 3300014745 Ga0157377_10017469 Ga0157377_100174692 203
52 3300025321 Ga0207656_10019302 Ga0207656_100193023 203
53 3300025901 Ga0207688_10027800 Ga0207688_100278003 203
54 3300025909 Ga0207705_10051097 Ga0207705_100510973 203
55 3300025912 Ga0207707_10442111 Ga0207707_104421112 203
56 3300025919 Ga0207657_10002490 Ga0207657_1000249014 203
57 3300025921 Ga0207652_10265262 Ga0207652_102652622 203
58 3300025926 Ga0207659_10096303 Ga0207659_100963032 203
59 3300025927 Ga0207687_10078826 Ga0207687_100788262 203
60 3300025932 Ga0207690_10035464 Ga0207690_100354643 203
61 3300025933 Ga0207706_10022001 Ga0207706_100220013 203
62 3300025935 Ga0207709_10032353 Ga0207709_100323533 203
63 3300025937 Ga0207669_10012998 Ga0207669_100129984 203
64 3300025938 Ga0207704_10021981 Ga0207704_100219812 203
65 3300025940 Ga0207691_10069787 Ga0207691_100697873 203
66 3300025944 Ga0207661_10052715 Ga0207661_100527153 203
67 3300025945 Ga0207679_10134058 Ga0207679_101340582 203
68 3300025949 Ga0207667_10255036 Ga0207667_102550362 203
69 3300025960 Ga0207651_10034092 Ga0207651_100340923 203
70 3300025981 Ga0207640_10029429 Ga0207640_100294292 203
71 3300026023 Ga0207677_10048876 Ga0207677_100488762 203
72 3300026041 Ga0207639_10081289 Ga0207639_100812893 203
73 3300026075 Ga0207708_10048709 Ga0207708_100487092 203
74 3300026089 Ga0207648_10073677 Ga0207648_100736772 203
75 3300026121 Ga0207683_10108070 Ga0207683_101080702 203
76 3300026142 Ga0207698_10064662 Ga0207698_100646622 203
77 3300048904 Ga0496101_0087036 Ga0496101_0087036_917_1828 203
78 3300048907 Ga0496104_0162672 Ga0496104_0162672_1004_1915 203
79 3300048909 Ga0496106_0135129 Ga0496106_0135129_712_1623 203
80 3300048912 Ga0496109_0024562 Ga0496109_0024562_1237_2148 203
81 3300003323 rootH1_10014150 rootH1_100141503 206
82 3300005467 Ga0070706_100094120 Ga0070706_1000941203 206
83 3300005518 Ga0070699_100025033 Ga0070699_1000250333 206
84 3300025910 Ga0207684_10009022 Ga0207684_100090222 206
85 3300006847 Ga0075431_100171554 Ga0075431_1001715543 207
86 3300025907 Ga0207645_10014930 Ga0207645_100149304 207
87 3300050510 nmdc:mga06r32_162377_c1 nmdc:mga06r32_162377_c1_373_1281 207
88 3300005468 Ga0070707_100080325 Ga0070707_1000803254 208
89 3300025910 Ga0207684_10125841 Ga0207684_101258413 208
90 3300009147 Ga0114129_10136284 Ga0114129_101362841 209
91 3300048907 Ga0496104_0140637 Ga0496104_0140637_409_1191 210
92 3300053140 Ga0500573_0047454 Ga0500573_0047454_538_1314 210
93 3300053140 Ga0500573_0097520 Ga0500573_0097520_853_1629 210
94 3300053125 Ga0500618_027464 Ga0500618_027464_516_1298 212
95 3300053140 Ga0500573_0236828 Ga0500573_0236828_146_937 212
96 3300009094 Ga0111539_10038039 Ga0111539_100380393 213
97 3300009101 Ga0105247_10011633 Ga0105247_100116333 213
98 3300009553 Ga0105249_10145392 Ga0105249_101453922 213
99 3300013308 Ga0157375_10437285 Ga0157375_104372852 213
100 3300014968 Ga0157379_10158099 Ga0157379_101580992 213
101 3300014969 Ga0157376_10028053 Ga0157376_100280532 213
102 3300048904 Ga0496101_0110052 Ga0496101_0110052_973_1869 213
103 3300048910 Ga0496107_0140289 Ga0496107_0140289_133_1029 213
104 3300048916 Ga0496113_0021498 Ga0496113_0021498_2866_3762 213
105 3300050508 nmdc:mga09592_5246_c1 nmdc:mga09592_5246_c1_5317_6105 213
106 3300013102 Ga0157371_10011550 Ga0157371_100115502 214
107 3300049574 Ga0501038_0316853 Ga0501038_0316853_22_819 214
108 3300049576 Ga0501040_0168556 Ga0501040_0168556_736_1533 214
109 3300049741 Ga0501079_0315064 Ga0501079_0315064_368_1165 214
110 3300005445 Ga0070708_100036594 Ga0070708_1000365943 215
111 3300005467 Ga0070706_100085393 Ga0070706_1000853932 215
112 3300005468 Ga0070707_100096428 Ga0070707_1000964282 215
113 3300005468 Ga0070707_100258449 Ga0070707_1002584492 215
114 3300005471 Ga0070698_100036486 Ga0070698_1000364864 215
115 3300005471 Ga0070698_100151996 Ga0070698_1001519962 215
116 3300005518 Ga0070699_100054379 Ga0070699_1000543793 215
117 3300005536 Ga0070697_100001084 Ga0070697_1000010848 215
118 3300005536 Ga0070697_100025425 Ga0070697_1000254253 215
119 3300009147 Ga0114129_10012145 Ga0114129_1001214511 215
120 3300025910 Ga0207684_10011036 Ga0207684_100110365 215
121 3300025910 Ga0207684_10013657 Ga0207684_100136572 215
122 3300025922 Ga0207646_10003155 Ga0207646_1000315517 215
123 3300025922 Ga0207646_10047624 Ga0207646_100476242 215
124 3300025922 Ga0207646_10093658 Ga0207646_100936582 215
125 3300042876 Ga0451577_0052996 Ga0451577_0052996_33_821 215
126 3300044673 Ga0453683_0026353 Ga0453683_0026353_2176_2964 215
127 3300044712 Ga0453684_0007326 Ga0453684_0007326_3262_4050 215
128 3300049572 Ga0501036_0010719 Ga0501036_0010719_3810_4601 215
129 3300050507 nmdc:mga05p37_7863_c1 nmdc:mga05p37_7863_c1_490_1278 215
130 3300005329 Ga0070683_100153607 Ga0070683_1001536072 216
131 3300005354 Ga0070675_100258171 Ga0070675_1002581712 216
132 3300005455 Ga0070663_100054465 Ga0070663_1000544652 216
133 3300005457 Ga0070662_100212076 Ga0070662_1002120762 216
134 3300005535 Ga0070684_100331425 Ga0070684_1003314252 216
135 3300005535 Ga0070684_100404710 Ga0070684_1004047102 216
136 3300005564 Ga0070664_100094432 Ga0070664_1000944322 216
137 3300005577 Ga0068857_100013049 Ga0068857_1000130496 216
138 3300005615 Ga0070702_100139704 Ga0070702_1001397041 216
139 3300005617 Ga0068859_100052600 Ga0068859_1000526002 216
140 3300006058 Ga0075432_10015501 Ga0075432_100155013 216
141 3300006852 Ga0075433_10272201 Ga0075433_102722012 216
142 3300006871 Ga0075434_100360142 Ga0075434_1003601422 216
143 3300006931 Ga0097620_100052599 Ga0097620_1000525992 216
144 3300009094 Ga0111539_10065086 Ga0111539_100650863 216
145 3300025908 Ga0207643_10018189 Ga0207643_100181892 216
146 3300025925 Ga0207650_10061325 Ga0207650_100613253 216
147 3300025931 Ga0207644_10150226 Ga0207644_101502262 216
148 3300025935 Ga0207709_10053080 Ga0207709_100530802 216
149 3300025940 Ga0207691_10033166 Ga0207691_100331662 216
150 3300025942 Ga0207689_10038040 Ga0207689_100380404 216
