F481141

General Info

Members Datasets Scaffolds Average Seq Length
795 367 633 204

Family's Representative Sequence

Representative Sequence 3300030733|Ga0314311_1040412|Ga0314311_10404124
Length 228
Sequence MSAHTDPLYTSPFRLPLIAILRGITPGETLAHVQTLVDEDYDAIEIPLNSPDWADSIGAAARSFGDKAWIGGGTVLRERDVDALEALGARFIVTPNTRPELIRYAVNRGLRVVAGFATASEAFAAIDAGAQMLKLFPASVYGPDLIRALRAVLPPLPLFVVGGVNPATLHGYLSAGSTGAGIGGELYKPGQPVERTRDSARAFRQAYLEHASLKSSASSEKDSPESTS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
3 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
4 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
5 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
6 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
7 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
8 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
9 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
10 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
11 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
12 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
13 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
14 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
15 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
16 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
17 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
18 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
19 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
20 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
21 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
22 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
23 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
24 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
25 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
26 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
27 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
28 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
29 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
30 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
31 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
32 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
33 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
34 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
35 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
36 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
37 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
38 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
39 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
40 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
41 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
42 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
43 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
44 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
45 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
46 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
47 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
48 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
49 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
50 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
51 2636415599 Klebsiella variicola DX120E Isolate Unclassified
52 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
53 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
54 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
55 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
56 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
57 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
58 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
59 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
60 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
61 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
62 2734482264 Dyella sp. AD052 Isolate Unclassified
63 2738543009 Luteibacter sp. OK325 Isolate Unclassified
64 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
65 2751185917 Enterobacter sp. HK169 Isolate Unclassified
66 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
67 2775507074 Klebsiella sp. D5A Isolate Unclassified
68 2818991457 Xanthomonas translucens 569 Isolate Unclassified
69 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
70 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
71 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
72 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
73 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
74 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
75 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
76 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
77 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
78 2876601092 Pantoea endophytica 596 Isolate Unclassified
79 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
80 2885266251 Ralstonia sp. SET104 Isolate Nodule
81 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
82 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
83 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
84 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
85 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
86 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
87 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
88 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
89 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
90 2919085039 Luteibacter sp. 1214 Isolate Unclassified
91 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
92 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
93 2919150387 Rahnella aceris 1817 Isolate Unclassified
94 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
95 2927143783 Rahnella sp. 2050 Isolate Unclassified
96 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
97 2928058823 Ralstonia sp. 1138 Isolate Unclassified
98 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
99 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
100 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
101 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
102 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
103 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
104 2941471342 Luteibacter sp. 621 Isolate Unclassified
105 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
106 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
107 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
108 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
109 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
110 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
111 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
112 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
113 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
114 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
115 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
116 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
117 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
118 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
119 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
120 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
121 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
122 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
123 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
124 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
125 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
126 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
127 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
128 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
129 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
130 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
131 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
132 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
133 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
134 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
135 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
136 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
137 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
138 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
139 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
140 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
141 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
142 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
143 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
144 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
145 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
146 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
147 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
148 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
149 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
150 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
151 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
152 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
153 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
154 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
155 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
156 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
157 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
158 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
159 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
160 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
161 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
164 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
168 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
169 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
172 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
173 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
176 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
177 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
178 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
179 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
182 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
190 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
191 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
193 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
194 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
195 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
198 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
199 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
200 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
203 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
223 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
227 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
228 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
229 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
241 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
242 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
243 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
244 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
245 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
246 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
247 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
248 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
249 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
252 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
