F481043
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 792 | 364 | 735 | 360 |
Family's Representative Sequence
| Representative Sequence | 3300049649|Ga0501198_000010|Ga0501198_000010_92305_93447 |
| Length | 380 |
| Sequence | MERRSFVRGAGLAGVVAGAGALLSACGKKDAQPVAGTAPAAAPAVSTGGSIRWRLASSFPKSLDTIYGAAEVFAKKVGEMTGGKFQISVHAGGELMPPFGVVDGVQKATVEMAHTAPYYFFGKDETFALACAIPFGLNSRQMTAWMYEGNGLKLIREFYAQYNIISFPMGNTGAQMGGWYRKELKSVADMKGLKIRIGGFAGKVIERMGGVPQNIPGGEIYQALEKGTIDATEWVGPYDDQKLGFNKVAPNYYYPGWWEGGPQLDLYVNTAAYQSLSPEYKAVIESAAAYAHTQMQARYDARNPDALRQLVASGTKLFRFPKDVMDAAFKESMALYSELSAKNPNWKKVYEDYAKFRTDQNLWFRFAEAGFDSYMHQQKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 7 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 8 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 9 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 10 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 11 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 12 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 13 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 14 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 15 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 16 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 17 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 18 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 19 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 20 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 21 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 22 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 23 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 24 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 25 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 26 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 27 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 28 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 29 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 30 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 31 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 32 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 33 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 34 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 35 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 36 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 37 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 38 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 39 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 40 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 41 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 42 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 43 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 44 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 45 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 46 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 47 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 48 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 49 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 50 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 51 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 52 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 53 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 54 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 55 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 56 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 57 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 63 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 65 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 66 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 68 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 70 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 78 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 80 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 95 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 99 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 102 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 115 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 116 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 119 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 126 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 127 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 139 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 239 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 240 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 246 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 247 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 252 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 253 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 254 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 255 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 256 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 257 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 258 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 259 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 260 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 261 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 273 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 276 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 277 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 278 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 279 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 280 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 281 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 282 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 283 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 284 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 285 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 286 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 287 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 288 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 289 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 290 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 291 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 292 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 293 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 294 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 295 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 296 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 297 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 298 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 299 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 300 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 301 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 327 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 332 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 333 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 335 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 336 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 337 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 338 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 339 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 349 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 351 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 352 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 353 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 354 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 355 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 359 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 360 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 362 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 363 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 364 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.07 |
| Metatranscriptomes | 0 |
| Isolates | 5.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.48 |
| Nodule | 1.01 |
| Rhizoplane | 1.77 |
| Rhizosphere | 64.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009650 | 3300001979 | Bacteria | 3765 |
| 2 | JGI25155J39150_1000005 | 3300002704 | Bacteria | 261712 |
| 3 | JGI25156J39149_1000006 | 3300002705 | Bacteria | 261778 |
| 4 | JGI25154J39366_1000015 | 3300002738 | Bacteria | 261778 |
| 5 | JGI25157J39369_1000111 | 3300002741 | Bacteria | 69508 |
| 6 | JGI25152J39213_1002353 | 3300002773 | Bacteria | 7259 |
| 7 | JGI25152J39213_1003217 | 3300002773 | Bacteria | 5679 |
| 8 | JGI25150J39212_1002625 | 3300002774 | Bacteria | 4417 |
| 9 | JGI25150J39212_1003507 | 3300002774 | Bacteria | 3661 |
| 10 | JGI25150J39212_1005857 | 3300002774 | Bacteria | 2584 |