151 3300025945 Ga0207679_10149599 Ga0207679_101495992 216
152 3300026075 Ga0207708_10039834 Ga0207708_100398343 216
153 3300026089 Ga0207648_10148672 Ga0207648_101486721 216
154 3300026116 Ga0207674_10020614 Ga0207674_100206142 216
155 3300026116 Ga0207674_10089188 Ga0207674_100891882 216
156 3300026121 Ga0207683_10021675 Ga0207683_100216752 216
157 3300027907 Ga0207428_10104395 Ga0207428_101043952 216
158 3300048908 Ga0496105_0174149 Ga0496105_0174149_705_1616 216
159 3300049568 Ga0501031_0009218 Ga0501031_0009218_1888_2682 216
160 3300049568 Ga0501031_0021850 Ga0501031_0021850_1998_2795 216
161 3300049568 Ga0501031_0029120 Ga0501031_0029120_1370_2164 216
162 3300049569 Ga0501032_0005070 Ga0501032_0005070_3200_3997 216
163 3300049569 Ga0501032_0012228 Ga0501032_0012228_5057_5851 216
164 3300049571 Ga0501034_0019006 Ga0501034_0019006_3875_4672 216
165 3300049571 Ga0501034_0091535 Ga0501034_0091535_806_1600 216
166 3300049572 Ga0501036_0009699 Ga0501036_0009699_5913_6710 216
167 3300049572 Ga0501036_0022202 Ga0501036_0022202_859_1653 216
168 3300049573 Ga0501037_0008295 Ga0501037_0008295_5913_6710 216
169 3300049573 Ga0501037_0028678 Ga0501037_0028678_1879_2673 216
170 3300049574 Ga0501038_0001881 Ga0501038_0001881_17175_17969 216
171 3300049574 Ga0501038_0008574 Ga0501038_0008574_4203_5000 216
172 3300049574 Ga0501038_0189076 Ga0501038_0189076_503_1297 216
173 3300049575 Ga0501039_0215331 Ga0501039_0215331_236_1030 216
174 3300049578 Ga0501042_0060421 Ga0501042_0060421_1886_2683 216
175 3300049579 Ga0501043_0005163 Ga0501043_0005163_3194_3991 216
176 3300049579 Ga0501043_0007779 Ga0501043_0007779_1852_2646 216
177 3300049579 Ga0501043_0012734 Ga0501043_0012734_3576_4370 216
178 3300049580 Ga0501046_0012263 Ga0501046_0012263_4012_4809 216
179 3300049580 Ga0501046_0035410 Ga0501046_0035410_1571_2365 216
180 3300049581 Ga0501047_0030131 Ga0501047_0030131_2721_3518 216
181 3300049581 Ga0501047_0059077 Ga0501047_0059077_1026_1820 216
182 3300049581 Ga0501047_0267919 Ga0501047_0267919_361_1155 216
183 3300049582 Ga0501048_0005769 Ga0501048_0005769_8218_9012 216
184 3300049582 Ga0501048_0011434 Ga0501048_0011434_3473_4267 216
185 3300049582 Ga0501048_0013919 Ga0501048_0013919_2084_2881 216
186 3300049583 Ga0501067_0007714 Ga0501067_0007714_5014_5808 216
187 3300049583 Ga0501067_0015268 Ga0501067_0015268_1575_2369 216
188 3300049584 Ga0501068_0009932 Ga0501068_0009932_3172_3966 216
189 3300049584 Ga0501068_0011551 Ga0501068_0011551_2973_3770 216
190 3300049584 Ga0501068_0020805 Ga0501068_0020805_353_1147 216
191 3300049585 Ga0501069_0000166 Ga0501069_0000166_21085_21879 216
192 3300049586 Ga0501070_0016745 Ga0501070_0016745_3746_4540 216
193 3300049586 Ga0501070_0134856 Ga0501070_0134856_336_1133 216
194 3300049587 Ga0501071_0010812 Ga0501071_0010812_2267_3061 216
195 3300049587 Ga0501071_0079657 Ga0501071_0079657_1571_2365 216
196 3300049588 Ga0501072_0024380 Ga0501072_0024380_1748_2542 216
197 3300049588 Ga0501072_0235487 Ga0501072_0235487_113_907 216
198 3300049589 Ga0501073_0001412 Ga0501073_0001412_4093_4890 216
199 3300049589 Ga0501073_0012631 Ga0501073_0012631_3951_4745 216
200 3300049589 Ga0501073_0030813 Ga0501073_0030813_1153_1947 216
201 3300049590 Ga0501074_0007669 Ga0501074_0007669_3473_4267 216
202 3300049590 Ga0501074_0009612 Ga0501074_0009612_4382_5179 216
203 3300049590 Ga0501074_0028639 Ga0501074_0028639_537_1331 216
204 3300049592 Ga0501076_0003442 Ga0501076_0003442_7275_8072 216
205 3300049741 Ga0501079_0004089 Ga0501079_0004089_7857_8654 216
206 3300049741 Ga0501079_0005076 Ga0501079_0005076_1913_2707 216
207 3300049742 Ga0501080_0005191 Ga0501080_0005191_5960_6754 216
208 3300049742 Ga0501080_0006194 Ga0501080_0006194_6140_6937 216
209 3300049742 Ga0501080_0146262 Ga0501080_0146262_365_1159 216
210 3300049744 Ga0501083_0006389 Ga0501083_0006389_3747_4544 216
211 3300049744 Ga0501083_0056051 Ga0501083_0056051_1571_2365 216
212 3300049822 Ga0501035_0001547 Ga0501035_0001547_19095_19892 216
213 3300049822 Ga0501035_0021456 Ga0501035_0021456_1444_2238 216
214 3300049823 Ga0501044_0004749 Ga0501044_0004749_4779_5576 216
215 3300049823 Ga0501044_0012589 Ga0501044_0012589_1154_1948 216
216 3300049824 Ga0501045_0002062 Ga0501045_0002062_6005_6799 216
217 3300049824 Ga0501045_0144747 Ga0501045_0144747_762_1556 216
218 3300050511 nmdc:mga08y16_32962_c1 nmdc:mga08y16_32962_c1_2438_3349 216
219 3300050515 nmdc:mga0a205_73310_c1 nmdc:mga0a205_73310_c1_2194_3105 216
220 3300054114 Ga0501084_0000888 Ga0501084_0000888_11063_11860 216
221 3300054114 Ga0501084_0093239 Ga0501084_0093239_382_1176 216
222 3300060353 Ga0501082_0010225 Ga0501082_0010225_897_1694 216
223 3300060353 Ga0501082_0012592 Ga0501082_0012592_2544_3338 216
224 3300005544 Ga0070686_100197939 Ga0070686_1001979392 217
225 3300006358 Ga0068871_100273574 Ga0068871_1002735742 217
226 3300013100 Ga0157373_10016259 Ga0157373_100162592 217
227 3300013307 Ga0157372_10502152 Ga0157372_105021522 217
228 3300025923 Ga0207681_10222444 Ga0207681_102224442 217
229 3300026067 Ga0207678_10026970 Ga0207678_100269702 217
230 3300049584 Ga0501068_0082706 Ga0501068_0082706_654_1565 217
231 3300049585 Ga0501069_0053305 Ga0501069_0053305_358_1269 217
232 3300049587 Ga0501071_0008178 Ga0501071_0008178_2790_3701 217
233 3300049572 Ga0501036_0190469 Ga0501036_0190469_731_1573 218
234 3300061734 Ga0530510_0000656 Ga0530510_0000656_10738_11637 218
235 3300005329 Ga0070683_100009813 Ga0070683_1000098136 219
236 3300005338 Ga0068868_100069325 Ga0068868_1000693252 219
237 3300005354 Ga0070675_100370959 Ga0070675_1003709592 219
238 3300005365 Ga0070688_100081964 Ga0070688_1000819642 219
239 3300005440 Ga0070705_100060963 Ga0070705_1000609631 219
240 3300005441 Ga0070700_100246084 Ga0070700_1002460842 219
241 3300005535 Ga0070684_100010496 Ga0070684_1000104963 219
242 3300005616 Ga0068852_100491542 Ga0068852_1004915422 219
243 3300009098 Ga0105245_10030005 Ga0105245_100300053 219
244 3300013102 Ga0157371_10292843 Ga0157371_102928432 219