253 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
254 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
255 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
256 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
257 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
258 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
259 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
264 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
274 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
290 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
305 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
328 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
331 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
332 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
333 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
336 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
337 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
338 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
339 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
340 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
341 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
342 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
343 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
344 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
345 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
346 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
347 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
348 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
351 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
352 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
353 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 640753048 Serratia proteamaculans 568 Isolate Endosphere
356 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
357 8018221730 Enterobacter sp. CM29 Isolate Unclassified
358 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
359 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
360 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
361 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
362 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
363 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
364 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
365 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
366 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
367 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.5
Metatranscriptomes 0.13
Isolates 20.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 11.95
Nodule 2.77
Rhizoplane 12.96
Rhizosphere 46.29
Stem 0
Stem Tuber 0.63
Unclassified 25.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1953027 2162886007 Bacteria 1775
2 SwRhRL2b_contig_2120134 2162886007 Bacteria 1670
3 SwRhRL2b_contig_297839 2162886007 Bacteria 3654
4 JGI24736J21556_1000142 3300001904 Bacteria 12439
5 JGI24741J21665_1000408 3300001915 Bacteria 12965
6 JGI24740J21852_10001196 3300001979 Bacteria 11704
7 JGI24740J21852_10003713 3300001979 Bacteria 6645
8 JGI24738J21930_10000022 3300002075 Bacteria 29505
9 JGI25156J39149_1007428 3300002705 Bacteria 2880
10 JGI25156J39149_1008238 3300002705 Bacteria 2644
11 JGI25156J39149_1010668 3300002705 Bacteria 2141
12 JGI25162J39368_1000441 3300002737 Bacteria 33362
13 JGI25162J39368_1002136 3300002737 Bacteria 8327
14 JGI25154J39366_1000508 3300002738 Bacteria 19845
15 JGI25163J39215_1000118 3300002771 Bacteria 33381
16 JGI25164J39214_1000302 3300002772 Bacteria 33358
17 JGI25152J39213_1000138 3300002773 Bacteria 50113
18 JGI25150J39212_1000280 3300002774 Bacteria 26822
19 JGI25151J46595_10000207 3300003187 Bacteria 71940
20 JGI25153J46596_10000146 3300003215 Bacteria 71940
21 JGI25153J46596_10001144 3300003215 Bacteria 16045
22 rootH2_10035727 3300003320 Bacteria 32574
23 Ga0055538_1000217 3300003751 Bacteria 33362
24 Ga0055538_1002216 3300003751 Bacteria 3003
25 Ga0055538_1002256 3300003751 Bacteria 2951
26 Ga0055539_1000259 3300003752 Bacteria 33362
27 Ga0055539_1000443 3300003752 Bacteria 14387
28 Ga0055533_1000250 3300003756 Bacteria 33362
29 Ga0055533_1001778 3300003756 Bacteria 5458
30 Ga0055533_1003288 3300003756 Bacteria 3301
31 Ga0055533_1003737 3300003756 Bacteria 2954
32 Ga0055532_1000008 3300003758 Bacteria 404753
33 Ga0055525_1000347 3300003759 Bacteria 33362
34 Ga0055525_1000500 3300003759 Bacteria 19694
35 Ga0055535_1000006 3300003761 Bacteria 404753
36 Ga0055542_1001574 3300003762 Bacteria 10636
37 Ga0055542_1001803 3300003762 Bacteria 8864
38 Ga0055529_1000025 3300003763 Bacteria 304757
39 Ga0055541_1000156 3300003841 Bacteria 33362
40 Ga0055541_1003489 3300003841 Bacteria 2954
41 Ga0058692_1000122 3300003856 Bacteria 50557
42 Ga0058692_1001369 3300003856 Bacteria 9036
43 Ga0058692_1036824 3300003856 Bacteria 883
44 Ga0058692_1047794 3300003856 Bacteria 721
45 Ga0058692_1047821 3300003856 Bacteria 721
46 Ga0065703_1018795 3300005272 Bacteria 7755
47 Ga0065704_10000581 3300005289 Bacteria 28087
48 Ga0065704_10002543 3300005289 Bacteria 5889
49 Ga0065704_10002719 3300005289 Bacteria 4795
50 Ga0065704_10003831 3300005289 Bacteria 13528
51 Ga0065704_10005470 3300005289 Bacteria 3537
52 Ga0065704_10071016 3300005289 Bacteria 13755
53 Ga0070670_100013647 3300005331 Bacteria 6963
54 Ga0070670_100848595 3300005331 Bacteria 826
55 Ga0070682_100139932 3300005337 Bacteria 1648
56 Ga0070660_100172769 3300005339 Bacteria 1746
57 Ga0070661_100000417 3300005344 Bacteria 32723
58 Ga0070661_100012002 3300005344 Bacteria 6053
59 Ga0070659_100014802 3300005366 Bacteria 5832
60 Ga0070709_10540451 3300005434 Bacteria 890
61 Ga0070663_100000035 3300005455 Bacteria 66161
62 Ga0068853_100070789 3300005539 Bacteria 3036
63 Ga0070665_100000160 3300005548 Bacteria 122425
64 Ga0070665_100016979 3300005548 Bacteria 7297
65 Ga0070665_100174268 3300005548 Bacteria 2152
66 Ga0070664_100000001 3300005564 Bacteria 551832
67 Ga0068857_100000013 3300005577 Bacteria 105599
68 Ga0068854_100000060 3300005578 Bacteria 80591
69 Ga0068856_100002389 3300005614 Bacteria 19317
70 Ga0068852_100289129 3300005616 Bacteria 1583
71 Ga0068851_10512842 3300005834 Bacteria 720
72 Ga0075364_10000771 3300006051 Bacteria 16831
73 Ga0075364_10011667 3300006051 Bacteria 5344
74 Ga0075364_10120262 3300006051 Bacteria 1758
75 Ga0075366_10128116 3300006195 Bacteria 1531
76 Ga0075366_10279518 3300006195 Bacteria 1020
77 Ga0075370_10020928 3300006353 Bacteria 3581
78 Ga0079104_1000036 3300006946 Bacteria 194741
79 Ga0079104_1000122 3300006946 Bacteria 111219
80 Ga0079104_1000203 3300006946 Bacteria 83190
81 Ga0079104_1000437 3300006946 Bacteria 47476
82 Ga0079104_1001827 3300006946 Bacteria 13090
83 Ga0079104_1002423 3300006946 Bacteria 10072
84 Ga0079104_1002630 3300006946 Bacteria 9381
85 Ga0079104_1004312 3300006946 Bacteria 6154
86 Ga0079104_1005598 3300006946 Bacteria 4976
87 Ga0079104_1011891 3300006946 Bacteria 2768
88 Ga0105251_10000277 3300009011 Bacteria 51445
89 Ga0105251_10000340 3300009011 Bacteria 46427
90 Ga0105251_10000396 3300009011 Bacteria 42564
91 Ga0105251_10001409 3300009011 Bacteria 20711
92 Ga0105251_10003581 3300009011 Bacteria 11191
93 Ga0105251_10004348 3300009011 Bacteria 9691
94 Ga0105251_10025676 3300009011 Bacteria 3009
95 Ga0105251_10040584 3300009011 Bacteria 2269
96 Ga0105244_10000026 3300009036 Bacteria 216056
97 Ga0105244_10001959 3300009036 Bacteria 15960
98 Ga0105244_10002307 3300009036 Bacteria 14498
99 Ga0105244_10003041 3300009036 Bacteria 12310
100 Ga0105244_10004064 3300009036 Bacteria 10211
101 Ga0105244_10010955 3300009036 Bacteria 5468
102 Ga0105244_10021983 3300009036 Bacteria 3517
103 Ga0105244_10112146 3300009036 Bacteria 1326
104 Ga0105244_10125555 3300009036 Bacteria 1240
105 Ga0105244_10324307 3300009036 Bacteria 711
106 Ga0105250_10000855 3300009092 Bacteria 17996
107 Ga0105250_10003442 3300009092 Bacteria 7498
108 Ga0105250_10007232 3300009092 Bacteria 4780
109 Ga0105250_10023228 3300009092 Bacteria 2499
110 Ga0105250_10129823 3300009092 Bacteria 1040
111 Ga0105240_10044181 3300009093 Bacteria 5665
112 Ga0105240_10074091 3300009093 Bacteria 4203
113 Ga0105240_10451012 3300009093 Bacteria 1439
114 Ga0105240_10602298 3300009093 Bacteria 1210
115 Ga0105247_10002519 3300009101 Bacteria 12448
116 Ga0105243_10000259 3300009148 Bacteria 60174
117 Ga0105243_10049069 3300009148 Bacteria 3329
118 Ga0105243_11461781 3300009148 Bacteria 706
119 Ga0105237_10000774 3300009545 Bacteria 43726
120 Ga0105237_10284518 3300009545 Bacteria 1656
121 Ga0105238_10004980 3300009551 Bacteria 13136
122 Ga0105239_10000644 3300010375 Bacteria 49525
123 Ga0105239_10005758 3300010375 Bacteria 14456
124 Ga0105239_10123537 3300010375 Bacteria 2876
125 Ga0105246_10035707 3300011119 Bacteria 3324
126 Ga0157373_10000646 3300013100 Bacteria 27422
127 Ga0157373_10002943 3300013100 Bacteria 12904
128 Ga0157371_10000404 3300013102 Bacteria 54021
129 Ga0157371_10001363 3300013102 Bacteria 25629
130 Ga0157371_10005803 3300013102 Bacteria 10332
131 Ga0157371_10016673 3300013102 Bacteria 5475
132 Ga0157371_10029511 3300013102 Bacteria 3964
133 Ga0157371_10091166 3300013102 Bacteria 2159
134 Ga0157370_10001790 3300013104 Bacteria 26488
135 Ga0157370_10006219 3300013104 Bacteria 13227
136 Ga0157370_10007229 3300013104 Bacteria 12116
137 Ga0157369_10004570 3300013105 Bacteria 16272
138 Ga0157369_10005312 3300013105 Bacteria 15012
139 Ga0157369_10005563 3300013105 Bacteria 14629
140 Ga0157369_10036912 3300013105 Bacteria 5352
141 Ga0157372_10000062 3300013307 Bacteria 119721
142 Ga0157372_10006644 3300013307 Bacteria 12308
143 Ga0157372_10030390 3300013307 Bacteria 5911
144 Ga0157372_10040945 3300013307 Bacteria 5120
145 Ga0182008_10000147 3300014497 Bacteria 54639
146 Ga0182008_10018593 3300014497 Bacteria 3597
147 Ga0182008_10286360 3300014497 Bacteria 859
148 Ga0182006_1000058 3300015261 Bacteria 167164
149 Ga0182006_1006900 3300015261 Bacteria 5234
150 Ga0182006_1010041 3300015261 Bacteria 4222
151 Ga0182007_10003715 3300015262 Bacteria 7132
152 Ga0182007_10050023 3300015262 Bacteria 1380
153 Ga0182005_1000015 3300015265 Bacteria 387565
154 Ga0182005_1006809 3300015265 Bacteria 3462
155 Ga0182005_1017808 3300015265 Bacteria 1965
156 Ga0183366_1004 3300015679 Bacteria 252597
157 Ga0183370_1004 3300015680 Bacteria 252597
158 Ga0183369_1010 3300015685 Bacteria 252581
159 Ga0183368_1008 3300015687 Bacteria 252581
160 Ga0163161_10045481 3300017792 Bacteria 3166
161 Ga0213876_10000049 3300021384 Bacteria 145629
162 Ga0209760_100179 3300025207 Bacteria 33431
163 Ga0209784_100001 3300025224 Bacteria 3600592
164 Ga0209784_100063 3300025224 Bacteria 159576
165 Ga0209784_101473 3300025224 Bacteria 3091
166 Ga0209566_100001 3300025225 Bacteria 3600765
167 Ga0209566_100048 3300025225 Bacteria 241570
168 Ga0209566_102021 3300025225 Bacteria 4270
169 Ga0209566_102596 3300025225 Bacteria 3221
170 Ga0209674_100002 3300025226 Bacteria 3600592
171 Ga0209674_100071 3300025226 Bacteria 241568
172 Ga0209674_100868 3300025226 Bacteria 9873
173 Ga0209674_102214 3300025226 Bacteria 4314
174 Ga0209674_103236 3300025226 Bacteria 3069
175 Ga0209672_100199 3300025228 Bacteria 47771
176 Ga0209672_100339 3300025228 Bacteria 30154
177 Ga0209147_100002 3300025229 Bacteria 2158988
178 Ga0209563_100002 3300025230 Bacteria 2045675
179 Ga0209563_100085 3300025230 Bacteria 186579
180 Ga0209563_110025 3300025230 Bacteria 1406
181 Ga0207427_100032 3300025231 Bacteria 349939
182 Ga0209437_100001 3300025233 Bacteria 2045675
183 Ga0209437_100092 3300025233 Bacteria 240044