| 11 | JGI25159J45721_1003156 | 3300002987 | Bacteria | 5930 |
| 12 | JGI25159J45721_1010735 | 3300002987 | Bacteria | 2306 |
| 13 | JGI25151J46595_10025360 | 3300003187 | Bacteria | 2414 |
| 14 | JGI25151J46595_10025978 | 3300003187 | Bacteria | 2371 |
| 15 | JGI25153J46596_10011279 | 3300003215 | Bacteria | 3964 |
| 16 | JGI25153J46596_10025852 | 3300003215 | Bacteria | 2089 |
| 17 | rootL2_10003410 | 3300003322 | Bacteria | 24274 |
| 18 | rootH1_10006954 | 3300003323 | Bacteria | 7249 |
| 19 | rootH1_10024154 | 3300003323 | Bacteria | 5841 |
| 20 | rootH1_10098199 | 3300003323 | Bacteria | 4902 |
| 21 | rootH1_10120714 | 3300003323 | Bacteria | 1604 |
| 22 | JGI26128J50194_1000166 | 3300003347 | Bacteria | 2944 |
| 23 | JGI25160J50197_1000045 | 3300003354 | Bacteria | 142992 |
| 24 | JGI26145J50221_1001536 | 3300003371 | Bacteria | 1818 |
| 25 | JGI25161J50226_1000008 | 3300003374 | Bacteria | 239245 |
| 26 | JGI25161J50226_1005839 | 3300003374 | Bacteria | 2314 |
| 27 | Ga0055535_1000076 | 3300003761 | Bacteria | 111203 |
| 28 | Ga0055542_1000009 | 3300003762 | Bacteria | 416550 |
| 29 | Ga0055526_1003100 | 3300003771 | Bacteria | 10787 |
| 30 | Ga0055526_1004023 | 3300003771 | Bacteria | 9034 |
| 31 | Ga0055526_1004056 | 3300003771 | Bacteria | 8990 |
| 32 | Ga0055526_1005431 | 3300003771 | Bacteria | 7330 |
| 33 | Ga0055537_1000198 | 3300003773 | Bacteria | 45289 |
| 34 | Ga0055537_1007287 | 3300003773 | Bacteria | 2683 |
| 35 | Ga0055524_1000080 | 3300003775 | Bacteria | 120203 |
| 36 | Ga0055524_1000126 | 3300003775 | Bacteria | 89985 |
| 37 | Ga0055524_1002605 | 3300003775 | Bacteria | 9176 |
| 38 | Ga0055524_1013464 | 3300003775 | Bacteria | 3082 |
| 39 | Ga0055536_1004051 | 3300003781 | Bacteria | 7630 |
| 40 | Ga0055536_1005604 | 3300003781 | Bacteria | 6083 |
| 41 | Ga0055534_1007296 | 3300003784 | Bacteria | 2652 |
| 42 | Ga0055534_1008433 | 3300003784 | Bacteria | 2334 |
| 43 | Ga0055528_1000633 | 3300003790 | Bacteria | 25778 |
| 44 | Ga0055530_10000699 | 3300003791 | Bacteria | 28341 |
| 45 | Ga0055530_10001787 | 3300003791 | Bacteria | 14951 |
| 46 | Ga0055530_10003267 | 3300003791 | Bacteria | 9431 |
| 47 | Ga0055540_1000002 | 3300003792 | Bacteria | 436954 |
| 48 | Ga0055540_1000021 | 3300003792 | Bacteria | 208733 |
| 49 | Ga0055531_10000051 | 3300003794 | Bacteria | 130125 |
| 50 | Ga0055531_10001171 | 3300003794 | Bacteria | 20185 |
| 51 | Ga0055531_10001860 | 3300003794 | Bacteria | 14814 |
| 52 | Ga0055531_10002049 | 3300003794 | Bacteria | 13902 |
| 53 | Ga0055531_10005509 | 3300003794 | Bacteria | 7398 |
| 54 | Ga0055531_10009879 | 3300003794 | Bacteria | 4826 |
| 55 | Ga0055543_1000241 | 3300004625 | Bacteria | 42294 |
| 56 | Ga0055543_1004447 | 3300004625 | Bacteria | 3827 |
| 57 | Ga0055543_1006196 | 3300004625 | Bacteria | 2929 |
| 58 | Ga0065165_1000281 | 3300005262 | Bacteria | 86863 |
| 59 | Ga0065165_1001682 | 3300005262 | Bacteria | 22357 |
| 60 | Ga0065165_1002866 | 3300005262 | Bacteria | 13317 |
| 61 | Ga0065165_1019922 | 3300005262 | Bacteria | 2379 |
| 62 | Ga0065704_10114513 | 3300005289 | Bacteria | 1889 |
| 63 | Ga0065704_10119442 | 3300005289 | Bacteria | 1796 |
| 64 | Ga0065707_10081939 | 3300005295 | Bacteria | 28637 |
| 65 | Ga0070676_10024271 | 3300005328 | Bacteria | 3414 |
| 66 | Ga0070676_10070055 | 3300005328 | Bacteria | 2103 |
| 67 | Ga0070683_100052323 | 3300005329 | Bacteria | 3783 |
| 68 | Ga0070683_100071927 | 3300005329 | Bacteria | 3228 |
| 69 | Ga0070690_100013344 | 3300005330 | Bacteria | 4852 |
| 70 | Ga0070670_100038495 | 3300005331 | Bacteria | 4112 |
| 71 | Ga0070670_100203478 | 3300005331 | Bacteria | 1720 |
| 72 | Ga0070677_10001509 | 3300005333 | Bacteria | 7370 |
| 73 | Ga0070677_10038033 | 3300005333 | Bacteria | 1881 |
| 74 | Ga0068869_100033038 | 3300005334 | Bacteria | 3650 |
| 75 | Ga0068869_100123908 | 3300005334 | Bacteria | 1980 |
| 76 | Ga0070666_10012908 | 3300005335 | Bacteria | 5284 |
| 77 | Ga0070666_10034478 | 3300005335 | Bacteria | 3354 |
| 78 | Ga0070666_10269555 | 3300005335 | Bacteria | 1208 |
| 79 | Ga0068868_100010659 | 3300005338 | Bacteria | 6662 |
| 80 | Ga0068868_100020394 | 3300005338 | Bacteria | 4979 |
| 81 | Ga0068868_100024897 | 3300005338 | Bacteria | 4545 |
| 82 | Ga0068868_100079151 | 3300005338 | Bacteria | 2633 |
| 83 | Ga0070687_100011369 | 3300005343 | Bacteria | 3892 |
| 84 | Ga0070687_100081563 | 3300005343 | Bacteria | 1766 |
| 85 | Ga0070661_100001480 | 3300005344 | Bacteria | 16303 |
| 86 | Ga0070661_100007936 | 3300005344 | Bacteria | 7329 |
| 87 | Ga0070661_100119931 | 3300005344 | Bacteria | 1969 |
| 88 | Ga0070668_100004749 | 3300005347 | Bacteria | 10080 |
| 89 | Ga0070668_100048819 | 3300005347 | Bacteria | 3256 |
| 90 | Ga0070669_100005812 | 3300005353 | Bacteria | 8897 |
| 91 | Ga0070669_100078644 | 3300005353 | Bacteria | 2452 |
| 92 | Ga0070675_100006120 | 3300005354 | Bacteria | 9227 |
| 93 | Ga0070675_100023293 | 3300005354 | Bacteria | 4950 |
| 94 | Ga0070675_100031516 | 3300005354 | Bacteria | 4286 |
| 95 | Ga0070675_100071647 | 3300005354 | Bacteria | 2876 |
| 96 | Ga0070675_100154830 | 3300005354 | Bacteria | 1967 |
| 97 | Ga0070674_100008402 | 3300005356 | Bacteria | 6147 |
| 98 | Ga0070674_100075724 | 3300005356 | Bacteria | 2391 |
| 99 | Ga0070674_100093906 | 3300005356 | Bacteria | 2171 |
| 100 | Ga0070673_100009720 | 3300005364 | Bacteria | 6470 |
| 101 | Ga0070673_100023472 | 3300005364 | Bacteria | 4507 |
| 102 | Ga0070673_100257388 | 3300005364 | Bacteria | 1523 |
| 103 | Ga0070688_100119227 | 3300005365 | Bacteria | 1765 |
| 104 | Ga0070659_100000895 | 3300005366 | Bacteria | 21810 |
| 105 | Ga0070659_100043221 | 3300005366 | Bacteria | 3524 |
| 106 | Ga0070659_100153206 | 3300005366 | Bacteria | 1881 |
| 107 | Ga0070667_100003317 | 3300005367 | Bacteria | 13761 |
| 108 | Ga0070667_100014226 | 3300005367 | Bacteria | 6573 |
| 109 | Ga0070667_100022123 | 3300005367 | Bacteria | 5273 |
| 110 | Ga0070667_100063120 | 3300005367 | Bacteria | 3138 |
| 111 | Ga0070667_100068630 | 3300005367 | Bacteria | 3017 |
| 112 | Ga0070667_100106220 | 3300005367 | Bacteria | 2430 |
| 113 | Ga0070667_100170864 | 3300005367 | Bacteria | 1919 |
| 114 | Ga0070694_100223237 | 3300005444 | Bacteria | 1414 |
| 115 | Ga0070663_100001333 | 3300005455 | Bacteria | 13499 |
| 116 | Ga0070663_100014640 | 3300005455 | Bacteria | 5039 |
| 117 | Ga0070663_100027849 | 3300005455 | Bacteria | 3841 |
| 118 | Ga0070678_100009248 | 3300005456 | Bacteria | 5957 |
| 119 | Ga0070678_100032205 | 3300005456 | Bacteria | 3626 |
| 120 | Ga0070678_100068262 | 3300005456 | Bacteria | 2650 |
| 121 | Ga0070678_100152233 | 3300005456 | Bacteria | 1864 |
| 122 | Ga0070662_100027320 | 3300005457 | Bacteria | 3959 |
| 123 | Ga0070662_100027728 | 3300005457 | Bacteria | 3935 |
| 124 | Ga0070662_100037558 | 3300005457 | Bacteria | 3434 |
| 125 | Ga0070662_100038825 | 3300005457 | Bacteria | 3384 |
| 126 | Ga0070662_100041597 | 3300005457 | Bacteria | 3279 |
| 127 | Ga0070662_100051987 | 3300005457 | Bacteria | 2961 |
| 128 | Ga0070662_100072755 | 3300005457 | Bacteria | 2539 |
| 129 | Ga0070662_100171740 | 3300005457 | Bacteria | 1703 |
| 130 | Ga0068867_100001695 | 3300005459 | Bacteria | 15364 |
| 131 | Ga0068867_100012152 | 3300005459 | Bacteria | 6083 |
| 132 | Ga0068867_100012224 | 3300005459 | Bacteria | 6067 |
| 133 | Ga0068867_100068070 | 3300005459 | Bacteria | 2656 |
| 134 | Ga0068867_100075899 | 3300005459 | Bacteria | 2522 |
| 135 | Ga0070685_10129182 | 3300005466 | Bacteria | 1578 |
| 136 | Ga0070706_100073922 | 3300005467 | Bacteria | 3156 |
| 137 | Ga0070679_100006195 | 3300005530 | Bacteria | 11138 |
| 138 | Ga0068853_100039596 | 3300005539 | Bacteria | 4020 |
| 139 | Ga0068853_100055956 | 3300005539 | Bacteria | 3400 |
| 140 | Ga0070672_100002003 | 3300005543 | Bacteria | 12792 |
| 141 | Ga0070672_100016349 | 3300005543 | Bacteria | 5311 |
| 142 | Ga0070672_100018179 | 3300005543 | Bacteria | 5075 |
| 143 | Ga0070672_100048771 | 3300005543 | Bacteria | 3292 |
| 144 | Ga0070672_100073007 | 3300005543 | Bacteria | 2733 |
| 145 | Ga0070672_100111880 | 3300005543 | Bacteria | 2226 |
| 146 | Ga0070672_100123330 | 3300005543 | Bacteria | 2123 |
| 147 | Ga0070664_100012448 | 3300005564 | Bacteria | 6915 |
| 148 | Ga0070664_100026777 | 3300005564 | Bacteria | 4787 |
| 149 | Ga0070664_100066596 | 3300005564 | Bacteria | 3076 |
| 150 | Ga0070664_100104387 | 3300005564 | Bacteria | 2468 |
| 151 | Ga0070664_100254324 | 3300005564 | Bacteria | 1580 |
| 152 | Ga0068857_100045560 | 3300005577 | Bacteria | 3891 |
| 153 | Ga0068857_100133456 | 3300005577 | Bacteria | 2241 |
| 154 | Ga0068857_100211746 | 3300005577 | Bacteria | 1769 |
| 155 | Ga0068856_100011617 | 3300005614 | Bacteria | 8542 |
| 156 | Ga0068852_100013224 | 3300005616 | Bacteria | 6309 |