245 3300014745 Ga0157377_10038837 Ga0157377_100388373 219
246 3300025901 Ga0207688_10002539 Ga0207688_100025392 219
247 3300025926 Ga0207659_10242435 Ga0207659_102424352 219
248 3300025927 Ga0207687_10007965 Ga0207687_100079652 219
249 3300025944 Ga0207661_10052167 Ga0207661_100521672 219
250 3300026023 Ga0207677_10008588 Ga0207677_100085885 219
251 3300026075 Ga0207708_10083849 Ga0207708_100838493 219
252 3300026121 Ga0207683_10181390 Ga0207683_101813902 219
253 3300026142 Ga0207698_10410288 Ga0207698_104102882 219
254 3300048905 Ga0496102_0351488 Ga0496102_0351488_142_1047 219
255 3300048911 Ga0496108_0027134 Ga0496108_0027134_2427_3332 219
256 3300048912 Ga0496109_0025767 Ga0496109_0025767_1837_2742 219
257 3300048913 Ga0496110_0005834 Ga0496110_0005834_1621_2526 219
258 3300048914 Ga0496111_0058031 Ga0496111_0058031_1012_1917 219
259 3300048915 Ga0496112_0098029 Ga0496112_0098029_1335_2240 219
260 3300010375 Ga0105239_10127648 Ga0105239_101276483 220
261 3300046660 Ga0495625_0224780 Ga0495625_0224780_73_960 220
262 3300048905 Ga0496102_0321754 Ga0496102_0321754_52_879 220
263 3300048909 Ga0496106_0086769 Ga0496106_0086769_618_1445 220
264 3300048913 Ga0496110_0196147 Ga0496110_0196147_597_1424 220
265 3300048915 Ga0496112_0036675 Ga0496112_0036675_157_984 220
266 3300048916 Ga0496113_0116315 Ga0496113_0116315_118_945 220
267 3300050507 nmdc:mga05p37_150533_c1 nmdc:mga05p37_150533_c1_132_959 220
268 3300050515 nmdc:mga0a205_76424_c1 nmdc:mga0a205_76424_c1_262_1089 220
269 3300046664 Ga0495659_0115697 Ga0495659_0115697_50_865 222
270 3300050509 nmdc:mga0qj67_98562_c1 nmdc:mga0qj67_98562_c1_84_986 223
271 3300050510 nmdc:mga06r32_97066_c1 nmdc:mga06r32_97066_c1_866_1768 223
272 3300039450 Ga0436363_1421802 Ga0436363_1421802_83_988 224
273 3300005981 Ga0081538_10098811 Ga0081538_100988112 225
274 3300009147 Ga0114129_10941376 Ga0114129_109413762 225
275 3300005985 Ga0081539_10003664 Ga0081539_1000366418 226
276 3300006844 Ga0075428_100230313 Ga0075428_1002303132 226
277 3300039450 Ga0436363_1110042 Ga0436363_1110042_461_1324 226
278 3300003203 JGI25406J46586_10036843 JGI25406J46586_100368432 227
279 3300032004 Ga0307414_10082633 Ga0307414_100826333 227
280 3300032126 Ga0307415_100303186 Ga0307415_1003031861 227
281 3300014325 Ga0163163_10337282 Ga0163163_103372822 228
282 3300025935 Ga0207709_10226263 Ga0207709_102262632 228
283 3300046615 Ga0495656_0000008 Ga0495656_0000008_4335_5201 228
284 3300046664 Ga0495659_0001962 Ga0495659_0001962_4750_5616 228
285 3300049587 Ga0501071_0087711 Ga0501071_0087711_287_1174 228
286 3300005445 Ga0070708_100183921 Ga0070708_1001839212 229
287 3300005367 Ga0070667_100038389 Ga0070667_1000383892 230
288 3300005983 Ga0081540_1018683 Ga0081540_10186833 230
289 3300025981 Ga0207640_10367500 Ga0207640_103675001 230
290 3300025986 Ga0207658_10027377 Ga0207658_100273772 230
291 3300028381 Ga0268264_10347628 Ga0268264_103476281 230
292 3300031824 Ga0307413_10102061 Ga0307413_101020611 230
293 3300032005 Ga0307411_10053923 Ga0307411_100539232 230
294 3300042115 Ga0450911_000174 Ga0450911_000174_11080_11937 230
295 3300048924 Ga0496121_0029719 Ga0496121_0029719_1525_2382 230
296 3300048928 Ga0496125_0011084 Ga0496125_0011084_2183_3040 230
297 3300038443 Ga0395901_0156856 Ga0395901_0156856_882_1778 231
298 3300048928 Ga0496125_0041028 Ga0496125_0041028_85_942 231
299 3300049743 Ga0501081_0022534 Ga0501081_0022534_18_950 231
300 3300061734 Ga0530510_0012132 Ga0530510_0012132_4036_4935 231
301 3300005468 Ga0070707_100225521 Ga0070707_1002255211 232
302 3300025910 Ga0207684_10299998 Ga0207684_102999981 232
303 3300025922 Ga0207646_10245154 Ga0207646_102451541 232
304 3300031852 Ga0307410_10198896 Ga0307410_101988962 232
305 3300049583 Ga0501067_0009048 Ga0501067_0009048_1256_2146 232
306 3300046648 Ga0495611_0012711 Ga0495611_0012711_377_1273 234
307 3300049576 Ga0501040_0073685 Ga0501040_0073685_309_1262 234
308 3300049591 Ga0501075_0023412 Ga0501075_0023412_2325_3278 234
309 3300049592 Ga0501076_0027168 Ga0501076_0027168_20_973 234
310 3300049824 Ga0501045_0074839 Ga0501045_0074839_330_1283 234
311 3300053125 Ga0500618_000075 Ga0500618_000075_39169_40017 234
312 3300025302 Ga0207426_1019449 Ga0207426_10194492 235
313 3300031548 Ga0307408_100233817 Ga0307408_1002338172 235
314 3300005844 Ga0068862_100004772 Ga0068862_10000477211 236
315 3300028380 Ga0268265_10004310 Ga0268265_100043108 236
316 3300037471 Ga0395905_0008475 Ga0395905_0008475_8925_9764 236
317 3300049742 Ga0501080_0384048 Ga0501080_0384048_120_1073 236
318 3300034817 Ga0373948_0006165 Ga0373948_0006165_113_1009 237
319 3300034819 Ga0373958_0008572 Ga0373958_0008572_492_1388 237
320 3300035114 Ga0373939_0002495 Ga0373939_0002495_2408_3304 237
321 3300035121 Ga0373960_0009426 Ga0373960_0009426_196_1092 237
322 3300035691 Ga0373931_0026999 Ga0373931_0026999_1004_1900 237
323 3300046506 Ga0495583_0039415 Ga0495583_0039415_911_1807 237
324 3300046520 Ga0495637_0065166 Ga0495637_0065166_349_1245 237
325 3300046665 Ga0495661_0122324 Ga0495661_0122324_254_1150 237
326 3300049569 Ga0501032_0002720 Ga0501032_0002720_8583_9488 237
327 3300049573 Ga0501037_0028114 Ga0501037_0028114_458_1363 237
328 3300049574 Ga0501038_0021677 Ga0501038_0021677_2037_2942 237
329 3300049579 Ga0501043_0020815 Ga0501043_0020815_3013_3918 237
330 3300049581 Ga0501047_0009271 Ga0501047_0009271_5382_6287 237
331 3300049584 Ga0501068_0139071 Ga0501068_0139071_49_957 237
332 3300049586 Ga0501070_0052268 Ga0501070_0052268_2233_3138 237
333 3300049822 Ga0501035_0021507 Ga0501035_0021507_2234_3139 237
334 3300053139 Ga0500568_0015778 Ga0500568_0015778_2080_3003 237
335 iso_pu_bacteria 8056207758 8056213110 237
336 3300025298 Ga0209050_1007002 Ga0209050_10070022 238
337 3300025303 Ga0209051_1028456 Ga0209051_10284562 238
338 3300025304 Ga0209257_1000562 Ga0209257_100056260 238
339 3300048913 Ga0496110_0237903 Ga0496110_0237903_511_1374 238
340 3300005547 Ga0070693_100093523 Ga0070693_1000935232 239