184 Ga0209437_100597 3300025233 Bacteria 22628
185 Ga0209258_100002 3300025242 Bacteria 2158988
186 Ga0207425_1000011 3300025245 Bacteria 550735
187 Ga0207425_1005801 3300025245 Bacteria 3470
188 Ga0209646_1000035 3300025246 Bacteria 363209
189 Ga0209026_1004937 3300025250 Bacteria 3756
190 Ga0209677_100002 3300025253 Bacteria 2045675
191 Ga0209677_100040 3300025253 Bacteria 241568
192 Ga0209148_1000077 3300025254 Bacteria 298133
193 Ga0209148_1001986 3300025254 Bacteria 8110
194 Ga0209759_1002426 3300025256 Bacteria 8172
195 Ga0209759_1002601 3300025256 Bacteria 7784
196 Ga0209759_1009418 3300025256 Bacteria 2954
197 Ga0209129_1000021 3300025258 Bacteria 445018
198 Ga0209129_1000273 3300025258 Bacteria 50169
199 Ga0209233_1001959 3300025261 Bacteria 7829
200 Ga0209455_1000009 3300025272 Bacteria 1042273
201 Ga0209025_1000054 3300025294 Bacteria 317002
202 Ga0209758_1000062 3300025297 Bacteria 317002
203 Ga0209758_1000124 3300025297 Bacteria 189933
204 Ga0207696_1000202 3300025711 Bacteria 91342
205 Ga0207696_1000949 3300025711 Bacteria 17703
206 Ga0207696_1002169 3300025711 Bacteria 9843
207 Ga0207696_1007432 3300025711 Bacteria 4291
208 Ga0207696_1068022 3300025711 Bacteria 993
209 Ga0207655_1000057 3300025728 Bacteria 273598
210 Ga0207655_1000067 3300025728 Bacteria 245484
211 Ga0207655_1000111 3300025728 Bacteria 170772
212 Ga0207655_1000122 3300025728 Bacteria 154848
213 Ga0207655_1000218 3300025728 Bacteria 98543
214 Ga0207655_1001050 3300025728 Bacteria 27637
215 Ga0207655_1002313 3300025728 Bacteria 15653
216 Ga0207655_1004581 3300025728 Bacteria 9736
217 Ga0207655_1005717 3300025728 Bacteria 8399
218 Ga0207655_1017144 3300025728 Bacteria 3919
219 Ga0207655_1073276 3300025728 Bacteria 1264
220 Ga0207713_1000136 3300025735 Bacteria 112016
221 Ga0207713_1000184 3300025735 Bacteria 88768
222 Ga0207713_1000636 3300025735 Bacteria 34132
223 Ga0207713_1000748 3300025735 Bacteria 30270
224 Ga0207713_1001628 3300025735 Bacteria 17520
225 Ga0207713_1002034 3300025735 Bacteria 15140
226 Ga0207713_1002094 3300025735 Bacteria 14894
227 Ga0207713_1004241 3300025735 Bacteria 9366
228 Ga0207713_1019257 3300025735 Bacteria 3346
229 Ga0207713_1022160 3300025735 Bacteria 3023
230 Ga0207713_1055433 3300025735 Bacteria 1547
231 Ga0207713_1108535 3300025735 Bacteria 947
232 Ga0207713_1167184 3300025735 Bacteria 696
233 Ga0207710_10006699 3300025900 Bacteria 4910
234 Ga0207699_10275255 3300025906 Bacteria 1168
235 Ga0207695_10029467 3300025913 Bacteria 6063
236 Ga0207695_10315359 3300025913 Bacteria 1453
237 Ga0207695_10462880 3300025913 Bacteria 1151
238 Ga0207671_10106400 3300025914 Bacteria 2130
239 Ga0207649_10000390 3300025920 Bacteria 32941
240 Ga0207649_10016527 3300025920 Bacteria 4165
241 Ga0207694_10026503 3300025924 Bacteria 4410
242 Ga0207650_10005141 3300025925 Bacteria 8932
243 Ga0207650_10299112 3300025925 Bacteria 1314
244 Ga0207690_10008873 3300025932 Bacteria 5968
245 Ga0207709_10000289 3300025935 Bacteria 57229
246 Ga0207709_10025625 3300025935 Bacteria 3378
247 Ga0207709_10175268 3300025935 Bacteria 1509
248 Ga0207679_10000003 3300025945 Bacteria 597553
249 Ga0207668_10178236 3300025972 Bacteria 1674
250 Ga0207640_10000071 3300025981 Bacteria 80591
251 Ga0207639_10013416 3300026041 Bacteria 5736
252 Ga0207678_10000175 3300026067 Bacteria 54512
253 Ga0207702_10000110 3300026078 Bacteria 95353
254 Ga0207674_10000071 3300026116 Bacteria 105678
255 Ga0207674_10011098 3300026116 Bacteria 10131
256 Ga0209281_1000031 3300027111 Bacteria 422772
257 Ga0209281_1000080 3300027111 Bacteria 261394
258 Ga0209281_1000086 3300027111 Bacteria 250986
259 Ga0209281_1000117 3300027111 Bacteria 209272
260 Ga0209281_1000206 3300027111 Bacteria 133510
261 Ga0209281_1000261 3300027111 Bacteria 101694
262 Ga0209281_1000338 3300027111 Bacteria 79936
263 Ga0209281_1001242 3300027111 Bacteria 16718
264 Ga0209281_1001877 3300027111 Bacteria 10098
265 Ga0209281_1002414 3300027111 Bacteria 7565
266 Ga0209281_1006922 3300027111 Bacteria 2887
267 Ga0209371_1000005 3300027312 Bacteria 1061740
268 Ga0209371_1000016 3300027312 Bacteria 646301
269 Ga0209371_1000029 3300027312 Bacteria 424797
270 Ga0209371_1000042 3300027312 Bacteria 333147
271 Ga0209371_1000133 3300027312 Bacteria 122145
272 Ga0209371_1000257 3300027312 Bacteria 64352
273 Ga0209371_1001693 3300027312 Bacteria 13989
274 Ga0209371_1002593 3300027312 Bacteria 9935
275 Ga0209371_1003013 3300027312 Bacteria 8707
276 Ga0209371_1003174 3300027312 Bacteria 8314
277 Ga0209371_1006640 3300027312 Bacteria 4232
278 Ga0209371_1007062 3300027312 Bacteria 3999
279 Ga0209371_1011434 3300027312 Bacteria 2636
280 Ga0268266_10000129 3300028379 Bacteria 148215
281 Ga0265338_10000325 3300028800 Bacteria 86856
282 Ga0268256_1000006 3300030500 Bacteria 1063991
283 Ga0268256_1000015 3300030500 Bacteria 646300
284 Ga0268256_1000032 3300030500 Bacteria 424603
285 Ga0268256_1000042 3300030500 Bacteria 333815
286 Ga0268256_1000262 3300030500 Bacteria 55825
287 Ga0268256_1001353 3300030500 Bacteria 14953
288 Ga0268256_1001716 3300030500 Bacteria 12466
289 Ga0268256_1001932 3300030500 Bacteria 11354
290 Ga0268256_1004434 3300030500 Bacteria 5821
291 Ga0268256_1008802 3300030500 Bacteria 3426
292 Ga0268256_1015762 3300030500 Bacteria 2192
293 Ga0268256_1016889 3300030500 Bacteria 2074
294 Ga0314311_1040412 3300030733 Bacteria 3597
295 Ga0316180_1107520 3300030736 Bacteria 1040
296 Ga0307513_10001608 3300031456 Bacteria 32435
297 Ga0307513_10260736 3300031456 Bacteria 1523
298 Ga0307408_100537304 3300031548 Bacteria 1029
299 Ga0307516_10000839 3300031730 Bacteria 42125
300 Ga0307516_10021192 3300031730 Bacteria 6697
301 Ga0307413_10169599 3300031824 Bacteria 1543
302 Ga0307416_100403429 3300032002 Bacteria 1405
303 Ga0307414_10054579 3300032004 Bacteria 2793
304 Ga0307411_10215567 3300032005 Bacteria 1485
305 Ga0307411_10471575 3300032005 Bacteria 1055
306 Ga0395900_0051003 3300037418 Bacteria 4262
307 Ga0237819_00016 3300038705 Bacteria 57788
308 Ga0436365_0245969 3300039437 Bacteria 378821
309 Ga0436361_0306735 3300039447 Bacteria 992
310 Ga0439436_0021044 3300041404 Bacteria 1941
311 Ga0439438_001391 3300041405 Bacteria 10661
312 Ga0439461_0049857 3300041410 Bacteria 926
313 Ga0439465_0000100 3300041413 Bacteria 19698
314 Ga0439465_0001284 3300041413 Bacteria 8075
315 Ga0451791_0636960 3300041451 Bacteria 1586
316 Ga0451795_0318373 3300041456 Bacteria 2184
317 Ga0451795_1430113 3300041456 Bacteria 1410
318 Ga0451800_0059861 3300041459 Bacteria 12136
319 Ga0451802_0930997 3300041460 Bacteria 1582
320 Ga0451807_1140708 3300041486 Bacteria 1058
321 Ga0451807_1201342 3300041486 Bacteria 2974
322 Ga0451807_1442420 3300041486 Bacteria 902
323 Ga0451843_0176899 3300041509 Bacteria 1131
324 Ga0451843_0192670 3300041509 Bacteria 1276
325 Ga0451843_0790152 3300041509 Bacteria 1545
326 Ga0451853_1122400 3300041512 Bacteria 2558
327 Ga0439432_002208 3300042006 Bacteria 7351
328 Ga0439449_0000021 3300042007 Bacteria 46082
329 Ga0439449_0007292 3300042007 Bacteria 4203
330 Ga0439449_0182974 3300042007 Bacteria 783
331 Ga0439452_000012 3300042010 Bacteria 412478
332 Ga0439452_000076 3300042010 Bacteria 87445
333 Ga0439452_000494 3300042010 Bacteria 21620
334 Ga0439452_003672 3300042010 Bacteria 5319
335 Ga0439462_0013083 3300042015 Bacteria 2126
336 Ga0450919_001638 3300042121 Bacteria 2935
337 Ga0450908_000002 3300042184 Bacteria 94473
338 Ga0439434_0117050 3300042435 Bacteria 867
339 Ga0439464_0015981 3300042439 Bacteria 2028
340 Ga0439464_0038068 3300042439 Bacteria 1366
341 Ga0450918_000309 3300042531 Bacteria 10941
342 Ga0451577_0539157 3300042876 Bacteria 1059
343 Ga0466986_0149237 3300044650 Bacteria 1579
344 Ga0466972_0015030 3300044658 Bacteria 3870
345 Ga0466981_0000020 3300044669 Bacteria 87281
346 Ga0466982_0265244 3300044672 Bacteria 997
347 Ga0466961_0004626 3300044693 Bacteria 8635
348 Ga0466968_0005600 3300044735 Bacteria 4703
349 Ga0466968_0007269 3300044735 Bacteria 4208
350 Ga0466970_0180750 3300044765 Bacteria 1170
351 Ga0466959_0137677 3300045049 Bacteria 1727
352 Ga0451576_0366245 3300045051 Bacteria 1510
353 Ga0466967_0241181 3300045976 Bacteria 1724
354 Ga0495617_002601 3300046452 Bacteria 7082
355 Ga0495627_042627 3300046453 Bacteria 1390
356 Ga0495627_111572 3300046453 Bacteria 776
357 Ga0495590_0039164 3300046457 Bacteria 1653
358 Ga0495591_000095 3300046458 Bacteria 100685
359 Ga0495591_000126 3300046458 Bacteria 83383
360 Ga0495591_022272 3300046458 Bacteria 2051
361 Ga0495638_0000089 3300046460 Bacteria 151067
362 Ga0495638_0019681 3300046460 Bacteria 4464
363 Ga0495638_0095170 3300046460 Bacteria 1789
364 Ga0495638_0212032 3300046460 Bacteria 1087
365 Ga0495650_0000094 3300046471 Bacteria 219056
366 Ga0495650_0000126 3300046471 Bacteria 178143
367 Ga0495650_0003963 3300046471 Bacteria 10407
368 Ga0495650_0019712 3300046471 Bacteria 3309
369 Ga0495650_0108513 3300046471 Bacteria 1033
370 Ga0495584_0012741 3300046491 Bacteria 4292
371 Ga0495585_0000430 3300046492 Bacteria 40270
372 Ga0495585_0005856 3300046492 Bacteria 7706
373 Ga0495596_0032191 3300046500 Bacteria 2091
374 Ga0495607_0000020 3300046501 Bacteria 164851
375 Ga0495607_0000228 3300046501 Bacteria 59878
376 Ga0495607_0026575 3300046501 Bacteria 3591
377 Ga0495607_0082615 3300046501 Bacteria 1762
378 Ga0495606_0001334 3300046507 Bacteria 33605
379 Ga0495606_0126507 3300046507 Bacteria 1523
380 Ga0495610_0001340 3300046512 Bacteria 21851
381 Ga0495610_0016688 3300046512 Bacteria 4216
382 Ga0495616_0000345 3300046513 Bacteria 36848
383 Ga0495616_0001053 3300046513 Bacteria 19712
384 Ga0495616_0025941 3300046513 Bacteria 3125
385 Ga0495620_0001761 3300046515 Bacteria 12736
386 Ga0495620_0004456 3300046515 Bacteria 7889
387 Ga0495620_0107556 3300046515 Bacteria 1107
388 Ga0495631_0001487 3300046518 Bacteria 14186
389 Ga0495631_0003169 3300046518 Bacteria 9048
390 Ga0495632_0000005 3300046519 Bacteria 362872
391 Ga0495632_0016225 3300046519 Bacteria 4150
392 Ga0495632_0041863 3300046519 Bacteria 2299
393 Ga0495632_0047690 3300046519 Bacteria 2124
394 Ga0495643_0066981 3300046522 Bacteria 1893
395 Ga0495648_0000506 3300046524 Bacteria 41982
396 Ga0495648_0003625 3300046524 Bacteria 13516
397 Ga0495663_0000528 3300046525 Bacteria 13699
398 Ga0495663_0127359 3300046525 Bacteria 856
399 Ga0495654_0000072 3300046530 Bacteria 115797
400 Ga0495654_0002518 3300046530 Bacteria 11773
401 Ga0495654_0007878 3300046530 Bacteria 5924
402 Ga0495654_0064590 3300046530 Bacteria 1749
403 Ga0495609_0004462 3300046538 Bacteria 7651
404 Ga0495597_0277284 3300046542 Bacteria 654
405 Ga0495633_0007264 3300046558 Bacteria 6409
406 Ga0495668_0011531 3300046616 Bacteria 5290
407 Ga0495668_0031901 3300046616 Bacteria 2967
408 Ga0495611_0000005 3300046648 Bacteria 284271
409 Ga0495611_0000039 3300046648 Bacteria 100068
410 Ga0495625_0000066 3300046660 Bacteria 172144
411 Ga0495625_0013019 3300046660 Bacteria 6708
412 Ga0495661_0002922 3300046665 Bacteria 12925
413 Ga0495670_0002223 3300046691 Bacteria 9590
414 Ga0495670_0003498 3300046691 Bacteria 7710
415 Ga0495671_0000247 3300046692 Bacteria 46575
416 Ga0495671_0005011 3300046692 Bacteria 7801
417 Ga0495671_0056656 3300046692 Bacteria 1940
418 Ga0495671_0065449 3300046692 Bacteria 1789
419 Ga0495649_0004130 3300046694 Bacteria 9537
420 Ga0495589_0000026 3300046794 Bacteria 184723
421 Ga0495589_0000076 3300046794 Bacteria 91288
422 Ga0495589_0035865 3300046794 Bacteria 2486
423 Ga0495660_0000028 3300046810 Bacteria 244534
424 Ga0495660_0000051 3300046810 Bacteria 138590
425 Ga0495660_0000605 3300046810 Bacteria 28275
