F481178

General Info

Members Datasets Scaffolds Average Seq Length
796 505 615 265

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10451862|Ga0081455_104518621
Length 275
Sequence MSNTSYPYLKIDHVDKAYARGAQVTEVLSDITVAIDKGEFVSIIGHSGCGKSTLLNIVAGLTPVSAGAVLLENKEVNDPGPDRAVVFQNHSLLPWLTVYENVRLAVDKVFSGSKSGTKSRAERHAWTMHNLELVQMAHAKDRRPMEISGGMKQRVGLARALAMEPKVLLLDEPFGALDALTRAHLQDSVMAIHAQLRNTVLMITHDVDEAVLLSDRIVMMTNGPAARIGEVLTVPLARPRRRLELSADPAYIKARQRVIEFLYARHRAPGLQAAE

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
6 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
7 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
12 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
13 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
14 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
15 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
16 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
17 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
18 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
19 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
20 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
21 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
22 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
23 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
24 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
25 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
26 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
27 2841760612 Bosea sp. Tri-49 Isolate Nodule
28 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
29 2844104063 Bosea sp. Tri-39 Isolate Nodule
30 2851182111 Bosea sp. Tri-44 Isolate Nodule
31 2851246043 Bosea sp. Tri-54 Isolate Nodule
32 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
33 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
34 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
35 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
36 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
37 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
38 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
39 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
40 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
41 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
42 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
43 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
44 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
45 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
46 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
47 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
48 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
49 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
50 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
51 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
52 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
53 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
54 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
55 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
56 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
57 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
58 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
59 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
60 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
61 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
62 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
63 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
64 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
65 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
66 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
67 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
68 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
69 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
70 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
71 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
72 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
73 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
74 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
75 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
76 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
77 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
78 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
79 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
80 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
81 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
82 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
83 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
84 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
85 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
86 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
87 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
88 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
89 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
90 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
91 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
92 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
93 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
94 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
95 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
96 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
97 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
98 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
99 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
100 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
101 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
102 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
103 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
104 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
105 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
106 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
107 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
108 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
109 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
110 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
111 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
112 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
113 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
114 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
115 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
116 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
117 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
118 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
119 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
120 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
121 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
122 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
123 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
124 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
125 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
126 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
127 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
128 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
129 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
130 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
131 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
132 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
133 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
134 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
135 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
136 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
137 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
138 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
139 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
140 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
141 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
142 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
143 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
144 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
145 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
146 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
147 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
148 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
149 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
150 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
151 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
152 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
153 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
154 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
155 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
156 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
157 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
158 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
159 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
160 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
161 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
162 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
163 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
164 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
165 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
166 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
167 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
168 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
169 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
170 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
171 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
172 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
173 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
174 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
175 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
176 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
177 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
178 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
179 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
180 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
181 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
182 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
183 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
184 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
185 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
186 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
187 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
188 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
189 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
190 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
191 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
192 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
193 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
194 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
195 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
196 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
197 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
198 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
199 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
200 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
201 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
202 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
203 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
204 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
205 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
206 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
207 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
208 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
209 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
210 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
211 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
212 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
213 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
214 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
215 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
216 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
217 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
218 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
219 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
220 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
221 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
222 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
223 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
224 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
225 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