341 3300046472 Ga0495580_0025026 Ga0495580_0025026_612_1520 239
342 3300005344 Ga0070661_100026778 Ga0070661_1000267783 240
343 3300005345 Ga0070692_10106324 Ga0070692_101063242 240
344 3300005347 Ga0070668_100054343 Ga0070668_1000543432 240
345 3300005354 Ga0070675_100021763 Ga0070675_1000217635 240
346 3300005356 Ga0070674_100109701 Ga0070674_1001097012 240
347 3300005444 Ga0070694_100009080 Ga0070694_1000090806 240
348 3300005456 Ga0070678_100085124 Ga0070678_1000851243 240
349 3300005471 Ga0070698_100021151 Ga0070698_1000211516 240
350 3300005547 Ga0070693_100010955 Ga0070693_1000109553 240
351 3300005549 Ga0070704_100007424 Ga0070704_1000074245 240
352 3300005718 Ga0068866_10001490 Ga0068866_100014909 240
353 3300005719 Ga0068861_100006306 Ga0068861_1000063064 240
354 3300006058 Ga0075432_10000854 Ga0075432_100008548 240
355 3300006358 Ga0068871_100042611 Ga0068871_1000426114 240
356 3300006846 Ga0075430_100075051 Ga0075430_1000750512 240
357 3300006847 Ga0075431_100029626 Ga0075431_1000296265 240
358 3300006852 Ga0075433_10002380 Ga0075433_1000238011 240
359 3300006871 Ga0075434_100002270 Ga0075434_10000227019 240
360 3300006871 Ga0075434_100015902 Ga0075434_1000159025 240
361 3300009094 Ga0111539_10009437 Ga0111539_1000943710 240
362 3300009147 Ga0114129_10010122 Ga0114129_1001012214 240
363 3300009147 Ga0114129_10029708 Ga0114129_100297082 240
364 3300009148 Ga0105243_10107201 Ga0105243_101072012 240
365 3300009553 Ga0105249_10029668 Ga0105249_100296682 240
366 3300013297 Ga0157378_10049462 Ga0157378_100494622 240
367 3300014745 Ga0157377_10023180 Ga0157377_100231803 240
368 3300025899 Ga0207642_10025587 Ga0207642_100255873 240
369 3300025907 Ga0207645_10064195 Ga0207645_100641952 240
370 3300025926 Ga0207659_10139981 Ga0207659_101399812 240
371 3300025927 Ga0207687_10208828 Ga0207687_102088282 240
372 3300025934 Ga0207686_10006732 Ga0207686_100067324 240
373 3300025937 Ga0207669_10277156 Ga0207669_102771562 240
374 3300026023 Ga0207677_10034416 Ga0207677_100344164 240
375 3300026118 Ga0207675_100011563 Ga0207675_1000115636 240
376 3300027907 Ga0207428_10002320 Ga0207428_100023206 240
377 3300027907 Ga0207428_10018781 Ga0207428_100187813 240
378 3300028381 Ga0268264_10285602 Ga0268264_102856022 240
379 3300046558 Ga0495633_0138570 Ga0495633_0138570_220_1107 240
380 3300046794 Ga0495589_0111587 Ga0495589_0111587_136_1044 240
381 3300047472 Ga0495686_0105642 Ga0495686_0105642_309_1220 240
382 3300050507 nmdc:mga05p37_18686_c1 nmdc:mga05p37_18686_c1_2763_3659 240
383 3300050507 nmdc:mga05p37_4695_c1 nmdc:mga05p37_4695_c1_9125_10021 240
384 3300050507 nmdc:mga05p37_96687_c1 nmdc:mga05p37_96687_c1_82_978 240
385 3300050509 nmdc:mga0qj67_6731_c1 nmdc:mga0qj67_6731_c1_1079_1975 240
386 3300050510 nmdc:mga06r32_53930_c1 nmdc:mga06r32_53930_c1_14_910 240
387 3300050511 nmdc:mga08y16_191120_c1 nmdc:mga08y16_191120_c1_413_1309 240
388 3300050512 nmdc:mga0n895_18116_c1 nmdc:mga0n895_18116_c1_3872_4768 240
389 3300050512 nmdc:mga0n895_20008_c1 nmdc:mga0n895_20008_c1_990_1886 240
390 3300050515 nmdc:mga0a205_36052_c1 nmdc:mga0a205_36052_c1_3146_4042 240
391 3300053096 Ga0500641_0012760 Ga0500641_0012760_209_1120 240
392 3300053142 Ga0500577_0067149 Ga0500577_0067149_48_935 240
393 3300031251 Ga0265327_10074678 Ga0265327_100746782 241
394 3300031852 Ga0307410_10154128 Ga0307410_101541282 241
395 3300045976 Ga0466967_0036322 Ga0466967_0036322_2650_3555 241
396 3300046460 Ga0495638_0000299 Ga0495638_0000299_4430_5320 241
397 3300046474 Ga0495605_0042217 Ga0495605_0042217_1054_1944 241
398 3300046492 Ga0495585_0002346 Ga0495585_0002346_456_1346 241
399 3300046506 Ga0495583_0058215 Ga0495583_0058215_561_1451 241
400 3300046518 Ga0495631_0001476 Ga0495631_0001476_12336_13226 241
401 3300046519 Ga0495632_0043822 Ga0495632_0043822_1083_1973 241
402 3300046530 Ga0495654_0097671 Ga0495654_0097671_450_1340 241
403 3300046616 Ga0495668_0028640 Ga0495668_0028640_847_1737 241
404 3300046648 Ga0495611_0012625 Ga0495611_0012625_972_1862 241
405 3300046660 Ga0495625_0090145 Ga0495625_0090145_276_1166 241
406 3300046691 Ga0495670_0144899 Ga0495670_0144899_128_1018 241
407 3300046810 Ga0495660_0068141 Ga0495660_0068141_22_912 241
408 3300049580 Ga0501046_0181377 Ga0501046_0181377_445_1335 241
409 3300049742 Ga0501080_0213813 Ga0501080_0213813_436_1347 241
410 3300050514 nmdc:mga08x19_152229_c1 nmdc:mga08x19_152229_c1_567_1442 241
411 3300053105 Ga0500557_033666 Ga0500557_033666_467_1357 241
412 3300053139 Ga0500568_0001239 Ga0500568_0001239_15476_16366 241
413 3300053151 Ga0500604_0020246 Ga0500604_0020246_553_1464 241
414 3300053153 Ga0500616_0015018 Ga0500616_0015018_985_1875 241
415 3300006844 Ga0075428_100023025 Ga0075428_1000230256 242
416 3300006847 Ga0075431_100012616 Ga0075431_1000126167 242
417 3300031731 Ga0307405_10475755 Ga0307405_104757551 242
418 3300031995 Ga0307409_100434292 Ga0307409_1004342922 242
419 3300035089 Ga0373944_0014893 Ga0373944_0014893_580_1482 242
420 3300046459 Ga0495629_0058446 Ga0495629_0058446_1756_2649 242
421 3300046476 Ga0495662_0013542 Ga0495662_0013542_1487_2380 242
422 3300046529 Ga0495652_0100181 Ga0495652_0100181_892_1785 242
423 3300046536 Ga0495587_0119745 Ga0495587_0119745_165_1058 242
424 3300046557 Ga0495622_0015943 Ga0495622_0015943_2073_2966 242
425 3300046663 Ga0495635_0062488 Ga0495635_0062488_412_1305 242
426 3300049576 Ga0501040_0163990 Ga0501040_0163990_289_1176 242
427 3300049822 Ga0501035_0497170 Ga0501035_0497170_12_872 242
428 3300050510 nmdc:mga06r32_16871_c1 nmdc:mga06r32_16871_c1_498_1400 242
429 3300050515 nmdc:mga0a205_23580_c1 nmdc:mga0a205_23580_c1_2749_3651 242
430 3300053085 Ga0495619_0127838 Ga0495619_0127838_230_1123 242
431 3300003203 JGI25406J46586_10061084 JGI25406J46586_100610842 243
432 3300003215 JGI25153J46596_10000156 JGI25153J46596_1000015613 243
433 3300003215 JGI25153J46596_10001297 JGI25153J46596_100012972 243
434 3300005985 Ga0081539_10000977 Ga0081539_1000097752 243
435 3300005985 Ga0081539_10126197 Ga0081539_101261972 243