426 Ga0495660_0000748 3300046810 Bacteria 24559
427 Ga0495660_0024891 3300046810 Bacteria 3404
428 Ga0495672_0000011 3300047320 Bacteria 535362
429 Ga0495672_0000039 3300047320 Bacteria 272506
430 Ga0495683_0006874 3300047323 Bacteria 6182
431 Ga0495683_0044546 3300047323 Bacteria 2231
432 Ga0495679_000010 3300047446 Bacteria 337760
433 Ga0495679_000016 3300047446 Bacteria 282024
434 Ga0495673_0000038 3300047469 Bacteria 303785
435 Ga0495673_0000045 3300047469 Bacteria 280765
436 Ga0495673_0000137 3300047469 Bacteria 134484
437 Ga0495673_0004237 3300047469 Bacteria 9052
438 Ga0495686_0000050 3300047472 Bacteria 269010
439 Ga0495686_0000297 3300047472 Bacteria 85762
440 Ga0495686_0010944 3300047472 Bacteria 6422
441 Ga0495686_0014214 3300047472 Bacteria 5487
442 Ga0496100_0124828 3300048903 Bacteria 1805
443 Ga0496101_0000063 3300048904 Bacteria 125670
444 Ga0496101_0045517 3300048904 Bacteria 3143
445 Ga0496102_0001073 3300048905 Bacteria 25277
446 Ga0496103_0020776 3300048906 Bacteria 3947
447 Ga0496104_0010348 3300048907 Bacteria 8330
448 Ga0496104_0022124 3300048907 Bacteria 5842
449 Ga0496104_0022787 3300048907 Bacteria 5753
450 Ga0496105_0082514 3300048908 Bacteria 2655
451 Ga0496105_0229458 3300048908 Bacteria 1509
452 Ga0496106_0000097 3300048909 Bacteria 66262
453 Ga0496106_0113043 3300048909 Bacteria 2116
454 Ga0496106_0261754 3300048909 Bacteria 1384
455 Ga0496107_0317150 3300048910 Bacteria 1160
456 Ga0496116_0000147 3300048919 Bacteria 142463
457 Ga0496116_0001013 3300048919 Bacteria 34257
458 Ga0496116_0001377 3300048919 Bacteria 27467
459 Ga0496116_0019647 3300048919 Bacteria 5164
460 Ga0496116_0032380 3300048919 Bacteria 3726
461 Ga0496116_0036256 3300048919 Bacteria 3453
462 Ga0496116_0041384 3300048919 Bacteria 3161
463 Ga0496116_0078490 3300048919 Bacteria 2058
464 Ga0496116_0127098 3300048919 Bacteria 1462
465 Ga0496116_0213427 3300048919 Bacteria 997
466 Ga0496117_0000306 3300048920 Bacteria 85642
467 Ga0496117_0000798 3300048920 Bacteria 49089
468 Ga0496117_0002498 3300048920 Bacteria 23080
469 Ga0496117_0009407 3300048920 Bacteria 9095
470 Ga0496117_0009676 3300048920 Bacteria 8918
471 Ga0496117_0015996 3300048920 Bacteria 6355
472 Ga0496117_0017021 3300048920 Bacteria 6088
473 Ga0496117_0025420 3300048920 Bacteria 4657
474 Ga0496117_0035095 3300048920 Bacteria 3769
475 Ga0496117_0043737 3300048920 Bacteria 3252
476 Ga0496117_0065767 3300048920 Bacteria 2462
477 Ga0496117_0079731 3300048920 Bacteria 2156
478 Ga0496117_0087910 3300048920 Bacteria 2012
479 Ga0496118_0000384 3300048921 Bacteria 74482
480 Ga0496118_0001315 3300048921 Bacteria 37765
481 Ga0496118_0001557 3300048921 Bacteria 34088
482 Ga0496118_0002666 3300048921 Bacteria 23595
483 Ga0496118_0017113 3300048921 Bacteria 6617
484 Ga0496118_0017872 3300048921 Bacteria 6433
485 Ga0496118_0018201 3300048921 Bacteria 6346
486 Ga0496118_0030651 3300048921 Bacteria 4481
487 Ga0496118_0032601 3300048921 Bacteria 4287
488 Ga0496118_0044303 3300048921 Bacteria 3485
489 Ga0496118_0051567 3300048921 Bacteria 3146
490 Ga0496118_0069764 3300048921 Bacteria 2543
491 Ga0496118_0072403 3300048921 Bacteria 2475
492 Ga0496118_0082285 3300048921 Bacteria 2256
493 Ga0496118_0091993 3300048921 Bacteria 2083
494 Ga0496118_0101033 3300048921 Bacteria 1949
495 Ga0496118_0141389 3300048921 Bacteria 1525
496 Ga0496118_0156753 3300048921 Bacteria 1415
497 Ga0496118_0294635 3300048921 Bacteria 894
498 Ga0496118_0339382 3300048921 Bacteria 806
499 Ga0496119_0000105 3300048922 Bacteria 119993
500 Ga0496119_0000606 3300048922 Bacteria 48440
501 Ga0496119_0000942 3300048922 Bacteria 37503
502 Ga0496119_0001682 3300048922 Bacteria 25855
503 Ga0496119_0003515 3300048922 Bacteria 16199
504 Ga0496119_0003913 3300048922 Bacteria 15134
505 Ga0496119_0007592 3300048922 Bacteria 9729
506 Ga0496119_0013225 3300048922 Bacteria 6597
507 Ga0496119_0014214 3300048922 Bacteria 6253
508 Ga0496119_0016199 3300048922 Bacteria 5693
509 Ga0496119_0017141 3300048922 Bacteria 5469
510 Ga0496119_0048063 3300048922 Bacteria 2649
511 Ga0496119_0051570 3300048922 Bacteria 2527
512 Ga0496119_0076576 3300048922 Bacteria 1940
513 Ga0496119_0104633 3300048922 Bacteria 1582
514 Ga0496120_0000016 3300048923 Bacteria 307608
515 Ga0496120_0000217 3300048923 Bacteria 99402
516 Ga0496120_0000308 3300048923 Bacteria 81512
517 Ga0496120_0000570 3300048923 Bacteria 56326
518 Ga0496120_0001434 3300048923 Bacteria 28732
519 Ga0496120_0001929 3300048923 Bacteria 22808
520 Ga0496120_0003312 3300048923 Bacteria 14796
521 Ga0496120_0008363 3300048923 Bacteria 7524
522 Ga0496120_0014157 3300048923 Bacteria 5324
523 Ga0496120_0017818 3300048923 Bacteria 4590
524 Ga0496120_0018987 3300048923 Bacteria 4414
525 Ga0496120_0036893 3300048923 Bacteria 2904
526 Ga0496120_0058433 3300048923 Bacteria 2166
527 Ga0496120_0135758 3300048923 Bacteria 1254
528 Ga0496121_0000449 3300048924 Bacteria 81130
529 Ga0496121_0001465 3300048924 Bacteria 39770
530 Ga0496121_0002510 3300048924 Bacteria 27888
531 Ga0496121_0002595 3300048924 Bacteria 27283
532 Ga0496121_0008153 3300048924 Bacteria 12443
533 Ga0496121_0013651 3300048924 Bacteria 8708
534 Ga0496121_0014908 3300048924 Bacteria 8191
535 Ga0496121_0024031 3300048924 Bacteria 5841
536 Ga0496121_0027721 3300048924 Bacteria 5294
537 Ga0496121_0046770 3300048924 Bacteria 3699
538 Ga0496121_0154178 3300048924 Bacteria 1687
539 Ga0496121_0157132 3300048924 Bacteria 1667
540 Ga0496122_0000104 3300048925 Bacteria 195617
541 Ga0496122_0000441 3300048925 Bacteria 87041
542 Ga0496122_0001479 3300048925 Bacteria 37819
543 Ga0496122_0001663 3300048925 Bacteria 34489
544 Ga0496122_0002614 3300048925 Bacteria 25219
545 Ga0496122_0008000 3300048925 Bacteria 11552
546 Ga0496122_0016924 3300048925 Bacteria 6851
547 Ga0496122_0018321 3300048925 Bacteria 6479
548 Ga0496122_0043252 3300048925 Bacteria 3531
549 Ga0496122_0044424 3300048925 Bacteria 3467
550 Ga0496122_0049718 3300048925 Bacteria 3206
551 Ga0496122_0078593 3300048925 Bacteria 2310
552 Ga0496122_0091490 3300048925 Bacteria 2071
553 Ga0496122_0146343 3300048925 Bacteria 1467
554 Ga0496122_0438566 3300048925 Bacteria 651
555 Ga0496123_0000060 3300048926 Bacteria 224015
556 Ga0496123_0000342 3300048926 Bacteria 87798
557 Ga0496123_0000706 3300048926 Bacteria 54610
558 Ga0496123_0001369 3300048926 Bacteria 34241
559 Ga0496123_0001529 3300048926 Bacteria 31947
560 Ga0496123_0009004 3300048926 Bacteria 9056
561 Ga0496123_0009956 3300048926 Bacteria 8476
562 Ga0496123_0013993 3300048926 Bacteria 6681
563 Ga0496123_0014537 3300048926 Bacteria 6517
564 Ga0496123_0017255 3300048926 Bacteria 5819
565 Ga0496123_0023534 3300048926 Bacteria 4712
566 Ga0496123_0059424 3300048926 Bacteria 2472
567 Ga0496123_0067323 3300048926 Bacteria 2262
568 Ga0496123_0085386 3300048926 Bacteria 1899
569 Ga0496123_0166095 3300048926 Bacteria 1170
570 Ga0496123_0174613 3300048926 Bacteria 1129
571 Ga0496124_0000092 3300048927 Bacteria 189213
572 Ga0496124_0000578 3300048927 Bacteria 61876
573 Ga0496124_0001105 3300048927 Bacteria 42427
574 Ga0496124_0005071 3300048927 Bacteria 15020
575 Ga0496124_0006189 3300048927 Bacteria 13114
576 Ga0496124_0007962 3300048927 Bacteria 11153
577 Ga0496124_0020106 3300048927 Bacteria 6183
578 Ga0496124_0160663 3300048927 Bacteria 1751
579 Ga0496124_0234677 3300048927 Bacteria 1368
580 Ga0496125_0000103 3300048928 Bacteria 201675
581 Ga0496125_0004496 3300048928 Bacteria 16046
582 Ga0496125_0012969 3300048928 Bacteria 8228
583 Ga0496125_0015333 3300048928 Bacteria 7418
584 Ga0496125_0138992 3300048928 Bacteria 1692
585 Ga0496125_0143257 3300048928 Bacteria 1657
586 Ga0496125_0146040 3300048928 Bacteria 1634
587 Ga0496125_0293154 3300048928 Bacteria 1000
588 Ga0496126_0000595 3300048929 Bacteria 68485
589 Ga0496126_0001327 3300048929 Bacteria 39329
590 Ga0496126_0004373 3300048929 Bacteria 16940
591 Ga0496126_0013690 3300048929 Bacteria 8234
592 Ga0496126_0022167 3300048929 Bacteria 6187
593 Ga0496126_0085608 3300048929 Bacteria 2778
594 Ga0496126_0149151 3300048929 Bacteria 2005
595 Ga0496126_0154026 3300048929 Bacteria 1968
596 Ga0496126_0196212 3300048929 Bacteria 1707
597 Ga0496126_0218819 3300048929 Bacteria 1601
598 Ga0496126_0266693 3300048929 Bacteria 1422
599 Ga0496126_0318707 3300048929 Bacteria 1278
600 Ga0495678_000253 3300049459 Bacteria 60057
601 Ga0495678_000553 3300049459 Bacteria 36055
602 Ga0495682_0006979 3300049460 Bacteria 4528
603 Ga0501034_0107090 3300049571 Bacteria 2788
604 Ga0501235_029497 3300049669 Bacteria 1235
605 Ga0501253_030299 3300049683 Bacteria 1027
606 Ga0501225_0002546 3300049705 Bacteria 5626
607 Ga0501270_059776 3300049767 Bacteria 712
608 nmdc:mga00v17_404756_c1 3300050491 Bacteria 887
609 nmdc:mga00v17_77020_c1 3300050491 Bacteria 2076
610 nmdc:mga00v17_774_c1 3300050491 Bacteria 17379
611 nmdc:mga0k408_181521_c1 3300050493 Bacteria 1255
612 nmdc:mga0k408_335724_c1 3300050493 Bacteria 901
613 Ga0500643_000074 3300053087 Bacteria 111502
614 Ga0500644_0012484 3300053088 Bacteria 2350
615 Ga0500644_0183777 3300053088 Bacteria 857
616 Ga0500646_0044942 3300053090 Bacteria 1255
617 Ga0500555_000248 3300053103 Bacteria 23844
618 Ga0500562_077082 3300053108 Bacteria 901
619 Ga0500569_162131 3300053109 Bacteria 757
620 Ga0500623_183555 3300053127 Bacteria 802
621 Ga0500628_007076 3300053129 Bacteria 1913
622 Ga0500652_032569 3300053131 Bacteria 2054
623 Ga0500655_021247 3300053133 Bacteria 1216
624 Ga0500561_0097804 3300053137 Bacteria 876
625 Ga0500568_0067062 3300053139 Bacteria 1379
626 Ga0500577_0024311 3300053142 Bacteria 2036
627 Ga0500622_0000125 3300053156 Bacteria 81109
628 Ga0500622_0240265 3300053156 Bacteria 801
629 Ga0500633_0136364 3300053160 Bacteria 917
630 Ga0500634_0000047 3300053161 Bacteria 55541
631 Ga0500570_111242 3300053724 Bacteria 1111
632 Ga0587072_009553 3300059643 Bacteria 1552
633 Ga0466962_0004848 3300061719 Bacteria 6476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025735 Ga0207713_1055433 Ga0207713_10554332 170
2 3300006195 Ga0075366_10128116 Ga0075366_101281162 177
3 3300006353 Ga0075370_10020928 Ga0075370_100209282 177
4 3300046519 Ga0495632_0041863 Ga0495632_0041863_1136_1750 177
5 3300053139 Ga0500568_0067062 Ga0500568_0067062_356_970 177
6 3300005834 Ga0068851_10512842 Ga0068851_105128421 178
7 3300025226 Ga0209674_102214 Ga0209674_1022144 178
8 3300025233 Ga0209437_100597 Ga0209437_10059720 178
9 3300025254 Ga0209148_1001986 Ga0209148_10019862 178
10 3300046515 Ga0495620_0107556 Ga0495620_0107556_133_747 180
11 3300053088 Ga0500644_0012484 Ga0500644_0012484_720_1334 180
12 3300053090 Ga0500646_0044942 Ga0500646_0044942_412_1026 180
13 3300053109 Ga0500569_162131 Ga0500569_162131_94_708 180
14 3300053127 Ga0500623_183555 Ga0500623_183555_158_772 180
15 3300053129 Ga0500628_007076 Ga0500628_007076_10_624 180
16 3300053131 Ga0500652_032569 Ga0500652_032569_828_1442 180
17 3300053133 Ga0500655_021247 Ga0500655_021247_307_921 180
18 3300053142 Ga0500577_0024311 Ga0500577_0024311_414_1028 180
19 3300053156 Ga0500622_0000125 Ga0500622_0000125_32503_33117 180
20 3300053724 Ga0500570_111242 Ga0500570_111242_458_1072 180
21 3300050491 nmdc:mga00v17_404756_c1 nmdc:mga00v17_404756_c1_24_569 181
22 iso_pu_bacteria 2599185169 2599412935 195
23 iso_pu_bacteria 2600255254 2601525594 195
24 iso_pu_bacteria 2600255255 2601530796 195
25 iso_pu_bacteria 2600255280 2601617715 195
26 iso_pu_bacteria 2600255281 2601622749 195
27 iso_pu_bacteria 2600255287 2601644705 195
28 iso_pu_bacteria 2600255288 2601651022 195
29 iso_pu_bacteria 2600255289 2601656072 195