| 157 | Ga0068852_100098100 | 3300005616 | Bacteria | 2638 |
| 158 | Ga0068852_100152189 | 3300005616 | Bacteria | 2152 |
| 159 | Ga0068859_100020694 | 3300005617 | Bacteria | 6603 |
| 160 | Ga0068859_100138376 | 3300005617 | Bacteria | 2509 |
| 161 | Ga0068859_100285296 | 3300005617 | Bacteria | 1744 |
| 162 | Ga0068864_100003870 | 3300005618 | Bacteria | 12325 |
| 163 | Ga0068864_100050348 | 3300005618 | Bacteria | 3585 |
| 164 | Ga0068864_100128344 | 3300005618 | Bacteria | 2275 |
| 165 | Ga0068866_10024439 | 3300005718 | Bacteria | 2825 |
| 166 | Ga0068861_100004497 | 3300005719 | Bacteria | 9359 |
| 167 | Ga0068861_100011784 | 3300005719 | Bacteria | 6085 |
| 168 | Ga0068861_100150581 | 3300005719 | Bacteria | 1908 |
| 169 | Ga0068851_10036782 | 3300005834 | Bacteria | 2452 |
| 170 | Ga0068863_100002141 | 3300005841 | Bacteria | 19598 |
| 171 | Ga0068863_100031883 | 3300005841 | Bacteria | 5027 |
| 172 | Ga0068863_100052117 | 3300005841 | Bacteria | 3878 |
| 173 | Ga0068858_100001584 | 3300005842 | Bacteria | 23228 |
| 174 | Ga0068858_100010943 | 3300005842 | Bacteria | 8575 |
| 175 | Ga0068858_100103729 | 3300005842 | Bacteria | 2653 |
| 176 | Ga0068860_100001910 | 3300005843 | Bacteria | 22116 |
| 177 | Ga0068860_100014499 | 3300005843 | Bacteria | 7714 |
| 178 | Ga0068862_100004043 | 3300005844 | Bacteria | 12431 |
| 179 | Ga0068862_100032435 | 3300005844 | Bacteria | 4414 |
| 180 | Ga0081455_10042458 | 3300005937 | Bacteria | 3988 |
| 181 | Ga0075363_100042299 | 3300006048 | Bacteria | 2407 |
| 182 | Ga0075363_100076636 | 3300006048 | Bacteria | 1824 |
| 183 | Ga0075364_10042087 | 3300006051 | Bacteria | 2967 |
| 184 | Ga0075364_10065652 | 3300006051 | Bacteria | 2382 |
| 185 | Ga0075432_10078022 | 3300006058 | Bacteria | 1197 |
| 186 | Ga0075367_10075388 | 3300006178 | Bacteria | 2034 |
| 187 | Ga0075366_10001872 | 3300006195 | Bacteria | 10611 |
| 188 | Ga0075366_10002038 | 3300006195 | Bacteria | 10253 |
| 189 | Ga0075366_10002642 | 3300006195 | Bacteria | 9232 |
| 190 | Ga0075366_10019111 | 3300006195 | Bacteria | 3960 |
| 191 | Ga0075366_10022185 | 3300006195 | Bacteria | 3692 |
| 192 | Ga0075366_10036912 | 3300006195 | Bacteria | 2882 |
| 193 | Ga0097621_100028821 | 3300006237 | Bacteria | 4379 |
| 194 | Ga0097621_100048534 | 3300006237 | Bacteria | 3444 |
| 195 | Ga0075370_10000167 | 3300006353 | Bacteria | 22616 |
| 196 | Ga0075370_10000719 | 3300006353 | Bacteria | 13125 |
| 197 | Ga0075370_10001130 | 3300006353 | Bacteria | 11191 |
| 198 | Ga0075370_10001256 | 3300006353 | Bacteria | 10806 |
| 199 | Ga0075370_10003689 | 3300006353 | Bacteria | 7332 |
| 200 | Ga0075370_10007483 | 3300006353 | Bacteria | 5565 |
| 201 | Ga0075370_10010571 | 3300006353 | Bacteria | 4831 |
| 202 | Ga0075370_10010698 | 3300006353 | Bacteria | 4809 |
| 203 | Ga0075370_10036557 | 3300006353 | Bacteria | 2759 |
| 204 | Ga0068871_100013614 | 3300006358 | Bacteria | 6040 |
| 205 | Ga0068871_100053243 | 3300006358 | Bacteria | 3279 |
| 206 | Ga0068871_100122983 | 3300006358 | Bacteria | 2194 |
| 207 | Ga0068871_100194356 | 3300006358 | Bacteria | 1749 |
| 208 | Ga0075434_100210582 | 3300006871 | Bacteria | 1964 |
| 209 | Ga0075429_100001027 | 3300006880 | Bacteria | 22297 |
| 210 | Ga0097620_100020694 | 3300006931 | Bacteria | 6603 |
| 211 | Ga0097620_100138375 | 3300006931 | Bacteria | 2509 |
| 212 | Ga0097620_100285271 | 3300006931 | Bacteria | 1744 |
| 213 | Ga0099823_1009799 | 3300006944 | Bacteria | 9735 |
| 214 | Ga0079104_1000003 | 3300006946 | Bacteria | 468966 |
| 215 | Ga0079104_1000017 | 3300006946 | Bacteria | 313784 |
| 216 | Ga0105250_10006594 | 3300009092 | Bacteria | 5055 |
| 217 | Ga0105240_10060587 | 3300009093 | Bacteria | 4718 |
| 218 | Ga0105240_10166101 | 3300009093 | Bacteria | 2618 |
| 219 | Ga0111539_10558671 | 3300009094 | Bacteria | 1333 |
| 220 | Ga0105243_10001185 | 3300009148 | Bacteria | 23541 |
| 221 | Ga0105243_10009310 | 3300009148 | Bacteria | 7491 |
| 222 | Ga0105241_10050916 | 3300009174 | Bacteria | 3157 |
| 223 | Ga0105242_10000453 | 3300009176 | Bacteria | 32663 |
| 224 | Ga0105242_10061013 | 3300009176 | Bacteria | 3100 |
| 225 | Ga0105248_10020330 | 3300009177 | Bacteria | 7355 |
| 226 | Ga0105248_10026443 | 3300009177 | Bacteria | 6456 |
| 227 | Ga0105248_10046549 | 3300009177 | Bacteria | 4862 |
| 228 | Ga0105248_10156522 | 3300009177 | Bacteria | 2571 |
| 229 | Ga0105248_10193669 | 3300009177 | Bacteria | 2290 |
| 230 | Ga0105248_10516871 | 3300009177 | Bacteria | 1346 |
| 231 | Ga0105237_10122139 | 3300009545 | Bacteria | 2599 |
| 232 | Ga0105238_10018116 | 3300009551 | Bacteria | 7161 |
| 233 | Ga0105238_10044211 | 3300009551 | Bacteria | 4504 |
| 234 | Ga0105249_10017708 | 3300009553 | Bacteria | 6327 |
| 235 | Ga0105249_10038194 | 3300009553 | Bacteria | 4356 |
| 236 | Ga0105239_10131653 | 3300010375 | Bacteria | 2782 |
| 237 | Ga0157319_1000010 | 3300012497 | Bacteria | 197331 |
| 238 | Ga0157326_1001365 | 3300012513 | Bacteria | 2703 |
| 239 | Ga0157371_10032792 | 3300013102 | Bacteria | 3736 |
| 240 | Ga0157370_10008137 | 3300013104 | Bacteria | 11346 |
| 241 | Ga0157370_10314169 | 3300013104 | Bacteria | 1446 |
| 242 | Ga0157369_10085797 | 3300013105 | Bacteria | 3364 |
| 243 | Ga0157369_10137307 | 3300013105 | Bacteria | 2588 |
| 244 | Ga0157374_10020040 | 3300013296 | Bacteria | 5929 |
| 245 | Ga0157374_10030533 | 3300013296 | Bacteria | 4894 |
| 246 | Ga0157374_10199617 | 3300013296 | Bacteria | 1958 |
| 247 | Ga0157378_10000558 | 3300013297 | Bacteria | 35454 |
| 248 | Ga0157378_10061097 | 3300013297 | Bacteria | 3362 |
| 249 | Ga0157378_10144207 | 3300013297 | Bacteria | 2214 |
| 250 | Ga0163162_10009181 | 3300013306 | Bacteria | 9623 |
| 251 | Ga0163162_10024807 | 3300013306 | Bacteria | 5923 |
| 252 | Ga0163162_10031794 | 3300013306 | Bacteria | 5237 |
| 253 | Ga0163162_10033157 | 3300013306 | Bacteria | 5130 |
| 254 | Ga0163162_10364771 | 3300013306 | Bacteria | 1577 |
| 255 | Ga0157372_10095120 | 3300013307 | Bacteria | 3394 |
| 256 | Ga0157375_10008783 | 3300013308 | Bacteria | 8855 |
| 257 | Ga0157375_10021275 | 3300013308 | Bacteria | 5943 |
| 258 | Ga0157375_10039281 | 3300013308 | Bacteria | 4554 |
| 259 | Ga0157375_10063774 | 3300013308 | Bacteria | 3667 |
| 260 | Ga0157375_10093518 | 3300013308 | Bacteria | 3073 |
| 261 | Ga0163163_10017948 | 3300014325 | Bacteria | 6611 |
| 262 | Ga0157380_10016835 | 3300014326 | Bacteria | 5398 |
| 263 | Ga0157380_10031042 | 3300014326 | Bacteria | 4099 |
| 264 | Ga0157380_10332189 | 3300014326 | Bacteria | 1414 |
| 265 | Ga0182008_10001333 | 3300014497 | Bacteria | 16811 |
| 266 | Ga0182008_10015908 | 3300014497 | Bacteria | 3917 |
| 267 | Ga0182008_10084691 | 3300014497 | Bacteria | 1561 |
| 268 | Ga0157377_10000028 | 3300014745 | Bacteria | 134810 |
| 269 | Ga0157379_10017086 | 3300014968 | Bacteria | 6387 |
| 270 | Ga0157379_10027080 | 3300014968 | Bacteria | 5102 |
| 271 | Ga0157379_10028234 | 3300014968 | Bacteria | 4994 |
| 272 | Ga0157379_10046145 | 3300014968 | Bacteria | 3888 |
| 273 | Ga0157379_10116340 | 3300014968 | Bacteria | 2405 |
| 274 | Ga0157379_10167652 | 3300014968 | Bacteria | 1982 |
| 275 | Ga0157376_10090511 | 3300014969 | Bacteria | 2648 |
| 276 | Ga0182006_1003396 | 3300015261 | Bacteria | 8152 |
| 277 | Ga0182007_10022577 | 3300015262 | Bacteria | 2220 |
| 278 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 279 | Ga0163161_10006225 | 3300017792 | Bacteria | 8270 |
| 280 | Ga0163161_10017349 | 3300017792 | Bacteria | 5038 |
| 281 | Ga0163161_10089002 | 3300017792 | Bacteria | 2283 |
| 282 | Ga0163161_10139077 | 3300017792 | Bacteria | 1837 |
| 283 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 284 | Ga0209672_100628 | 3300025228 | Bacteria | 18239 |
| 285 | Ga0209147_101067 | 3300025229 | Bacteria | 11568 |
| 286 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 287 | Ga0207425_1000235 | 3300025245 | Bacteria | 42925 |
| 288 | Ga0207425_1000519 | 3300025245 | Bacteria | 23496 |
| 289 | Ga0207425_1002451 | 3300025245 | Bacteria | 6518 |
| 290 | Ga0207425_1007765 | 3300025245 | Bacteria | 2800 |
| 291 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 292 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 293 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 294 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 295 | Ga0209129_1000013 | 3300025258 | Bacteria | 524874 |
| 296 | Ga0209129_1000075 | 3300025258 | Bacteria | 201273 |
| 297 | Ga0209565_1000028 | 3300025263 | Bacteria | 348536 |
| 298 | Ga0209565_1000587 | 3300025263 | Bacteria | 24582 |
| 299 | Ga0209565_1001309 | 3300025263 | Bacteria | 11439 |
| 300 | Ga0209673_1000035 | 3300025273 | Bacteria | 328411 |
| 301 | Ga0209673_1000279 | 3300025273 | Bacteria | 96141 |
| 302 | Ga0209673_1001569 | 3300025273 | Bacteria | 20372 |