226 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
227 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
228 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
229 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
230 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
231 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
232 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
233 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
234 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
235 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
236 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
237 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
238 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
239 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
240 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
241 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
242 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
243 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
244 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
245 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
246 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
247 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
248 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
249 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
250 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
251 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
252 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
253 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
254 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
255 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
256 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
257 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
258 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
259 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
260 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
261 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
262 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
263 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
264 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
265 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
266 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
267 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
268 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
269 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
270 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
271 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
272 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
273 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
274 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
275 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
276 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
277 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
278 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
279 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
280 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
281 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
282 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
283 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
284 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
285 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
286 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
287 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
288 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
289 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
290 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
291 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
292 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
293 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
294 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
295 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
296 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
297 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
298 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
350 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
354 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
356 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
360 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
361 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
362 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
363 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
364 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
365 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
366 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
367 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
368 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
369 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
370 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
371 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
372 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
373 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
374 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
375 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
376 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
377 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
378 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
379 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
380 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
381 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
382 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
383 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
384 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
385 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
386 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
387 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
388 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
389 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
390 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
391 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
392 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
393 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
394 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
395 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
396 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
397 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
398 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
399 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
400 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
401 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
402 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
403 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
404 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
405 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
406 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
407 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
408 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
409 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
410 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
411 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
412 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
413 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
414 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
415 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
416 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
417 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
418 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
419 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
420 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
421 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
422 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
423 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
424 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
425 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
426 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
427 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
428 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
429 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
430 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
431 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
432 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
433 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
434 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
435 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
436 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
437 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
438 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
439 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
440 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
441 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
442 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
443 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
444 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
445 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
446 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
447 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
448 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
449 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
450 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
451 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
452 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
453 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
454 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
455 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
456 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
457 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
458 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
459 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
463 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
464 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
465 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
466 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
467 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
468 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
469 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
470 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
471 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
472 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
473 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
474 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
475 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
476 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
477 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
478 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
479 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
480 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
481 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
482 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
483 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
484 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
485 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
486 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
487 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
488 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
489 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
490 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
491 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
492 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
493 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
494 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
495 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
496 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
497 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
498 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
499 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
500 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
501 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
502 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
503 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
504 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
505 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.26
Metatranscriptomes 0
Isolates 22.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 7.41
Nodule 19.72
Rhizoplane 7.54
Rhizosphere 62.69
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1000813 3300002073 Bacteria 2875