30 iso_pu_bacteria 2600255290 2601660995 195
31 iso_pu_bacteria 2600255291 2601664870 195
32 iso_pu_bacteria 2600255298 2601697261 195
33 iso_pu_bacteria 2600255299 2601702649 195
34 iso_pu_bacteria 2600255300 2601708838 195
35 iso_pu_bacteria 2600255301 2601713875 195
36 iso_pu_bacteria 2600255302 2601718921 195
37 iso_pu_bacteria 2600255303 2601722691 195
38 iso_pu_bacteria 2600255304 2601728958 195
39 iso_pu_bacteria 2600255305 2601733867 195
40 iso_pu_bacteria 2600255306 2601738842 195
41 iso_pu_bacteria 2600255307 2601743350 195
42 iso_pu_bacteria 2600255309 2601754476 195
43 iso_pu_bacteria 2600255392 2602021417 195
44 iso_pu_bacteria 2602042052 2603662812 195
45 iso_pu_bacteria 2602042053 2603667709 195
46 iso_pu_bacteria 2602042103 2603841392 195
47 iso_pu_bacteria 2602042104 2603846479 195
48 iso_pu_bacteria 2602042105 2603851554 195
49 iso_pu_bacteria 2602042106 2603856605 195
50 iso_pu_bacteria 2602042109 2603868466 195
51 iso_pu_bacteria 2602042110 2603874201 195
52 iso_pu_bacteria 2602042111 2603878518 195
53 iso_pu_bacteria 2603880178 2606051364 195
54 iso_pu_bacteria 2603880184 2606072359 195
55 iso_pu_bacteria 2603880202 2606149049 195
56 iso_pu_bacteria 2603880211 2606179272 195
57 iso_pu_bacteria 2675903046 2676409802 195
58 iso_pu_bacteria 2894414249 2894417639 195
59 iso_pu_bacteria 2554235234 2555262063 196
60 iso_pu_bacteria 2919108558 2919112755 196
61 iso_pu_bacteria 2971820967 2971825757 196
62 3300003856 Ga0058692_1000122 Ga0058692_100012236 198
63 3300009011 Ga0105251_10000340 Ga0105251_1000034032 198
64 3300025735 Ga0207713_1000136 Ga0207713_100013682 198
65 3300027312 Ga0209371_1000133 Ga0209371_100013382 198
66 3300030500 Ga0268256_1001353 Ga0268256_100135310 198
67 iso_pu_bacteria 2818991457 2819659741 198
68 iso_pu_bacteria 2852684882 2852685444 198
69 iso_pu_bacteria 2919130084 2919131601 198
70 iso_pu_bacteria 2929195423 2929198026 198
71 iso_pu_bacteria 8021622325 8021624373 198
72 iso_pu_bacteria 8021626552 8021628964 198
73 iso_pu_bacteria 8021648035 8021649877 198
74 3300017792 Ga0163161_10045481 Ga0163161_100454813 199
75 3300025735 Ga0207713_1167184 Ga0207713_11671841 199
76 3300031456 Ga0307513_10001608 Ga0307513_100016084 199
77 3300031456 Ga0307513_10260736 Ga0307513_102607362 199
78 3300032005 Ga0307411_10471575 Ga0307411_104715752 199
79 3300041410 Ga0439461_0049857 Ga0439461_0049857_37_666 199
80 3300041413 Ga0439465_0001284 Ga0439465_0001284_3178_3807 199
81 3300041456 Ga0451795_1430113 Ga0451795_1430113_252_881 199
82 3300041460 Ga0451802_0930997 Ga0451802_0930997_481_1110 199
83 3300041486 Ga0451807_1140708 Ga0451807_1140708_67_711 199
84 3300041486 Ga0451807_1201342 Ga0451807_1201342_384_1013 199
85 3300041509 Ga0451843_0192670 Ga0451843_0192670_74_703 199
86 3300041509 Ga0451843_0790152 Ga0451843_0790152_444_1073 199
87 3300042007 Ga0439449_0007292 Ga0439449_0007292_2029_2706 199
88 3300042435 Ga0439434_0117050 Ga0439434_0117050_163_792 199
89 3300046460 Ga0495638_0095170 Ga0495638_0095170_91_744 199
90 3300046525 Ga0495663_0000528 Ga0495663_0000528_731_1384 199
91 3300046525 Ga0495663_0127359 Ga0495663_0127359_118_747 199
92 3300046692 Ga0495671_0005011 Ga0495671_0005011_6218_6871 199
93 iso_pu_bacteria 2593339238 2595447617 199
94 iso_pu_bacteria 2734482264 2735835221 199
95 iso_pu_bacteria 2738543009 2739229065 199
96 iso_pu_bacteria 2842914999 2842916876 199
97 iso_pu_bacteria 2884338543 2884342389 199
98 iso_pu_bacteria 2895498888 2895499115 199
99 iso_pu_bacteria 2895511927 2895512136 199
100 iso_pu_bacteria 2895522137 2895522145 199
101 iso_pu_bacteria 2895525241 2895527409 199
102 iso_pu_bacteria 2919085039 2919088055 199
103 iso_pu_bacteria 2941471342 2941474947 199
104 3300042015 Ga0439462_0013083 Ga0439462_0013083_1446_2069 200
105 3300049767 Ga0501270_059776 Ga0501270_059776_43_687 200
106 iso_pu_bacteria 2585428057 2587725306 200
107 iso_pu_bacteria 2585428058 2587731336 200
108 iso_pu_bacteria 2643221644 2644246411 200
109 3300005289 Ga0065704_10071016 Ga0065704_100710166 201
110 3300005331 Ga0070670_100013647 Ga0070670_1000136478 201
111 3300006051 Ga0075364_10000771 Ga0075364_1000077112 201
112 3300009011 Ga0105251_10000396 Ga0105251_1000039625 201
113 3300009148 Ga0105243_10049069 Ga0105243_100490692 201
114 3300015265 Ga0182005_1006809 Ga0182005_10068092 201
115 3300025735 Ga0207713_1001628 Ga0207713_10016283 201
116 3300025925 Ga0207650_10005141 Ga0207650_1000514110 201
117 3300025935 Ga0207709_10025625 Ga0207709_100256253 201
118 3300027312 Ga0209371_1000016 Ga0209371_100001611 201
119 3300030500 Ga0268256_1000015 Ga0268256_1000015559 201
120 3300031548 Ga0307408_100537304 Ga0307408_1005373042 201
121 3300031824 Ga0307413_10169599 Ga0307413_101695992 201
122 3300032002 Ga0307416_100403429 Ga0307416_1004034292 201
123 3300032004 Ga0307414_10054579 Ga0307414_100545793 201
124 3300032005 Ga0307411_10215567 Ga0307411_102155672 201
125 3300041451 Ga0451791_0636960 Ga0451791_0636960_464_1102 201
126 3300041456 Ga0451795_0318373 Ga0451795_0318373_874_1512 201
127 3300041459 Ga0451800_0059861 Ga0451800_0059861_2031_2651 201
128 3300041486 Ga0451807_1442420 Ga0451807_1442420_117_755 201
129 3300041509 Ga0451843_0176899 Ga0451843_0176899_314_952 201
130 3300042006 Ga0439432_002208 Ga0439432_002208_1693_2340 201
131 3300042007 Ga0439449_0182974 Ga0439449_0182974_94_741 201
132 3300046471 Ga0495650_0019712 Ga0495650_0019712_2337_2945 201
133 3300046471 Ga0495650_0108513 Ga0495650_0108513_91_699 201
134 3300046558 Ga0495633_0007264 Ga0495633_0007264_334_960 201
135 3300046692 Ga0495671_0056656 Ga0495671_0056656_1170_1778 201
136 3300048907 Ga0496104_0022787 Ga0496104_0022787_1807_2415 201
137 3300048920 Ga0496117_0000798 Ga0496117_0000798_40340_40960 201
138 3300048920 Ga0496117_0025420 Ga0496117_0025420_2771_3379 201
139 3300048921 Ga0496118_0017113 Ga0496118_0017113_2957_3565 201
140 3300048921 Ga0496118_0018201 Ga0496118_0018201_5285_5905 201
141 3300048921 Ga0496118_0082285 Ga0496118_0082285_1385_2005 201
142 3300048922 Ga0496119_0001682 Ga0496119_0001682_7139_7747 201
143 3300048922 Ga0496119_0007592 Ga0496119_0007592_3657_4277 201
144 3300048923 Ga0496120_0000570 Ga0496120_0000570_40340_40960 201
145 3300048923 Ga0496120_0001929 Ga0496120_0001929_18006_18614 201
146 3300048925 Ga0496122_0002614 Ga0496122_0002614_21088_21708 201
147 3300048926 Ga0496123_0000706 Ga0496123_0000706_32208_32828 201
148 3300048927 Ga0496124_0001105 Ga0496124_0001105_15432_16052 201
149 3300048929 Ga0496126_0022167 Ga0496126_0022167_226_846 201
150 3300049669 Ga0501235_029497 Ga0501235_029497_45_692 201
151 3300049683 Ga0501253_030299 Ga0501253_030299_282_929 201
152 3300050491 nmdc:mga00v17_774_c1 nmdc:mga00v17_774_c1_16083_16712 201
153 3300053161 Ga0500634_0000047 Ga0500634_0000047_17554_18180 201
154 iso_pu_bacteria 2508501071 2508849960 201
155 iso_pu_bacteria 2511231025 2511380187 201
156 iso_pu_bacteria 2511231035 2511437548 201
157 iso_pu_bacteria 2537561728 2538428622 201
158 iso_pu_bacteria 2554235234 2555262311 201
159 iso_pu_bacteria 2588253510 2588290092 201
160 iso_pu_bacteria 2596583598 2597031809 201
161 iso_pu_bacteria 2599185169 2599413301 201
162 iso_pu_bacteria 2599185178 2599446507 201
163 iso_pu_bacteria 2600255254 2601525955 201
164 iso_pu_bacteria 2600255255 2601531028 201
165 iso_pu_bacteria 2600255280 2601617847 201
166 iso_pu_bacteria 2600255281 2601622881 201
167 iso_pu_bacteria 2600255287 2601646373 201
168 iso_pu_bacteria 2600255288 2601651265 201
169 iso_pu_bacteria 2600255289 2601656219 201
170 iso_pu_bacteria 2600255290 2601661242 201
171 iso_pu_bacteria 2600255291 2601666357 201
172 iso_pu_bacteria 2600255298 2601699330 201
173 iso_pu_bacteria 2600255299 2601704227 201
174 iso_pu_bacteria 2600255300 2601709069 201
175 iso_pu_bacteria 2600255301 2601714118 201
176 iso_pu_bacteria 2600255302 2601719152 201
177 iso_pu_bacteria 2600255303 2601724162 201
178 iso_pu_bacteria 2600255304 2601729074 201
179 iso_pu_bacteria 2600255305 2601734114 201
180 iso_pu_bacteria 2600255306 2601739100 201
181 iso_pu_bacteria 2600255307 2601743871 201
182 iso_pu_bacteria 2600255309 2601754716 201
183 iso_pu_bacteria 2600255392 2602021885 201
184 iso_pu_bacteria 2602042052 2603659108 201
185 iso_pu_bacteria 2602042053 2603663985 201
186 iso_pu_bacteria 2602042066 2603701634 201
187 iso_pu_bacteria 2602042103 2603836444 201
188 iso_pu_bacteria 2602042104 2603841524 201
189 iso_pu_bacteria 2602042105 2603846595 201
190 iso_pu_bacteria 2602042106 2603851667 201
191 iso_pu_bacteria 2602042109 2603864589 201
192 iso_pu_bacteria 2602042110 2603874333 201
193 iso_pu_bacteria 2602042111 2603874628 201
194 iso_pu_bacteria 2603880178 2606051512 201
195 iso_pu_bacteria 2603880184 2606068430 201
196 iso_pu_bacteria 2603880202 2606149197 201
197 iso_pu_bacteria 2603880211 2606174329 201
198 iso_pu_bacteria 2608642108 2608671478 201
199 iso_pu_bacteria 2609459761 2609910886 201
200 iso_pu_bacteria 2636415599 2637224606 201
201 iso_pu_bacteria 2643221592 2643972810 201
202 iso_pu_bacteria 2643221625 2644143343 201
203 iso_pu_bacteria 2643221648 2644276220 201
204 iso_pu_bacteria 2667528172 2671104804 201
205 iso_pu_bacteria 2671180115 2671585147 201
206 iso_pu_bacteria 2675903046 2676410094 201
207 iso_pu_bacteria 2681812866 2681995015 201
208 iso_pu_bacteria 2681812869 2682009519 201
209 iso_pu_bacteria 2711768156 2712471757 201
210 iso_pu_bacteria 2751185917 2753853909 201
211 iso_pu_bacteria 2765235842 2765586806 201
212 iso_pu_bacteria 2775507074 2777022988 201
213 iso_pu_bacteria 2823373977 2823377996 201
214 iso_pu_bacteria 2844425489 2844425499 201
215 iso_pu_bacteria 2854601825 2854603227 201
216 iso_pu_bacteria 2855195626 2855195654 201
217 iso_pu_bacteria 2858466076 2858470437 201
218 iso_pu_bacteria 2871272651 2871274746 201
219 iso_pu_bacteria 2871282230 2871283409 201
220 iso_pu_bacteria 2876601092 2876603564 201
221 iso_pu_bacteria 2885266251 2885270318 201
222 iso_pu_bacteria 2888373701 2888375735 201
223 iso_pu_bacteria 2900577576 2900580958 201
224 iso_pu_bacteria 2904474040 2904479131 201
225 iso_pu_bacteria 2904513164 2904514461 201
226 iso_pu_bacteria 2919108558 2919113566 201
227 iso_pu_bacteria 2919150387 2919155435 201
228 iso_pu_bacteria 2923634449 2923637306 201
229 iso_pu_bacteria 2927143783 2927148849 201
230 iso_pu_bacteria 2927833300 2927836262 201
231 iso_pu_bacteria 2928058823 2928061570 201
232 iso_pu_bacteria 2935625433 2935628696 201
233 iso_pu_bacteria 2939568625 2939571912 201
234 iso_pu_bacteria 2939602548 2939606481 201
235 iso_pu_bacteria 2939617950 2939621001 201
236 iso_pu_bacteria 2939642701 2939646229 201
237 iso_pu_bacteria 2945874760 2945875254 201
238 iso_pu_bacteria 2969079654 2969081649 201
239 iso_pu_bacteria 2971820967 2971820977 201
240 iso_pu_bacteria 2974310843 2974314324 201
241 iso_pu_bacteria 2974435778 2974436190 201
242 iso_pu_bacteria 2984559226 2984564063 201
243 iso_pu_bacteria 2984595703 2984596797 201
244 iso_pu_bacteria 640753048 640935528 201
245 iso_pu_bacteria 8016733728 8016737908 201
246 iso_pu_bacteria 8018221730 8018225585 201
247 iso_pu_bacteria 8018405270 8018406389 201
248 iso_pu_bacteria 8019499862 8019503733 201
249 iso_pu_bacteria 8019504834 8019507042 201
250 iso_pu_bacteria 8054844752 8054845112 201
251 iso_pu_bacteria 8054849141 8054852548 201
252 iso_pu_bacteria 8055092621 8055093438 201
253 iso_pu_bacteria 8055693939 8055693949 201
254 3300013102 Ga0157371_10000404 Ga0157371_1000040411 202
255 3300030733 Ga0314311_1040412 Ga0314311_10404124 202
256 3300030736 Ga0316180_1107520 Ga0316180_11075202 202