436 3300006847 Ga0075431_100598722 Ga0075431_1005987221 243
437 3300025297 Ga0209758_1000119 Ga0209758_1000119166 243
438 3300025922 Ga0207646_10109980 Ga0207646_101099802 243
439 3300031235 Ga0265330_10050509 Ga0265330_100505092 243
440 3300031239 Ga0265328_10043977 Ga0265328_100439772 243
441 3300031247 Ga0265340_10079294 Ga0265340_100792942 243
442 3300031344 Ga0265316_10034575 Ga0265316_100345754 243
443 3300031711 Ga0265314_10080258 Ga0265314_100802582 243
444 3300031712 Ga0265342_10051659 Ga0265342_100516592 243
445 3300049568 Ga0501031_0004612 Ga0501031_0004612_5214_6104 243
446 3300049572 Ga0501036_0025265 Ga0501036_0025265_814_1704 243
447 3300049572 Ga0501036_0262789 Ga0501036_0262789_495_1394 243
448 3300049574 Ga0501038_0176076 Ga0501038_0176076_191_1081 243
449 3300049576 Ga0501040_0003985 Ga0501040_0003985_5159_6049 243
450 3300049577 Ga0501041_0083116 Ga0501041_0083116_788_1678 243
451 3300049578 Ga0501042_0007794 Ga0501042_0007794_5141_6031 243
452 3300049580 Ga0501046_0097700 Ga0501046_0097700_493_1392 243
453 3300049582 Ga0501048_0001403 Ga0501048_0001403_2436_3326 243
454 3300049583 Ga0501067_0062754 Ga0501067_0062754_929_1828 243
455 3300049587 Ga0501071_0002460 Ga0501071_0002460_3473_4363 243
456 3300049588 Ga0501072_0008198 Ga0501072_0008198_1715_2605 243
457 3300049589 Ga0501073_0094983 Ga0501073_0094983_894_1784 243
458 3300049590 Ga0501074_0051376 Ga0501074_0051376_982_1872 243
459 3300049591 Ga0501075_0005483 Ga0501075_0005483_3225_4115 243
460 3300049592 Ga0501076_0010477 Ga0501076_0010477_3287_4177 243
461 3300049741 Ga0501079_0051651 Ga0501079_0051651_777_1667 243
462 3300049742 Ga0501080_0131803 Ga0501080_0131803_735_1634 243
463 3300049742 Ga0501080_0287125 Ga0501080_0287125_529_1419 243
464 3300049743 Ga0501081_0034615 Ga0501081_0034615_971_1861 243
465 3300049744 Ga0501083_0023722 Ga0501083_0023722_96_995 243
466 3300049822 Ga0501035_0039139 Ga0501035_0039139_2310_3200 243
467 3300049824 Ga0501045_0019068 Ga0501045_0019068_1646_2536 243
468 3300053153 Ga0500616_0002241 Ga0500616_0002241_7248_8159 243
469 3300054114 Ga0501084_0018632 Ga0501084_0018632_2569_3459 243
470 3300060353 Ga0501082_0034485 Ga0501082_0034485_3271_4161 243
471 3300060353 Ga0501082_0099324 Ga0501082_0099324_1402_2301 243
472 3300005468 Ga0070707_100315862 Ga0070707_1003158622 244
473 3300005549 Ga0070704_100042576 Ga0070704_1000425763 244
474 3300005985 Ga0081539_10027690 Ga0081539_100276903 244
475 3300006852 Ga0075433_10083595 Ga0075433_100835952 244
476 3300025922 Ga0207646_10036457 Ga0207646_100364573 244
477 3300031995 Ga0307409_100157590 Ga0307409_1001575902 244
478 3300047319 Ga0495674_0333620 Ga0495674_0333620_50_1009 244
479 3300049575 Ga0501039_0091123 Ga0501039_0091123_945_1898 244
480 3300049591 Ga0501075_0046501 Ga0501075_0046501_1916_2869 244
481 3300006914 Ga0075436_100112983 Ga0075436_1001129832 245
482 3300007076 Ga0075435_100281523 Ga0075435_1002815232 245
483 3300007265 Ga0099794_10002875 Ga0099794_100028757 245
484 3300021384 Ga0213876_10020344 Ga0213876_100203443 245
485 3300025910 Ga0207684_10292974 Ga0207684_102929742 245
486 3300027671 Ga0209588_1004368 Ga0209588_10043683 245
487 3300039437 Ga0436365_0199037 Ga0436365_0199037_21712_22638 245
488 3300050514 nmdc:mga08x19_71853_c1 nmdc:mga08x19_71853_c1_404_1294 245
489 3300005985 Ga0081539_10071160 Ga0081539_100711601 246
490 3300031852 Ga0307410_10100712 Ga0307410_101007122 246
491 3300031901 Ga0307406_10301164 Ga0307406_103011642 246
492 3300032002 Ga0307416_100022715 Ga0307416_1000227153 246
493 3300032126 Ga0307415_100338116 Ga0307415_1003381162 246
494 3300044694 Ga0466963_0296361 Ga0466963_0296361_27_953 246
495 3300049578 Ga0501042_0119210 Ga0501042_0119210_874_1779 246
496 3300049592 Ga0501076_0116666 Ga0501076_0116666_459_1364 246
497 3300059424 Ga0590075_021824 Ga0590075_021824_146_1051 246
498 3300059426 Ga0590077_006279 Ga0590077_006279_232_1137 246
499 3300061734 Ga0530510_0013307 Ga0530510_0013307_2990_3886 246
500 3300021441 Ga0213871_10008183 Ga0213871_100081832 247
501 3300025254 Ga0209148_1010860 Ga0209148_10108602 247
502 3300032002 Ga0307416_100227590 Ga0307416_1002275902 247
503 3300039438 Ga0436360_0631597 Ga0436360_0631597_1499_2425 247
504 3300039453 Ga0436362_0332095 Ga0436362_0332095_1640_2566 247
505 3300039453 Ga0436362_0650647 Ga0436362_0650647_426_1379 247
506 3300049582 Ga0501048_0330334 Ga0501048_0330334_10_924 247
507 3300006847 Ga0075431_100278718 Ga0075431_1002787182 248
508 3300025922 Ga0207646_10059172 Ga0207646_100591723 248
509 3300031711 Ga0265314_10048196 Ga0265314_100481963 248
510 3300049568 Ga0501031_0110034 Ga0501031_0110034_461_1369 248
511 3300049569 Ga0501032_0002226 Ga0501032_0002226_12896_13804 248
512 3300049570 Ga0501033_0002027 Ga0501033_0002027_7004_7912 248
513 3300049571 Ga0501034_0003286 Ga0501034_0003286_5572_6480 248
514 3300049572 Ga0501036_0006183 Ga0501036_0006183_3872_4780 248
515 3300049573 Ga0501037_0022625 Ga0501037_0022625_1850_2758 248
516 3300049574 Ga0501038_0026151 Ga0501038_0026151_1880_2788 248
517 3300049575 Ga0501039_0000586 Ga0501039_0000586_20022_20930 248
518 3300049579 Ga0501043_0002665 Ga0501043_0002665_7004_7912 248
519 3300049580 Ga0501046_0001687 Ga0501046_0001687_14550_15458 248
520 3300049581 Ga0501047_0008214 Ga0501047_0008214_3573_4481 248
521 3300049582 Ga0501048_0033443 Ga0501048_0033443_2389_3297 248
522 3300049583 Ga0501067_0000637 Ga0501067_0000637_16949_17857 248
523 3300049584 Ga0501068_0013853 Ga0501068_0013853_1589_2497 248
524 3300049585 Ga0501069_0003362 Ga0501069_0003362_4455_5363 248
525 3300049586 Ga0501070_0001189 Ga0501070_0001189_12303_13211 248
526 3300049589 Ga0501073_0002428 Ga0501073_0002428_1044_1952 248
527 3300049590 Ga0501074_0002168 Ga0501074_0002168_6507_7415 248
528 3300049592 Ga0501076_0267740 Ga0501076_0267740_131_1039 248
529 3300049741 Ga0501079_0063412 Ga0501079_0063412_157_1065 248
530 3300049742 Ga0501080_0001509 Ga0501080_0001509_13170_14078 248