| 303 | Ga0209673_1005270 | 3300025273 | Bacteria | 6566 |
| 304 | Ga0209673_1009154 | 3300025273 | Bacteria | 4322 |
| 305 | Ga0209130_1000052 | 3300025284 | Bacteria | 216971 |
| 306 | Ga0209130_1000112 | 3300025284 | Bacteria | 131607 |
| 307 | Ga0209130_1000158 | 3300025284 | Bacteria | 101323 |
| 308 | Ga0209130_1000363 | 3300025284 | Bacteria | 51603 |
| 309 | Ga0209675_1000490 | 3300025291 | Bacteria | 29771 |
| 310 | Ga0209675_1000662 | 3300025291 | Bacteria | 24203 |
| 311 | Ga0209676_1000069 | 3300025292 | Bacteria | 312462 |
| 312 | Ga0209676_1009320 | 3300025292 | Bacteria | 4248 |
| 313 | Ga0209025_1000103 | 3300025294 | Bacteria | 228054 |
| 314 | Ga0209025_1000169 | 3300025294 | Bacteria | 161428 |
| 315 | Ga0209025_1005988 | 3300025294 | Bacteria | 9662 |
| 316 | Ga0209025_1012424 | 3300025294 | Bacteria | 5457 |
| 317 | Ga0209025_1033092 | 3300025294 | Bacteria | 2398 |
| 318 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 319 | Ga0209564_1000046 | 3300025295 | Bacteria | 373787 |
| 320 | Ga0209564_1000822 | 3300025295 | Bacteria | 42276 |
| 321 | Ga0209564_1001252 | 3300025295 | Bacteria | 28203 |
| 322 | Ga0209564_1001892 | 3300025295 | Bacteria | 18788 |
| 323 | Ga0209564_1003304 | 3300025295 | Bacteria | 11202 |
| 324 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 325 | Ga0209758_1000067 | 3300025297 | Bacteria | 288575 |
| 326 | Ga0209758_1009236 | 3300025297 | Bacteria | 6183 |
| 327 | Ga0209758_1017756 | 3300025297 | Bacteria | 3521 |
| 328 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 329 | Ga0209050_1000202 | 3300025298 | Bacteria | 133468 |
| 330 | Ga0209050_1000919 | 3300025298 | Bacteria | 38782 |
| 331 | Ga0209050_1002480 | 3300025298 | Bacteria | 15663 |
| 332 | Ga0209050_1004530 | 3300025298 | Bacteria | 9343 |
| 333 | Ga0209050_1004531 | 3300025298 | Bacteria | 9342 |
| 334 | Ga0209050_1005114 | 3300025298 | Bacteria | 8441 |
| 335 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 336 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 337 | Ga0209256_1000077 | 3300025299 | Bacteria | 230410 |
| 338 | Ga0209256_1000121 | 3300025299 | Bacteria | 167299 |
| 339 | Ga0209256_1000204 | 3300025299 | Bacteria | 112000 |
| 340 | Ga0209256_1004433 | 3300025299 | Bacteria | 8822 |
| 341 | Ga0209256_1025326 | 3300025299 | Bacteria | 1730 |
| 342 | Ga0207426_1000101 | 3300025302 | Bacteria | 262096 |
| 343 | Ga0207426_1000129 | 3300025302 | Bacteria | 210930 |
| 344 | Ga0207426_1000153 | 3300025302 | Bacteria | 182839 |
| 345 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 346 | Ga0209051_1000024 | 3300025303 | Bacteria | 437007 |
| 347 | Ga0209051_1001172 | 3300025303 | Bacteria | 23803 |
| 348 | Ga0209051_1002779 | 3300025303 | Bacteria | 12066 |
| 349 | Ga0209051_1005838 | 3300025303 | Bacteria | 7082 |
| 350 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 351 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 352 | Ga0209257_1000079 | 3300025304 | Bacteria | 316420 |
| 353 | Ga0209257_1001164 | 3300025304 | Bacteria | 33458 |
| 354 | Ga0209257_1002118 | 3300025304 | Bacteria | 20730 |
| 355 | Ga0209257_1002981 | 3300025304 | Bacteria | 15411 |
| 356 | Ga0209257_1005195 | 3300025304 | Bacteria | 9349 |
| 357 | Ga0209257_1010355 | 3300025304 | Bacteria | 4739 |
| 358 | Ga0209257_1014066 | 3300025304 | Bacteria | 3480 |
| 359 | Ga0207697_10016551 | 3300025315 | Bacteria | 3037 |
| 360 | Ga0207697_10021324 | 3300025315 | Bacteria | 2653 |
| 361 | Ga0207656_10008342 | 3300025321 | Bacteria | 3809 |
| 362 | Ga0207656_10013005 | 3300025321 | Bacteria | 3172 |
| 363 | Ga0207656_10015171 | 3300025321 | Bacteria | 2979 |
| 364 | Ga0207696_1010287 | 3300025711 | Bacteria | 3438 |
| 365 | Ga0207655_1007289 | 3300025728 | Bacteria | 7194 |
| 366 | Ga0207682_10002379 | 3300025893 | Bacteria | 8471 |
| 367 | Ga0207682_10008373 | 3300025893 | Bacteria | 4091 |
| 368 | Ga0207682_10019881 | 3300025893 | Bacteria | 2633 |
| 369 | Ga0207645_10007602 | 3300025907 | Bacteria | 7638 |
| 370 | Ga0207645_10026945 | 3300025907 | Bacteria | 3714 |
| 371 | Ga0207645_10101935 | 3300025907 | Bacteria | 1852 |
| 372 | Ga0207705_10048902 | 3300025909 | Bacteria | 3043 |
| 373 | Ga0207671_10120879 | 3300025914 | Bacteria | 2002 |
| 374 | Ga0207660_10145054 | 3300025917 | Bacteria | 1818 |
| 375 | Ga0207662_10022590 | 3300025918 | Bacteria | 3608 |
| 376 | Ga0207662_10086052 | 3300025918 | Bacteria | 1926 |
| 377 | Ga0207657_10216015 | 3300025919 | Bacteria | 1537 |
| 378 | Ga0207649_10001227 | 3300025920 | Bacteria | 15398 |
| 379 | Ga0207649_10071463 | 3300025920 | Bacteria | 2216 |
| 380 | Ga0207652_10002539 | 3300025921 | Bacteria | 15323 |
| 381 | Ga0207681_10011771 | 3300025923 | Bacteria | 5381 |
| 382 | Ga0207681_10185343 | 3300025923 | Bacteria | 1588 |
| 383 | Ga0207694_10021004 | 3300025924 | Bacteria | 4942 |
| 384 | Ga0207650_10006268 | 3300025925 | Bacteria | 8104 |
| 385 | Ga0207650_10007691 | 3300025925 | Bacteria | 7340 |
| 386 | Ga0207650_10076908 | 3300025925 | Bacteria | 2522 |
| 387 | Ga0207659_10003024 | 3300025926 | Bacteria | 10030 |
| 388 | Ga0207659_10010792 | 3300025926 | Bacteria | 5749 |
| 389 | Ga0207659_10037306 | 3300025926 | Bacteria | 3373 |
| 390 | Ga0207659_10050662 | 3300025926 | Bacteria | 2951 |
| 391 | Ga0207659_10064108 | 3300025926 | Bacteria | 2658 |
| 392 | Ga0207659_10231266 | 3300025926 | Bacteria | 1491 |
| 393 | Ga0207659_10305966 | 3300025926 | Bacteria | 1307 |
| 394 | Ga0207644_10061994 | 3300025931 | Bacteria | 2710 |
| 395 | Ga0207690_10005538 | 3300025932 | Bacteria | 7454 |
| 396 | Ga0207706_10000845 | 3300025933 | Bacteria | 31549 |
| 397 | Ga0207706_10021167 | 3300025933 | Bacteria | 5844 |
| 398 | Ga0207706_10046558 | 3300025933 | Bacteria | 3840 |
| 399 | Ga0207706_10087408 | 3300025933 | Bacteria | 2741 |
| 400 | Ga0207706_10123099 | 3300025933 | Bacteria | 2282 |
| 401 | Ga0207706_10124154 | 3300025933 | Bacteria | 2271 |
| 402 | Ga0207706_10156586 | 3300025933 | Bacteria | 2003 |
| 403 | Ga0207686_10004663 | 3300025934 | Bacteria | 7346 |
| 404 | Ga0207686_10017750 | 3300025934 | Bacteria | 4015 |
| 405 | Ga0207686_10062762 | 3300025934 | Bacteria | 2361 |
| 406 | Ga0207709_10000032 | 3300025935 | Bacteria | 324478 |
| 407 | Ga0207709_10001212 | 3300025935 | Bacteria | 18545 |
| 408 | Ga0207709_10002462 | 3300025935 | Bacteria | 11620 |
| 409 | Ga0207709_10025234 | 3300025935 | Bacteria | 3402 |
| 410 | Ga0207669_10009749 | 3300025937 | Bacteria | 4590 |
| 411 | Ga0207669_10035146 | 3300025937 | Bacteria | 2848 |
| 412 | Ga0207669_10047435 | 3300025937 | Bacteria | 2545 |
| 413 | Ga0207669_10148757 | 3300025937 | Bacteria | 1637 |
| 414 | Ga0207704_10003573 | 3300025938 | Bacteria | 7066 |
| 415 | Ga0207704_10019101 | 3300025938 | Bacteria | 3594 |
| 416 | Ga0207704_10190416 | 3300025938 | Bacteria | 1492 |
| 417 | Ga0207691_10000944 | 3300025940 | Bacteria | 28788 |
| 418 | Ga0207691_10010958 | 3300025940 | Bacteria | 8700 |
| 419 | Ga0207691_10011136 | 3300025940 | Bacteria | 8632 |
| 420 | Ga0207691_10018444 | 3300025940 | Bacteria | 6613 |
| 421 | Ga0207691_10044478 | 3300025940 | Bacteria | 4088 |
| 422 | Ga0207691_10044937 | 3300025940 | Bacteria | 4063 |
| 423 | Ga0207691_10089394 | 3300025940 | Bacteria | 2762 |
| 424 | Ga0207691_10099071 | 3300025940 | Bacteria | 2603 |
| 425 | Ga0207691_10177981 | 3300025940 | Bacteria | 1859 |
| 426 | Ga0207691_10227737 | 3300025940 | Bacteria | 1615 |
| 427 | Ga0207711_10013379 | 3300025941 | Bacteria | 6816 |
| 428 | Ga0207711_10046340 | 3300025941 | Bacteria | 3714 |
| 429 | Ga0207711_10056715 | 3300025941 | Bacteria | 3366 |
| 430 | Ga0207711_10081721 | 3300025941 | Bacteria | 2824 |
| 431 | Ga0207689_10000225 | 3300025942 | Bacteria | 50122 |
| 432 | Ga0207689_10156758 | 3300025942 | Bacteria | 1877 |
| 433 | Ga0207679_10000864 | 3300025945 | Bacteria | 19388 |
| 434 | Ga0207679_10021206 | 3300025945 | Bacteria | 4400 |
| 435 | Ga0207679_10029761 | 3300025945 | Bacteria | 3805 |
| 436 | Ga0207679_10094033 | 3300025945 | Bacteria | 2326 |
| 437 | Ga0207651_10006251 | 3300025960 | Bacteria | 6208 |
| 438 | Ga0207651_10061262 | 3300025960 | Bacteria | 2616 |
| 439 | Ga0207712_10142876 | 3300025961 | Bacteria | 1839 |
| 440 | Ga0207668_10014832 | 3300025972 | Bacteria | 4830 |
| 441 | Ga0207668_10173564 | 3300025972 | Bacteria | 1693 |
| 442 | Ga0207658_10003189 | 3300025986 | Bacteria | 11689 |
| 443 | Ga0207658_10006549 | 3300025986 | Bacteria | 7942 |
| 444 | Ga0207658_10021149 | 3300025986 | Bacteria | 4512 |
| 445 | Ga0207658_10116768 | 3300025986 | Bacteria | 2120 |
| 446 | Ga0207677_10003900 | 3300026023 | Bacteria | 7942 |
| 447 | Ga0207677_10035679 | 3300026023 | Bacteria | 3232 |
| 448 | Ga0207677_10088153 | 3300026023 | Bacteria | 2249 |