2 JGI24748J21848_1001232 3300002074 Bacteria 2797
3 JGI24749J21850_1003635 3300002076 Bacteria 2155
4 JGI24744J21845_10007594 3300002077 Bacteria 2240
5 JGI24034J26672_10004512 3300002239 Bacteria 1976
6 JGI24742J22300_10000771 3300002244 Bacteria 4867
7 JGI25157J39369_1000789 3300002741 Bacteria 16171
8 JGI25159J45721_1014387 3300002987 Bacteria 1789
9 Ga0058692_1006972 3300003856 Bacteria 3042
10 Ga0070683_100487048 3300005329 Bacteria 1178
11 Ga0070690_100053695 3300005330 Bacteria 2578
12 Ga0070690_100078221 3300005330 Bacteria 2160
13 Ga0070670_100002578 3300005331 Bacteria 14984
14 Ga0070670_100023945 3300005331 Bacteria 5252
15 Ga0070670_100026578 3300005331 Bacteria 4979
16 Ga0070670_100223635 3300005331 Bacteria 1638
17 Ga0068869_100059708 3300005334 Bacteria 2793
18 Ga0068869_100109601 3300005334 Bacteria 2099
19 Ga0070666_10039936 3300005335 Bacteria 3129
20 Ga0068868_100017867 3300005338 Bacteria 5291
21 Ga0070660_100042107 3300005339 Bacteria 3484
22 Ga0070689_100004714 3300005340 Bacteria 9253
23 Ga0070689_100099823 3300005340 Bacteria 2296
24 Ga0070689_100469351 3300005340 Bacteria 1073
25 Ga0070687_100022552 3300005343 Bacteria 2979
26 Ga0070692_10013178 3300005345 Bacteria 3849
27 Ga0070669_100059519 3300005353 Bacteria 2805
28 Ga0070675_100005140 3300005354 Bacteria 9983
29 Ga0070675_100033552 3300005354 Bacteria 4163
30 Ga0070675_100225679 3300005354 Bacteria 1633
31 Ga0070675_100607994 3300005354 Bacteria 992
32 Ga0070671_100035820 3300005355 Bacteria 4112
33 Ga0070674_100028369 3300005356 Bacteria 3676
34 Ga0070688_100003162 3300005365 Bacteria 8430
35 Ga0070667_100112334 3300005367 Bacteria 2363
36 Ga0070714_100203265 3300005435 Bacteria 1813
37 Ga0070710_10100864 3300005437 Bacteria 1719
38 Ga0070701_10002506 3300005438 Bacteria 7092
39 Ga0070701_10021281 3300005438 Bacteria 3092
40 Ga0070701_10058535 3300005438 Bacteria 2023
41 Ga0070701_10090868 3300005438 Bacteria 1673
42 Ga0070705_100006016 3300005440 Bacteria 5935
43 Ga0070700_100022906 3300005441 Bacteria 3649
44 Ga0070700_100039860 3300005441 Bacteria 2872
45 Ga0070700_100074285 3300005441 Bacteria 2178
46 Ga0070700_100168733 3300005441 Bacteria 1514
47 Ga0070694_100018466 3300005444 Bacteria 4425
48 Ga0070694_100046563 3300005444 Bacteria 2912
49 Ga0070708_100008206 3300005445 Bacteria 8381
50 Ga0070663_100325560 3300005455 Bacteria 1237
51 Ga0070678_100094983 3300005456 Bacteria 2296
52 Ga0070662_100168747 3300005457 Bacteria 1717
53 Ga0070681_10015501 3300005458 Bacteria 7591
54 Ga0068867_100008831 3300005459 Bacteria 7112
55 Ga0068867_100123980 3300005459 Bacteria 2000
56 Ga0068867_100245815 3300005459 Bacteria 1453
57 Ga0070685_10003217 3300005466 Bacteria 8312
58 Ga0070685_10080973 3300005466 Bacteria 1946
59 Ga0070706_100059323 3300005467 Bacteria 3531
60 Ga0070707_100032395 3300005468 Bacteria 4980
61 Ga0070698_100049739 3300005471 Bacteria 4277
62 Ga0070699_100000958 3300005518 Bacteria 26920
63 Ga0070699_100049393 3300005518 Bacteria 3641
64 Ga0070679_100123450 3300005530 Bacteria 2573
65 Ga0070684_100025212 3300005535 Bacteria 4996
66 Ga0070697_100035881 3300005536 Bacteria 4002
67 Ga0068853_100283032 3300005539 Bacteria 1529
68 Ga0070672_100044713 3300005543 Bacteria 3422
69 Ga0070672_100070124 3300005543 Bacteria 2784
70 Ga0070672_100315091 3300005543 Bacteria 1329
71 Ga0070686_100019835 3300005544 Bacteria 3969
72 Ga0070686_100142903 3300005544 Bacteria 1668
73 Ga0070695_100000397 3300005545 Bacteria 22586
74 Ga0070695_100014398 3300005545 Bacteria 4768
75 Ga0070696_100128396 3300005546 Bacteria 1842
76 Ga0070665_100002095 3300005548 Bacteria 22353
77 Ga0070665_100048509 3300005548 Bacteria 4263
78 Ga0070704_100006925 3300005549 Bacteria 6719
79 Ga0070704_100078002 3300005549 Bacteria 2428
80 Ga0070704_100110511 3300005549 Bacteria 2090
81 Ga0070664_100043629 3300005564 Bacteria 3784
82 Ga0070664_100184189 3300005564 Bacteria 1857
83 Ga0068857_100045186 3300005577 Bacteria 3907
84 Ga0068857_100067242 3300005577 Bacteria 3190
85 Ga0068857_100304576 3300005577 Bacteria 1469
86 Ga0068854_100055965 3300005578 Bacteria 2842
87 Ga0070702_100017208 3300005615 Bacteria 3724
88 Ga0070702_100171278 3300005615 Bacteria 1412
89 Ga0068859_100008199 3300005617 Bacteria 10597
90 Ga0068859_100084046 3300005617 Bacteria 3227
91 Ga0068859_100116716 3300005617 Bacteria 2734
92 Ga0068859_100162981 3300005617 Bacteria 2309
93 Ga0068859_100344423 3300005617 Bacteria 1585
94 Ga0068859_100442688 3300005617 Bacteria 1396
95 Ga0068864_100016617 3300005618 Bacteria 6129
96 Ga0068864_100035692 3300005618 Bacteria 4234
97 Ga0068864_100044607 3300005618 Bacteria 3801
98 Ga0068864_100538890 3300005618 Bacteria 1127
99 Ga0068866_10151388 3300005718 Bacteria 1344
100 Ga0068861_100003146 3300005719 Bacteria 10911
101 Ga0068861_100035575 3300005719 Bacteria 3690
102 Ga0068861_100300150 3300005719 Bacteria 1391
103 Ga0068861_100522432 3300005719 Bacteria 1077
104 Ga0068870_10002967 3300005840 Bacteria 7154
105 Ga0068870_10069918 3300005840 Bacteria 1911
106 Ga0068863_100022154 3300005841 Bacteria 6065
107 Ga0068863_100259415 3300005841 Bacteria 1680
108 Ga0068858_100679937 3300005842 Bacteria 1001
109 Ga0068860_100024395 3300005843 Bacteria 5843
110 Ga0068860_100178858 3300005843 Bacteria 2050
111 Ga0068860_100187674 3300005843 Bacteria 2000
112 Ga0068860_100325524 3300005843 Bacteria 1509
113 Ga0068862_100015557 3300005844 Bacteria 6319
114 Ga0068862_100064741 3300005844 Bacteria 3148
115 Ga0068862_100139777 3300005844 Bacteria 2149
116 Ga0081455_10002125 3300005937 Bacteria 23618
117 Ga0081455_10007852 3300005937 Bacteria 11173
118 Ga0081455_10024860 3300005937 Bacteria 5537
119 Ga0081455_10048637 3300005937 Bacteria 3662
120 Ga0081455_10052581 3300005937 Bacteria 3485
121 Ga0081455_10451862 3300005937 Bacteria 877
122 Ga0081538_10009799 3300005981 Bacteria 7929
123 Ga0081539_10001507 3300005985 Bacteria 39333
124 Ga0081539_10046780 3300005985 Bacteria 2477
125 Ga0070717_10030914 3300006028 Bacteria 4303
126 Ga0075365_10011946 3300006038 Bacteria 5131
127 Ga0075365_10032564 3300006038 Bacteria 3352
128 Ga0075365_10229901 3300006038 Bacteria 1302
129 Ga0075365_10262768 3300006038 Bacteria 1214
130 Ga0075368_10001288 3300006042 Bacteria 7947
131 Ga0075368_10031065 3300006042 Bacteria 2070
132 Ga0075368_10073851 3300006042 Bacteria 1380
133 Ga0075363_100034135 3300006048 Bacteria 2654
134 Ga0075364_10015907 3300006051 Bacteria 4670
135 Ga0075364_10151749 3300006051 Bacteria 1561
136 Ga0075364_10343897 3300006051 Bacteria 1016
137 Ga0075432_10023766 3300006058 Bacteria 2100
138 Ga0070712_100073436 3300006175 Bacteria 2453
139 Ga0075362_10007577 3300006177 Bacteria 4120
140 Ga0075362_10027447 3300006177 Bacteria 2438
141 Ga0075367_10002330 3300006178 Bacteria 8638
142 Ga0075367_10008639 3300006178 Bacteria 5285
143 Ga0075367_10009107 3300006178 Bacteria 5173
144 Ga0075367_10050715 3300006178 Bacteria 2451
145 Ga0075367_10110241 3300006178 Bacteria 1689
146 Ga0075367_10146305 3300006178 Bacteria 1465
147 Ga0075427_10001903 3300006194 Bacteria 2742
148 Ga0075366_10002683 3300006195 Bacteria 9182
149 Ga0097621_100020815 3300006237 Bacteria 5062
150 Ga0097621_100099132 3300006237 Bacteria 2449
151 Ga0097621_100600393 3300006237 Bacteria 1006
152 Ga0075370_10069394 3300006353 Bacteria 2014
153 Ga0075370_10094523 3300006353 Bacteria 1726
154 Ga0068871_100105440 3300006358 Bacteria 2365
155 Ga0075428_100005390 3300006844 Bacteria 14222
156 Ga0075428_100043597 3300006844 Bacteria 4932
157 Ga0075428_100115849 3300006844 Bacteria 2919
158 Ga0075428_100157602 3300006844 Bacteria 2465
159 Ga0075428_100209493 3300006844 Bacteria 2106
160 Ga0075430_100000037 3300006846 Bacteria 68528
161 Ga0075430_100000140 3300006846 Bacteria 46272
162 Ga0075430_100052502 3300006846 Bacteria 3434
163 Ga0075430_100053681 3300006846 Bacteria 3393
164 Ga0075430_100070227 3300006846 Bacteria 2938
165 Ga0075430_100083957 3300006846 Bacteria 2668
166 Ga0075430_100085394 3300006846 Bacteria 2643
167 Ga0075430_100315390 3300006846 Bacteria 1293
168 Ga0075431_100001318 3300006847 Bacteria 22699
169 Ga0075431_100007626 3300006847 Bacteria 10776
170 Ga0075431_100012944 3300006847 Bacteria 8420
171 Ga0075431_100022627 3300006847 Bacteria 6425
172 Ga0075431_100511766 3300006847 Bacteria 1190
173 Ga0075433_10000050 3300006852 Bacteria 50089
174 Ga0075433_10237908 3300006852 Bacteria 1617
175 Ga0075434_100000179 3300006871 Bacteria 41085
176 Ga0075434_100053725 3300006871 Bacteria 4003
177 Ga0075434_100150543 3300006871 Bacteria 2347
178 Ga0075429_100001170 3300006880 Bacteria 21187
179 Ga0075429_100015042 3300006880 Bacteria 6709
180 Ga0075429_100016376 3300006880 Bacteria 6425
181 Ga0075429_100069478 3300006880 Bacteria 3067
182 Ga0075429_100122508 3300006880 Bacteria 2273
183 Ga0075429_100125003 3300006880 Bacteria 2249
184 Ga0068865_100095569 3300006881 Bacteria 2165
185 Ga0068865_100353871 3300006881 Bacteria 1191
186 Ga0075436_100123231 3300006914 Bacteria 1815
187 Ga0097620_100008199 3300006931 Bacteria 10597
188 Ga0097620_100084049 3300006931 Bacteria 3227
189 Ga0097620_100116718 3300006931 Bacteria 2734
190 Ga0097620_100162996 3300006931 Bacteria 2309
191 Ga0097620_100344445 3300006931 Bacteria 1585
192 Ga0097620_100442703 3300006931 Bacteria 1396
193 Ga0079104_1028471 3300006946 Bacteria 1418
194 Ga0075435_100001211 3300007076 Bacteria 16537
195 Ga0075435_100040220 3300007076 Bacteria 3733
196 Ga0099795_10002446 3300007788 Bacteria 4369
197 Ga0105251_10028678 3300009011 Bacteria 2810
198 Ga0111539_10000565 3300009094 Bacteria 47399
199 Ga0111539_10025042 3300009094 Bacteria 7313
200 Ga0111539_10243181 3300009094 Bacteria 2095
201 Ga0111539_10331634 3300009094 Bacteria 1771
202 Ga0111539_10373757 3300009094 Bacteria 1659
203 Ga0111539_10431201 3300009094 Bacteria 1535
204 Ga0111539_10870615 3300009094 Bacteria 1048
205 Ga0105245_10126527 3300009098 Bacteria 2393
206 Ga0105247_10012454 3300009101 Bacteria 5108
207 Ga0114129_10003182 3300009147 Bacteria 23025
208 Ga0114129_10006815 3300009147 Bacteria 16225
209 Ga0114129_10039625 3300009147 Bacteria 6643
210 Ga0114129_10079883 3300009147 Bacteria 4547
211 Ga0114129_10085173 3300009147 Bacteria 4385
212 Ga0114129_10113700 3300009147 Bacteria 3733
213 Ga0114129_10164097 3300009147 Bacteria 3033
214 Ga0114129_10501264 3300009147 Bacteria 1586
215 Ga0105243_10035760 3300009148 Bacteria 3851
216 Ga0105243_10131798 3300009148 Bacteria 2121
217 Ga0105243_10449924 3300009148 Bacteria 1208
218 Ga0105241_10078169 3300009174 Bacteria 2585
219 Ga0105241_10200354 3300009174 Bacteria 1667
220 Ga0105242_10029381 3300009176 Bacteria 4384
221 Ga0105237_10179967 3300009545 Bacteria 2115
222 Ga0105238_10045770 3300009551 Bacteria 4420
223 Ga0105246_10081049 3300011119 Bacteria 2312
224 Ga0157373_10047843 3300013100 Bacteria 3050
225 Ga0157371_10001049 3300013102 Bacteria 30298
226 Ga0157371_10038768 3300013102 Bacteria 3408
227 Ga0157374_10011472 3300013296 Bacteria 7675
228 Ga0157378_10434899 3300013297 Bacteria 1299
229 Ga0163162_10011400 3300013306 Bacteria 8668
230 Ga0157375_10011366 3300013308 Bacteria 7860
231 Ga0163163_10228165 3300014325 Bacteria 1911
232 Ga0157380_10001434 3300014326 Bacteria 15615
233 Ga0157380_10027085 3300014326 Bacteria 4356
234 Ga0157380_10107215 3300014326 Bacteria 2339
235 Ga0157377_10033989 3300014745 Bacteria 2787
236 Ga0157379_10157170 3300014968 Bacteria 2052
237 Ga0157376_10392089 3300014969 Bacteria 1340
238 Ga0163161_10113729 3300017792 Bacteria 2026
239 Ga0213876_10051869 3300021384 Bacteria 2168
240 Ga0209758_1000702 3300025297 Bacteria 49657
241 Ga0207656_10056666 3300025321 Bacteria 1709
242 Ga0207655_1047574 3300025728 Bacteria 1769
243 Ga0207642_10015397 3300025899 Bacteria 2848
244 Ga0207710_10007297 3300025900 Bacteria 4685
245 Ga0207688_10001854 3300025901 Bacteria 11314
246 Ga0207685_10040877 3300025905 Bacteria 1731
247 Ga0207645_10037124 3300025907 Bacteria 3128
248 Ga0207643_10000418 3300025908 Bacteria 28078
249 Ga0207643_10121117 3300025908 Bacteria 1550
250 Ga0207684_10014542 3300025910 Bacteria 6780
251 Ga0207654_10170207 3300025911 Bacteria 1414
252 Ga0207707_10023299 3300025912 Bacteria 5418
253 Ga0207671_10078141 3300025914 Bacteria 2478
254 Ga0207660_10044408 3300025917 Bacteria 3126
255 Ga0207662_10026343 3300025918 Bacteria 3353
256 Ga0207662_10031898 3300025918 Bacteria 3063
257 Ga0207662_10219493 3300025918 Bacteria 1237
258 Ga0207657_10012700 3300025919 Bacteria 8299
259 Ga0207649_10014278 3300025920 Bacteria 4444
260 Ga0207652_10084479 3300025921 Bacteria 2781
261 Ga0207646_10264876 3300025922 Bacteria 1553
262 Ga0207681_10019331 3300025923 Bacteria 4303
263 Ga0207694_10024597 3300025924 Bacteria 4574
264 Ga0207650_10001829 3300025925 Bacteria 15043
265 Ga0207650_10088008 3300025925 Bacteria 2368
266 Ga0207659_10056201 3300025926 Bacteria 2818
267 Ga0207659_10063349 3300025926 Bacteria 2672
268 Ga0207687_10087623 3300025927 Bacteria 2263