257 3300041404 Ga0439436_0021044 Ga0439436_0021044_1072_1791 202
258 3300041413 Ga0439465_0000100 Ga0439465_0000100_18573_19271 202
259 3300042007 Ga0439449_0000021 Ga0439449_0000021_38013_38711 202
260 3300046453 Ga0495627_111572 Ga0495627_111572_73_693 202
261 3300046512 Ga0495610_0001340 Ga0495610_0001340_845_1465 202
262 3300046518 Ga0495631_0003169 Ga0495631_0003169_3848_4468 202
263 3300048908 Ga0496105_0082514 Ga0496105_0082514_653_1273 202
264 3300048919 Ga0496116_0032380 Ga0496116_0032380_3073_3693 202
265 3300048921 Ga0496118_0032601 Ga0496118_0032601_2593_3213 202
266 3300048921 Ga0496118_0072403 Ga0496118_0072403_1377_1997 202
267 3300048921 Ga0496118_0294635 Ga0496118_0294635_38_658 202
268 3300048922 Ga0496119_0000606 Ga0496119_0000606_14932_15552 202
269 3300048923 Ga0496120_0000217 Ga0496120_0000217_1166_1786 202
270 3300048924 Ga0496121_0046770 Ga0496121_0046770_250_870 202
271 3300048925 Ga0496122_0008000 Ga0496122_0008000_6430_7050 202
272 3300048926 Ga0496123_0009956 Ga0496123_0009956_5958_6578 202
273 3300048927 Ga0496124_0005071 Ga0496124_0005071_12674_13294 202
274 3300048928 Ga0496125_0004496 Ga0496125_0004496_11346_11966 202
275 3300048928 Ga0496125_0012969 Ga0496125_0012969_2608_3228 202
276 3300048929 Ga0496126_0000595 Ga0496126_0000595_41646_42266 202
277 3300053088 Ga0500644_0183777 Ga0500644_0183777_191_811 202
278 iso_pu_bacteria 2747842501 2748015584 202
279 3300001904 JGI24736J21556_1000142 JGI24736J21556_100014213 203
280 3300002075 JGI24738J21930_10000022 JGI24738J21930_1000002220 203
281 3300005331 Ga0070670_100848595 Ga0070670_1008485951 203
282 3300005344 Ga0070661_100012002 Ga0070661_1000120026 203
283 3300005434 Ga0070709_10540451 Ga0070709_105404512 203
284 3300009101 Ga0105247_10002519 Ga0105247_1000251911 203
285 3300009545 Ga0105237_10284518 Ga0105237_102845183 203
286 3300010375 Ga0105239_10005758 Ga0105239_1000575813 203
287 3300010375 Ga0105239_10123537 Ga0105239_101235372 203
288 3300013105 Ga0157369_10036912 Ga0157369_100369125 203
289 3300014497 Ga0182008_10018593 Ga0182008_100185932 203
290 3300015261 Ga0182006_1000058 Ga0182006_100005840 203
291 3300015262 Ga0182007_10003715 Ga0182007_100037153 203
292 3300015265 Ga0182005_1000015 Ga0182005_1000015160 203
293 3300015265 Ga0182005_1017808 Ga0182005_10178082 203
294 3300025900 Ga0207710_10006699 Ga0207710_100066995 203
295 3300025906 Ga0207699_10275255 Ga0207699_102752552 203
296 3300025920 Ga0207649_10016527 Ga0207649_100165272 203
297 3300025925 Ga0207650_10299112 Ga0207650_102991123 203
298 3300025972 Ga0207668_10178236 Ga0207668_101782362 203
299 3300031730 Ga0307516_10000839 Ga0307516_1000083918 203
300 3300042184 Ga0450908_000002 Ga0450908_000002_53796_54407 203
301 3300044735 Ga0466968_0005600 Ga0466968_0005600_137_748 203
302 3300046452 Ga0495617_002601 Ga0495617_002601_1116_1727 203
303 3300046457 Ga0495590_0039164 Ga0495590_0039164_819_1430 203
304 3300046460 Ga0495638_0000089 Ga0495638_0000089_25837_26448 203
305 3300046460 Ga0495638_0212032 Ga0495638_0212032_276_887 203
306 3300046491 Ga0495584_0012741 Ga0495584_0012741_3067_3678 203
307 3300046492 Ga0495585_0000430 Ga0495585_0000430_11292_11903 203
308 3300046492 Ga0495585_0005856 Ga0495585_0005856_1186_1797 203
309 3300046501 Ga0495607_0000020 Ga0495607_0000020_13238_13849 203
310 3300046501 Ga0495607_0000228 Ga0495607_0000228_43624_44235 203
311 3300046501 Ga0495607_0026575 Ga0495607_0026575_2037_2648 203
312 3300046501 Ga0495607_0082615 Ga0495607_0082615_31_642 203
313 3300046507 Ga0495606_0001334 Ga0495606_0001334_22353_22964 203
314 3300046507 Ga0495606_0126507 Ga0495606_0126507_557_1168 203
315 3300046512 Ga0495610_0016688 Ga0495610_0016688_1185_1796 203
316 3300046513 Ga0495616_0000345 Ga0495616_0000345_7875_8486 203
317 3300046513 Ga0495616_0001053 Ga0495616_0001053_7989_8600 203
318 3300046515 Ga0495620_0004456 Ga0495620_0004456_2621_3232 203
319 3300046518 Ga0495631_0001487 Ga0495631_0001487_12368_12979 203
320 3300046519 Ga0495632_0000005 Ga0495632_0000005_189896_190507 203
321 3300046519 Ga0495632_0016225 Ga0495632_0016225_1560_2171 203
322 3300046522 Ga0495643_0066981 Ga0495643_0066981_447_1058 203
323 3300046524 Ga0495648_0000506 Ga0495648_0000506_31266_31877 203
324 3300046524 Ga0495648_0003625 Ga0495648_0003625_6438_7049 203
325 3300046538 Ga0495609_0004462 Ga0495609_0004462_2874_3485 203
326 3300046616 Ga0495668_0011531 Ga0495668_0011531_2620_3231 203
327 3300046648 Ga0495611_0000005 Ga0495611_0000005_106652_107263 203
328 3300046648 Ga0495611_0000039 Ga0495611_0000039_61325_61936 203
329 3300046660 Ga0495625_0000066 Ga0495625_0000066_142397_143008 203
330 3300046665 Ga0495661_0002922 Ga0495661_0002922_11065_11676 203
331 3300046691 Ga0495670_0002223 Ga0495670_0002223_7795_8406 203
332 3300046691 Ga0495670_0003498 Ga0495670_0003498_1044_1655 203
333 3300046692 Ga0495671_0000247 Ga0495671_0000247_20342_20953 203
334 3300046794 Ga0495589_0000026 Ga0495589_0000026_63544_64155 203
335 3300046810 Ga0495660_0000605 Ga0495660_0000605_17804_18415 203
336 3300046810 Ga0495660_0000748 Ga0495660_0000748_17621_18232 203
337 3300047323 Ga0495683_0006874 Ga0495683_0006874_4415_5026 203
338 3300047446 Ga0495679_000010 Ga0495679_000010_143220_143831 203
339 3300047469 Ga0495673_0000038 Ga0495673_0000038_176893_177504 203
340 3300047469 Ga0495673_0000045 Ga0495673_0000045_134083_134694 203
341 3300047469 Ga0495673_0004237 Ga0495673_0004237_2115_2726 203
342 3300047472 Ga0495686_0000050 Ga0495686_0000050_170818_171429 203
343 3300047472 Ga0495686_0000297 Ga0495686_0000297_41814_42425 203
344 3300047472 Ga0495686_0014214 Ga0495686_0014214_3671_4282 203
345 3300048909 Ga0496106_0000097 Ga0496106_0000097_6203_6814 203
346 3300048909 Ga0496106_0261754 Ga0496106_0261754_294_905 203
347 3300048910 Ga0496107_0317150 Ga0496107_0317150_248_859 203
348 3300048920 Ga0496117_0065767 Ga0496117_0065767_451_1062 203
349 3300048921 Ga0496118_0001315 Ga0496118_0001315_15319_15930 203
350 3300048921 Ga0496118_0002666 Ga0496118_0002666_16092_16703 203
351 3300048921 Ga0496118_0101033 Ga0496118_0101033_372_983 203
352 3300048921 Ga0496118_0141389 Ga0496118_0141389_137_748 203
353 3300048921 Ga0496118_0156753 Ga0496118_0156753_113_724 203
354 3300048924 Ga0496121_0000449 Ga0496121_0000449_32075_32686 203
355 3300048924 Ga0496121_0001465 Ga0496121_0001465_29362_29973 203
356 3300048924 Ga0496121_0002510 Ga0496121_0002510_9484_10095 203
357 3300048925 Ga0496122_0043252 Ga0496122_0043252_1759_2370 203
358 3300048925 Ga0496122_0091490 Ga0496122_0091490_915_1526 203
359 3300048926 Ga0496123_0013993 Ga0496123_0013993_3782_4393 203
360 3300048926 Ga0496123_0059424 Ga0496123_0059424_866_1477 203
361 3300048927 Ga0496124_0006189 Ga0496124_0006189_5035_5649 203
362 3300048929 Ga0496126_0013690 Ga0496126_0013690_1180_1791 203
363 3300048929 Ga0496126_0218819 Ga0496126_0218819_719_1330 203
364 3300049459 Ga0495678_000253 Ga0495678_000253_15420_16031 203
365 3300049460 Ga0495682_0006979 Ga0495682_0006979_1197_1808 203
366 3300049705 Ga0501225_0002546 Ga0501225_0002546_1959_2636 203
367 3300053087 Ga0500643_000074 Ga0500643_000074_67422_68033 203
368 3300053103 Ga0500555_000248 Ga0500555_000248_1645_2256 203
369 3300053108 Ga0500562_077082 Ga0500562_077082_223_834 203
370 3300053160 Ga0500633_0136364 Ga0500633_0136364_144_755 203
371 3300005539 Ga0068853_100070789 Ga0068853_1000707893 204
372 3300005548 Ga0070665_100174268 Ga0070665_1001742682 204
373 3300005616 Ga0068852_100289129 Ga0068852_1002891292 204
374 3300009093 Ga0105240_10074091 Ga0105240_100740912 204
375 3300009545 Ga0105237_10000774 Ga0105237_1000077421 204
376 3300009551 Ga0105238_10004980 Ga0105238_100049808 204
377 3300010375 Ga0105239_10000644 Ga0105239_1000064413 204
378 3300025913 Ga0207695_10462880 Ga0207695_104628802 204
379 3300025914 Ga0207671_10106400 Ga0207671_101064002 204
380 3300025924 Ga0207694_10026503 Ga0207694_100265035 204
381 3300026041 Ga0207639_10013416 Ga0207639_100134161 204
382 3300031730 Ga0307516_10021192 Ga0307516_100211923 204
383 3300042121 Ga0450919_001638 Ga0450919_001638_97_711 204
384 3300042531 Ga0450918_000309 Ga0450918_000309_8354_8968 204
385 3300042876 Ga0451577_0539157 Ga0451577_0539157_182_799 204
386 3300045051 Ga0451576_0366245 Ga0451576_0366245_715_1332 204
387 3300046471 Ga0495650_0003963 Ga0495650_0003963_6308_6922 204
388 3300047472 Ga0495686_0010944 Ga0495686_0010944_1743_2384 204
389 3300049571 Ga0501034_0107090 Ga0501034_0107090_999_1655 204
390 3300050493 nmdc:mga0k408_181521_c1 nmdc:mga0k408_181521_c1_28_645 204
391 2162886007 SwRhRL2b_contig_1953027 SwRhRL2b_0330.00004640 205
392 2162886007 SwRhRL2b_contig_2120134 SwRhRL2b_0070.00007930 205
393 2162886007 SwRhRL2b_contig_297839 SwRhRL2b_0127.00004120 205
394 3300001915 JGI24741J21665_1000408 JGI24741J21665_100040810 205
395 3300001979 JGI24740J21852_10001196 JGI24740J21852_100011963 205
396 3300001979 JGI24740J21852_10003713 JGI24740J21852_100037132 205
397 3300002705 JGI25156J39149_1007428 JGI25156J39149_10074284 205
398 3300002705 JGI25156J39149_1008238 JGI25156J39149_10082382 205
399 3300002705 JGI25156J39149_1010668 JGI25156J39149_10106683 205
400 3300002737 JGI25162J39368_1000441 JGI25162J39368_100044122 205
401 3300002737 JGI25162J39368_1002136 JGI25162J39368_10021364 205
402 3300002738 JGI25154J39366_1000508 JGI25154J39366_10005088 205
403 3300002771 JGI25163J39215_1000118 JGI25163J39215_100011822 205
404 3300002772 JGI25164J39214_1000302 JGI25164J39214_100030215 205
405 3300002773 JGI25152J39213_1000138 JGI25152J39213_100013851 205
406 3300002774 JGI25150J39212_1000280 JGI25150J39212_10002805 205
407 3300003187 JGI25151J46595_10000207 JGI25151J46595_1000020718 205
408 3300003215 JGI25153J46596_10000146 JGI25153J46596_1000014618 205
409 3300003215 JGI25153J46596_10001144 JGI25153J46596_1000114411 205
410 3300003320 rootH2_10035727 rootH2_1003572715 205
411 3300003751 Ga0055538_1000217 Ga0055538_100021715 205
412 3300003751 Ga0055538_1002216 Ga0055538_10022163 205
413 3300003751 Ga0055538_1002256 Ga0055538_10022563 205
414 3300003752 Ga0055539_1000259 Ga0055539_100025915 205
415 3300003752 Ga0055539_1000443 Ga0055539_10004436 205
416 3300003756 Ga0055533_1000250 Ga0055533_100025015 205
417 3300003756 Ga0055533_1001778 Ga0055533_10017782 205
418 3300003756 Ga0055533_1003288 Ga0055533_10032884 205
419 3300003756 Ga0055533_1003737 Ga0055533_10037372 205
420 3300003758 Ga0055532_1000008 Ga0055532_1000008383 205
421 3300003759 Ga0055525_1000347 Ga0055525_100034715 205
422 3300003759 Ga0055525_1000500 Ga0055525_100050011 205
423 3300003761 Ga0055535_1000006 Ga0055535_10000068 205
424 3300003762 Ga0055542_1001574 Ga0055542_10015749 205
425 3300003762 Ga0055542_1001803 Ga0055542_10018039 205
426 3300003763 Ga0055529_1000025 Ga0055529_10000258 205
427 3300003841 Ga0055541_1000156 Ga0055541_100015622 205
428 3300003841 Ga0055541_1003489 Ga0055541_10034892 205
429 3300003856 Ga0058692_1001369 Ga0058692_10013692 205
430 3300003856 Ga0058692_1036824 Ga0058692_10368241 205
431 3300003856 Ga0058692_1047794 Ga0058692_10477941 205
432 3300003856 Ga0058692_1047821 Ga0058692_10478211 205
433 3300005272 Ga0065703_1018795 Ga0065703_10187952 205
434 3300005289 Ga0065704_10000581 Ga0065704_1000058119 205
435 3300005289 Ga0065704_10002543 Ga0065704_100025433 205
436 3300005289 Ga0065704_10002719 Ga0065704_100027194 205
437 3300005289 Ga0065704_10003831 Ga0065704_100038313 205
438 3300005289 Ga0065704_10005470 Ga0065704_100054702 205
439 3300005337 Ga0070682_100139932 Ga0070682_1001399322 205
440 3300005339 Ga0070660_100172769 Ga0070660_1001727692 205