| 449 | Ga0207703_10001484 | 3300026035 | Bacteria | 21390 |
| 450 | Ga0207703_10032892 | 3300026035 | Bacteria | 4107 |
| 451 | Ga0207703_10089633 | 3300026035 | Bacteria | 2583 |
| 452 | Ga0207703_10144035 | 3300026035 | Bacteria | 2071 |
| 453 | Ga0207639_10166516 | 3300026041 | Bacteria | 1863 |
| 454 | Ga0207639_10191056 | 3300026041 | Bacteria | 1749 |
| 455 | Ga0207639_10271338 | 3300026041 | Bacteria | 1488 |
| 456 | Ga0207639_10309361 | 3300026041 | Bacteria | 1399 |
| 457 | Ga0207678_10012524 | 3300026067 | Bacteria | 7448 |
| 458 | Ga0207678_10065269 | 3300026067 | Bacteria | 3126 |
| 459 | Ga0207678_10117339 | 3300026067 | Bacteria | 2271 |
| 460 | Ga0207678_10172832 | 3300026067 | Bacteria | 1845 |
| 461 | Ga0207702_10036064 | 3300026078 | Bacteria | 4135 |
| 462 | Ga0207641_10008519 | 3300026088 | Bacteria | 8470 |
| 463 | Ga0207641_10021323 | 3300026088 | Bacteria | 5326 |
| 464 | Ga0207648_10000146 | 3300026089 | Bacteria | 70573 |
| 465 | Ga0207648_10002481 | 3300026089 | Bacteria | 19810 |
| 466 | Ga0207648_10005079 | 3300026089 | Bacteria | 13337 |
| 467 | Ga0207648_10033097 | 3300026089 | Bacteria | 4560 |
| 468 | Ga0207648_10145787 | 3300026089 | Bacteria | 2088 |
| 469 | Ga0207648_10153981 | 3300026089 | Bacteria | 2029 |
| 470 | Ga0207676_10016086 | 3300026095 | Bacteria | 5410 |
| 471 | Ga0207676_10019189 | 3300026095 | Bacteria | 4983 |
| 472 | Ga0207676_10026201 | 3300026095 | Bacteria | 4335 |
| 473 | Ga0207676_10162301 | 3300026095 | Bacteria | 1937 |
| 474 | Ga0207676_10222930 | 3300026095 | Bacteria | 1680 |
| 475 | Ga0207674_10021396 | 3300026116 | Bacteria | 6963 |
| 476 | Ga0207674_10050451 | 3300026116 | Bacteria | 4251 |
| 477 | Ga0207674_10149734 | 3300026116 | Bacteria | 2291 |
| 478 | Ga0207675_100004297 | 3300026118 | Bacteria | 13767 |
| 479 | Ga0207675_100007940 | 3300026118 | Bacteria | 10008 |
| 480 | Ga0207675_100125768 | 3300026118 | Bacteria | 2428 |
| 481 | Ga0207683_10012690 | 3300026121 | Bacteria | 7187 |
| 482 | Ga0207683_10013995 | 3300026121 | Bacteria | 6840 |
| 483 | Ga0207683_10103552 | 3300026121 | Bacteria | 2543 |
| 484 | Ga0207683_10113636 | 3300026121 | Bacteria | 2425 |
| 485 | Ga0207683_10126947 | 3300026121 | Bacteria | 2292 |
| 486 | Ga0207683_10137667 | 3300026121 | Bacteria | 2198 |
| 487 | Ga0207683_10192397 | 3300026121 | Bacteria | 1852 |
| 488 | Ga0207698_10001243 | 3300026142 | Bacteria | 14895 |
| 489 | Ga0207698_10030755 | 3300026142 | Bacteria | 3866 |
| 490 | Ga0207698_10074112 | 3300026142 | Bacteria | 2714 |
| 491 | Ga0207698_10190839 | 3300026142 | Bacteria | 1825 |
| 492 | Ga0207698_10261807 | 3300026142 | Bacteria | 1589 |
| 493 | Ga0207698_10406829 | 3300026142 | Bacteria | 1302 |
| 494 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 495 | Ga0209281_1000042 | 3300027111 | Bacteria | 344748 |
| 496 | Ga0209389_1014524 | 3300027296 | Bacteria | 7155 |
| 497 | Ga0209981_1007857 | 3300027378 | Bacteria | 1444 |
| 498 | Ga0209999_1000544 | 3300027543 | Bacteria | 5910 |
| 499 | Ga0209971_1002891 | 3300027682 | Bacteria | 4100 |
| 500 | Ga0209966_1000036 | 3300027695 | Bacteria | 55883 |
| 501 | Ga0209974_10000455 | 3300027876 | Bacteria | 13596 |
| 502 | Ga0268265_10005309 | 3300028380 | Bacteria | 8830 |
| 503 | Ga0268264_10011851 | 3300028381 | Bacteria | 7185 |
| 504 | Ga0268264_10015393 | 3300028381 | Bacteria | 6271 |
| 505 | Ga0307517_10115516 | 3300028786 | Bacteria | 2014 |
| 506 | Ga0307517_10124787 | 3300028786 | Bacteria | 1884 |
| 507 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 508 | Ga0307515_10000053 | 3300028794 | Bacteria | 266512 |
| 509 | Ga0307515_10000529 | 3300028794 | Bacteria | 90388 |
| 510 | Ga0307515_10005082 | 3300028794 | Bacteria | 26754 |
| 511 | Ga0307515_10006495 | 3300028794 | Bacteria | 23397 |
| 512 | Ga0307515_10104200 | 3300028794 | Bacteria | 3392 |
| 513 | Ga0307515_10119380 | 3300028794 | Bacteria | 3000 |
| 514 | Ga0265330_10000014 | 3300031235 | Bacteria | 175673 |
| 515 | Ga0265332_10000011 | 3300031238 | Bacteria | 284299 |
| 516 | Ga0265328_10009555 | 3300031239 | Bacteria | 3946 |
| 517 | Ga0265325_10044997 | 3300031241 | Bacteria | 2295 |
| 518 | Ga0265331_10019144 | 3300031250 | Bacteria | 3538 |
| 519 | Ga0265327_10000184 | 3300031251 | Bacteria | 133023 |
| 520 | Ga0265327_10000355 | 3300031251 | Bacteria | 87181 |
| 521 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 522 | Ga0307513_10000015 | 3300031456 | Bacteria | 296183 |
| 523 | Ga0307513_10006695 | 3300031456 | Bacteria | 15034 |
| 524 | Ga0307513_10212349 | 3300031456 | Bacteria | 1765 |
| 525 | Ga0307513_10254241 | 3300031456 | Bacteria | 1551 |
| 526 | Ga0307509_10082658 | 3300031507 | Bacteria | 3313 |
| 527 | Ga0307408_100000150 | 3300031548 | Bacteria | 77682 |
| 528 | Ga0307408_100312909 | 3300031548 | Bacteria | 1320 |
| 529 | Ga0307408_100416696 | 3300031548 | Bacteria | 1157 |
| 530 | Ga0307508_10000004 | 3300031616 | Bacteria | 287547 |
| 531 | Ga0307514_10001404 | 3300031649 | Bacteria | 29857 |
| 532 | Ga0307514_10064671 | 3300031649 | Bacteria | 2773 |
| 533 | Ga0265314_10000026 | 3300031711 | Bacteria | 284299 |
| 534 | Ga0265342_10130266 | 3300031712 | Bacteria | 1410 |
| 535 | Ga0307516_10000497 | 3300031730 | Bacteria | 52295 |
| 536 | Ga0307516_10003104 | 3300031730 | Bacteria | 21606 |
| 537 | Ga0307516_10003697 | 3300031730 | Bacteria | 19455 |
| 538 | Ga0307516_10095734 | 3300031730 | Bacteria | 2791 |
| 539 | Ga0307516_10109150 | 3300031730 | Bacteria | 2573 |
| 540 | Ga0307516_10272720 | 3300031730 | Bacteria | 1377 |
| 541 | Ga0307405_10004178 | 3300031731 | Bacteria | 6796 |
| 542 | Ga0307413_10000382 | 3300031824 | Bacteria | 14204 |
| 543 | Ga0307413_10046773 | 3300031824 | Bacteria | 2576 |
| 544 | Ga0307410_10038494 | 3300031852 | Bacteria | 3133 |
| 545 | Ga0307406_10013196 | 3300031901 | Bacteria | 4729 |
| 546 | Ga0307406_10028804 | 3300031901 | Bacteria | 3358 |
| 547 | Ga0307406_10046459 | 3300031901 | Bacteria | 2732 |
| 548 | Ga0307412_10024767 | 3300031911 | Bacteria | 3708 |
| 549 | Ga0307409_100000086 | 3300031995 | Bacteria | 33256 |
| 550 | Ga0307409_100030709 | 3300031995 | Bacteria | 3865 |
| 551 | Ga0307409_100167534 | 3300031995 | Bacteria | 1930 |
| 552 | Ga0307416_100070093 | 3300032002 | Bacteria | 2905 |
| 553 | Ga0307416_100085870 | 3300032002 | Bacteria | 2680 |
| 554 | Ga0307416_100117761 | 3300032002 | Bacteria | 2359 |
| 555 | Ga0307416_100315228 | 3300032002 | Bacteria | 1563 |
| 556 | Ga0307416_100324400 | 3300032002 | Bacteria | 1544 |
| 557 | Ga0307416_100383021 | 3300032002 | Bacteria | 1437 |
| 558 | Ga0307411_10000869 | 3300032005 | Bacteria | 11391 |
| 559 | Ga0307411_10003562 | 3300032005 | Bacteria | 7250 |
| 560 | Ga0307415_100009938 | 3300032126 | Bacteria | 5365 |
| 561 | Ga0307415_100066344 | 3300032126 | Bacteria | 2518 |
| 562 | Ga0307507_10007188 | 3300033179 | Bacteria | 16399 |
| 563 | Ga0373948_0010692 | 3300034817 | Bacteria | 1608 |
| 564 | Ga0373950_0006394 | 3300034818 | Bacteria | 1795 |
| 565 | Ga0373939_0000069 | 3300035114 | Bacteria | 33328 |
| 566 | Ga0373960_0014790 | 3300035121 | Bacteria | 1982 |
| 567 | Ga0373931_0001617 | 3300035691 | Bacteria | 9757 |
| 568 | Ga0373927_0076598 | 3300035695 | Bacteria | 2166 |
| 569 | Ga0373937_0051389 | 3300036401 | Bacteria | 3778 |
| 570 | Ga0395899_0014146 | 3300037312 | Bacteria | 6090 |
| 571 | Ga0395900_0000109 | 3300037418 | Bacteria | 146053 |
| 572 | Ga0395900_0022771 | 3300037418 | Bacteria | 6410 |
| 573 | Ga0395900_0110563 | 3300037418 | Bacteria | 2823 |
| 574 | Ga0395898_0000868 | 3300037466 | Bacteria | 49428 |
| 575 | Ga0395898_0038551 | 3300037466 | Bacteria | 4735 |
| 576 | Ga0395905_0000377 | 3300037471 | Bacteria | 63595 |
| 577 | Ga0395905_0003562 | 3300037471 | Bacteria | 16585 |
| 578 | Ga0395905_0028880 | 3300037471 | Bacteria | 5227 |
| 579 | Ga0395905_0029126 | 3300037471 | Bacteria | 5204 |
| 580 | Ga0395905_0045312 | 3300037471 | Bacteria | 4125 |
| 581 | Ga0395905_0050200 | 3300037471 | Bacteria | 3909 |
| 582 | Ga0395905_0066244 | 3300037471 | Bacteria | 3382 |
| 583 | Ga0395905_0071033 | 3300037471 | Bacteria | 3264 |
| 584 | Ga0395905_0127146 | 3300037471 | Bacteria | 2396 |
| 585 | Ga0395905_0134402 | 3300037471 | Bacteria | 2326 |
| 586 | Ga0436365_1492983 | 3300039437 | Bacteria | 1255 |
| 587 | Ga0439465_0063323 | 3300041413 | Bacteria | 1228 |
| 588 | Ga0451789_0948633 | 3300041443 | Bacteria | 2267 |
| 589 | Ga0451800_1194461 | 3300041459 | Bacteria | 2440 |
| 590 | Ga0451802_0797663 | 3300041460 | Bacteria | 1669 |
| 591 | Ga0439449_0054938 | 3300042007 | Bacteria | 1471 |
| 592 | Ga0450917_000395 | 3300042120 | Bacteria | 3275 |
| 593 | Ga0450888_000086 | 3300042126 | Bacteria | 7140 |
| 594 | Ga0450890_000675 | 3300042127 | Bacteria | 4973 |
| 595 | Ga0450890_000986 | 3300042127 | Bacteria | 4131 |