269 Ga0207700_10145158 3300025928 Bacteria 1955
270 Ga0207700_10217261 3300025928 Bacteria 1619
271 Ga0207706_10004539 3300025933 Bacteria 13029
272 Ga0207706_10057602 3300025933 Bacteria 3423
273 Ga0207686_10028762 3300025934 Bacteria 3270
274 Ga0207709_10125757 3300025935 Bacteria 1739
275 Ga0207670_10014592 3300025936 Bacteria 4670
276 Ga0207670_10048986 3300025936 Bacteria 2823
277 Ga0207669_10014859 3300025937 Bacteria 3913
278 Ga0207704_10156792 3300025938 Bacteria 1615
279 Ga0207704_10204533 3300025938 Bacteria 1448
280 Ga0207691_10015805 3300025940 Bacteria 7171
281 Ga0207691_10037991 3300025940 Bacteria 4456
282 Ga0207691_10105215 3300025940 Bacteria 2514
283 Ga0207711_10076372 3300025941 Bacteria 2917
284 Ga0207689_10071966 3300025942 Bacteria 2840
285 Ga0207689_10073188 3300025942 Bacteria 2815
286 Ga0207689_10134416 3300025942 Bacteria 2036
287 Ga0207689_10202805 3300025942 Bacteria 1637
288 Ga0207661_10218849 3300025944 Bacteria 1682
289 Ga0207679_10461271 3300025945 Bacteria 1128
290 Ga0207712_10060715 3300025961 Bacteria 2681
291 Ga0207668_10060329 3300025972 Bacteria 2661
292 Ga0207640_10031878 3300025981 Bacteria 3263
293 Ga0207658_10609069 3300025986 Bacteria 982
294 Ga0207677_10017844 3300026023 Bacteria 4244
295 Ga0207703_10054653 3300026035 Bacteria 3248
296 Ga0207703_10134989 3300026035 Bacteria 2135
297 Ga0207639_10006376 3300026041 Bacteria 8014
298 Ga0207639_10431322 3300026041 Bacteria 1193
299 Ga0207678_10014083 3300026067 Bacteria 7032
300 Ga0207678_10400390 3300026067 Bacteria 1189
301 Ga0207708_10002881 3300026075 Bacteria 12675
302 Ga0207708_10033722 3300026075 Bacteria 3891
303 Ga0207708_10036315 3300026075 Bacteria 3752
304 Ga0207708_10078386 3300026075 Bacteria 2537
305 Ga0207708_10117559 3300026075 Bacteria 2069
306 Ga0207641_10024407 3300026088 Bacteria 4984
307 Ga0207641_10075971 3300026088 Bacteria 2903
308 Ga0207641_10220589 3300026088 Bacteria 1758
309 Ga0207641_10223751 3300026088 Bacteria 1746
310 Ga0207641_10323483 3300026088 Bacteria 1463
311 Ga0207648_10009436 3300026089 Bacteria 9348
312 Ga0207648_10048867 3300026089 Bacteria 3703
313 Ga0207648_10410101 3300026089 Bacteria 1229
314 Ga0207676_10050657 3300026095 Bacteria 3238
315 Ga0207676_10062867 3300026095 Bacteria 2946
316 Ga0207676_10134304 3300026095 Bacteria 2108
317 Ga0207676_10201530 3300026095 Bacteria 1759
318 Ga0207674_10000240 3300026116 Bacteria 68544
319 Ga0207674_10067021 3300026116 Bacteria 3615
320 Ga0207674_10163696 3300026116 Bacteria 2179
321 Ga0207675_100001517 3300026118 Bacteria 23282
322 Ga0207675_100010921 3300026118 Bacteria 8510
323 Ga0207675_100066173 3300026118 Bacteria 3377
324 Ga0207675_100107910 3300026118 Bacteria 2625
325 Ga0207675_100299562 3300026118 Bacteria 1566
326 Ga0207683_10025013 3300026121 Bacteria 5148
327 Ga0207683_10110247 3300026121 Bacteria 2464
328 Ga0207683_10370706 3300026121 Bacteria 1315
329 Ga0207698_10177998 3300026142 Bacteria 1880
330 Ga0209281_1002399 3300027111 Bacteria 7621
331 Ga0209371_1000135 3300027312 Bacteria 121718
332 Ga0209179_1000688 3300027512 Bacteria 3631
333 Ga0209998_10038490 3300027717 Bacteria 1080
334 Ga0209813_10001909 3300027866 Bacteria 4700
335 Ga0209813_10031752 3300027866 Bacteria 1561
336 Ga0209974_10058230 3300027876 Bacteria 1306
337 Ga0207428_10000485 3300027907 Bacteria 47761
338 Ga0207428_10078186 3300027907 Bacteria 2589
339 Ga0207428_10349750 3300027907 Bacteria 1087
340 Ga0207428_10486344 3300027907 Bacteria 897
341 Ga0268266_10013114 3300028379 Bacteria 7146
342 Ga0268266_10066365 3300028379 Bacteria 3121
343 Ga0268266_10067001 3300028379 Bacteria 3106
344 Ga0268265_10002419 3300028380 Bacteria 14092
345 Ga0268265_10048398 3300028380 Bacteria 3191
346 Ga0268265_10096683 3300028380 Bacteria 2374
347 Ga0268264_10001273 3300028381 Bacteria 23900
348 Ga0268264_10122871 3300028381 Bacteria 2290
349 Ga0268264_10188786 3300028381 Bacteria 1877
350 Ga0268264_10240311 3300028381 Bacteria 1677
351 Ga0268264_10263492 3300028381 Bacteria 1607
352 Ga0268256_1000148 3300030500 Bacteria 94347
353 Ga0307511_10004306 3300030521 Bacteria 14525
354 Ga0265332_10001500 3300031238 Bacteria 12981
355 Ga0265329_10009619 3300031242 Bacteria 3594
356 Ga0265340_10012118 3300031247 Bacteria 4558
357 Ga0265339_10000253 3300031249 Bacteria 42950
358 Ga0265331_10022837 3300031250 Bacteria 3186
359 Ga0307513_10459668 3300031456 Bacteria 996
360 Ga0307408_100083621 3300031548 Bacteria 2392
361 Ga0307408_100427314 3300031548 Bacteria 1144
362 Ga0265314_10005768 3300031711 Bacteria 11111
363 Ga0265342_10000039 3300031712 Bacteria 140091
364 Ga0307405_10147304 3300031731 Bacteria 1651
365 Ga0307413_10018816 3300031824 Bacteria 3633
366 Ga0307410_10005539 3300031852 Bacteria 6695
367 Ga0307406_10027619 3300031901 Bacteria 3421
368 Ga0307407_10018156 3300031903 Bacteria 3550
369 Ga0307407_10065731 3300031903 Bacteria 2136
370 Ga0307409_100030120 3300031995 Bacteria 3894
371 Ga0307409_100038659 3300031995 Bacteria 3532
372 Ga0307409_100270597 3300031995 Bacteria 1564
373 Ga0307416_100023992 3300032002 Bacteria 4441
374 Ga0307411_10010375 3300032005 Bacteria 4961
375 Ga0307411_10042872 3300032005 Bacteria 2891
376 Ga0307415_100070432 3300032126 Bacteria 2456
377 Ga0373938_0017130 3300034957 Bacteria 1424
378 Ga0373926_0066834 3300035083 Bacteria 1317
379 Ga0373944_0044038 3300035089 Bacteria 1388
380 Ga0373939_0002189 3300035114 Bacteria 4634
381 Ga0373941_0050900 3300035115 Bacteria 1316
382 Ga0373960_0003305 3300035121 Bacteria 3649
383 Ga0373943_0040064 3300035170 Bacteria 2260
384 Ga0373946_0020259 3300035171 Bacteria 2569
385 Ga0373946_0140816 3300035171 Bacteria 1118
386 Ga0373942_0009883 3300035207 Bacteria 2235
387 Ga0373942_0049718 3300035207 Bacteria 1172
388 Ga0373962_0030996 3300035242 Bacteria 1465
389 Ga0373931_0002261 3300035691 Bacteria 8511
390 Ga0373931_0038360 3300035691 Bacteria 2505
391 Ga0373931_0111506 3300035691 Bacteria 1552
392 Ga0373931_0155940 3300035691 Bacteria 1334
393 Ga0373935_0074532 3300035692 Bacteria 2194
394 Ga0373935_0125234 3300035692 Bacteria 1721
395 Ga0373927_0047956 3300035695 Bacteria 2763
396 Ga0373927_0060884 3300035695 Bacteria 2442
397 Ga0373925_0157782 3300037068 Bacteria 1785
398 Ga0373925_0183572 3300037068 Bacteria 1657
399 Ga0373925_0458587 3300037068 Bacteria 1044
400 Ga0395898_0094463 3300037466 Bacteria 2874
401 Ga0395901_0082092 3300038443 Bacteria 3367
402 Ga0436365_1129034 3300039437 Bacteria 1126
403 Ga0436360_0206105 3300039438 Bacteria 1515
404 Ga0436361_1155031 3300039447 Bacteria 2475
405 Ga0439461_0043769 3300041410 Bacteria 975
406 Ga0451797_1070901 3300041453 Bacteria 2010
407 Ga0451807_0888807 3300041486 Bacteria 2268
408 Ga0451807_0982580 3300041486 Bacteria 2542
409 Ga0439431_0054584 3300041997 Bacteria 1043
410 Ga0439435_0028273 3300042436 Bacteria 1506
411 Ga0439464_0011374 3300042439 Bacteria 2357
412 Ga0466968_0063542 3300044735 Bacteria 1596
413 Ga0495627_025977 3300046453 Bacteria 1894
414 Ga0495603_0009391 3300046455 Bacteria 5910
415 Ga0495603_0037614 3300046455 Bacteria 2904
416 Ga0495603_0089888 3300046455 Bacteria 1796
417 Ga0495591_053466 3300046458 Bacteria 1095
418 Ga0495638_0135328 3300046460 Bacteria 1444
419 Ga0495653_0012380 3300046463 Bacteria 6963
420 Ga0495584_0070026 3300046491 Bacteria 1763
421 Ga0495585_0002879 3300046492 Bacteria 11961
422 Ga0495585_0019507 3300046492 Bacteria 3909
423 Ga0495607_0038737 3300046501 Bacteria 2853
424 Ga0495606_0001140 3300046507 Bacteria 37797
425 Ga0495618_0163049 3300046514 Bacteria 1420
426 Ga0495631_0141458 3300046518 Bacteria 1033
427 Ga0495637_0052379 3300046520 Bacteria 1704
428 Ga0495643_0151044 3300046522 Bacteria 1150
429 Ga0495666_0035414 3300046526 Bacteria 2434
430 Ga0495652_0348968 3300046529 Bacteria 1061
431 Ga0495665_0062132 3300046531 Bacteria 1972
432 Ga0495640_0122475 3300046533 Bacteria 1689
433 Ga0495622_0004589 3300046557 Bacteria 6398
434 Ga0495656_0069407 3300046615 Bacteria 1561
435 Ga0495668_0017657 3300046616 Bacteria 4134
436 Ga0495668_0168465 3300046616 Bacteria 1200
437 Ga0495625_0094839 3300046660 Bacteria 2058
438 Ga0495659_0015392 3300046664 Bacteria 2514
439 Ga0495659_0135369 3300046664 Bacteria 980
440 Ga0495661_0000030 3300046665 Bacteria 171980
441 Ga0495599_0267748 3300046678 Bacteria 1037
442 Ga0495658_0019453 3300046683 Bacteria 3545
443 Ga0495669_0073740 3300046684 Bacteria 1559
444 Ga0495613_0001307 3300046689 Bacteria 19057
445 Ga0495613_0226755 3300046689 Bacteria 1310
446 Ga0495624_0164978 3300046690 Bacteria 1352
447 Ga0495671_0058046 3300046692 Bacteria 1915
448 Ga0495649_0000288 3300046694 Bacteria 44617
449 Ga0495649_0035125 3300046694 Bacteria 2757
450 Ga0495600_0281860 3300046809 Bacteria 1052
451 Ga0495660_0063638 3300046810 Bacteria 1974
452 Ga0495672_0011577 3300047320 Bacteria 6217
453 Ga0495676_0028770 3300047321 Bacteria 4741
454 Ga0495676_0115594 3300047321 Bacteria 1961
455 Ga0495683_0000018 3300047323 Bacteria 185871
456 Ga0495677_0083701 3300047445 Bacteria 1198
457 Ga0495679_026051 3300047446 Bacteria 1947
458 Ga0495673_0059565 3300047469 Bacteria 1641
459 Ga0496100_0028230 3300048903 Bacteria 3459
460 Ga0496100_0069923 3300048903 Bacteria 2339
461 Ga0496100_0518862 3300048903 Bacteria 919
462 Ga0496101_0188938 3300048904 Bacteria 1589
463 Ga0496101_0193440 3300048904 Bacteria 1570
464 Ga0496102_0017492 3300048905 Bacteria 6279
465 Ga0496102_0023681 3300048905 Bacteria 5455
466 Ga0496102_0149679 3300048905 Bacteria 2192
467 Ga0496102_0168988 3300048905 Bacteria 2058
468 Ga0496102_0273462 3300048905 Bacteria 1593
469 Ga0496103_0038434 3300048906 Bacteria 2936
470 Ga0496103_0092970 3300048906 Bacteria 1904
471 Ga0496104_0001191 3300048907 Bacteria 22367
472 Ga0496104_0002505 3300048907 Bacteria 15804
473 Ga0496104_0042153 3300048907 Bacteria 4282
474 Ga0496104_0086936 3300048907 Bacteria 2985
475 Ga0496104_0283256 3300048907 Bacteria 1570
476 Ga0496105_0020524 3300048908 Bacteria 5340
477 Ga0496105_0030374 3300048908 Bacteria 4428
478 Ga0496105_0046218 3300048908 Bacteria 3593
479 Ga0496106_0002303 3300048909 Bacteria 14240
480 Ga0496106_0266587 3300048909 Bacteria 1371
481 Ga0496107_0042027 3300048910 Bacteria 3283
482 Ga0496107_0050841 3300048910 Bacteria 2988
483 Ga0496107_0065076 3300048910 Bacteria 2643
484 Ga0496108_0000357 3300048911 Bacteria 38614
485 Ga0496108_0031017 3300048911 Bacteria 4431
486 Ga0496108_0211232 3300048911 Bacteria 1685
487 Ga0496108_0223064 3300048911 Bacteria 1638
488 Ga0496108_0370197 3300048911 Bacteria 1251
489 Ga0496108_0396427 3300048911 Bacteria 1205
490 Ga0496109_0002224 3300048912 Bacteria 16103
491 Ga0496109_0056593 3300048912 Bacteria 3578
492 Ga0496109_0076390 3300048912 Bacteria 3081
493 Ga0496110_0010509 3300048913 Bacteria 7535
494 Ga0496110_0031350 3300048913 Bacteria 4586
495 Ga0496110_0035179 3300048913 Bacteria 4344
496 Ga0496110_0055514 3300048913 Bacteria 3485
497 Ga0496111_0000632 3300048914 Bacteria 18585
498 Ga0496111_0002843 3300048914 Bacteria 10561
499 Ga0496111_0029514 3300048914 Bacteria 3895
500 Ga0496111_0133639 3300048914 Bacteria 1837
501 Ga0496112_0006469 3300048915 Bacteria 10288
502 Ga0496112_0022644 3300048915 Bacteria 5990
503 Ga0496112_0194493 3300048915 Bacteria 1989
504 Ga0496113_0019635 3300048916 Bacteria 4731
505 Ga0496113_0038585 3300048916 Bacteria 3512
506 Ga0496113_0131970 3300048916 Bacteria 1961
507 Ga0496113_0615176 3300048916 Bacteria 870
508 Ga0496114_0024665 3300048917 Bacteria 4909
509 Ga0496114_0137334 3300048917 Bacteria 2115
510 Ga0496115_0010413 3300048918 Bacteria 6947
511 Ga0496115_0017174 3300048918 Bacteria 5524
512 Ga0496115_0026348 3300048918 Bacteria 4537
513 Ga0496115_0147851 3300048918 Bacteria 1940
514 Ga0501033_0109088 3300049570 Bacteria 2016
515 Ga0501036_0600575 3300049572 Bacteria 913
516 Ga0501042_0360836 3300049578 Bacteria 1051
517 Ga0501068_0000244 3300049584 Bacteria 26692
518 Ga0501069_0154697 3300049585 Bacteria 1319
519 Ga0501072_0266491 3300049588 Bacteria 1363
520 Ga0501072_0503549 3300049588 Bacteria 958
521 Ga0501073_0052916 3300049589 Bacteria 2842
522 Ga0501074_0128084 3300049590 Bacteria 1816
523 Ga0501076_0197740 3300049592 Bacteria 1641
524 Ga0501076_0365851 3300049592 Bacteria 1185
525 Ga0501077_0034253 3300049593 Bacteria 3232
526 Ga0501077_0095259 3300049593 Bacteria 1887
527 Ga0501079_0147357 3300049741 Bacteria 1835
528 Ga0501079_0153959 3300049741 Bacteria 1792
529 Ga0501079_0286682 3300049741 Bacteria 1287
530 Ga0501080_0021102 3300049742 Bacteria 6029
531 Ga0501081_0039071 3300049743 Bacteria 3246
532 nmdc:mga03683_114301_c1 3300050489 Bacteria 1196
533 nmdc:mga03683_11651_c1 3300050489 Bacteria 3190
534 nmdc:mga03683_20812_c1 3300050489 Bacteria 2522
535 nmdc:mga03683_46571_c1 3300050489 Bacteria 1798
536 nmdc:mga03n38_146331_c1 3300050490 Bacteria 1185
537 nmdc:mga03n38_20279_c2 3300050490 Bacteria 1479
538 nmdc:mga03n38_22227_c1 3300050490 Bacteria 2564
539 nmdc:mga03n38_253858_c1 3300050490 Bacteria 930