531 3300049744 Ga0501083_0000158 Ga0501083_0000158_39925_40833 248
532 3300049822 Ga0501035_0014966 Ga0501035_0014966_2164_3072 248
533 3300049823 Ga0501044_0025282 Ga0501044_0025282_3787_4695 248
534 3300050510 nmdc:mga06r32_200856_c1 nmdc:mga06r32_200856_c1_537_1448 248
535 3300054114 Ga0501084_0004046 Ga0501084_0004046_889_1797 248
536 3300060353 Ga0501082_0001437 Ga0501082_0001437_16968_17876 248
537 3300021361 Ga0213872_10050912 Ga0213872_100509122 249
538 3300039447 Ga0436361_0319848 Ga0436361_0319848_187_1119 249
539 3300053731 Ga0500609_001315 Ga0500609_001315_711_1622 249
540 3300005468 Ga0070707_100496225 Ga0070707_1004962251 250
541 3300009147 Ga0114129_10057876 Ga0114129_100578764 250
542 iso_pu_bacteria 2510917028 2511184805 250
543 3300005471 Ga0070698_100106581 Ga0070698_1001065812 251
544 3300035695 Ga0373927_0006704 Ga0373927_0006704_1396_2304 251
545 3300039450 Ga0436363_0406837 Ga0436363_0406837_470_1378 252
546 3300044684 Ga0466966_0113944 Ga0466966_0113944_534_1433 252
547 3300044719 Ga0466971_0087081 Ga0466971_0087081_175_1074 252
548 3300045049 Ga0466959_0024348 Ga0466959_0024348_335_1234 252
549 3300045836 Ga0466958_0124082 Ga0466958_0124082_328_1227 252
550 3300005293 Ga0065715_10110124 Ga0065715_101101243 253
551 3300005327 Ga0070658_10313008 Ga0070658_103130082 253
552 3300005330 Ga0070690_100001347 Ga0070690_10000134711 253
553 3300005331 Ga0070670_100043042 Ga0070670_1000430423 253
554 3300005334 Ga0068869_100096304 Ga0068869_1000963042 253
555 3300005335 Ga0070666_10012643 Ga0070666_100126434 253
556 3300005338 Ga0068868_100000669 Ga0068868_10000066911 253
557 3300005340 Ga0070689_100003750 Ga0070689_10000375011 253
558 3300005343 Ga0070687_100075695 Ga0070687_1000756952 253
559 3300005355 Ga0070671_100018593 Ga0070671_1000185934 253
560 3300005364 Ga0070673_100002342 Ga0070673_10000234210 253
561 3300005365 Ga0070688_100019491 Ga0070688_1000194913 253
562 3300005367 Ga0070667_100026883 Ga0070667_1000268833 253
563 3300005434 Ga0070709_10115790 Ga0070709_101157902 253
564 3300005436 Ga0070713_100050023 Ga0070713_1000500232 253
565 3300005439 Ga0070711_100028417 Ga0070711_1000284173 253
566 3300005458 Ga0070681_10112325 Ga0070681_101123252 253
567 3300005466 Ga0070685_10003867 Ga0070685_100038673 253
568 3300005544 Ga0070686_100110246 Ga0070686_1001102462 253
569 3300005548 Ga0070665_100016632 Ga0070665_1000166324 253
570 3300005615 Ga0070702_100187347 Ga0070702_1001873472 253
571 3300005617 Ga0068859_100053441 Ga0068859_1000534414 253
572 3300005618 Ga0068864_100035018 Ga0068864_1000350182 253
573 3300005841 Ga0068863_100029706 Ga0068863_1000297064 253
574 3300005842 Ga0068858_100247312 Ga0068858_1002473122 253
575 3300005843 Ga0068860_100036412 Ga0068860_1000364124 253
576 3300005937 Ga0081455_10049099 Ga0081455_100490993 253
577 3300006163 Ga0070715_10024930 Ga0070715_100249302 253
578 3300006175 Ga0070712_100121253 Ga0070712_1001212532 253
579 3300006237 Ga0097621_100195092 Ga0097621_1001950922 253
580 3300006358 Ga0068871_100051187 Ga0068871_1000511873 253
581 3300006358 Ga0068871_100086639 Ga0068871_1000866392 253
582 3300006931 Ga0097620_100053439 Ga0097620_1000534394 253
583 3300009098 Ga0105245_10004428 Ga0105245_100044284 253
584 3300009176 Ga0105242_10079910 Ga0105242_100799103 253
585 3300009177 Ga0105248_10514000 Ga0105248_105140002 253
586 3300009551 Ga0105238_10444174 Ga0105238_104441742 253
587 3300011119 Ga0105246_10465977 Ga0105246_104659771 253
588 3300013296 Ga0157374_10001150 Ga0157374_1000115018 253
589 3300013306 Ga0163162_10085182 Ga0163162_100851822 253
590 3300013308 Ga0157375_10001887 Ga0157375_100018873 253
591 3300014968 Ga0157379_10025961 Ga0157379_100259612 253
592 3300014969 Ga0157376_10104162 Ga0157376_101041622 253
593 3300025903 Ga0207680_10030975 Ga0207680_100309753 253
594 3300025906 Ga0207699_10101575 Ga0207699_101015752 253
595 3300025915 Ga0207693_10012669 Ga0207693_100126692 253
596 3300025915 Ga0207693_10015531 Ga0207693_100155314 253
597 3300025918 Ga0207662_10031121 Ga0207662_100311212 253
598 3300025925 Ga0207650_10035282 Ga0207650_100352823 253
599 3300025927 Ga0207687_10000492 Ga0207687_100004925 253
600 3300025928 Ga0207700_10113101 Ga0207700_101131012 253
601 3300025931 Ga0207644_10011954 Ga0207644_100119543 253
602 3300025934 Ga0207686_10163666 Ga0207686_101636662 253
603 3300025936 Ga0207670_10007955 Ga0207670_100079554 253
604 3300025938 Ga0207704_10256863 Ga0207704_102568632 253
605 3300025939 Ga0207665_10012130 Ga0207665_100121303 253
606 3300025941 Ga0207711_10000323 Ga0207711_1000032332 253
607 3300025960 Ga0207651_10002690 Ga0207651_1000269010 253
608 3300025986 Ga0207658_10011876 Ga0207658_100118763 253
609 3300026023 Ga0207677_10000457 Ga0207677_100004573 253
610 3300026035 Ga0207703_10005665 Ga0207703_100056659 253
611 3300026078 Ga0207702_10099356 Ga0207702_100993562 253
612 3300026088 Ga0207641_10025247 Ga0207641_100252472 253
613 3300026095 Ga0207676_10000704 Ga0207676_1000070411 253
614 3300026142 Ga0207698_10027960 Ga0207698_100279602 253
615 3300028379 Ga0268266_10167571 Ga0268266_101675712 253
616 3300028381 Ga0268264_10005778 Ga0268264_100057785 253
617 3300035086 Ga0373934_0019550 Ga0373934_0019550_719_1621 253
618 3300035116 Ga0373945_0011628 Ga0373945_0011628_300_1202 253
619 3300035116 Ga0373945_0026139 Ga0373945_0026139_1059_1961 253
620 3300035117 Ga0373953_0029257 Ga0373953_0029257_321_1223 253
621 3300035118 Ga0373954_0014406 Ga0373954_0014406_903_1805 253
622 3300035118 Ga0373954_0047352 Ga0373954_0047352_913_1815 253
623 3300035119 Ga0373956_0017966 Ga0373956_0017966_2008_2910 253
624 3300035119 Ga0373956_0058894 Ga0373956_0058894_232_1134 253
625 3300035120 Ga0373957_0022350 Ga0373957_0022350_1188_2090 253
626 3300035170 Ga0373943_0017068 Ga0373943_0017068_2039_2941 253
627 3300035172 Ga0373955_0014540 Ga0373955_0014540_1848_2750 253
628 3300035172 Ga0373955_0035471 Ga0373955_0035471_372_1274 253
629 3300035410 Ga0373924_0039681 Ga0373924_0039681_323_1225 253