| 596 | Ga0450891_000157 | 3300042129 | Bacteria | 6428 |
| 597 | Ga0450892_000356 | 3300042130 | Bacteria | 5426 |
| 598 | Ga0450898_002712 | 3300042134 | Bacteria | 2487 |
| 599 | Ga0450899_003727 | 3300042135 | Bacteria | 1637 |
| 600 | Ga0450889_000632 | 3300042144 | Bacteria | 3897 |
| 601 | Ga0450918_000026 | 3300042531 | Bacteria | 30691 |
| 602 | Ga0450893_0000069 | 3300042532 | Bacteria | 10972 |
| 603 | Ga0451577_0000142 | 3300042876 | Bacteria | 160598 |
| 604 | Ga0451577_0001509 | 3300042876 | Bacteria | 30757 |
| 605 | Ga0451577_0002068 | 3300042876 | Bacteria | 24786 |
| 606 | Ga0451577_0007013 | 3300042876 | Bacteria | 11113 |
| 607 | Ga0451577_0020090 | 3300042876 | Bacteria | 6134 |
| 608 | Ga0451577_0215815 | 3300042876 | Bacteria | 1734 |
| 609 | Ga0451577_0217043 | 3300042876 | Bacteria | 1728 |
| 610 | Ga0466969_0000385 | 3300044656 | Bacteria | 24302 |
| 611 | Ga0466969_0013212 | 3300044656 | Bacteria | 4349 |
| 612 | Ga0466972_0034233 | 3300044658 | Bacteria | 2490 |
| 613 | Ga0453683_0003599 | 3300044673 | Bacteria | 11378 |
| 614 | Ga0466966_0006769 | 3300044684 | Bacteria | 7588 |
| 615 | Ga0466966_0023138 | 3300044684 | Bacteria | 4069 |
| 616 | Ga0466966_0091990 | 3300044684 | Bacteria | 1882 |
| 617 | Ga0466961_0011070 | 3300044693 | Bacteria | 5765 |
| 618 | Ga0466961_0023583 | 3300044693 | Bacteria | 3959 |
| 619 | Ga0466961_0031065 | 3300044693 | Bacteria | 3433 |
| 620 | Ga0466961_0054701 | 3300044693 | Bacteria | 2545 |
| 621 | Ga0466963_0064455 | 3300044694 | Bacteria | 2455 |
| 622 | Ga0466963_0086826 | 3300044694 | Bacteria | 2126 |
| 623 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 624 | Ga0453684_0000694 | 3300044712 | Bacteria | 119688 |
| 625 | Ga0453684_0033107 | 3300044712 | Bacteria | 7212 |
| 626 | Ga0453684_0040850 | 3300044712 | Bacteria | 6288 |
| 627 | Ga0453684_0053731 | 3300044712 | Bacteria | 5255 |
| 628 | Ga0453684_0176775 | 3300044712 | Bacteria | 2510 |
| 629 | Ga0453684_0297008 | 3300044712 | Bacteria | 1837 |
| 630 | Ga0453684_0369110 | 3300044712 | Bacteria | 1614 |
| 631 | Ga0466971_0013038 | 3300044719 | Bacteria | 3646 |
| 632 | Ga0466970_0017336 | 3300044765 | Bacteria | 3721 |
| 633 | Ga0466959_0000371 | 3300045049 | Bacteria | 26505 |
| 634 | Ga0466959_0019290 | 3300045049 | Bacteria | 5014 |
| 635 | Ga0466959_0072253 | 3300045049 | Bacteria | 2497 |
| 636 | Ga0466959_0075169 | 3300045049 | Bacteria | 2442 |
| 637 | Ga0451576_0000909 | 3300045051 | Bacteria | 56035 |
| 638 | Ga0451576_0002187 | 3300045051 | Bacteria | 30196 |
| 639 | Ga0451576_0007327 | 3300045051 | Bacteria | 13242 |
| 640 | Ga0451576_0012822 | 3300045051 | Bacteria | 9405 |
| 641 | Ga0451576_0028892 | 3300045051 | Bacteria | 5939 |
| 642 | Ga0451576_0039865 | 3300045051 | Bacteria | 4972 |
| 643 | Ga0451576_0153533 | 3300045051 | Bacteria | 2401 |
| 644 | Ga0451576_0289442 | 3300045051 | Bacteria | 1713 |
| 645 | Ga0451576_0344039 | 3300045051 | Bacteria | 1561 |
| 646 | Ga0451576_0486235 | 3300045051 | Bacteria | 1297 |
| 647 | Ga0466958_0022478 | 3300045836 | Bacteria | 3694 |
| 648 | Ga0466967_0085582 | 3300045976 | Bacteria | 2854 |
| 649 | Ga0466967_0174591 | 3300045976 | Bacteria | 2024 |
| 650 | Ga0495583_0000193 | 3300046506 | Bacteria | 101909 |
| 651 | Ga0495628_0240274 | 3300046516 | Bacteria | 1355 |
| 652 | Ga0495632_0002146 | 3300046519 | Bacteria | 15310 |
| 653 | Ga0495632_0003371 | 3300046519 | Bacteria | 11383 |
| 654 | Ga0495632_0007855 | 3300046519 | Bacteria | 6637 |
| 655 | Ga0495648_0016379 | 3300046524 | Bacteria | 5348 |
| 656 | Ga0495642_0121997 | 3300046528 | Bacteria | 1119 |
| 657 | Ga0495621_0026108 | 3300046539 | Bacteria | 1967 |
| 658 | Ga0495597_0001551 | 3300046542 | Bacteria | 16254 |
| 659 | Ga0495656_0000062 | 3300046615 | Bacteria | 49355 |
| 660 | Ga0495625_0067071 | 3300046660 | Bacteria | 2526 |
| 661 | Ga0495649_0001518 | 3300046694 | Bacteria | 17442 |
| 662 | Ga0495687_000599 | 3300047443 | Bacteria | 42066 |
| 663 | Ga0495684_0114505 | 3300047471 | Bacteria | 2033 |
| 664 | Ga0495626_0021022 | 3300048091 | Bacteria | 3246 |
| 665 | Ga0496102_0018285 | 3300048905 | Bacteria | 6158 |
| 666 | Ga0496105_0035322 | 3300048908 | Bacteria | 4114 |
| 667 | Ga0496107_0055573 | 3300048910 | Bacteria | 2859 |
| 668 | Ga0496108_0072577 | 3300048911 | Bacteria | 2906 |
| 669 | Ga0496109_0057078 | 3300048912 | Bacteria | 3563 |
| 670 | Ga0496109_0084109 | 3300048912 | Bacteria | 2935 |
| 671 | Ga0496112_0014880 | 3300048915 | Bacteria | 7239 |
| 672 | Ga0496115_0238042 | 3300048918 | Bacteria | 1501 |
| 673 | Ga0496118_0068611 | 3300048921 | Bacteria | 2574 |
| 674 | Ga0496122_0032346 | 3300048925 | Bacteria | 4328 |
| 675 | Ga0496123_0036924 | 3300048926 | Bacteria | 3456 |
| 676 | Ga0496125_0007601 | 3300048928 | Bacteria | 11505 |
| 677 | Ga0496126_0014772 | 3300048929 | Bacteria | 7877 |
| 678 | Ga0496126_0156221 | 3300048929 | Bacteria | 1952 |
| 679 | Ga0501300_004837 | 3300049523 | Bacteria | 1991 |
| 680 | Ga0501036_0317644 | 3300049572 | Bacteria | 1302 |
| 681 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 682 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 683 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 684 | Ga0501198_000010 | 3300049649 | Bacteria | 119733 |
| 685 | Ga0501222_000009 | 3300049662 | Bacteria | 118560 |
| 686 | Ga0501222_001295 | 3300049662 | Bacteria | 3510 |
| 687 | Ga0501223_008470 | 3300049663 | Bacteria | 2098 |
| 688 | Ga0501252_000450 | 3300049682 | Bacteria | 3135 |
| 689 | Ga0501255_002105 | 3300049684 | Bacteria | 1706 |
| 690 | Ga0501229_001888 | 3300049706 | Bacteria | 2456 |
| 691 | Ga0501262_008134 | 3300049759 | Bacteria | 1279 |
| 692 | Ga0501265_000996 | 3300049762 | Bacteria | 3187 |
| 693 | Ga0501272_001530 | 3300049769 | Bacteria | 2201 |
| 694 | Ga0501045_0020428 | 3300049824 | Bacteria | 4729 |
| 695 | Ga0501045_0191008 | 3300049824 | Bacteria | 1526 |
| 696 | nmdc:mga0k408_11976_c1 | 3300050493 | Bacteria | 4732 |
| 697 | nmdc:mga0k408_1332_c1 | 3300050493 | Bacteria | 13363 |
| 698 | nmdc:mga0k408_16177_c2 | 3300050493 | Bacteria | 3070 |
| 699 | nmdc:mga0k408_181937_c1 | 3300050493 | Bacteria | 1254 |
| 700 | nmdc:mga0k408_2245_c1 | 3300050493 | Bacteria | 10324 |
| 701 | nmdc:mga0k408_25138_c1 | 3300050493 | Bacteria | 3371 |
| 702 | nmdc:mga0k408_47091_c1 | 3300050493 | Bacteria | 2492 |
| 703 | nmdc:mga0k408_5225_c1 | 3300050493 | Bacteria | 6891 |
| 704 | nmdc:mga0k408_69768_c1 | 3300050493 | Bacteria | 2051 |
| 705 | nmdc:mga06z11_120738_c1 | 3300050494 | Bacteria | 1462 |
| 706 | nmdc:mga07m45_1111_c1 | 3300050496 | Bacteria | 12038 |
| 707 | nmdc:mga07m45_1313_c1 | 3300050496 | Bacteria | 11319 |
| 708 | nmdc:mga07m45_21568_c1 | 3300050496 | Bacteria | 3509 |
| 709 | nmdc:mga07m45_4922_c1 | 3300050496 | Bacteria | 6581 |
| 710 | nmdc:mga07m45_63_c1 | 3300050496 | Bacteria | 41859 |
| 711 | nmdc:mga05p37_70873_c1 | 3300050507 | Bacteria | 4287 |
| 712 | nmdc:mga09592_3159_c1 | 3300050508 | Bacteria | 13376 |
| 713 | nmdc:mga0sz30_13751_c1 | 3300050516 | Bacteria | 3174 |
| 714 | Ga0495595_0137824 | 3300053084 | Bacteria | 1196 |
| 715 | Ga0500578_0000746 | 3300053086 | Bacteria | 38474 |
| 716 | Ga0500644_0038987 | 3300053088 | Bacteria | 1563 |
| 717 | Ga0500646_0020058 | 3300053090 | Bacteria | 1773 |
| 718 | Ga0500651_0029161 | 3300053093 | Bacteria | 3468 |
| 719 | Ga0500642_0000935 | 3300053130 | Bacteria | 8467 |
| 720 | Ga0500652_000142 | 3300053131 | Bacteria | 27284 |
| 721 | Ga0500652_000807 | 3300053131 | Bacteria | 10505 |
| 722 | Ga0500655_007435 | 3300053133 | Bacteria | 1971 |
| 723 | Ga0500658_0003009 | 3300053134 | Bacteria | 6470 |
| 724 | Ga0500568_0013996 | 3300053139 | Bacteria | 3636 |
| 725 | Ga0500568_0023720 | 3300053139 | Bacteria | 2607 |
| 726 | Ga0500619_000310 | 3300053154 | Bacteria | 9550 |
| 727 | Ga0500622_0000599 | 3300053156 | Bacteria | 32760 |
| 728 | Ga0500622_0000952 | 3300053156 | Bacteria | 24620 |
| 729 | Ga0500622_0002819 | 3300053156 | Bacteria | 12189 |
| 730 | Ga0500622_0014209 | 3300053156 | Bacteria | 4280 |
| 731 | Ga0500634_0037535 | 3300053161 | Bacteria | 2635 |
| 732 | Ga0500636_0000020 | 3300053177 | Bacteria | 96868 |
| 733 | Ga0500645_004363 | 3300053730 | Bacteria | 5438 |
| 734 | Ga0590071_000859 | 3300059421 | Bacteria | 8461 |
| 735 | Ga0466962_0030617 | 3300061719 | Bacteria | 2577 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049572 | Ga0501036_0317644 | Ga0501036_0317644_157_1242 | 325 |
| 2 | 3300049824 | Ga0501045_0191008 | Ga0501045_0191008_292_1377 | 325 |
| 3 | 3300046524 | Ga0495648_0016379 | Ga0495648_0016379_2266_3351 | 333 |
| 4 | 3300044712 | Ga0453684_0040850 | Ga0453684_0040850_3694_4776 | 336 |
| 5 | 3300003791 | Ga0055530_10001787 | Ga0055530_100017877 | 340 |