540 nmdc:mga0yw44_111122_c1 3300050492 Bacteria 1756
541 nmdc:mga0yw44_2536_c1 3300050492 Bacteria 7835
542 nmdc:mga0yw44_397650_c1 3300050492 Bacteria 931
543 nmdc:mga0yw44_90385_c1 3300050492 Bacteria 1934
544 nmdc:mga0k408_109900_c1 3300050493 Bacteria 1630
545 nmdc:mga0k408_215804_c1 3300050493 Bacteria 1146
546 nmdc:mga06z11_110064_c1 3300050494 Bacteria 1524
547 nmdc:mga06z11_45087_c1 3300050494 Bacteria 2228
548 nmdc:mga06z11_51627_c1 3300050494 Bacteria 2106
549 nmdc:mga04h51_57647_c1 3300050495 Bacteria 1322
550 nmdc:mga04h51_63862_c1 3300050495 Bacteria 1269
551 nmdc:mga07m45_185873_c1 3300050496 Bacteria 1208
552 nmdc:mga07m45_6280_c1 3300050496 Bacteria 3722
553 nmdc:mga05p37_118078_c1 3300050507 Bacteria 3259
554 nmdc:mga05p37_140014_c1 3300050507 Bacteria 2965
555 nmdc:mga05p37_219_c1 3300050507 Bacteria 57577
556 nmdc:mga05p37_252833_c1 3300050507 Bacteria 2113
557 nmdc:mga05p37_320244_c1 3300050507 Bacteria 1835
558 nmdc:mga05p37_46651_c1 3300050507 Bacteria 5327
559 nmdc:mga05p37_616163_c1 3300050507 Bacteria 1222
560 nmdc:mga09592_209948_c1 3300050508 Bacteria 1687
561 nmdc:mga09592_345531_c1 3300050508 Bacteria 1288
562 nmdc:mga09592_452_c1 3300050508 Bacteria 30462
563 nmdc:mga09592_49703_c1 3300050508 Bacteria 3536
564 nmdc:mga09592_85436_c1 3300050508 Bacteria 2692
565 nmdc:mga0qj67_23009_c1 3300050509 Bacteria 4789
566 nmdc:mga0qj67_310017_c1 3300050509 Bacteria 1278
567 nmdc:mga0qj67_34_c1 3300050509 Bacteria 96663
568 nmdc:mga0qj67_396_c1 3300050509 Bacteria 30122
569 nmdc:mga0qj67_54201_c1 3300050509 Bacteria 3175
570 nmdc:mga0qj67_61731_c1 3300050509 Bacteria 2976
571 nmdc:mga0qj67_64703_c1 3300050509 Bacteria 2910
572 nmdc:mga0qj67_76690_c1 3300050509 Bacteria 2674
573 nmdc:mga06r32_138088_c1 3300050510 Bacteria 2412
574 nmdc:mga06r32_156904_c1 3300050510 Bacteria 2257
575 nmdc:mga06r32_274_c1 3300050510 Bacteria 42858
576 nmdc:mga06r32_3222_c1 3300050510 Bacteria 14610
577 nmdc:mga06r32_473275_c1 3300050510 Bacteria 1231
578 nmdc:mga06r32_5504_c1 3300050510 Bacteria 11406
579 nmdc:mga06r32_8399_c1 3300050510 Bacteria 9302
580 nmdc:mga08y16_15638_c1 3300050511 Bacteria 7979
581 nmdc:mga08y16_26695_c1 3300050511 Bacteria 6087
582 nmdc:mga08y16_289070_c1 3300050511 Bacteria 1690
583 nmdc:mga08y16_743205_c1 3300050511 Bacteria 978
584 nmdc:mga08y16_99167_c1 3300050511 Bacteria 3033
585 nmdc:mga0n895_121069_c1 3300050512 Bacteria 2638
586 nmdc:mga0n895_124_c1 3300050512 Bacteria 45833
587 nmdc:mga0n895_244875_c1 3300050512 Bacteria 1820
588 nmdc:mga0n895_313358_c1 3300050512 Bacteria 1590
589 nmdc:mga0n895_32234_c1 3300050512 Bacteria 5028
590 nmdc:mga0n895_360822_c1 3300050512 Bacteria 1471
591 nmdc:mga0rr50_33458_c1 3300050513 Bacteria 3672
592 nmdc:mga0rr50_4689_c1 3300050513 Bacteria 8056
593 nmdc:mga08x19_39035_c1 3300050514 Bacteria 3017
594 nmdc:mga0a205_166287_c1 3300050515 Bacteria 2101
595 nmdc:mga0a205_97_c1 3300050515 Bacteria 49530
596 nmdc:mga0sz30_4555_c1 3300050516 Bacteria 5020
597 nmdc:mga0sz30_8151_c1 3300050516 Bacteria 3948
598 Ga0500635_0018384 3300053080 Bacteria 2108
599 Ga0495595_0119961 3300053084 Bacteria 1281
600 Ga0495595_0223077 3300053084 Bacteria 941
601 Ga0495619_0012914 3300053085 Bacteria 5261
602 Ga0495619_0105098 3300053085 Bacteria 1925
603 Ga0500641_0005846 3300053096 Bacteria 4355
604 Ga0500555_034532 3300053103 Bacteria 1424
605 Ga0500572_000639 3300053111 Bacteria 11610
606 Ga0500618_003240 3300053125 Bacteria 5665
607 Ga0500658_0052954 3300053134 Bacteria 1664
608 Ga0500616_0034917 3300053153 Bacteria 2736
609 Ga0500622_0083081 3300053156 Bacteria 1600
610 Ga0500622_0102497 3300053156 Bacteria 1407
611 Ga0500637_0013399 3300053178 Bacteria 4300
612 Ga0501084_0002850 3300054114 Bacteria 13972
613 Ga0501084_0079048 3300054114 Bacteria 2757
614 Ga0501082_0371908 3300060353 Bacteria 1247
615 Ga0530510_0027730 3300061734 Bacteria 4058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10009799 Ga0081538_100097992 242
2 3300049572 Ga0501036_0600575 Ga0501036_0600575_10_738 242
3 3300025905 Ga0207685_10040877 Ga0207685_100408772 244
4 3300037068 Ga0373925_0458587 Ga0373925_0458587_121_885 244
5 3300050493 nmdc:mga0k408_215804_c1 nmdc:mga0k408_215804_c1_367_1107 246
6 3300006178 Ga0075367_10050715 Ga0075367_100507153 249
7 3300006178 Ga0075367_10009107 Ga0075367_100091073 251
8 3300007788 Ga0099795_10002446 Ga0099795_100024464 253
9 3300027512 Ga0209179_1000688 Ga0209179_10006884 253
10 iso_pu_bacteria 2510065053 2510281651 256
11 iso_pu_bacteria 2510065055 2510292178 256
12 iso_pu_bacteria 2510065058 2510309799 256
13 iso_pu_bacteria 2917832318 2917832496 256
14 iso_pu_bacteria 2919125081 2919125295 256
15 iso_pu_bacteria 2984504281 2984508502 256
16 iso_pu_bacteria 2990196909 2990197572 256
17 iso_pu_bacteria 8016728285 8016729245 256
18 3300006178 Ga0075367_10002330 Ga0075367_100023304 257
19 3300027866 Ga0209813_10031752 Ga0209813_100317522 257
20 3300050516 nmdc:mga0sz30_8151_c1 nmdc:mga0sz30_8151_c1_811_1608 257
21 3300005937 Ga0081455_10052581 Ga0081455_100525812 259
22 3300013102 Ga0157371_10001049 Ga0157371_1000104919 259
23 3300035207 Ga0373942_0009883 Ga0373942_0009883_897_1691 259
24 3300046557 Ga0495622_0004589 Ga0495622_0004589_1184_1978 259
25 3300046690 Ga0495624_0164978 Ga0495624_0164978_243_1037 259
26 3300046694 Ga0495649_0035125 Ga0495649_0035125_1154_1948 259
27 3300047320 Ga0495672_0011577 Ga0495672_0011577_4320_5114 259
28 3300053080 Ga0500635_0018384 Ga0500635_0018384_844_1638 259
29 3300053178 Ga0500637_0013399 Ga0500637_0013399_2144_2938 259
30 iso_pu_bacteria 2513237087 2513592843 260
31 iso_pu_bacteria 2828305725 2828306948 260
32 iso_pu_bacteria 2977986579 2977988205 260
33 iso_pu_bacteria 3007252601 3007253847 260
34 iso_pu_bacteria 3007315729 3007317414 260
35 3300041997 Ga0439431_0054584 Ga0439431_0054584_215_1009 261
36 3300046520 Ga0495637_0052379 Ga0495637_0052379_587_1384 261
37 3300046689 Ga0495613_0001307 Ga0495613_0001307_8051_8842 261
38 3300053111 Ga0500572_000639 Ga0500572_000639_7423_8214 261
39 iso_pu_bacteria 2510065057 2510305665 261
40 iso_pu_bacteria 2511231027 2511391399 261
41 iso_pu_bacteria 2511231052 2511503696 261
42 iso_pu_bacteria 2512047086 2512528836 261
43 iso_pu_bacteria 2513237086 2513587538 261
44 iso_pu_bacteria 2513237091 2513621232 261
45 iso_pu_bacteria 2516653046 2516896928 261
46 iso_pu_bacteria 2551306084 2551674493 261
47 iso_pu_bacteria 2551306085 2551689700 261
48 iso_pu_bacteria 2551306086 2551690994 261
49 iso_pu_bacteria 2551306087 2551698288 261
50 iso_pu_bacteria 2551306089 2551711236 261
51 iso_pu_bacteria 2551306090 2551719765 261
52 iso_pu_bacteria 2551306091 2551729579 261
53 iso_pu_bacteria 2551306092 2551733845 261
54 iso_pu_bacteria 2551306093 2551745295 261
55 iso_pu_bacteria 2765235802 2765468536 261
56 iso_pu_bacteria 2767802442 2770198258 261
57 iso_pu_bacteria 2775506902 2776272833 261
58 iso_pu_bacteria 2775506904 2776283275 261
59 iso_pu_bacteria 2840764183 2840765709 261
60 iso_pu_bacteria 2841760612 2841762388 261
61 iso_pu_bacteria 2842871566 2842875668 261
62 iso_pu_bacteria 2844104063 2844109926 261
63 iso_pu_bacteria 2851182111 2851186954 261
64 iso_pu_bacteria 2851246043 2851248401 261
65 iso_pu_bacteria 2855825444 2855831201 261
66 iso_pu_bacteria 2855839649 2855845179 261
67 iso_pu_bacteria 2858800743 2858804530 261
68 iso_pu_bacteria 2915993759 2915999856 261
69 iso_pu_bacteria 2916000859 2916007028 261
70 iso_pu_bacteria 2916007675 2916013162 261
71 iso_pu_bacteria 2916014648 2916019809 261
72 iso_pu_bacteria 2916021584 2916026943 261
73 iso_pu_bacteria 2916028427 2916031378 261
74 iso_pu_bacteria 2916035215 2916035717 261
75 iso_pu_bacteria 2916041962 2916042556 261
76 iso_pu_bacteria 2916048683 2916053822 261
77 iso_pu_bacteria 2916055098 2916058117 261
78 iso_pu_bacteria 2916068649 2916073519 261
79 iso_pu_bacteria 2916076590 2916082515 261
80 iso_pu_bacteria 2919119836 2919123891 261
81 iso_pu_bacteria 2921201388 2921206002 261
82 iso_pu_bacteria 2921208531 2921214332 261
83 iso_pu_bacteria 2921237296 2921241970 261
84 iso_pu_bacteria 2921244191 2921246496 261
85 iso_pu_bacteria 2921257292 2921258090 261
86 iso_pu_bacteria 2921263974 2921266792 261
87 iso_pu_bacteria 2921282425 2921284051 261
88 iso_pu_bacteria 2921289301 2921296386 261
89 iso_pu_bacteria 2921296804 2921303978 261
90 iso_pu_bacteria 2924144063 2924146843 261
91 iso_pu_bacteria 2924150972 2924153946 261
92 iso_pu_bacteria 2924158325 2924161304 261
93 iso_pu_bacteria 2924165586 2924167699 261
94 iso_pu_bacteria 2924172951 2924175560 261
95 iso_pu_bacteria 2924179722 2924186242 261
96 iso_pu_bacteria 2924186466 2924191623 261
97 iso_pu_bacteria 2924193448 2924200132 261
98 iso_pu_bacteria 2924200457 2924203234 261
99 iso_pu_bacteria 2924207177 2924211876 261
100 iso_pu_bacteria 2924214083 2924217037 261
101 iso_pu_bacteria 2924221636 2924228807 261
102 iso_pu_bacteria 2924228884 2924230213 261
103 iso_pu_bacteria 2928521798 2928524942 261
104 iso_pu_bacteria 2937002841 2937007883 261
105 iso_pu_bacteria 2937009748 2937011922 261
106 iso_pu_bacteria 2937016420 2937019669 261
107 iso_pu_bacteria 2937023124 2937029141 261
108 iso_pu_bacteria 2937042894 2937043062 261
109 iso_pu_bacteria 2937049772 2937051044 261
110 iso_pu_bacteria 2937056579 2937058859 261
111 iso_pu_bacteria 2937063883 2937067149 261
112 iso_pu_bacteria 2937071275 2937072497 261
113 iso_pu_bacteria 2937091812 2937094173 261
114 iso_pu_bacteria 2937098957 2937100014 261
115 iso_pu_bacteria 2937106411 2937107613 261
116 iso_pu_bacteria 2937119839 2937122147 261
117 iso_pu_bacteria 2937126314 2937132829 261
118 iso_pu_bacteria 2954011201 2954011450 261
119 iso_pu_bacteria 2957382221 2957383615 261
120 iso_pu_bacteria 2957388812 2957392562 261
121 iso_pu_bacteria 2957395598 2957396947 261
122 iso_pu_bacteria 2957402308 2957403616 261
123 iso_pu_bacteria 2957408893 2957412289 261
124 iso_pu_bacteria 2957422303 2957428558 261
125 iso_pu_bacteria 2957430029 2957437043 261
126 iso_pu_bacteria 2957450854 2957454945 261
127 iso_pu_bacteria 2957457609 2957459121 261
128 iso_pu_bacteria 2957464669 2957467119 261
129 iso_pu_bacteria 2957471148 2957472579 261
130 iso_pu_bacteria 2957478035 2957480801 261
131 iso_pu_bacteria 2957484790 2957489836 261
132 iso_pu_bacteria 2957491536 2957494658 261
133 iso_pu_bacteria 2957498199 2957498459 261
134 iso_pu_bacteria 2957505466 2957512863 261
135 iso_pu_bacteria 2960584000 2960589798 261
136 iso_pu_bacteria 2960603979 2960610367 261
137 iso_pu_bacteria 2960610863 2960613975 261
138 iso_pu_bacteria 2960624210 2960628666 261
139 iso_pu_bacteria 2960637947 2960638554 261
140 iso_pu_bacteria 2960645483 2960652469 261
141 iso_pu_bacteria 2960652885 2960654114 261
142 iso_pu_bacteria 2960667422 2960670335 261
143 iso_pu_bacteria 2960674078 2960674826 261
144 iso_pu_bacteria 2960687367 2960692696 261
145 iso_pu_bacteria 2964607997 2964612683 261
146 iso_pu_bacteria 2964615318 2964620107 261
147 iso_pu_bacteria 2964621998 2964623822 261
148 iso_pu_bacteria 2964628898 2964634585 261
149 iso_pu_bacteria 2964636051 2964639907 261
150 iso_pu_bacteria 2964643177 2964649013 261
151 iso_pu_bacteria 2964649959 2964650519 261
152 iso_pu_bacteria 2964656573 2964658705 261
153 iso_pu_bacteria 2964663802 2964664723 261
154 iso_pu_bacteria 2964670856 2964674519 261
155 iso_pu_bacteria 2964678106 2964683453 261
156 iso_pu_bacteria 2964685014 2964686673 261
157 iso_pu_bacteria 2964691889 2964697336 261
158 iso_pu_bacteria 2964705432 2964708462 261
159 iso_pu_bacteria 2964712639 2964718945 261
160 iso_pu_bacteria 2964719344 2964725382 261
161 iso_pu_bacteria 2967664464 2967671233 261
162 iso_pu_bacteria 2967671571 2967676108 261
163 iso_pu_bacteria 2967678726 2967684232 261
164 iso_pu_bacteria 2967693043 2967697998 261
165 iso_pu_bacteria 2967699805 2967705554 261
166 iso_pu_bacteria 2967706974 2967713971 261
167 iso_pu_bacteria 2967714385 2967716062 261
168 iso_pu_bacteria 2967721400 2967727970 261
169 iso_pu_bacteria 2967742019 2967747451 261
170 iso_pu_bacteria 2967748971 2967753617 261
171 iso_pu_bacteria 2967755722 2967760205 261
172 iso_pu_bacteria 2967762386 2967768079 261
173 iso_pu_bacteria 2967769361 2967772021 261
174 iso_pu_bacteria 2967775926 2967777453 261
175 iso_pu_bacteria 2970019648 2970025260 261
176 iso_pu_bacteria 2970033650 2970034674 261
177 iso_pu_bacteria 2970040964 2970042332 261
178 iso_pu_bacteria 2970047711 2970050770 261
179 iso_pu_bacteria 2970054988 2970057549 261
180 iso_pu_bacteria 2970061556 2970067584 261
181 iso_pu_bacteria 2970068827 2970069595 261
182 iso_pu_bacteria 2970076120 2970080054 261
183 iso_pu_bacteria 2970088815 2970089074 261
184 iso_pu_bacteria 2970095765 2970102188 261
185 iso_pu_bacteria 2970102677 2970106721 261
186 iso_pu_bacteria 2970109326 2970113107 261
187 iso_pu_bacteria 2970116247 2970122277 261
188 iso_pu_bacteria 2970129317 2970134050 261
189 iso_pu_bacteria 2970136068 2970143395 261