630 3300035692 Ga0373935_0029554 Ga0373935_0029554_1833_2735 253
631 3300035695 Ga0373927_0011563 Ga0373927_0011563_974_1876 253
632 3300035695 Ga0373927_0013114 Ga0373927_0013114_1525_2427 253
633 3300035724 Ga0373933_0027325 Ga0373933_0027325_2138_3040 253
634 3300035725 Ga0373947_0019642 Ga0373947_0019642_1389_2291 253
635 3300036401 Ga0373937_0032263 Ga0373937_0032263_3282_4184 253
636 3300036401 Ga0373937_0051695 Ga0373937_0051695_1719_2621 253
637 3300037068 Ga0373925_0012185 Ga0373925_0012185_1479_2381 253
638 3300037068 Ga0373925_0035772 Ga0373925_0035772_675_1577 253
639 3300046459 Ga0495629_0136800 Ga0495629_0136800_788_1690 253
640 3300046462 Ga0495651_0213294 Ga0495651_0213294_409_1311 253
641 3300046472 Ga0495580_0160861 Ga0495580_0160861_579_1481 253
642 3300046473 Ga0495582_0016638 Ga0495582_0016638_281_1183 253
643 3300046475 Ga0495639_0004411 Ga0495639_0004411_272_1174 253
644 3300046477 Ga0495664_0008311 Ga0495664_0008311_2141_3043 253
645 3300046516 Ga0495628_0142228 Ga0495628_0142228_409_1311 253
646 3300046517 Ga0495630_0175478 Ga0495630_0175478_695_1597 253
647 3300046531 Ga0495665_0135066 Ga0495665_0135066_320_1222 253
648 3300046535 Ga0495586_0113270 Ga0495586_0113270_442_1344 253
649 3300046536 Ga0495587_0077622 Ga0495587_0077622_411_1313 253
650 3300046543 Ga0495645_0018391 Ga0495645_0018391_2612_3514 253
651 3300046559 Ga0495667_0122879 Ga0495667_0122879_85_987 253
652 3300046663 Ga0495635_0028152 Ga0495635_0028152_2047_2949 253
653 3300046679 Ga0495623_0121986 Ga0495623_0121986_600_1502 253
654 3300046683 Ga0495658_0049725 Ga0495658_0049725_867_1769 253
655 3300046689 Ga0495613_0112224 Ga0495613_0112224_72_974 253
656 3300047315 Ga0495581_0007010 Ga0495581_0007010_987_1889 253
657 3300047322 Ga0495680_0029512 Ga0495680_0029512_2714_3616 253
658 3300047471 Ga0495684_0014543 Ga0495684_0014543_4644_5546 253
659 3300048088 Ga0495602_0116242 Ga0495602_0116242_901_1803 253
660 3300048907 Ga0496104_0131465 Ga0496104_0131465_487_1389 253
661 3300048908 Ga0496105_0272851 Ga0496105_0272851_281_1183 253
662 3300048909 Ga0496106_0221486 Ga0496106_0221486_314_1216 253
663 3300048911 Ga0496108_0180828 Ga0496108_0180828_300_1202 253
664 3300048912 Ga0496109_0128762 Ga0496109_0128762_1049_1951 253
665 3300048915 Ga0496112_0028842 Ga0496112_0028842_3865_4767 253
666 3300048918 Ga0496115_0205429 Ga0496115_0205429_591_1493 253
667 3300049571 Ga0501034_0012148 Ga0501034_0012148_3880_4797 253
668 3300053077 Ga0495601_0143533 Ga0495601_0143533_601_1503 253
669 3300053078 Ga0495612_0007186 Ga0495612_0007186_683_1585 253
670 3300053085 Ga0495619_0025307 Ga0495619_0025307_620_1522 253
671 iso_pu_bacteria 2952252522 2952255968 253
672 3300006038 Ga0075365_10000130 Ga0075365_1000013011 254
673 3300006048 Ga0075363_100056935 Ga0075363_1000569352 254
674 3300006177 Ga0075362_10016131 Ga0075362_100161313 254
675 3300006178 Ga0075367_10000511 Ga0075367_100005112 254
676 3300006186 Ga0075369_10000560 Ga0075369_1000056014 254
677 3300009766 Ga0123342_1003902 Ga0123342_100390218 254
678 3300053130 Ga0500642_0014769 Ga0500642_0014769_1981_2892 254
679 3300002737 JGI25162J39368_1001199 JGI25162J39368_100119910 255
680 3300002987 JGI25159J45721_1007086 JGI25159J45721_10070862 255
681 3300003214 JGI25165J46597_1000736 JGI25165J46597_100073613 255
682 3300003354 JGI25160J50197_1000046 JGI25160J50197_100004691 255
683 3300003374 JGI25161J50226_1000031 JGI25161J50226_100003191 255
684 3300004625 Ga0055543_1000008 Ga0055543_1000008158 255
685 3300005262 Ga0065165_1000336 Ga0065165_100033631 255
686 3300005436 Ga0070713_100000036 Ga0070713_10000003635 255
687 3300005468 Ga0070707_100036625 Ga0070707_1000366254 255
688 3300005539 Ga0068853_100054451 Ga0068853_1000544513 255
689 3300005548 Ga0070665_100565817 Ga0070665_1005658172 255
690 3300005937 Ga0081455_10022903 Ga0081455_100229032 255
691 3300006175 Ga0070712_100368939 Ga0070712_1003689392 255
692 3300009551 Ga0105238_10017601 Ga0105238_100176013 255
693 3300025233 Ga0209437_100086 Ga0209437_100086200 255
694 3300025261 Ga0209233_1000465 Ga0209233_100046513 255
695 3300025284 Ga0209130_1000088 Ga0209130_100008837 255
696 3300025302 Ga0207426_1000012 Ga0207426_100001292 255
697 3300025910 Ga0207684_10360300 Ga0207684_103603002 255
698 3300025924 Ga0207694_10011943 Ga0207694_100119436 255
699 3300025928 Ga0207700_10000098 Ga0207700_100000982 255
700 3300026041 Ga0207639_10262055 Ga0207639_102620552 255
701 3300028379 Ga0268266_10543283 Ga0268266_105432832 255
702 3300028794 Ga0307515_10266394 Ga0307515_102663941 255
703 3300046530 Ga0495654_0015133 Ga0495654_0015133_2359_3267 255
704 3300048929 Ga0496126_0327513 Ga0496126_0327513_258_1163 255
705 3300049568 Ga0501031_0024825 Ga0501031_0024825_2459_3412 255
706 3300049571 Ga0501034_0126998 Ga0501034_0126998_68_967 255
707 3300049572 Ga0501036_0117389 Ga0501036_0117389_437_1390 255
708 3300049572 Ga0501036_0169838 Ga0501036_0169838_97_1050 255
709 3300049574 Ga0501038_0048695 Ga0501038_0048695_1449_2402 255
710 3300049575 Ga0501039_0010466 Ga0501039_0010466_854_1807 255
711 3300049576 Ga0501040_0055736 Ga0501040_0055736_773_1726 255
712 3300049577 Ga0501041_0015917 Ga0501041_0015917_831_1784 255
713 3300049577 Ga0501041_0018770 Ga0501041_0018770_1978_2931 255
714 3300049578 Ga0501042_0051176 Ga0501042_0051176_839_1792 255
715 3300049581 Ga0501047_0134752 Ga0501047_0134752_1309_2208 255
716 3300049582 Ga0501048_0056054 Ga0501048_0056054_1477_2430 255
717 3300049585 Ga0501069_0081037 Ga0501069_0081037_385_1284 255
718 3300049587 Ga0501071_0036582 Ga0501071_0036582_958_1911 255
719 3300049588 Ga0501072_0096441 Ga0501072_0096441_89_1042 255
720 3300049588 Ga0501072_0133490 Ga0501072_0133490_187_1140 255
721 3300049589 Ga0501073_0027936 Ga0501073_0027936_2870_3769 255
722 3300049590 Ga0501074_0004036 Ga0501074_0004036_1392_2345 255
723 3300049591 Ga0501075_0021321 Ga0501075_0021321_933_1886 255
724 3300049591 Ga0501075_0047564 Ga0501075_0047564_962_1915 255