441 3300005344 Ga0070661_100000417 Ga0070661_1000004178 205
442 3300005366 Ga0070659_100014802 Ga0070659_1000148026 205
443 3300005455 Ga0070663_100000035 Ga0070663_10000003565 205
444 3300005548 Ga0070665_100000160 Ga0070665_10000016029 205
445 3300005548 Ga0070665_100016979 Ga0070665_1000169794 205
446 3300005564 Ga0070664_100000001 Ga0070664_100000001515 205
447 3300005577 Ga0068857_100000013 Ga0068857_10000001351 205
448 3300005578 Ga0068854_100000060 Ga0068854_10000006073 205
449 3300005614 Ga0068856_100002389 Ga0068856_1000023899 205
450 3300006051 Ga0075364_10011667 Ga0075364_100116676 205
451 3300006051 Ga0075364_10120262 Ga0075364_101202623 205
452 3300006195 Ga0075366_10279518 Ga0075366_102795182 205
453 3300006946 Ga0079104_1000036 Ga0079104_100003648 205
454 3300006946 Ga0079104_1000122 Ga0079104_100012293 205
455 3300006946 Ga0079104_1000203 Ga0079104_10002039 205
456 3300006946 Ga0079104_1000437 Ga0079104_100043746 205
457 3300006946 Ga0079104_1001827 Ga0079104_10018277 205
458 3300006946 Ga0079104_1002423 Ga0079104_10024236 205
459 3300006946 Ga0079104_1002630 Ga0079104_10026307 205
460 3300006946 Ga0079104_1004312 Ga0079104_10043125 205
461 3300006946 Ga0079104_1005598 Ga0079104_10055983 205
462 3300006946 Ga0079104_1011891 Ga0079104_10118912 205
463 3300009011 Ga0105251_10000277 Ga0105251_1000027748 205
464 3300009011 Ga0105251_10001409 Ga0105251_100014095 205
465 3300009011 Ga0105251_10003581 Ga0105251_100035817 205
466 3300009011 Ga0105251_10004348 Ga0105251_100043482 205
467 3300009011 Ga0105251_10025676 Ga0105251_100256765 205
468 3300009011 Ga0105251_10040584 Ga0105251_100405843 205
469 3300009036 Ga0105244_10000026 Ga0105244_100000265 205
470 3300009036 Ga0105244_10001959 Ga0105244_100019596 205
471 3300009036 Ga0105244_10002307 Ga0105244_100023076 205
472 3300009036 Ga0105244_10003041 Ga0105244_100030414 205
473 3300009036 Ga0105244_10004064 Ga0105244_1000406410 205
474 3300009036 Ga0105244_10010955 Ga0105244_100109554 205
475 3300009036 Ga0105244_10021983 Ga0105244_100219833 205
476 3300009036 Ga0105244_10112146 Ga0105244_101121462 205
477 3300009036 Ga0105244_10125555 Ga0105244_101255552 205
478 3300009036 Ga0105244_10324307 Ga0105244_103243071 205
479 3300009092 Ga0105250_10000855 Ga0105250_100008554 205
480 3300009092 Ga0105250_10003442 Ga0105250_100034423 205
481 3300009092 Ga0105250_10007232 Ga0105250_100072322 205
482 3300009092 Ga0105250_10023228 Ga0105250_100232283 205
483 3300009092 Ga0105250_10129823 Ga0105250_101298232 205
484 3300009093 Ga0105240_10044181 Ga0105240_100441815 205
485 3300009093 Ga0105240_10451012 Ga0105240_104510122 205
486 3300009093 Ga0105240_10602298 Ga0105240_106022982 205
487 3300009148 Ga0105243_10000259 Ga0105243_1000025927 205
488 3300009148 Ga0105243_11461781 Ga0105243_114617811 205
489 3300011119 Ga0105246_10035707 Ga0105246_100357073 205
490 3300013100 Ga0157373_10000646 Ga0157373_1000064617 205
491 3300013100 Ga0157373_10002943 Ga0157373_1000294310 205
492 3300013102 Ga0157371_10001363 Ga0157371_1000136310 205
493 3300013102 Ga0157371_10005803 Ga0157371_1000580310 205
494 3300013102 Ga0157371_10016673 Ga0157371_100166734 205
495 3300013102 Ga0157371_10029511 Ga0157371_100295114 205
496 3300013102 Ga0157371_10091166 Ga0157371_100911663 205
497 3300013104 Ga0157370_10001790 Ga0157370_1000179013 205
498 3300013104 Ga0157370_10006219 Ga0157370_100062199 205
499 3300013104 Ga0157370_10007229 Ga0157370_100072299 205
500 3300013105 Ga0157369_10004570 Ga0157369_1000457013 205
501 3300013105 Ga0157369_10005312 Ga0157369_1000531212 205
502 3300013105 Ga0157369_10005563 Ga0157369_100055632 205
503 3300013307 Ga0157372_10000062 Ga0157372_10000062114 205
504 3300013307 Ga0157372_10006644 Ga0157372_100066449 205
505 3300013307 Ga0157372_10030390 Ga0157372_100303905 205
506 3300013307 Ga0157372_10040945 Ga0157372_100409454 205
507 3300014497 Ga0182008_10000147 Ga0182008_100001473 205
508 3300014497 Ga0182008_10286360 Ga0182008_102863602 205
509 3300015261 Ga0182006_1006900 Ga0182006_10069003 205
510 3300015261 Ga0182006_1010041 Ga0182006_10100414 205
511 3300015262 Ga0182007_10050023 Ga0182007_100500232 205
512 3300015679 Ga0183366_1004 Ga0183366_100454 205
513 3300015680 Ga0183370_1004 Ga0183370_100454 205
514 3300015685 Ga0183369_1010 Ga0183369_101054 205
515 3300015687 Ga0183368_1008 Ga0183368_100854 205
516 3300021384 Ga0213876_10000049 Ga0213876_10000049132 205
517 3300025207 Ga0209760_100179 Ga0209760_10017919 205
518 3300025224 Ga0209784_100001 Ga0209784_1000011484 205
519 3300025224 Ga0209784_100063 Ga0209784_10006323 205
520 3300025224 Ga0209784_101473 Ga0209784_1014733 205
521 3300025225 Ga0209566_100001 Ga0209566_1000011484 205
522 3300025225 Ga0209566_100048 Ga0209566_100048124 205
523 3300025225 Ga0209566_102021 Ga0209566_1020215 205
524 3300025225 Ga0209566_102596 Ga0209566_1025963 205
525 3300025226 Ga0209674_100002 Ga0209674_1000021484 205
526 3300025226 Ga0209674_100071 Ga0209674_10007193 205
527 3300025226 Ga0209674_100868 Ga0209674_1008683 205
528 3300025226 Ga0209674_103236 Ga0209674_1032362 205
529 3300025228 Ga0209672_100199 Ga0209672_10019936 205
530 3300025228 Ga0209672_100339 Ga0209672_1003398 205
531 3300025229 Ga0209147_100002 Ga0209147_100002130 205
532 3300025230 Ga0209563_100002 Ga0209563_10000219 205
533 3300025230 Ga0209563_100085 Ga0209563_10008593 205
534 3300025230 Ga0209563_110025 Ga0209563_1100252 205
535 3300025231 Ga0207427_100032 Ga0207427_10003219 205
536 3300025233 Ga0209437_100001 Ga0209437_10000119 205
537 3300025233 Ga0209437_100092 Ga0209437_10009272 205
538 3300025242 Ga0209258_100002 Ga0209258_100002130 205
539 3300025245 Ga0207425_1000011 Ga0207425_100001150 205
540 3300025245 Ga0207425_1005801 Ga0207425_10058012 205
541 3300025246 Ga0209646_1000035 Ga0209646_10000359 205
542 3300025250 Ga0209026_1004937 Ga0209026_10049373 205
543 3300025253 Ga0209677_100002 Ga0209677_10000219 205
544 3300025253 Ga0209677_100040 Ga0209677_100040124 205
545 3300025254 Ga0209148_1000077 Ga0209148_1000077140 205
546 3300025256 Ga0209759_1002426 Ga0209759_10024264 205
547 3300025256 Ga0209759_1002601 Ga0209759_10026018 205
548 3300025256 Ga0209759_1009418 Ga0209759_10094183 205
549 3300025258 Ga0209129_1000021 Ga0209129_100002154 205
550 3300025258 Ga0209129_1000273 Ga0209129_10002734 205
551 3300025261 Ga0209233_1001959 Ga0209233_10019592 205
552 3300025272 Ga0209455_1000009 Ga0209455_10000099 205
553 3300025294 Ga0209025_1000054 Ga0209025_1000054117 205
554 3300025297 Ga0209758_1000062 Ga0209758_1000062117 205
555 3300025297 Ga0209758_1000124 Ga0209758_100012471 205
556 3300025711 Ga0207696_1000202 Ga0207696_100020255 205
557 3300025711 Ga0207696_1000949 Ga0207696_10009494 205
558 3300025711 Ga0207696_1002169 Ga0207696_10021698 205
559 3300025711 Ga0207696_1007432 Ga0207696_10074324 205
560 3300025711 Ga0207696_1068022 Ga0207696_10680222 205
561 3300025728 Ga0207655_1000057 Ga0207655_100005734 205
562 3300025728 Ga0207655_1000067 Ga0207655_100006753 205
563 3300025728 Ga0207655_1000111 Ga0207655_1000111131 205
564 3300025728 Ga0207655_1000122 Ga0207655_100012210 205
565 3300025728 Ga0207655_1000218 Ga0207655_100021879 205
566 3300025728 Ga0207655_1001050 Ga0207655_100105014 205
567 3300025728 Ga0207655_1002313 Ga0207655_10023133 205
568 3300025728 Ga0207655_1004581 Ga0207655_10045815 205
569 3300025728 Ga0207655_1005717 Ga0207655_10057176 205
570 3300025728 Ga0207655_1017144 Ga0207655_10171442 205
571 3300025728 Ga0207655_1073276 Ga0207655_10732762 205
572 3300025735 Ga0207713_1000184 Ga0207713_100018437 205
573 3300025735 Ga0207713_1000636 Ga0207713_100063630 205
574 3300025735 Ga0207713_1000748 Ga0207713_100074825 205
575 3300025735 Ga0207713_1002034 Ga0207713_10020348 205
576 3300025735 Ga0207713_1002094 Ga0207713_10020945 205
577 3300025735 Ga0207713_1004241 Ga0207713_10042415 205
578 3300025735 Ga0207713_1019257 Ga0207713_10192572 205
579 3300025735 Ga0207713_1022160 Ga0207713_10221602 205
580 3300025735 Ga0207713_1108535 Ga0207713_11085352 205
581 3300025913 Ga0207695_10029467 Ga0207695_100294674 205
582 3300025913 Ga0207695_10315359 Ga0207695_103153592 205
583 3300025920 Ga0207649_10000390 Ga0207649_100003909 205
584 3300025932 Ga0207690_10008873 Ga0207690_100088732 205
585 3300025935 Ga0207709_10000289 Ga0207709_1000028949 205
586 3300025935 Ga0207709_10175268 Ga0207709_101752682 205
587 3300025945 Ga0207679_10000003 Ga0207679_100000039 205
588 3300025981 Ga0207640_10000071 Ga0207640_100000719 205
589 3300026067 Ga0207678_10000175 Ga0207678_1000017540 205
590 3300026078 Ga0207702_10000110 Ga0207702_1000011078 205
591 3300026116 Ga0207674_10000071 Ga0207674_1000007151 205
592 3300026116 Ga0207674_10011098 Ga0207674_100110983 205
593 3300027111 Ga0209281_1000031 Ga0209281_100003129 205
594 3300027111 Ga0209281_1000080 Ga0209281_1000080129 205
595 3300027111 Ga0209281_1000086 Ga0209281_1000086183 205
596 3300027111 Ga0209281_1000117 Ga0209281_1000117196 205
597 3300027111 Ga0209281_1000206 Ga0209281_100020664 205
598 3300027111 Ga0209281_1000261 Ga0209281_100026110 205
599 3300027111 Ga0209281_1000338 Ga0209281_100033867 205
600 3300027111 Ga0209281_1001242 Ga0209281_100124211 205
601 3300027111 Ga0209281_1001877 Ga0209281_10018778 205
602 3300027111 Ga0209281_1002414 Ga0209281_10024143 205
603 3300027111 Ga0209281_1006922 Ga0209281_10069223 205
604 3300027312 Ga0209371_1000005 Ga0209371_1000005227 205
605 3300027312 Ga0209371_1000029 Ga0209371_100002953 205
606 3300027312 Ga0209371_1000042 Ga0209371_100004253 205
607 3300027312 Ga0209371_1000257 Ga0209371_100025734 205
608 3300027312 Ga0209371_1001693 Ga0209371_10016934 205
609 3300027312 Ga0209371_1002593 Ga0209371_10025937 205
610 3300027312 Ga0209371_1003013 Ga0209371_10030132 205
611 3300027312 Ga0209371_1003174 Ga0209371_10031742 205
612 3300027312 Ga0209371_1006640 Ga0209371_10066404 205
613 3300027312 Ga0209371_1007062 Ga0209371_10070624 205
614 3300027312 Ga0209371_1011434 Ga0209371_10114342 205
615 3300028379 Ga0268266_10000129 Ga0268266_1000012993 205
616 3300028800 Ga0265338_10000325 Ga0265338_1000032515 205
617 3300030500 Ga0268256_1000006 Ga0268256_1000006829 205
618 3300030500 Ga0268256_1000032 Ga0268256_1000032342 205
619 3300030500 Ga0268256_1000042 Ga0268256_1000042278 205
620 3300030500 Ga0268256_1000262 Ga0268256_100026222 205
621 3300030500 Ga0268256_1001716 Ga0268256_10017169 205
622 3300030500 Ga0268256_1001932 Ga0268256_10019327 205
623 3300030500 Ga0268256_1004434 Ga0268256_10044347 205
624 3300030500 Ga0268256_1008802 Ga0268256_10088023 205
625 3300030500 Ga0268256_1015762 Ga0268256_10157623 205
626 3300030500 Ga0268256_1016889 Ga0268256_10168891 205
627 3300037418 Ga0395900_0051003 Ga0395900_0051003_2395_3021 205
628 3300038705 Ga0237819_00016 Ga0237819_00016_349_987 205
629 3300039437 Ga0436365_0245969 Ga0436365_0245969_318301_318918 205
630 3300039447 Ga0436361_0306735 Ga0436361_0306735_66_701 205
631 3300041405 Ga0439438_001391 Ga0439438_001391_6886_7503 205
632 3300041512 Ga0451853_1122400 Ga0451853_1122400_1108_1725 205
633 3300042010 Ga0439452_000012 Ga0439452_000012_38472_39089 205
634 3300042010 Ga0439452_000076 Ga0439452_000076_79680_80297 205
635 3300042010 Ga0439452_000494 Ga0439452_000494_15391_16008 205
636 3300042010 Ga0439452_003672 Ga0439452_003672_371_988 205
637 3300042439 Ga0439464_0015981 Ga0439464_0015981_1239_1856 205
638 3300042439 Ga0439464_0038068 Ga0439464_0038068_148_765 205
639 3300044650 Ga0466986_0149237 Ga0466986_0149237_699_1325 205
640 3300044658 Ga0466972_0015030 Ga0466972_0015030_763_1398 205