190 iso_pu_bacteria 2970149975 2970156764 261
191 iso_pu_bacteria 2970156795 2970161777 261
192 iso_pu_bacteria 2970164137 2970168871 261
193 iso_pu_bacteria 2970170962 2970175446 261
194 iso_pu_bacteria 2970177841 2970183841 261
195 iso_pu_bacteria 2970184632 2970188098 261
196 iso_pu_bacteria 2970191845 2970198171 261
197 iso_pu_bacteria 2977516862 2977519202 261
198 iso_pu_bacteria 2977537788 2977541387 261
199 iso_pu_bacteria 2977551784 2977557075 261
200 iso_pu_bacteria 2977558990 2977560752 261
201 iso_pu_bacteria 2977572785 2977577865 261
202 iso_pu_bacteria 2977579622 2977586024 261
203 iso_pu_bacteria 3002141150 3002146239 261
204 iso_pu_bacteria 648276728 648739957 261
205 iso_pu_bacteria 8003992118 8003998401 261
206 3300005841 Ga0068863_100022154 Ga0068863_1000221546 262
207 3300005985 Ga0081539_10046780 Ga0081539_100467802 262
208 3300009147 Ga0114129_10079883 Ga0114129_100798831 262
209 3300050510 nmdc:mga06r32_3222_c1 nmdc:mga06r32_3222_c1_4873_5679 262
210 iso_pu_bacteria 2894817345 2894820782 262
211 3300002741 JGI25157J39369_1000789 JGI25157J39369_10007894 263
212 3300003856 Ga0058692_1006972 Ga0058692_10069722 263
213 3300005435 Ga0070714_100203265 Ga0070714_1002032652 263
214 3300005441 Ga0070700_100039860 Ga0070700_1000398602 263
215 3300005441 Ga0070700_100168733 Ga0070700_1001687332 263
216 3300005444 Ga0070694_100046563 Ga0070694_1000465632 263
217 3300005445 Ga0070708_100008206 Ga0070708_1000082066 263
218 3300005455 Ga0070663_100325560 Ga0070663_1003255601 263
219 3300005467 Ga0070706_100059323 Ga0070706_1000593232 263
220 3300005468 Ga0070707_100032395 Ga0070707_1000323954 263
221 3300005471 Ga0070698_100049739 Ga0070698_1000497392 263
222 3300005518 Ga0070699_100049393 Ga0070699_1000493933 263
223 3300005536 Ga0070697_100035881 Ga0070697_1000358814 263
224 3300005545 Ga0070695_100014398 Ga0070695_1000143983 263
225 3300005843 Ga0068860_100325524 Ga0068860_1003255241 263
226 3300006038 Ga0075365_10262768 Ga0075365_102627681 263
227 3300006042 Ga0075368_10001288 Ga0075368_100012885 263
228 3300006042 Ga0075368_10031065 Ga0075368_100310652 263
229 3300006042 Ga0075368_10073851 Ga0075368_100738512 263
230 3300006048 Ga0075363_100034135 Ga0075363_1000341352 263
231 3300006051 Ga0075364_10343897 Ga0075364_103438972 263
232 3300006844 Ga0075428_100043597 Ga0075428_1000435971 263
233 3300006846 Ga0075430_100053681 Ga0075430_1000536813 263
234 3300006846 Ga0075430_100083957 Ga0075430_1000839573 263
235 3300006847 Ga0075431_100007626 Ga0075431_1000076267 263
236 3300009094 Ga0111539_10025042 Ga0111539_100250425 263
237 3300009094 Ga0111539_10431201 Ga0111539_104312012 263
238 3300009094 Ga0111539_10870615 Ga0111539_108706152 263
239 3300013100 Ga0157373_10047843 Ga0157373_100478435 263
240 3300013102 Ga0157371_10038768 Ga0157371_100387682 263
241 3300014326 Ga0157380_10107215 Ga0157380_101072152 263
242 3300014968 Ga0157379_10157170 Ga0157379_101571701 263
243 3300026067 Ga0207678_10014083 Ga0207678_100140834 263
244 3300026067 Ga0207678_10400390 Ga0207678_104003902 263
245 3300026075 Ga0207708_10036315 Ga0207708_100363153 263
246 3300026075 Ga0207708_10078386 Ga0207708_100783863 263
247 3300027312 Ga0209371_1000135 Ga0209371_100013542 263
248 3300027866 Ga0209813_10001909 Ga0209813_100019093 263
249 3300027907 Ga0207428_10486344 Ga0207428_104863441 263
250 3300028381 Ga0268264_10188786 Ga0268264_101887862 263
251 3300028381 Ga0268264_10263492 Ga0268264_102634922 263
252 3300030500 Ga0268256_1000148 Ga0268256_100014842 263
253 3300031456 Ga0307513_10459668 Ga0307513_104596682 263
254 3300031995 Ga0307409_100270597 Ga0307409_1002705972 263
255 3300035114 Ga0373939_0002189 Ga0373939_0002189_1611_2411 263
256 3300035115 Ga0373941_0050900 Ga0373941_0050900_441_1241 263
257 3300035121 Ga0373960_0003305 Ga0373960_0003305_1368_2168 263
258 3300035207 Ga0373942_0049718 Ga0373942_0049718_56_856 263
259 3300035242 Ga0373962_0030996 Ga0373962_0030996_568_1368 263
260 3300035691 Ga0373931_0038360 Ga0373931_0038360_1648_2448 263
261 3300035691 Ga0373931_0111506 Ga0373931_0111506_728_1528 263
262 3300035695 Ga0373927_0047956 Ga0373927_0047956_1936_2736 263
263 3300042436 Ga0439435_0028273 Ga0439435_0028273_700_1491 263
264 3300042439 Ga0439464_0011374 Ga0439464_0011374_1342_2196 263
265 3300046455 Ga0495603_0009391 Ga0495603_0009391_4096_4941 263
266 3300046463 Ga0495653_0012380 Ga0495653_0012380_5339_6181 263
267 3300046491 Ga0495584_0070026 Ga0495584_0070026_220_1020 263
268 3300046492 Ga0495585_0002879 Ga0495585_0002879_10667_11509 263
269 3300046501 Ga0495607_0038737 Ga0495607_0038737_1042_1887 263
270 3300046507 Ga0495606_0001140 Ga0495606_0001140_3412_4254 263
271 3300046522 Ga0495643_0151044 Ga0495643_0151044_203_994 263
272 3300046660 Ga0495625_0094839 Ga0495625_0094839_236_1036 263
273 3300046664 Ga0495659_0135369 Ga0495659_0135369_79_879 263
274 3300046665 Ga0495661_0000030 Ga0495661_0000030_73588_74430 263
275 3300046692 Ga0495671_0058046 Ga0495671_0058046_115_960 263
276 3300046694 Ga0495649_0000288 Ga0495649_0000288_14159_15004 263
277 3300047321 Ga0495676_0028770 Ga0495676_0028770_15_860 263
278 3300047323 Ga0495683_0000018 Ga0495683_0000018_49741_50586 263
279 3300047469 Ga0495673_0059565 Ga0495673_0059565_279_1094 263
280 3300048907 Ga0496104_0001191 Ga0496104_0001191_12606_13406 263
281 3300048908 Ga0496105_0020524 Ga0496105_0020524_3069_3869 263
282 3300048911 Ga0496108_0211232 Ga0496108_0211232_615_1415 263
283 3300048911 Ga0496108_0223064 Ga0496108_0223064_53_853 263
284 3300048914 Ga0496111_0029514 Ga0496111_0029514_1196_1996 263
285 3300048916 Ga0496113_0131970 Ga0496113_0131970_70_870 263
286 3300048917 Ga0496114_0137334 Ga0496114_0137334_129_929 263
287 3300048918 Ga0496115_0010413 Ga0496115_0010413_3931_4731 263
288 3300049585 Ga0501069_0154697 Ga0501069_0154697_219_1013 263
289 3300050490 nmdc:mga03n38_22227_c1 nmdc:mga03n38_22227_c1_825_1631 263
290 3300050492 nmdc:mga0yw44_90385_c1 nmdc:mga0yw44_90385_c1_74_874 263
291 3300050495 nmdc:mga04h51_57647_c1 nmdc:mga04h51_57647_c1_141_941 263
292 3300050495 nmdc:mga04h51_63862_c1 nmdc:mga04h51_63862_c1_405_1205 263
293 3300050496 nmdc:mga07m45_185873_c1 nmdc:mga07m45_185873_c1_57_848 263
294 3300050507 nmdc:mga05p37_118078_c1 nmdc:mga05p37_118078_c1_605_1396 263
295 3300050509 nmdc:mga0qj67_54201_c1 nmdc:mga0qj67_54201_c1_1017_1820 263
296 3300050510 nmdc:mga06r32_156904_c1 nmdc:mga06r32_156904_c1_1223_2023 263
297 3300050511 nmdc:mga08y16_743205_c1 nmdc:mga08y16_743205_c1_89_889 263
298 3300050511 nmdc:mga08y16_99167_c1 nmdc:mga08y16_99167_c1_409_1209 263
299 3300053103 Ga0500555_034532 Ga0500555_034532_572_1381 263
300 3300053125 Ga0500618_003240 Ga0500618_003240_823_1674 263
301 3300053156 Ga0500622_0083081 Ga0500622_0083081_176_973 263
302 3300053156 Ga0500622_0102497 Ga0500622_0102497_361_1152 263
303 3300002073 JGI24745J21846_1000813 JGI24745J21846_10008133 264
304 3300002074 JGI24748J21848_1001232 JGI24748J21848_10012323 264
305 3300002076 JGI24749J21850_1003635 JGI24749J21850_10036352 264
306 3300002077 JGI24744J21845_10007594 JGI24744J21845_100075942 264
307 3300002239 JGI24034J26672_10004512 JGI24034J26672_100045122 264
308 3300002244 JGI24742J22300_10000771 JGI24742J22300_100007714 264
309 3300002987 JGI25159J45721_1014387 JGI25159J45721_10143871 264
310 3300005329 Ga0070683_100487048 Ga0070683_1004870482 264
311 3300005330 Ga0070690_100053695 Ga0070690_1000536953 264
312 3300005330 Ga0070690_100078221 Ga0070690_1000782212 264
313 3300005331 Ga0070670_100002578 Ga0070670_1000025788 264
314 3300005331 Ga0070670_100023945 Ga0070670_1000239452 264
315 3300005331 Ga0070670_100026578 Ga0070670_1000265785 264
316 3300005331 Ga0070670_100223635 Ga0070670_1002236351 264
317 3300005334 Ga0068869_100059708 Ga0068869_1000597083 264
318 3300005334 Ga0068869_100109601 Ga0068869_1001096012 264
319 3300005335 Ga0070666_10039936 Ga0070666_100399364 264
320 3300005338 Ga0068868_100017867 Ga0068868_1000178674 264
321 3300005339 Ga0070660_100042107 Ga0070660_1000421072 264
322 3300005340 Ga0070689_100004714 Ga0070689_1000047148 264
323 3300005340 Ga0070689_100099823 Ga0070689_1000998232 264
324 3300005340 Ga0070689_100469351 Ga0070689_1004693511 264
325 3300005343 Ga0070687_100022552 Ga0070687_1000225524 264
326 3300005345 Ga0070692_10013178 Ga0070692_100131783 264
327 3300005353 Ga0070669_100059519 Ga0070669_1000595192 264
328 3300005354 Ga0070675_100005140 Ga0070675_1000051407 264
329 3300005354 Ga0070675_100033552 Ga0070675_1000335523 264
330 3300005354 Ga0070675_100225679 Ga0070675_1002256792 264
331 3300005354 Ga0070675_100607994 Ga0070675_1006079942 264
332 3300005355 Ga0070671_100035820 Ga0070671_1000358203 264
333 3300005356 Ga0070674_100028369 Ga0070674_1000283694 264
334 3300005365 Ga0070688_100003162 Ga0070688_1000031626 264
335 3300005367 Ga0070667_100112334 Ga0070667_1001123343 264
336 3300005437 Ga0070710_10100864 Ga0070710_101008642 264
337 3300005438 Ga0070701_10002506 Ga0070701_100025066 264
338 3300005438 Ga0070701_10021281 Ga0070701_100212813 264
339 3300005438 Ga0070701_10058535 Ga0070701_100585352 264
340 3300005438 Ga0070701_10090868 Ga0070701_100908682 264
341 3300005440 Ga0070705_100006016 Ga0070705_1000060162 264
342 3300005441 Ga0070700_100022906 Ga0070700_1000229063 264
343 3300005441 Ga0070700_100074285 Ga0070700_1000742852 264
344 3300005444 Ga0070694_100018466 Ga0070694_1000184663 264
345 3300005456 Ga0070678_100094983 Ga0070678_1000949833 264
346 3300005457 Ga0070662_100168747 Ga0070662_1001687472 264
347 3300005458 Ga0070681_10015501 Ga0070681_100155011 264
348 3300005459 Ga0068867_100008831 Ga0068867_1000088314 264
349 3300005459 Ga0068867_100123980 Ga0068867_1001239802 264
350 3300005459 Ga0068867_100245815 Ga0068867_1002458152 264
351 3300005466 Ga0070685_10003217 Ga0070685_100032176 264
352 3300005466 Ga0070685_10080973 Ga0070685_100809732 264
353 3300005518 Ga0070699_100000958 Ga0070699_10000095817 264
354 3300005530 Ga0070679_100123450 Ga0070679_1001234502 264
355 3300005535 Ga0070684_100025212 Ga0070684_1000252124 264
356 3300005539 Ga0068853_100283032 Ga0068853_1002830322 264
357 3300005543 Ga0070672_100044713 Ga0070672_1000447133 264
358 3300005543 Ga0070672_100070124 Ga0070672_1000701242 264
359 3300005543 Ga0070672_100315091 Ga0070672_1003150912 264
360 3300005544 Ga0070686_100019835 Ga0070686_1000198353 264
361 3300005544 Ga0070686_100142903 Ga0070686_1001429032 264
362 3300005545 Ga0070695_100000397 Ga0070695_1000003973 264
363 3300005546 Ga0070696_100128396 Ga0070696_1001283963 264
364 3300005548 Ga0070665_100002095 Ga0070665_10000209511 264
365 3300005548 Ga0070665_100048509 Ga0070665_1000485093 264
366 3300005549 Ga0070704_100006925 Ga0070704_1000069254 264
367 3300005549 Ga0070704_100078002 Ga0070704_1000780022 264
368 3300005549 Ga0070704_100110511 Ga0070704_1001105113 264
369 3300005564 Ga0070664_100043629 Ga0070664_1000436293 264
370 3300005564 Ga0070664_100184189 Ga0070664_1001841892 264
371 3300005577 Ga0068857_100045186 Ga0068857_1000451863 264
372 3300005577 Ga0068857_100067242 Ga0068857_1000672422 264
373 3300005577 Ga0068857_100304576 Ga0068857_1003045762 264
374 3300005578 Ga0068854_100055965 Ga0068854_1000559653 264
375 3300005615 Ga0070702_100017208 Ga0070702_1000172082 264
376 3300005615 Ga0070702_100171278 Ga0070702_1001712782 264
377 3300005617 Ga0068859_100008199 Ga0068859_1000081998 264
378 3300005617 Ga0068859_100084046 Ga0068859_1000840463 264
379 3300005617 Ga0068859_100116716 Ga0068859_1001167164 264
380 3300005617 Ga0068859_100162981 Ga0068859_1001629813 264
381 3300005617 Ga0068859_100344423 Ga0068859_1003444231 264
382 3300005617 Ga0068859_100442688 Ga0068859_1004426882 264
383 3300005618 Ga0068864_100016617 Ga0068864_1000166172 264
384 3300005618 Ga0068864_100035692 Ga0068864_1000356924 264
385 3300005618 Ga0068864_100044607 Ga0068864_1000446073 264
386 3300005618 Ga0068864_100538890 Ga0068864_1005388902 264
387 3300005718 Ga0068866_10151388 Ga0068866_101513882 264
388 3300005719 Ga0068861_100003146 Ga0068861_1000031462 264
389 3300005719 Ga0068861_100035575 Ga0068861_1000355754 264
390 3300005719 Ga0068861_100300150 Ga0068861_1003001502 264
391 3300005719 Ga0068861_100522432 Ga0068861_1005224322 264
392 3300005840 Ga0068870_10002967 Ga0068870_100029672 264
393 3300005840 Ga0068870_10069918 Ga0068870_100699182 264
394 3300005841 Ga0068863_100259415 Ga0068863_1002594152 264
395 3300005842 Ga0068858_100679937 Ga0068858_1006799371 264
396 3300005843 Ga0068860_100024395 Ga0068860_1000243953 264
397 3300005843 Ga0068860_100178858 Ga0068860_1001788583 264
398 3300005843 Ga0068860_100187674 Ga0068860_1001876742 264
399 3300005844 Ga0068862_100015557 Ga0068862_1000155572 264
400 3300005844 Ga0068862_100064741 Ga0068862_1000647413 264
401 3300005844 Ga0068862_100139777 Ga0068862_1001397772 264
402 3300005937 Ga0081455_10002125 Ga0081455_1000212511 264
403 3300005937 Ga0081455_10007852 Ga0081455_100078526 264