| 6 | 3300003792 | Ga0055540_1000002 | Ga0055540_1000002268 | 340 |
| 7 | 3300003794 | Ga0055531_10001860 | Ga0055531_1000186010 | 340 |
| 8 | 3300025298 | Ga0209050_1000919 | Ga0209050_100091920 | 340 |
| 9 | 3300025303 | Ga0209051_1000024 | Ga0209051_1000024269 | 340 |
| 10 | 3300025304 | Ga0209257_1000079 | Ga0209257_1000079269 | 340 |
| 11 | 3300003323 | rootH1_10006954 | rootH1_100069544 | 341 |
| 12 | 3300042876 | Ga0451577_0217043 | Ga0451577_0217043_582_1670 | 341 |
| 13 | 3300044712 | Ga0453684_0297008 | Ga0453684_0297008_77_1165 | 341 |
| 14 | 3300045049 | Ga0466959_0075169 | Ga0466959_0075169_81_1127 | 342 |
| 15 | 3300042876 | Ga0451577_0215815 | Ga0451577_0215815_523_1650 | 343 |
| 16 | 3300044712 | Ga0453684_0033107 | Ga0453684_0033107_974_2101 | 345 |
| 17 | 3300025245 | Ga0207425_1002451 | Ga0207425_10024515 | 348 |
| 18 | 3300048905 | Ga0496102_0018285 | Ga0496102_0018285_2784_3866 | 349 |
| 19 | 3300037312 | Ga0395899_0014146 | Ga0395899_0014146_3448_4527 | 353 |
| 20 | 3300037418 | Ga0395900_0022771 | Ga0395900_0022771_2860_3939 | 353 |
| 21 | 3300037466 | Ga0395898_0038551 | Ga0395898_0038551_3442_4521 | 353 |
| 22 | 3300037471 | Ga0395905_0000377 | Ga0395905_0000377_31231_32379 | 353 |
| 23 | 3300037471 | Ga0395905_0028880 | Ga0395905_0028880_2792_3871 | 353 |
| 24 | 3300044656 | Ga0466969_0013212 | Ga0466969_0013212_3013_4152 | 353 |
| 25 | 3300044684 | Ga0466966_0091990 | Ga0466966_0091990_271_1350 | 353 |
| 26 | 3300044693 | Ga0466961_0023583 | Ga0466961_0023583_1831_2970 | 353 |
| 27 | 3300044765 | Ga0466970_0017336 | Ga0466970_0017336_2238_3317 | 353 |
| 28 | 3300046506 | Ga0495583_0000193 | Ga0495583_0000193_65523_66620 | 353 |
| 29 | 3300059421 | Ga0590071_000859 | Ga0590071_000859_2025_3170 | 354 |
| 30 | iso_pu_bacteria | 2511231002 | 2511245208 | 355 |
| 31 | iso_pu_bacteria | 2513020051 | 2513227156 | 355 |
| 32 | iso_pu_bacteria | 2585428057 | 2587726728 | 355 |
| 33 | iso_pu_bacteria | 2585428057 | 2587730179 | 355 |
| 34 | iso_pu_bacteria | 2585428058 | 2587733235 | 355 |
| 35 | iso_pu_bacteria | 2585428058 | 2587736294 | 355 |
| 36 | iso_pu_bacteria | 2588253510 | 2588290827 | 355 |
| 37 | iso_pu_bacteria | 2588253510 | 2588294344 | 355 |
| 38 | iso_pu_bacteria | 2599185214 | 2599627250 | 355 |
| 39 | iso_pu_bacteria | 2599185226 | 2599676665 | 355 |
| 40 | iso_pu_bacteria | 2599185227 | 2599680041 | 355 |
| 41 | iso_pu_bacteria | 2599185229 | 2599692057 | 355 |
| 42 | iso_pu_bacteria | 2643221592 | 2643968674 | 355 |
| 43 | iso_pu_bacteria | 2643221592 | 2643969035 | 355 |
| 44 | iso_pu_bacteria | 2643221625 | 2644142032 | 355 |
| 45 | iso_pu_bacteria | 2643221625 | 2644144166 | 355 |
| 46 | iso_pu_bacteria | 2643221644 | 2644245691 | 355 |
| 47 | iso_pu_bacteria | 2643221648 | 2644273286 | 355 |
| 48 | iso_pu_bacteria | 2643221648 | 2644274124 | 355 |
| 49 | iso_pu_bacteria | 2721755523 | 2722885062 | 355 |
| 50 | iso_pu_bacteria | 2738541277 | 2738719629 | 355 |
| 51 | iso_pu_bacteria | 2738541307 | 2738879936 | 355 |
| 52 | iso_pu_bacteria | 2738543012 | 2739245589 | 355 |
| 53 | iso_pu_bacteria | 2738543019 | 2739278828 | 355 |
| 54 | iso_pu_bacteria | 2818991446 | 2819599376 | 355 |
| 55 | iso_pu_bacteria | 2831864461 | 2831868501 | 355 |
| 56 | iso_pu_bacteria | 2838054893 | 2838055939 | 355 |
| 57 | iso_pu_bacteria | 2839138175 | 2839142889 | 355 |
| 58 | iso_pu_bacteria | 2842718218 | 2842719067 | 355 |
| 59 | iso_pu_bacteria | 2886848708 | 2886854881 | 355 |
| 60 | iso_pu_bacteria | 2899924645 | 2899925884 | 355 |
| 61 | iso_pu_bacteria | 2904541872 | 2904544297 | 355 |
| 62 | iso_pu_bacteria | 2928037797 | 2928041728 | 355 |
| 63 | iso_pu_bacteria | 2928044640 | 2928049292 | 355 |
| 64 | iso_pu_bacteria | 2928051484 | 2928052100 | 355 |
| 65 | iso_pu_bacteria | 2928064002 | 2928065220 | 355 |
| 66 | iso_pu_bacteria | 2928070936 | 2928076645 | 355 |
| 67 | iso_pu_bacteria | 2928084124 | 2928089246 | 355 |
| 68 | iso_pu_bacteria | 2929160207 | 2929162131 | 355 |
| 69 | iso_pu_bacteria | 2974320154 | 2974324303 | 355 |
| 70 | iso_pu_bacteria | 8002392321 | 8002392348 | 355 |
| 71 | iso_pu_bacteria | 2643221544 | 2643745505 | 357 |
| 72 | iso_pu_bacteria | 2643221585 | 2643935904 | 357 |
| 73 | iso_pu_bacteria | 2643221639 | 2644221365 | 357 |
| 74 | iso_pu_bacteria | 2643221646 | 2644257877 | 357 |
| 75 | iso_pu_bacteria | 2643221656 | 2644317687 | 357 |
| 76 | iso_pu_bacteria | 2738541337 | 2739057872 | 357 |
| 77 | 3300005343 | Ga0070687_100081563 | Ga0070687_1000815632 | 358 |
| 78 | 3300005444 | Ga0070694_100223237 | Ga0070694_1002232371 | 358 |
| 79 | 3300006058 | Ga0075432_10078022 | Ga0075432_100780221 | 358 |
| 80 | 3300013306 | Ga0163162_10364771 | Ga0163162_103647712 | 358 |
| 81 | 3300027378 | Ga0209981_1007857 | Ga0209981_10078571 | 358 |
| 82 | 3300028786 | Ga0307517_10124787 | Ga0307517_101247871 | 358 |
| 83 | 3300031730 | Ga0307516_10000497 | Ga0307516_100004974 | 358 |
| 84 | 3300044712 | Ga0453684_0000694 | Ga0453684_0000694_118447_119526 | 358 |
| 85 | 3300049649 | Ga0501198_000010 | Ga0501198_000010_92305_93447 | 358 |
| 86 | 3300049662 | Ga0501222_000009 | Ga0501222_000009_25063_26205 | 358 |
| 87 | 3300053177 | Ga0500636_0000020 | Ga0500636_0000020_36613_37704 | 358 |
| 88 | 3300001979 | JGI24740J21852_10009650 | JGI24740J21852_100096504 | 359 |
| 89 | 3300002704 | JGI25155J39150_1000005 | JGI25155J39150_1000005229 | 359 |
| 90 | 3300002705 | JGI25156J39149_1000006 | JGI25156J39149_1000006229 | 359 |
| 91 | 3300002738 | JGI25154J39366_1000015 | JGI25154J39366_100001516 | 359 |
| 92 | 3300002741 | JGI25157J39369_1000111 | JGI25157J39369_100011150 | 359 |
| 93 | 3300002773 | JGI25152J39213_1002353 | JGI25152J39213_10023532 | 359 |
| 94 | 3300002773 | JGI25152J39213_1002353 | JGI25152J39213_10023533 | 359 |
| 95 | 3300002773 | JGI25152J39213_1003217 | JGI25152J39213_10032176 | 359 |
| 96 | 3300002774 | JGI25150J39212_1002625 | JGI25150J39212_10026253 | 359 |
| 97 | 3300002774 | JGI25150J39212_1003507 | JGI25150J39212_10035073 | 359 |
| 98 | 3300002774 | JGI25150J39212_1005857 | JGI25150J39212_10058572 | 359 |
| 99 | 3300002987 | JGI25159J45721_1003156 | JGI25159J45721_10031562 | 359 |
| 100 | 3300002987 | JGI25159J45721_1010735 | JGI25159J45721_10107352 | 359 |
| 101 | 3300003187 | JGI25151J46595_10025360 | JGI25151J46595_100253601 | 359 |
| 102 | 3300003187 | JGI25151J46595_10025978 | JGI25151J46595_100259781 | 359 |
| 103 | 3300003215 | JGI25153J46596_10011279 | JGI25153J46596_100112794 | 359 |
| 104 | 3300003215 | JGI25153J46596_10011279 | JGI25153J46596_100112795 | 359 |
| 105 | 3300003215 | JGI25153J46596_10025852 | JGI25153J46596_100258521 | 359 |
| 106 | 3300003322 | rootL2_10003410 | rootL2_1000341012 | 359 |
| 107 | 3300003323 | rootH1_10024154 | rootH1_100241545 | 359 |
| 108 | 3300003323 | rootH1_10098199 | rootH1_100981992 | 359 |
| 109 | 3300003323 | rootH1_10120714 | rootH1_101207142 | 359 |
| 110 | 3300003347 | JGI26128J50194_1000166 | JGI26128J50194_10001662 | 359 |
| 111 | 3300003354 | JGI25160J50197_1000045 | JGI25160J50197_1000045104 | 359 |
| 112 | 3300003371 | JGI26145J50221_1001536 | JGI26145J50221_10015362 | 359 |
| 113 | 3300003374 | JGI25161J50226_1000008 | JGI25161J50226_1000008116 | 359 |
| 114 | 3300003374 | JGI25161J50226_1005839 | JGI25161J50226_10058394 | 359 |
| 115 | 3300003761 | Ga0055535_1000076 | Ga0055535_10000767 | 359 |
| 116 | 3300003762 | Ga0055542_1000009 | Ga0055542_1000009205 | 359 |
| 117 | 3300003771 | Ga0055526_1003100 | Ga0055526_10031003 | 359 |
| 118 | 3300003771 | Ga0055526_1004023 | Ga0055526_10040238 | 359 |
| 119 | 3300003771 | Ga0055526_1004056 | Ga0055526_10040563 | 359 |
| 120 | 3300003771 | Ga0055526_1005431 | Ga0055526_10054317 | 359 |
| 121 | 3300003771 | Ga0055526_1005431 | Ga0055526_10054318 | 359 |
| 122 | 3300003773 | Ga0055537_1000198 | Ga0055537_100019821 | 359 |
| 123 | 3300003773 | Ga0055537_1007287 | Ga0055537_10072873 | 359 |
| 124 | 3300003775 | Ga0055524_1000080 | Ga0055524_100008053 | 359 |
| 125 | 3300003775 | Ga0055524_1000126 | Ga0055524_100012645 | 359 |
| 126 | 3300003775 | Ga0055524_1002605 | Ga0055524_10026058 | 359 |
| 127 | 3300003775 | Ga0055524_1013464 | Ga0055524_10134642 | 359 |
| 128 | 3300003781 | Ga0055536_1004051 | Ga0055536_10040513 | 359 |
| 129 | 3300003781 | Ga0055536_1005604 | Ga0055536_10056042 | 359 |
| 130 | 3300003784 | Ga0055534_1007296 | Ga0055534_10072962 | 359 |
| 131 | 3300003784 | Ga0055534_1008433 | Ga0055534_10084331 | 359 |
| 132 | 3300003790 | Ga0055528_1000633 | Ga0055528_100063316 | 359 |
| 133 | 3300003791 | Ga0055530_10000699 | Ga0055530_1000069926 | 359 |
| 134 | 3300003791 | Ga0055530_10003267 | Ga0055530_100032679 | 359 |
| 135 | 3300003792 | Ga0055540_1000021 | Ga0055540_100002171 | 359 |
| 136 | 3300003794 | Ga0055531_10000051 | Ga0055531_1000005138 | 359 |