641 3300044669 Ga0466981_0000020 Ga0466981_0000020_60595_61212 205
642 3300044672 Ga0466982_0265244 Ga0466982_0265244_140_775 205
643 3300044693 Ga0466961_0004626 Ga0466961_0004626_3481_4116 205
644 3300044735 Ga0466968_0007269 Ga0466968_0007269_2075_2710 205
645 3300044765 Ga0466970_0180750 Ga0466970_0180750_314_949 205
646 3300045049 Ga0466959_0137677 Ga0466959_0137677_316_951 205
647 3300045976 Ga0466967_0241181 Ga0466967_0241181_334_969 205
648 3300046453 Ga0495627_042627 Ga0495627_042627_488_1105 205
649 3300046458 Ga0495591_000095 Ga0495591_000095_61529_62146 205
650 3300046458 Ga0495591_000126 Ga0495591_000126_81919_82536 205
651 3300046458 Ga0495591_022272 Ga0495591_022272_546_1163 205
652 3300046460 Ga0495638_0019681 Ga0495638_0019681_3656_4273 205
653 3300046471 Ga0495650_0000094 Ga0495650_0000094_22226_22843 205
654 3300046471 Ga0495650_0000126 Ga0495650_0000126_172127_172744 205
655 3300046500 Ga0495596_0032191 Ga0495596_0032191_630_1247 205
656 3300046513 Ga0495616_0025941 Ga0495616_0025941_342_959 205
657 3300046515 Ga0495620_0001761 Ga0495620_0001761_9772_10389 205
658 3300046519 Ga0495632_0047690 Ga0495632_0047690_165_800 205
659 3300046530 Ga0495654_0000072 Ga0495654_0000072_53802_54419 205
660 3300046530 Ga0495654_0002518 Ga0495654_0002518_1760_2377 205
661 3300046530 Ga0495654_0007878 Ga0495654_0007878_3671_4291 205
662 3300046530 Ga0495654_0064590 Ga0495654_0064590_283_900 205
663 3300046542 Ga0495597_0277284 Ga0495597_0277284_17_637 205
664 3300046616 Ga0495668_0031901 Ga0495668_0031901_599_1216 205
665 3300046660 Ga0495625_0013019 Ga0495625_0013019_1656_2276 205
666 3300046692 Ga0495671_0065449 Ga0495671_0065449_1010_1627 205
667 3300046694 Ga0495649_0004130 Ga0495649_0004130_3765_4382 205
668 3300046794 Ga0495589_0000076 Ga0495589_0000076_63292_63909 205
669 3300046794 Ga0495589_0035865 Ga0495589_0035865_1725_2342 205
670 3300046810 Ga0495660_0000028 Ga0495660_0000028_228894_229511 205
671 3300046810 Ga0495660_0000051 Ga0495660_0000051_135827_136444 205
672 3300046810 Ga0495660_0024891 Ga0495660_0024891_633_1250 205
673 3300047320 Ga0495672_0000011 Ga0495672_0000011_465095_465712 205
674 3300047320 Ga0495672_0000039 Ga0495672_0000039_205996_206616 205
675 3300047323 Ga0495683_0044546 Ga0495683_0044546_1018_1635 205
676 3300047446 Ga0495679_000016 Ga0495679_000016_12725_13345 205
677 3300047469 Ga0495673_0000137 Ga0495673_0000137_77188_77805 205
678 3300048903 Ga0496100_0124828 Ga0496100_0124828_1065_1712 205
679 3300048904 Ga0496101_0000063 Ga0496101_0000063_67792_68409 205
680 3300048904 Ga0496101_0045517 Ga0496101_0045517_2462_3079 205
681 3300048905 Ga0496102_0001073 Ga0496102_0001073_4134_4751 205
682 3300048906 Ga0496103_0020776 Ga0496103_0020776_2117_2734 205
683 3300048907 Ga0496104_0010348 Ga0496104_0010348_7416_8033 205
684 3300048907 Ga0496104_0022124 Ga0496104_0022124_239_856 205
685 3300048908 Ga0496105_0229458 Ga0496105_0229458_816_1433 205
686 3300048909 Ga0496106_0113043 Ga0496106_0113043_519_1136 205
687 3300048919 Ga0496116_0000147 Ga0496116_0000147_3254_3871 205
688 3300048919 Ga0496116_0001013 Ga0496116_0001013_26472_27089 205
689 3300048919 Ga0496116_0001377 Ga0496116_0001377_11818_12435 205
690 3300048919 Ga0496116_0019647 Ga0496116_0019647_2042_2659 205
691 3300048919 Ga0496116_0036256 Ga0496116_0036256_113_730 205
692 3300048919 Ga0496116_0041384 Ga0496116_0041384_2238_2855 205
693 3300048919 Ga0496116_0078490 Ga0496116_0078490_68_685 205
694 3300048919 Ga0496116_0127098 Ga0496116_0127098_657_1274 205
695 3300048919 Ga0496116_0213427 Ga0496116_0213427_115_732 205
696 3300048920 Ga0496117_0000306 Ga0496117_0000306_9135_9752 205
697 3300048920 Ga0496117_0002498 Ga0496117_0002498_1083_1700 205
698 3300048920 Ga0496117_0009407 Ga0496117_0009407_3885_4502 205
699 3300048920 Ga0496117_0009676 Ga0496117_0009676_2504_3121 205
700 3300048920 Ga0496117_0015996 Ga0496117_0015996_2492_3109 205
701 3300048920 Ga0496117_0017021 Ga0496117_0017021_3524_4141 205
702 3300048920 Ga0496117_0035095 Ga0496117_0035095_2312_2929 205
703 3300048920 Ga0496117_0043737 Ga0496117_0043737_2032_2649 205
704 3300048920 Ga0496117_0079731 Ga0496117_0079731_427_1044 205
705 3300048920 Ga0496117_0087910 Ga0496117_0087910_1041_1658 205
706 3300048921 Ga0496118_0000384 Ga0496118_0000384_53540_54157 205
707 3300048921 Ga0496118_0001557 Ga0496118_0001557_7171_7788 205
708 3300048921 Ga0496118_0017872 Ga0496118_0017872_3581_4198 205
709 3300048921 Ga0496118_0030651 Ga0496118_0030651_2873_3490 205
710 3300048921 Ga0496118_0044303 Ga0496118_0044303_2792_3409 205
711 3300048921 Ga0496118_0051567 Ga0496118_0051567_806_1423 205
712 3300048921 Ga0496118_0069764 Ga0496118_0069764_1585_2202 205
713 3300048921 Ga0496118_0091993 Ga0496118_0091993_593_1210 205
714 3300048921 Ga0496118_0339382 Ga0496118_0339382_92_727 205
715 3300048922 Ga0496119_0000105 Ga0496119_0000105_36960_37577 205
716 3300048922 Ga0496119_0000942 Ga0496119_0000942_8109_8726 205
717 3300048922 Ga0496119_0003515 Ga0496119_0003515_11198_11815 205
718 3300048922 Ga0496119_0003913 Ga0496119_0003913_10262_10879 205
719 3300048922 Ga0496119_0013225 Ga0496119_0013225_4149_4766 205
720 3300048922 Ga0496119_0014214 Ga0496119_0014214_5008_5625 205
721 3300048922 Ga0496119_0016199 Ga0496119_0016199_5011_5628 205
722 3300048922 Ga0496119_0017141 Ga0496119_0017141_2746_3363 205
723 3300048922 Ga0496119_0048063 Ga0496119_0048063_1509_2126 205
724 3300048922 Ga0496119_0051570 Ga0496119_0051570_896_1513 205
725 3300048922 Ga0496119_0076576 Ga0496119_0076576_57_674 205
726 3300048922 Ga0496119_0104633 Ga0496119_0104633_860_1477 205
727 3300048923 Ga0496120_0000016 Ga0496120_0000016_221490_222107 205
728 3300048923 Ga0496120_0000308 Ga0496120_0000308_4328_4945 205
729 3300048923 Ga0496120_0001434 Ga0496120_0001434_10359_10976 205
730 3300048923 Ga0496120_0003312 Ga0496120_0003312_5951_6568 205
731 3300048923 Ga0496120_0008363 Ga0496120_0008363_6684_7301 205
732 3300048923 Ga0496120_0014157 Ga0496120_0014157_2601_3218 205
733 3300048923 Ga0496120_0017818 Ga0496120_0017818_3046_3663 205
734 3300048923 Ga0496120_0018987 Ga0496120_0018987_56_673 205
735 3300048923 Ga0496120_0036893 Ga0496120_0036893_35_652 205
736 3300048923 Ga0496120_0058433 Ga0496120_0058433_1252_1869 205
737 3300048923 Ga0496120_0135758 Ga0496120_0135758_574_1191 205
738 3300048924 Ga0496121_0002595 Ga0496121_0002595_19497_20114 205
739 3300048924 Ga0496121_0008153 Ga0496121_0008153_6093_6710 205
740 3300048924 Ga0496121_0013651 Ga0496121_0013651_6245_6862 205
741 3300048924 Ga0496121_0014908 Ga0496121_0014908_6764_7381 205
742 3300048924 Ga0496121_0024031 Ga0496121_0024031_1338_1955 205
743 3300048924 Ga0496121_0027721 Ga0496121_0027721_1035_1652 205
744 3300048924 Ga0496121_0154178 Ga0496121_0154178_1008_1625 205
745 3300048924 Ga0496121_0157132 Ga0496121_0157132_889_1506 205
746 3300048925 Ga0496122_0000104 Ga0496122_0000104_8764_9381 205
747 3300048925 Ga0496122_0000441 Ga0496122_0000441_9421_10038 205
748 3300048925 Ga0496122_0001479 Ga0496122_0001479_11025_11642 205
749 3300048925 Ga0496122_0001663 Ga0496122_0001663_18132_18749 205
750 3300048925 Ga0496122_0016924 Ga0496122_0016924_3933_4550 205
751 3300048925 Ga0496122_0018321 Ga0496122_0018321_2102_2719 205
752 3300048925 Ga0496122_0044424 Ga0496122_0044424_1249_1866 205
753 3300048925 Ga0496122_0049718 Ga0496122_0049718_1200_1817 205
754 3300048925 Ga0496122_0078593 Ga0496122_0078593_445_1062 205
755 3300048925 Ga0496122_0146343 Ga0496122_0146343_63_680 205
756 3300048925 Ga0496122_0438566 Ga0496122_0438566_21_638 205
757 3300048926 Ga0496123_0000060 Ga0496123_0000060_32948_33565 205
758 3300048926 Ga0496123_0000342 Ga0496123_0000342_76979_77596 205
759 3300048926 Ga0496123_0001369 Ga0496123_0001369_18132_18749 205
760 3300048926 Ga0496123_0001529 Ga0496123_0001529_11025_11642 205
761 3300048926 Ga0496123_0009004 Ga0496123_0009004_907_1524 205
762 3300048926 Ga0496123_0014537 Ga0496123_0014537_1838_2455 205
763 3300048926 Ga0496123_0017255 Ga0496123_0017255_3649_4266 205
764 3300048926 Ga0496123_0023534 Ga0496123_0023534_3965_4582 205
765 3300048926 Ga0496123_0067323 Ga0496123_0067323_1337_1954 205
766 3300048926 Ga0496123_0085386 Ga0496123_0085386_177_794 205
767 3300048926 Ga0496123_0166095 Ga0496123_0166095_167_784 205
768 3300048926 Ga0496123_0174613 Ga0496123_0174613_478_1095 205
769 3300048927 Ga0496124_0000092 Ga0496124_0000092_139866_140483 205
770 3300048927 Ga0496124_0000578 Ga0496124_0000578_2543_3160 205
771 3300048927 Ga0496124_0007962 Ga0496124_0007962_3576_4193 205
772 3300048927 Ga0496124_0020106 Ga0496124_0020106_406_1023 205
773 3300048927 Ga0496124_0160663 Ga0496124_0160663_526_1143 205
774 3300048927 Ga0496124_0234677 Ga0496124_0234677_421_1038 205
775 3300048928 Ga0496125_0000103 Ga0496125_0000103_45235_45852 205
776 3300048928 Ga0496125_0015333 Ga0496125_0015333_2298_2915 205
777 3300048928 Ga0496125_0138992 Ga0496125_0138992_71_688 205
778 3300048928 Ga0496125_0143257 Ga0496125_0143257_133_750 205
779 3300048928 Ga0496125_0146040 Ga0496125_0146040_71_688 205
780 3300048928 Ga0496125_0293154 Ga0496125_0293154_255_881 205
781 3300048929 Ga0496126_0001327 Ga0496126_0001327_1632_2249 205
782 3300048929 Ga0496126_0004373 Ga0496126_0004373_2138_2755 205
783 3300048929 Ga0496126_0085608 Ga0496126_0085608_530_1147 205
784 3300048929 Ga0496126_0149151 Ga0496126_0149151_336_953 205
785 3300048929 Ga0496126_0154026 Ga0496126_0154026_62_679 205
786 3300048929 Ga0496126_0196212 Ga0496126_0196212_222_839 205
787 3300048929 Ga0496126_0266693 Ga0496126_0266693_675_1292 205
788 3300048929 Ga0496126_0318707 Ga0496126_0318707_517_1134 205
789 3300049459 Ga0495678_000553 Ga0495678_000553_35175_35792 205
790 3300050491 nmdc:mga00v17_77020_c1 nmdc:mga00v17_77020_c1_254_871 205
791 3300050493 nmdc:mga0k408_335724_c1 nmdc:mga0k408_335724_c1_159_776 205
792 3300053137 Ga0500561_0097804 Ga0500561_0097804_175_792 205
793 3300053156 Ga0500622_0240265 Ga0500622_0240265_103_720 205
794 3300059643 Ga0587072_009553 Ga0587072_009553_130_756 205
795 3300061719 Ga0466962_0004848 Ga0466962_0004848_396_1031 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

13

201

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v81-assembly1.cif.gz_A native kdpgal structure 0.9949 1 204
4qcc-assembly1.cif.gz_A structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains 0.9924 5 204
2v81-assembly1.cif.gz_A native kdpgal structure 0.9852 1 204
4qcc-assembly1.cif.gz_A structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains 0.9636 5 204
8e01-assembly1.cif.gz_A structure of engineered nano-cage fusion protein 0.9262 8 202
ID Description Score Start End Superfamily
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9951 2 204 3.20.20.70
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9805 2 204 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9199 8 203 3.20.20.70
4bk9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8965 7 195 3.20.20.70
2yw3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8909 8 199 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2J4R0M6-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase (EC 4.1.2.21) 0.9996 92 205 GO:0008674
AF-A0A370QUL1-F1-model_v4 2-dehydro-3-deoxyphosphogalactonate aldolase 0.9972 1 205 GO:0016829
AF-A0A5F0JXW7-F1-model_v4 deleted 0.9971 8 199
AF-A0A0J6AF76-F1-model_v4 deleted 0.9967 1 205
AF-A0A840RA45-F1-model_v4 2-dehydro-3-deoxyphosphogalactonate aldolase (EC 4.1.2.21) 0.9967 1 205 GO:0016829

Feature Viewer

pLDDT pTM Quality
96.93 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map