404 3300005937 Ga0081455_10024860 Ga0081455_100248603 264
405 3300005937 Ga0081455_10048637 Ga0081455_100486373 264
406 3300005937 Ga0081455_10451862 Ga0081455_104518621 264
407 3300005985 Ga0081539_10001507 Ga0081539_100015079 264
408 3300006028 Ga0070717_10030914 Ga0070717_100309144 264
409 3300006038 Ga0075365_10011946 Ga0075365_100119463 264
410 3300006038 Ga0075365_10032564 Ga0075365_100325644 264
411 3300006038 Ga0075365_10229901 Ga0075365_102299012 264
412 3300006051 Ga0075364_10015907 Ga0075364_100159073 264
413 3300006051 Ga0075364_10151749 Ga0075364_101517492 264
414 3300006058 Ga0075432_10023766 Ga0075432_100237662 264
415 3300006175 Ga0070712_100073436 Ga0070712_1000734363 264
416 3300006177 Ga0075362_10007577 Ga0075362_100075775 264
417 3300006177 Ga0075362_10027447 Ga0075362_100274472 264
418 3300006178 Ga0075367_10008639 Ga0075367_100086394 264
419 3300006178 Ga0075367_10110241 Ga0075367_101102412 264
420 3300006178 Ga0075367_10146305 Ga0075367_101463052 264
421 3300006194 Ga0075427_10001903 Ga0075427_100019033 264
422 3300006195 Ga0075366_10002683 Ga0075366_100026834 264
423 3300006237 Ga0097621_100020815 Ga0097621_1000208154 264
424 3300006237 Ga0097621_100099132 Ga0097621_1000991322 264
425 3300006237 Ga0097621_100600393 Ga0097621_1006003931 264
426 3300006353 Ga0075370_10069394 Ga0075370_100693942 264
427 3300006353 Ga0075370_10094523 Ga0075370_100945231 264
428 3300006358 Ga0068871_100105440 Ga0068871_1001054402 264
429 3300006844 Ga0075428_100005390 Ga0075428_1000053904 264
430 3300006844 Ga0075428_100115849 Ga0075428_1001158493 264
431 3300006844 Ga0075428_100157602 Ga0075428_1001576022 264
432 3300006844 Ga0075428_100209493 Ga0075428_1002094933 264
433 3300006846 Ga0075430_100000037 Ga0075430_1000000374 264
434 3300006846 Ga0075430_100000140 Ga0075430_10000014023 264
435 3300006846 Ga0075430_100052502 Ga0075430_1000525022 264
436 3300006846 Ga0075430_100070227 Ga0075430_1000702272 264
437 3300006846 Ga0075430_100085394 Ga0075430_1000853943 264
438 3300006846 Ga0075430_100315390 Ga0075430_1003153902 264
439 3300006847 Ga0075431_100001318 Ga0075431_1000013184 264
440 3300006847 Ga0075431_100012944 Ga0075431_1000129445 264
441 3300006847 Ga0075431_100022627 Ga0075431_1000226274 264
442 3300006847 Ga0075431_100511766 Ga0075431_1005117662 264
443 3300006852 Ga0075433_10000050 Ga0075433_1000005024 264
444 3300006852 Ga0075433_10237908 Ga0075433_102379083 264
445 3300006871 Ga0075434_100000179 Ga0075434_10000017913 264
446 3300006871 Ga0075434_100053725 Ga0075434_1000537253 264
447 3300006871 Ga0075434_100150543 Ga0075434_1001505432 264
448 3300006880 Ga0075429_100001170 Ga0075429_10000117010 264
449 3300006880 Ga0075429_100015042 Ga0075429_1000150424 264
450 3300006880 Ga0075429_100016376 Ga0075429_1000163764 264
451 3300006880 Ga0075429_100069478 Ga0075429_1000694782 264
452 3300006880 Ga0075429_100122508 Ga0075429_1001225082 264
453 3300006880 Ga0075429_100125003 Ga0075429_1001250032 264
454 3300006881 Ga0068865_100095569 Ga0068865_1000955693 264
455 3300006881 Ga0068865_100353871 Ga0068865_1003538712 264
456 3300006914 Ga0075436_100123231 Ga0075436_1001232312 264
457 3300006931 Ga0097620_100008199 Ga0097620_1000081993 264
458 3300006931 Ga0097620_100084049 Ga0097620_1000840493 264
459 3300006931 Ga0097620_100116718 Ga0097620_1001167184 264
460 3300006931 Ga0097620_100162996 Ga0097620_1001629963 264
461 3300006931 Ga0097620_100344445 Ga0097620_1003444451 264
462 3300006931 Ga0097620_100442703 Ga0097620_1004427032 264
463 3300006946 Ga0079104_1028471 Ga0079104_10284712 264
464 3300007076 Ga0075435_100001211 Ga0075435_1000012116 264
465 3300007076 Ga0075435_100040220 Ga0075435_1000402203 264
466 3300009011 Ga0105251_10028678 Ga0105251_100286781 264
467 3300009094 Ga0111539_10000565 Ga0111539_1000056523 264
468 3300009094 Ga0111539_10243181 Ga0111539_102431812 264
469 3300009094 Ga0111539_10331634 Ga0111539_103316342 264
470 3300009094 Ga0111539_10373757 Ga0111539_103737572 264
471 3300009098 Ga0105245_10126527 Ga0105245_101265271 264
472 3300009101 Ga0105247_10012454 Ga0105247_100124544 264
473 3300009147 Ga0114129_10003182 Ga0114129_1000318210 264
474 3300009147 Ga0114129_10006815 Ga0114129_1000681512 264
475 3300009147 Ga0114129_10039625 Ga0114129_100396252 264
476 3300009147 Ga0114129_10085173 Ga0114129_100851733 264
477 3300009147 Ga0114129_10113700 Ga0114129_101137002 264
478 3300009147 Ga0114129_10164097 Ga0114129_101640973 264
479 3300009147 Ga0114129_10501264 Ga0114129_105012642 264
480 3300009148 Ga0105243_10035760 Ga0105243_100357602 264
481 3300009148 Ga0105243_10131798 Ga0105243_101317982 264
482 3300009148 Ga0105243_10449924 Ga0105243_104499242 264
483 3300009174 Ga0105241_10078169 Ga0105241_100781692 264
484 3300009174 Ga0105241_10200354 Ga0105241_102003542 264
485 3300009176 Ga0105242_10029381 Ga0105242_100293813 264
486 3300009545 Ga0105237_10179967 Ga0105237_101799673 264
487 3300009551 Ga0105238_10045770 Ga0105238_100457703 264
488 3300011119 Ga0105246_10081049 Ga0105246_100810493 264
489 3300013296 Ga0157374_10011472 Ga0157374_100114723 264
490 3300013297 Ga0157378_10434899 Ga0157378_104348992 264
491 3300013306 Ga0163162_10011400 Ga0163162_100114003 264
492 3300013308 Ga0157375_10011366 Ga0157375_100113666 264
493 3300014325 Ga0163163_10228165 Ga0163163_102281653 264
494 3300014326 Ga0157380_10001434 Ga0157380_1000143415 264
495 3300014326 Ga0157380_10027085 Ga0157380_100270854 264
496 3300014745 Ga0157377_10033989 Ga0157377_100339893 264
497 3300014969 Ga0157376_10392089 Ga0157376_103920891 264
498 3300017792 Ga0163161_10113729 Ga0163161_101137292 264
499 3300021384 Ga0213876_10051869 Ga0213876_100518692 264
500 3300025297 Ga0209758_1000702 Ga0209758_100070237 264
501 3300025321 Ga0207656_10056666 Ga0207656_100566662 264
502 3300025728 Ga0207655_1047574 Ga0207655_10475742 264
503 3300025899 Ga0207642_10015397 Ga0207642_100153973 264
504 3300025900 Ga0207710_10007297 Ga0207710_100072973 264
505 3300025901 Ga0207688_10001854 Ga0207688_100018543 264
506 3300025907 Ga0207645_10037124 Ga0207645_100371242 264
507 3300025908 Ga0207643_10000418 Ga0207643_1000041817 264
508 3300025908 Ga0207643_10121117 Ga0207643_101211172 264
509 3300025910 Ga0207684_10014542 Ga0207684_100145425 264
510 3300025911 Ga0207654_10170207 Ga0207654_101702072 264
511 3300025912 Ga0207707_10023299 Ga0207707_100232992 264
512 3300025914 Ga0207671_10078141 Ga0207671_100781412 264
513 3300025917 Ga0207660_10044408 Ga0207660_100444083 264
514 3300025918 Ga0207662_10026343 Ga0207662_100263434 264
515 3300025918 Ga0207662_10031898 Ga0207662_100318982 264
516 3300025918 Ga0207662_10219493 Ga0207662_102194931 264
517 3300025919 Ga0207657_10012700 Ga0207657_100127008 264
518 3300025920 Ga0207649_10014278 Ga0207649_100142784 264
519 3300025921 Ga0207652_10084479 Ga0207652_100844793 264
520 3300025922 Ga0207646_10264876 Ga0207646_102648763 264
521 3300025923 Ga0207681_10019331 Ga0207681_100193313 264
522 3300025924 Ga0207694_10024597 Ga0207694_100245973 264
523 3300025925 Ga0207650_10001829 Ga0207650_100018298 264
524 3300025925 Ga0207650_10088008 Ga0207650_100880083 264
525 3300025926 Ga0207659_10056201 Ga0207659_100562011 264
526 3300025926 Ga0207659_10063349 Ga0207659_100633492 264
527 3300025927 Ga0207687_10087623 Ga0207687_100876233 264
528 3300025928 Ga0207700_10145158 Ga0207700_101451582 264
529 3300025928 Ga0207700_10217261 Ga0207700_102172612 264
530 3300025933 Ga0207706_10004539 Ga0207706_100045394 264
531 3300025933 Ga0207706_10057602 Ga0207706_100576025 264
532 3300025934 Ga0207686_10028762 Ga0207686_100287623 264
533 3300025935 Ga0207709_10125757 Ga0207709_101257573 264
534 3300025936 Ga0207670_10014592 Ga0207670_100145924 264
535 3300025936 Ga0207670_10048986 Ga0207670_100489862 264
536 3300025937 Ga0207669_10014859 Ga0207669_100148593 264
537 3300025938 Ga0207704_10156792 Ga0207704_101567921 264
538 3300025938 Ga0207704_10204533 Ga0207704_102045332 264
539 3300025940 Ga0207691_10015805 Ga0207691_100158057 264
540 3300025940 Ga0207691_10037991 Ga0207691_100379913 264
541 3300025940 Ga0207691_10105215 Ga0207691_101052152 264
542 3300025941 Ga0207711_10076372 Ga0207711_100763722 264
543 3300025942 Ga0207689_10071966 Ga0207689_100719662 264
544 3300025942 Ga0207689_10073188 Ga0207689_100731883 264
545 3300025942 Ga0207689_10134416 Ga0207689_101344163 264
546 3300025942 Ga0207689_10202805 Ga0207689_102028052 264
547 3300025944 Ga0207661_10218849 Ga0207661_102188492 264
548 3300025945 Ga0207679_10461271 Ga0207679_104612712 264
549 3300025961 Ga0207712_10060715 Ga0207712_100607153 264
550 3300025972 Ga0207668_10060329 Ga0207668_100603293 264
551 3300025981 Ga0207640_10031878 Ga0207640_100318783 264
552 3300025986 Ga0207658_10609069 Ga0207658_106090691 264
553 3300026023 Ga0207677_10017844 Ga0207677_100178443 264
554 3300026035 Ga0207703_10054653 Ga0207703_100546533 264
555 3300026035 Ga0207703_10134989 Ga0207703_101349891 264
556 3300026041 Ga0207639_10006376 Ga0207639_100063762 264
557 3300026041 Ga0207639_10431322 Ga0207639_104313222 264
558 3300026075 Ga0207708_10002881 Ga0207708_100028816 264
559 3300026075 Ga0207708_10033722 Ga0207708_100337222 264
560 3300026075 Ga0207708_10117559 Ga0207708_101175592 264
561 3300026088 Ga0207641_10024407 Ga0207641_100244073 264
562 3300026088 Ga0207641_10075971 Ga0207641_100759712 264
563 3300026088 Ga0207641_10220589 Ga0207641_102205891 264
564 3300026088 Ga0207641_10223751 Ga0207641_102237512 264
565 3300026088 Ga0207641_10323483 Ga0207641_103234831 264
566 3300026089 Ga0207648_10009436 Ga0207648_100094363 264
567 3300026089 Ga0207648_10048867 Ga0207648_100488673 264
568 3300026089 Ga0207648_10410101 Ga0207648_104101012 264
569 3300026095 Ga0207676_10050657 Ga0207676_100506573 264
570 3300026095 Ga0207676_10062867 Ga0207676_100628672 264
571 3300026095 Ga0207676_10134304 Ga0207676_101343041 264
572 3300026095 Ga0207676_10201530 Ga0207676_102015302 264
573 3300026116 Ga0207674_10000240 Ga0207674_1000024044 264
574 3300026116 Ga0207674_10067021 Ga0207674_100670213 264
575 3300026116 Ga0207674_10163696 Ga0207674_101636963 264
576 3300026118 Ga0207675_100001517 Ga0207675_10000151712 264
577 3300026118 Ga0207675_100010921 Ga0207675_1000109216 264
578 3300026118 Ga0207675_100066173 Ga0207675_1000661733 264
579 3300026118 Ga0207675_100107910 Ga0207675_1001079103 264
580 3300026118 Ga0207675_100299562 Ga0207675_1002995622 264
581 3300026121 Ga0207683_10025013 Ga0207683_100250133 264
582 3300026121 Ga0207683_10110247 Ga0207683_101102473 264
583 3300026121 Ga0207683_10370706 Ga0207683_103707062 264
584 3300026142 Ga0207698_10177998 Ga0207698_101779983 264
585 3300027111 Ga0209281_1002399 Ga0209281_10023993 264
586 3300027717 Ga0209998_10038490 Ga0209998_100384901 264
587 3300027876 Ga0209974_10058230 Ga0209974_100582302 264
588 3300027907 Ga0207428_10000485 Ga0207428_1000048523 264
589 3300027907 Ga0207428_10078186 Ga0207428_100781862 264
590 3300027907 Ga0207428_10349750 Ga0207428_103497502 264
591 3300028379 Ga0268266_10013114 Ga0268266_100131147 264
592 3300028379 Ga0268266_10066365 Ga0268266_100663652 264
593 3300028379 Ga0268266_10067001 Ga0268266_100670012 264
594 3300028380 Ga0268265_10002419 Ga0268265_1000241912 264
595 3300028380 Ga0268265_10048398 Ga0268265_100483984 264
596 3300028380 Ga0268265_10096683 Ga0268265_100966833 264
597 3300028381 Ga0268264_10001273 Ga0268264_100012737 264
598 3300028381 Ga0268264_10122871 Ga0268264_101228712 264
599 3300028381 Ga0268264_10240311 Ga0268264_102403112 264
600 3300030521 Ga0307511_10004306 Ga0307511_100043066 264
601 3300031238 Ga0265332_10001500 Ga0265332_100015009 264
602 3300031242 Ga0265329_10009619 Ga0265329_100096192 264
603 3300031247 Ga0265340_10012118 Ga0265340_100121183 264
604 3300031249 Ga0265339_10000253 Ga0265339_1000025320 264
605 3300031250 Ga0265331_10022837 Ga0265331_100228374 264
606 3300031548 Ga0307408_100083621 Ga0307408_1000836212 264
607 3300031548 Ga0307408_100427314 Ga0307408_1004273142 264
608 3300031711 Ga0265314_10005768 Ga0265314_100057686 264
609 3300031712 Ga0265342_10000039 Ga0265342_1000003972 264
610 3300031731 Ga0307405_10147304 Ga0307405_101473041 264
611 3300031824 Ga0307413_10018816 Ga0307413_100188163 264
612 3300031852 Ga0307410_10005539 Ga0307410_100055393 264
613 3300031901 Ga0307406_10027619 Ga0307406_100276193 264
614 3300031903 Ga0307407_10018156 Ga0307407_100181563 264
615 3300031903 Ga0307407_10065731 Ga0307407_100657312 264
616 3300031995 Ga0307409_100030120 Ga0307409_1000301204 264
617 3300031995 Ga0307409_100038659 Ga0307409_1000386593 264
618 3300032002 Ga0307416_100023992 Ga0307416_1000239922 264
619 3300032005 Ga0307411_10010375 Ga0307411_100103754 264
620 3300032005 Ga0307411_10042872 Ga0307411_100428722 264
621 3300032126 Ga0307415_100070432 Ga0307415_1000704322 264
622 3300034957 Ga0373938_0017130 Ga0373938_0017130_335_1129 264
623 3300035083 Ga0373926_0066834 Ga0373926_0066834_246_1103 264
624 3300035089 Ga0373944_0044038 Ga0373944_0044038_214_1008 264