725 3300049592 Ga0501076_0018387 Ga0501076_0018387_831_1784 255
726 3300049592 Ga0501076_0143803 Ga0501076_0143803_537_1490 255
727 3300049593 Ga0501077_0037610 Ga0501077_0037610_520_1473 255
728 3300049741 Ga0501079_0045594 Ga0501079_0045594_1621_2574 255
729 3300049742 Ga0501080_0038807 Ga0501080_0038807_820_1773 255
730 3300049742 Ga0501080_0205514 Ga0501080_0205514_297_1196 255
731 3300049743 Ga0501081_0007210 Ga0501081_0007210_1399_2352 255
732 3300049743 Ga0501081_0009622 Ga0501081_0009622_930_1883 255
733 3300049744 Ga0501083_0024915 Ga0501083_0024915_1910_2809 255
734 3300049744 Ga0501083_0153724 Ga0501083_0153724_264_1217 255
735 3300049822 Ga0501035_0237650 Ga0501035_0237650_276_1175 255
736 3300049824 Ga0501045_0106724 Ga0501045_0106724_314_1267 255
737 3300049824 Ga0501045_0185672 Ga0501045_0185672_482_1435 255
738 3300050512 nmdc:mga0n895_57789_c1 nmdc:mga0n895_57789_c1_2452_3351 255
739 3300054114 Ga0501084_0136175 Ga0501084_0136175_970_1923 255
740 3300054114 Ga0501084_0205853 Ga0501084_0205853_626_1579 255
741 3300054114 Ga0501084_0298786 Ga0501084_0298786_274_1227 255
742 3300060353 Ga0501082_0034527 Ga0501082_0034527_2063_3016 255
743 3300060353 Ga0501082_0085352 Ga0501082_0085352_97_1050 255
744 3300060353 Ga0501082_0089372 Ga0501082_0089372_1594_2547 255
745 3300060353 Ga0501082_0112012 Ga0501082_0112012_353_1252 255
746 3300060353 Ga0501082_0555290 Ga0501082_0555290_48_956 255
747 3300061734 Ga0530510_0014497 Ga0530510_0014497_3328_4281 255
748 3300061734 Ga0530510_0080185 Ga0530510_0080185_1025_1978 255
749 3300061734 Ga0530510_0199064 Ga0530510_0199064_302_1255 255
750 3300005445 Ga0070708_100294083 Ga0070708_1002940832 256
751 3300005536 Ga0070697_100062748 Ga0070697_1000627483 256
752 3300006163 Ga0070715_10152427 Ga0070715_101524272 256
753 3300009093 Ga0105240_10290719 Ga0105240_102907192 256
754 3300025913 Ga0207695_10332327 Ga0207695_103323272 256
755 3300031901 Ga0307406_10381919 Ga0307406_103819191 256
756 3300049586 Ga0501070_0120041 Ga0501070_0120041_271_1179 256
757 3300049589 Ga0501073_0019824 Ga0501073_0019824_2846_3754 256
758 3300049823 Ga0501044_0211839 Ga0501044_0211839_110_1018 256
759 iso_pu_bacteria 2667528174 2671112388 256
760 iso_pu_bacteria 2818991448 2819608389 256
761 3300049569 Ga0501032_0236835 Ga0501032_0236835_59_970 257
762 3300053153 Ga0500616_0041725 Ga0500616_0041725_137_1036 257
763 3300005327 Ga0070658_10039894 Ga0070658_100398942 258
764 3300049570 Ga0501033_0181645 Ga0501033_0181645_419_1330 258
765 3300049571 Ga0501034_0269483 Ga0501034_0269483_405_1316 258
766 3300049583 Ga0501067_0045462 Ga0501067_0045462_1194_2105 258
767 3300049586 Ga0501070_0136562 Ga0501070_0136562_498_1409 258
768 3300049589 Ga0501073_0007864 Ga0501073_0007864_3622_4533 258
769 3300049589 Ga0501073_0067011 Ga0501073_0067011_1455_2366 258
770 3300049744 Ga0501083_0020202 Ga0501083_0020202_3555_4466 258
771 3300049822 Ga0501035_0139660 Ga0501035_0139660_15_926 258
772 3300049823 Ga0501044_0018357 Ga0501044_0018357_6489_7400 258
773 3300053093 Ga0500651_0066760 Ga0500651_0066760_587_1510 258
774 3300053094 Ga0500566_0102525 Ga0500566_0102525_379_1302 258
775 3300053119 Ga0500595_000923 Ga0500595_000923_4315_5238 258
776 3300053156 Ga0500622_0049006 Ga0500622_0049006_1073_1996 258
777 3300054114 Ga0501084_0132751 Ga0501084_0132751_139_1050 258
778 3300041509 Ga0451843_0035460 Ga0451843_0035460_239_1144 259
779 3300048924 Ga0496121_0055547 Ga0496121_0055547_2171_3076 259
780 3300049571 Ga0501034_0344942 Ga0501034_0344942_471_1379 259
781 3300001979 JGI24740J21852_10000204 JGI24740J21852_1000020413 260
782 3300002704 JGI25155J39150_1000023 JGI25155J39150_100002371 260
783 3300002705 JGI25156J39149_1000029 JGI25156J39149_1000029106 260
784 3300002705 JGI25156J39149_1000094 JGI25156J39149_100009414 260
785 3300002737 JGI25162J39368_1000587 JGI25162J39368_100058712 260
786 3300002738 JGI25154J39366_1000067 JGI25154J39366_100006772 260
787 3300002741 JGI25157J39369_1000043 JGI25157J39369_100004356 260
788 3300003214 JGI25165J46597_1000341 JGI25165J46597_100034118 260
789 3300003322 rootL2_10045651 rootL2_100456512 260
790 3300025206 Ga0209435_100011 Ga0209435_100011304 260
791 3300025233 Ga0209437_100036 Ga0209437_10003648 260
792 3300025246 Ga0209646_1000024 Ga0209646_1000024107 260
793 3300025250 Ga0209026_1000030 Ga0209026_1000030107 260
794 3300025256 Ga0209759_1000011 Ga0209759_1000011304 260
795 3300025261 Ga0209233_1000166 Ga0209233_100016648 260
796 3300026078 Ga0207702_10143054 Ga0207702_101430542 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

124

308

0.99

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

33

83

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.3466 4 244
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.3381 4 244
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.2988 22 246
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.2908 22 246
4bjn-assembly4.cif.gz_H crystal structure of the flax-rust effector avrm-a 0.2758 128 258
ID Description Score Start End Superfamily
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5857 123 245 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5737 123 245 1.10.3720.10
af_P45767_178_390_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5343 115 250 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4678 120 250 1.10.3720.10
af_Q2FVE9_63_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4269 19 247 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2S8NB95-F1-model_v4 deleted 0.7649 122 205
AF-A0A2X3J780-F1-model_v4 Glutathione transport system permease protein gsiD 0.7501 115 228 GO:0005886
GO:0055085
AF-A0A2S8NB95-F1-model_v4 deleted 0.7485 122 205
AF-A0A2M8N531-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.7312 118 229 GO:0005886
GO:0055085
AF-A0A2X3J780-F1-model_v4 Glutathione transport system permease protein gsiD 0.6962 115 228 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
75 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map