625 3300035170 Ga0373943_0040064 Ga0373943_0040064_900_1694 264
626 3300035171 Ga0373946_0020259 Ga0373946_0020259_1136_1930 264
627 3300035171 Ga0373946_0140816 Ga0373946_0140816_18_818 264
628 3300035691 Ga0373931_0002261 Ga0373931_0002261_171_965 264
629 3300035691 Ga0373931_0155940 Ga0373931_0155940_487_1287 264
630 3300035692 Ga0373935_0074532 Ga0373935_0074532_853_1647 264
631 3300035692 Ga0373935_0125234 Ga0373935_0125234_90_890 264
632 3300035695 Ga0373927_0060884 Ga0373927_0060884_748_1542 264
633 3300037068 Ga0373925_0157782 Ga0373925_0157782_500_1294 264
634 3300037068 Ga0373925_0183572 Ga0373925_0183572_844_1644 264
635 3300037466 Ga0395898_0094463 Ga0395898_0094463_1857_2651 264
636 3300038443 Ga0395901_0082092 Ga0395901_0082092_716_1510 264
637 3300039437 Ga0436365_1129034 Ga0436365_1129034_211_1008 264
638 3300039438 Ga0436360_0206105 Ga0436360_0206105_263_1057 264
639 3300039447 Ga0436361_1155031 Ga0436361_1155031_265_1059 264
640 3300041410 Ga0439461_0043769 Ga0439461_0043769_146_940 264
641 3300041453 Ga0451797_1070901 Ga0451797_1070901_398_1201 264
642 3300041486 Ga0451807_0888807 Ga0451807_0888807_1337_2143 264
643 3300041486 Ga0451807_0982580 Ga0451807_0982580_1013_1816 264
644 3300044735 Ga0466968_0063542 Ga0466968_0063542_613_1422 264
645 3300046453 Ga0495627_025977 Ga0495627_025977_758_1552 264
646 3300046455 Ga0495603_0037614 Ga0495603_0037614_211_1005 264
647 3300046455 Ga0495603_0089888 Ga0495603_0089888_240_1034 264
648 3300046458 Ga0495591_053466 Ga0495591_053466_85_879 264
649 3300046460 Ga0495638_0135328 Ga0495638_0135328_183_977 264
650 3300046492 Ga0495585_0019507 Ga0495585_0019507_2126_2920 264
651 3300046514 Ga0495618_0163049 Ga0495618_0163049_543_1349 264
652 3300046518 Ga0495631_0141458 Ga0495631_0141458_34_828 264
653 3300046526 Ga0495666_0035414 Ga0495666_0035414_896_1690 264
654 3300046529 Ga0495652_0348968 Ga0495652_0348968_31_825 264
655 3300046531 Ga0495665_0062132 Ga0495665_0062132_308_1114 264
656 3300046533 Ga0495640_0122475 Ga0495640_0122475_601_1407 264
657 3300046615 Ga0495656_0069407 Ga0495656_0069407_79_873 264
658 3300046616 Ga0495668_0017657 Ga0495668_0017657_734_1537 264
659 3300046616 Ga0495668_0168465 Ga0495668_0168465_13_816 264
660 3300046664 Ga0495659_0015392 Ga0495659_0015392_1094_1888 264
661 3300046678 Ga0495599_0267748 Ga0495599_0267748_163_957 264
662 3300046683 Ga0495658_0019453 Ga0495658_0019453_1706_2500 264
663 3300046684 Ga0495669_0073740 Ga0495669_0073740_458_1252 264
664 3300046689 Ga0495613_0226755 Ga0495613_0226755_27_821 264
665 3300046809 Ga0495600_0281860 Ga0495600_0281860_168_962 264
666 3300046810 Ga0495660_0063638 Ga0495660_0063638_692_1486 264
667 3300047321 Ga0495676_0115594 Ga0495676_0115594_411_1205 264
668 3300047445 Ga0495677_0083701 Ga0495677_0083701_121_915 264
669 3300047446 Ga0495679_026051 Ga0495679_026051_318_1112 264
670 3300048903 Ga0496100_0028230 Ga0496100_0028230_1135_1929 264
671 3300048903 Ga0496100_0069923 Ga0496100_0069923_141_947 264
672 3300048903 Ga0496100_0518862 Ga0496100_0518862_33_827 264
673 3300048904 Ga0496101_0188938 Ga0496101_0188938_776_1570 264
674 3300048904 Ga0496101_0193440 Ga0496101_0193440_89_895 264
675 3300048905 Ga0496102_0017492 Ga0496102_0017492_5265_6080 264
676 3300048905 Ga0496102_0023681 Ga0496102_0023681_3904_4698 264
677 3300048905 Ga0496102_0149679 Ga0496102_0149679_951_1745 264
678 3300048905 Ga0496102_0168988 Ga0496102_0168988_32_838 264
679 3300048905 Ga0496102_0273462 Ga0496102_0273462_425_1282 264
680 3300048906 Ga0496103_0038434 Ga0496103_0038434_612_1406 264
681 3300048906 Ga0496103_0092970 Ga0496103_0092970_637_1443 264
682 3300048907 Ga0496104_0002505 Ga0496104_0002505_1952_2758 264
683 3300048907 Ga0496104_0042153 Ga0496104_0042153_1147_1941 264
684 3300048907 Ga0496104_0086936 Ga0496104_0086936_489_1283 264
685 3300048907 Ga0496104_0283256 Ga0496104_0283256_289_1083 264
686 3300048908 Ga0496105_0030374 Ga0496105_0030374_1547_2353 264
687 3300048908 Ga0496105_0046218 Ga0496105_0046218_839_1633 264
688 3300048909 Ga0496106_0002303 Ga0496106_0002303_4341_5156 264
689 3300048909 Ga0496106_0266587 Ga0496106_0266587_14_808 264
690 3300048910 Ga0496107_0042027 Ga0496107_0042027_1977_2771 264
691 3300048910 Ga0496107_0050841 Ga0496107_0050841_1771_2586 264
692 3300048910 Ga0496107_0065076 Ga0496107_0065076_1689_2483 264
693 3300048911 Ga0496108_0000357 Ga0496108_0000357_13190_13996 264
694 3300048911 Ga0496108_0031017 Ga0496108_0031017_1677_2471 264
695 3300048911 Ga0496108_0370197 Ga0496108_0370197_410_1225 264
696 3300048911 Ga0496108_0396427 Ga0496108_0396427_180_1037 264
697 3300048912 Ga0496109_0002224 Ga0496109_0002224_8933_9739 264
698 3300048912 Ga0496109_0056593 Ga0496109_0056593_1568_2362 264
699 3300048912 Ga0496109_0076390 Ga0496109_0076390_497_1291 264
700 3300048913 Ga0496110_0010509 Ga0496110_0010509_4427_5221 264
701 3300048913 Ga0496110_0031350 Ga0496110_0031350_2089_2883 264
702 3300048913 Ga0496110_0035179 Ga0496110_0035179_1757_2614 264
703 3300048913 Ga0496110_0055514 Ga0496110_0055514_1805_2611 264
704 3300048914 Ga0496111_0000632 Ga0496111_0000632_10272_11078 264
705 3300048914 Ga0496111_0002843 Ga0496111_0002843_874_1668 264
706 3300048914 Ga0496111_0133639 Ga0496111_0133639_760_1617 264
707 3300048915 Ga0496112_0006469 Ga0496112_0006469_8997_9803 264
708 3300048915 Ga0496112_0022644 Ga0496112_0022644_3001_3795 264
709 3300048915 Ga0496112_0194493 Ga0496112_0194493_379_1173 264
710 3300048916 Ga0496113_0019635 Ga0496113_0019635_2000_2806 264
711 3300048916 Ga0496113_0038585 Ga0496113_0038585_1188_1982 264
712 3300048916 Ga0496113_0615176 Ga0496113_0615176_45_845 264
713 3300048917 Ga0496114_0024665 Ga0496114_0024665_953_1747 264
714 3300048918 Ga0496115_0017174 Ga0496115_0017174_2269_3063 264
715 3300048918 Ga0496115_0026348 Ga0496115_0026348_572_1378 264
716 3300048918 Ga0496115_0147851 Ga0496115_0147851_718_1512 264
717 3300049570 Ga0501033_0109088 Ga0501033_0109088_1021_1830 264
718 3300049578 Ga0501042_0360836 Ga0501042_0360836_193_996 264
719 3300049584 Ga0501068_0000244 Ga0501068_0000244_19591_20388 264
720 3300049588 Ga0501072_0266491 Ga0501072_0266491_43_852 264
721 3300049588 Ga0501072_0503549 Ga0501072_0503549_34_831 264
722 3300049589 Ga0501073_0052916 Ga0501073_0052916_324_1121 264
723 3300049590 Ga0501074_0128084 Ga0501074_0128084_393_1202 264
724 3300049592 Ga0501076_0197740 Ga0501076_0197740_765_1574 264
725 3300049592 Ga0501076_0365851 Ga0501076_0365851_264_1061 264
726 3300049593 Ga0501077_0034253 Ga0501077_0034253_2299_3096 264
727 3300049593 Ga0501077_0095259 Ga0501077_0095259_337_1146 264
728 3300049741 Ga0501079_0147357 Ga0501079_0147357_194_991 264
729 3300049741 Ga0501079_0153959 Ga0501079_0153959_932_1741 264
730 3300049741 Ga0501079_0286682 Ga0501079_0286682_12_809 264
731 3300049742 Ga0501080_0021102 Ga0501080_0021102_820_1617 264
732 3300049743 Ga0501081_0039071 Ga0501081_0039071_847_1656 264
733 3300050489 nmdc:mga03683_114301_c1 nmdc:mga03683_114301_c1_71_865 264
734 3300050489 nmdc:mga03683_11651_c1 nmdc:mga03683_11651_c1_616_1410 264
735 3300050489 nmdc:mga03683_20812_c1 nmdc:mga03683_20812_c1_18_818 264
736 3300050489 nmdc:mga03683_46571_c1 nmdc:mga03683_46571_c1_754_1548 264
737 3300050490 nmdc:mga03n38_146331_c1 nmdc:mga03n38_146331_c1_75_869 264
738 3300050490 nmdc:mga03n38_20279_c2 nmdc:mga03n38_20279_c2_22_816 264
739 3300050490 nmdc:mga03n38_253858_c1 nmdc:mga03n38_253858_c1_99_896 264
740 3300050492 nmdc:mga0yw44_111122_c1 nmdc:mga0yw44_111122_c1_395_1189 264
741 3300050492 nmdc:mga0yw44_2536_c1 nmdc:mga0yw44_2536_c1_2521_3315 264
742 3300050492 nmdc:mga0yw44_397650_c1 nmdc:mga0yw44_397650_c1_80_874 264
743 3300050493 nmdc:mga0k408_109900_c1 nmdc:mga0k408_109900_c1_393_1187 264
744 3300050494 nmdc:mga06z11_110064_c1 nmdc:mga06z11_110064_c1_521_1315 264
745 3300050494 nmdc:mga06z11_45087_c1 nmdc:mga06z11_45087_c1_510_1310 264
746 3300050494 nmdc:mga06z11_51627_c1 nmdc:mga06z11_51627_c1_27_833 264
747 3300050496 nmdc:mga07m45_6280_c1 nmdc:mga07m45_6280_c1_1860_2660 264
748 3300050507 nmdc:mga05p37_140014_c1 nmdc:mga05p37_140014_c1_738_1535 264
749 3300050507 nmdc:mga05p37_219_c1 nmdc:mga05p37_219_c1_26831_27625 264
750 3300050507 nmdc:mga05p37_252833_c1 nmdc:mga05p37_252833_c1_625_1419 264
751 3300050507 nmdc:mga05p37_320244_c1 nmdc:mga05p37_320244_c1_711_1505 264
752 3300050507 nmdc:mga05p37_46651_c1 nmdc:mga05p37_46651_c1_1999_2805 264
753 3300050507 nmdc:mga05p37_616163_c1 nmdc:mga05p37_616163_c1_271_1068 264
754 3300050508 nmdc:mga09592_209948_c1 nmdc:mga09592_209948_c1_188_1045 264
755 3300050508 nmdc:mga09592_345531_c1 nmdc:mga09592_345531_c1_159_1016 264
756 3300050508 nmdc:mga09592_452_c1 nmdc:mga09592_452_c1_2618_3412 264
757 3300050508 nmdc:mga09592_49703_c1 nmdc:mga09592_49703_c1_2002_2799 264
758 3300050508 nmdc:mga09592_85436_c1 nmdc:mga09592_85436_c1_815_1609 264
759 3300050509 nmdc:mga0qj67_23009_c1 nmdc:mga0qj67_23009_c1_2944_3741 264
760 3300050509 nmdc:mga0qj67_310017_c1 nmdc:mga0qj67_310017_c1_137_931 264
761 3300050509 nmdc:mga0qj67_34_c1 nmdc:mga0qj67_34_c1_63589_64389 264
762 3300050509 nmdc:mga0qj67_396_c1 nmdc:mga0qj67_396_c1_2618_3412 264
763 3300050509 nmdc:mga0qj67_61731_c1 nmdc:mga0qj67_61731_c1_362_1159 264
764 3300050509 nmdc:mga0qj67_64703_c1 nmdc:mga0qj67_64703_c1_1849_2706 264
765 3300050509 nmdc:mga0qj67_76690_c1 nmdc:mga0qj67_76690_c1_1101_1895 264
766 3300050510 nmdc:mga06r32_138088_c1 nmdc:mga06r32_138088_c1_1193_1999 264
767 3300050510 nmdc:mga06r32_274_c1 nmdc:mga06r32_274_c1_18630_19424 264
768 3300050510 nmdc:mga06r32_473275_c1 nmdc:mga06r32_473275_c1_406_1200 264
769 3300050510 nmdc:mga06r32_5504_c1 nmdc:mga06r32_5504_c1_6118_6915 264
770 3300050510 nmdc:mga06r32_8399_c1 nmdc:mga06r32_8399_c1_2878_3693 264
771 3300050511 nmdc:mga08y16_15638_c1 nmdc:mga08y16_15638_c1_2456_3313 264
772 3300050511 nmdc:mga08y16_26695_c1 nmdc:mga08y16_26695_c1_2676_3470 264
773 3300050511 nmdc:mga08y16_289070_c1 nmdc:mga08y16_289070_c1_195_989 264
774 3300050512 nmdc:mga0n895_121069_c1 nmdc:mga0n895_121069_c1_314_1120 264
775 3300050512 nmdc:mga0n895_124_c1 nmdc:mga0n895_124_c1_26646_27440 264
776 3300050512 nmdc:mga0n895_244875_c1 nmdc:mga0n895_244875_c1_807_1601 264
777 3300050512 nmdc:mga0n895_313358_c1 nmdc:mga0n895_313358_c1_178_972 264
778 3300050512 nmdc:mga0n895_32234_c1 nmdc:mga0n895_32234_c1_722_1516 264
779 3300050512 nmdc:mga0n895_360822_c1 nmdc:mga0n895_360822_c1_359_1216 264
780 3300050513 nmdc:mga0rr50_33458_c1 nmdc:mga0rr50_33458_c1_2624_3418 264
781 3300050513 nmdc:mga0rr50_4689_c1 nmdc:mga0rr50_4689_c1_6101_6895 264
782 3300050514 nmdc:mga08x19_39035_c1 nmdc:mga08x19_39035_c1_1832_2626 264
783 3300050515 nmdc:mga0a205_166287_c1 nmdc:mga0a205_166287_c1_35_892 264
784 3300050515 nmdc:mga0a205_97_c1 nmdc:mga0a205_97_c1_26697_27491 264
785 3300050516 nmdc:mga0sz30_4555_c1 nmdc:mga0sz30_4555_c1_82_882 264
786 3300053084 Ga0495595_0119961 Ga0495595_0119961_262_1056 264
787 3300053084 Ga0495595_0223077 Ga0495595_0223077_16_810 264
788 3300053085 Ga0495619_0012914 Ga0495619_0012914_2456_3262 264
789 3300053085 Ga0495619_0105098 Ga0495619_0105098_159_953 264
790 3300053096 Ga0500641_0005846 Ga0500641_0005846_1896_2693 264
791 3300053134 Ga0500658_0052954 Ga0500658_0052954_100_894 264
792 3300053153 Ga0500616_0034917 Ga0500616_0034917_1382_2179 264
793 3300054114 Ga0501084_0002850 Ga0501084_0002850_12569_13366 264
794 3300054114 Ga0501084_0079048 Ga0501084_0079048_587_1396 264
795 3300060353 Ga0501082_0371908 Ga0501082_0371908_27_824 264
796 3300061734 Ga0530510_0027730 Ga0530510_0027730_2325_3134 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

28

175

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9313 5 223
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9308 5 225
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9231 3 225
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9202 5 229
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9184 5 227
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9733 4 251 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9615 4 251 3.40.50.300
af_P77737_9_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9378 4 211 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9348 5 243 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9347 2 226 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Z8P518-F1-model_v4 ABC transporter ATP-binding protein 0.9762 5 254 GO:0005524
GO:0016887
AF-A0A6A8AKN4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9647 1 191 GO:0005524
GO:0016887
AF-A0A2S8K3Z3-F1-model_v4 deleted 0.9607 34 188
AF-A0A6A8AKN4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9597 1 191 GO:0005524
GO:0016887
AF-F0Y1T7-F1-model_v4 ATPase AAA-type core domain-containing protein 0.9587 77 225 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359

Feature Viewer

pLDDT pTM Quality
93.09 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map