| 137 | 3300003794 | Ga0055531_10001171 | Ga0055531_1000117111 | 359 |
| 138 | 3300003794 | Ga0055531_10002049 | Ga0055531_100020496 | 359 |
| 139 | 3300003794 | Ga0055531_10005509 | Ga0055531_100055097 | 359 |
| 140 | 3300003794 | Ga0055531_10009879 | Ga0055531_100098796 | 359 |
| 141 | 3300004625 | Ga0055543_1000241 | Ga0055543_100024127 | 359 |
| 142 | 3300004625 | Ga0055543_1004447 | Ga0055543_10044474 | 359 |
| 143 | 3300004625 | Ga0055543_1006196 | Ga0055543_10061963 | 359 |
| 144 | 3300005262 | Ga0065165_1000281 | Ga0065165_100028158 | 359 |
| 145 | 3300005262 | Ga0065165_1001682 | Ga0065165_10016829 | 359 |
| 146 | 3300005262 | Ga0065165_1002866 | Ga0065165_10028666 | 359 |
| 147 | 3300005262 | Ga0065165_1019922 | Ga0065165_10199224 | 359 |
| 148 | 3300005289 | Ga0065704_10114513 | Ga0065704_101145132 | 359 |
| 149 | 3300005289 | Ga0065704_10119442 | Ga0065704_101194421 | 359 |
| 150 | 3300005295 | Ga0065707_10081939 | Ga0065707_100819393 | 359 |
| 151 | 3300005328 | Ga0070676_10024271 | Ga0070676_100242712 | 359 |
| 152 | 3300005328 | Ga0070676_10070055 | Ga0070676_100700552 | 359 |
| 153 | 3300005329 | Ga0070683_100052323 | Ga0070683_1000523232 | 359 |
| 154 | 3300005329 | Ga0070683_100071927 | Ga0070683_1000719272 | 359 |
| 155 | 3300005330 | Ga0070690_100013344 | Ga0070690_1000133442 | 359 |
| 156 | 3300005331 | Ga0070670_100038495 | Ga0070670_1000384952 | 359 |
| 157 | 3300005331 | Ga0070670_100203478 | Ga0070670_1002034781 | 359 |
| 158 | 3300005333 | Ga0070677_10001509 | Ga0070677_100015093 | 359 |
| 159 | 3300005333 | Ga0070677_10038033 | Ga0070677_100380331 | 359 |
| 160 | 3300005334 | Ga0068869_100033038 | Ga0068869_1000330382 | 359 |
| 161 | 3300005334 | Ga0068869_100123908 | Ga0068869_1001239082 | 359 |
| 162 | 3300005335 | Ga0070666_10012908 | Ga0070666_100129085 | 359 |
| 163 | 3300005335 | Ga0070666_10034478 | Ga0070666_100344782 | 359 |
| 164 | 3300005335 | Ga0070666_10269555 | Ga0070666_102695551 | 359 |
| 165 | 3300005338 | Ga0068868_100010659 | Ga0068868_1000106597 | 359 |
| 166 | 3300005338 | Ga0068868_100020394 | Ga0068868_1000203942 | 359 |
| 167 | 3300005338 | Ga0068868_100024897 | Ga0068868_1000248972 | 359 |
| 168 | 3300005338 | Ga0068868_100079151 | Ga0068868_1000791512 | 359 |
| 169 | 3300005343 | Ga0070687_100011369 | Ga0070687_1000113692 | 359 |
| 170 | 3300005344 | Ga0070661_100001480 | Ga0070661_10000148014 | 359 |
| 171 | 3300005344 | Ga0070661_100007936 | Ga0070661_1000079368 | 359 |
| 172 | 3300005344 | Ga0070661_100119931 | Ga0070661_1001199312 | 359 |
| 173 | 3300005347 | Ga0070668_100004749 | Ga0070668_1000047498 | 359 |
| 174 | 3300005347 | Ga0070668_100048819 | Ga0070668_1000488193 | 359 |
| 175 | 3300005353 | Ga0070669_100005812 | Ga0070669_1000058122 | 359 |
| 176 | 3300005353 | Ga0070669_100078644 | Ga0070669_1000786442 | 359 |
| 177 | 3300005354 | Ga0070675_100006120 | Ga0070675_1000061208 | 359 |
| 178 | 3300005354 | Ga0070675_100023293 | Ga0070675_1000232934 | 359 |
| 179 | 3300005354 | Ga0070675_100031516 | Ga0070675_1000315162 | 359 |
| 180 | 3300005354 | Ga0070675_100071647 | Ga0070675_1000716472 | 359 |
| 181 | 3300005354 | Ga0070675_100154830 | Ga0070675_1001548302 | 359 |
| 182 | 3300005356 | Ga0070674_100008402 | Ga0070674_1000084026 | 359 |
| 183 | 3300005356 | Ga0070674_100075724 | Ga0070674_1000757242 | 359 |
| 184 | 3300005356 | Ga0070674_100093906 | Ga0070674_1000939062 | 359 |
| 185 | 3300005364 | Ga0070673_100009720 | Ga0070673_1000097207 | 359 |
| 186 | 3300005364 | Ga0070673_100023472 | Ga0070673_1000234723 | 359 |
| 187 | 3300005364 | Ga0070673_100257388 | Ga0070673_1002573881 | 359 |
| 188 | 3300005365 | Ga0070688_100119227 | Ga0070688_1001192272 | 359 |
| 189 | 3300005366 | Ga0070659_100000895 | Ga0070659_1000008958 | 359 |
| 190 | 3300005366 | Ga0070659_100043221 | Ga0070659_1000432213 | 359 |
| 191 | 3300005366 | Ga0070659_100153206 | Ga0070659_1001532062 | 359 |
| 192 | 3300005367 | Ga0070667_100003317 | Ga0070667_10000331714 | 359 |
| 193 | 3300005367 | Ga0070667_100014226 | Ga0070667_1000142266 | 359 |
| 194 | 3300005367 | Ga0070667_100022123 | Ga0070667_1000221233 | 359 |
| 195 | 3300005367 | Ga0070667_100063120 | Ga0070667_1000631203 | 359 |
| 196 | 3300005367 | Ga0070667_100068630 | Ga0070667_1000686302 | 359 |
| 197 | 3300005367 | Ga0070667_100106220 | Ga0070667_1001062202 | 359 |
| 198 | 3300005367 | Ga0070667_100170864 | Ga0070667_1001708642 | 359 |
| 199 | 3300005455 | Ga0070663_100001333 | Ga0070663_1000013339 | 359 |
| 200 | 3300005455 | Ga0070663_100014640 | Ga0070663_1000146404 | 359 |
| 201 | 3300005455 | Ga0070663_100027849 | Ga0070663_1000278492 | 359 |
| 202 | 3300005456 | Ga0070678_100009248 | Ga0070678_1000092482 | 359 |
| 203 | 3300005456 | Ga0070678_100032205 | Ga0070678_1000322053 | 359 |
| 204 | 3300005456 | Ga0070678_100068262 | Ga0070678_1000682622 | 359 |
| 205 | 3300005456 | Ga0070678_100152233 | Ga0070678_1001522332 | 359 |
| 206 | 3300005457 | Ga0070662_100027320 | Ga0070662_1000273202 | 359 |
| 207 | 3300005457 | Ga0070662_100027728 | Ga0070662_1000277282 | 359 |
| 208 | 3300005457 | Ga0070662_100037558 | Ga0070662_1000375582 | 359 |
| 209 | 3300005457 | Ga0070662_100038825 | Ga0070662_1000388252 | 359 |
| 210 | 3300005457 | Ga0070662_100041597 | Ga0070662_1000415973 | 359 |
| 211 | 3300005457 | Ga0070662_100051987 | Ga0070662_1000519872 | 359 |
| 212 | 3300005457 | Ga0070662_100072755 | Ga0070662_1000727552 | 359 |
| 213 | 3300005457 | Ga0070662_100171740 | Ga0070662_1001717401 | 359 |
| 214 | 3300005459 | Ga0068867_100001695 | Ga0068867_1000016959 | 359 |
| 215 | 3300005459 | Ga0068867_100012152 | Ga0068867_1000121524 | 359 |
| 216 | 3300005459 | Ga0068867_100012224 | Ga0068867_1000122246 | 359 |
| 217 | 3300005459 | Ga0068867_100068070 | Ga0068867_1000680702 | 359 |
| 218 | 3300005459 | Ga0068867_100075899 | Ga0068867_1000758992 | 359 |
| 219 | 3300005466 | Ga0070685_10129182 | Ga0070685_101291822 | 359 |
| 220 | 3300005467 | Ga0070706_100073922 | Ga0070706_1000739222 | 359 |
| 221 | 3300005530 | Ga0070679_100006195 | Ga0070679_1000061952 | 359 |
| 222 | 3300005539 | Ga0068853_100039596 | Ga0068853_1000395962 | 359 |
| 223 | 3300005539 | Ga0068853_100055956 | Ga0068853_1000559562 | 359 |
| 224 | 3300005543 | Ga0070672_100002003 | Ga0070672_1000020038 | 359 |
| 225 | 3300005543 | Ga0070672_100016349 | Ga0070672_1000163492 | 359 |
| 226 | 3300005543 | Ga0070672_100018179 | Ga0070672_1000181792 | 359 |
| 227 | 3300005543 | Ga0070672_100048771 | Ga0070672_1000487712 | 359 |
| 228 | 3300005543 | Ga0070672_100073007 | Ga0070672_1000730072 | 359 |
| 229 | 3300005543 | Ga0070672_100111880 | Ga0070672_1001118802 | 359 |
| 230 | 3300005543 | Ga0070672_100123330 | Ga0070672_1001233302 | 359 |
| 231 | 3300005564 | Ga0070664_100012448 | Ga0070664_1000124488 | 359 |
| 232 | 3300005564 | Ga0070664_100026777 | Ga0070664_1000267775 | 359 |
| 233 | 3300005564 | Ga0070664_100066596 | Ga0070664_1000665961 | 359 |
| 234 | 3300005564 | Ga0070664_100104387 | Ga0070664_1001043872 | 359 |
| 235 | 3300005564 | Ga0070664_100254324 | Ga0070664_1002543242 | 359 |
| 236 | 3300005577 | Ga0068857_100045560 | Ga0068857_1000455602 | 359 |
| 237 | 3300005577 | Ga0068857_100133456 | Ga0068857_1001334562 | 359 |
| 238 | 3300005577 | Ga0068857_100211746 | Ga0068857_1002117462 | 359 |
| 239 | 3300005614 | Ga0068856_100011617 | Ga0068856_1000116175 | 359 |
| 240 | 3300005616 | Ga0068852_100013224 | Ga0068852_1000132244 | 359 |
| 241 | 3300005616 | Ga0068852_100098100 | Ga0068852_1000981002 | 359 |
| 242 | 3300005616 | Ga0068852_100152189 | Ga0068852_1001521892 | 359 |
| 243 | 3300005617 | Ga0068859_100020694 | Ga0068859_1000206942 | 359 |
| 244 | 3300005617 | Ga0068859_100138376 | Ga0068859_1001383762 | 359 |
| 245 | 3300005617 | Ga0068859_100285296 | Ga0068859_1002852962 | 359 |
| 246 | 3300005618 | Ga0068864_100003870 | Ga0068864_1000038708 | 359 |
| 247 | 3300005618 | Ga0068864_100050348 | Ga0068864_1000503482 | 359 |
| 248 | 3300005618 | Ga0068864_100128344 | Ga0068864_1001283442 | 359 |
| 249 | 3300005718 | Ga0068866_10024439 | Ga0068866_100244392 | 359 |
| 250 | 3300005719 | Ga0068861_100004497 | Ga0068861_10000449710 | 359 |
| 251 | 3300005719 | Ga0068861_100011784 | Ga0068861_1000117845 | 359 |
| 252 | 3300005719 | Ga0068861_100150581 | Ga0068861_1001505812 | 359 |
| 253 | 3300005834 | Ga0068851_10036782 | Ga0068851_100367822 | 359 |
| 254 | 3300005841 | Ga0068863_100002141 | Ga0068863_1000021412 | 359 |
| 255 | 3300005841 | Ga0068863_100031883 | Ga0068863_1000318832 | 359 |
| 256 | 3300005841 | Ga0068863_100052117 | Ga0068863_1000521172 | 359 |
| 257 | 3300005842 | Ga0068858_100001584 | Ga0068858_10000158415 | 359 |
| 258 | 3300005842 | Ga0068858_100010943 | Ga0068858_1000109439 | 359 |
| 259 | 3300005842 | Ga0068858_100103729 | Ga0068858_1001037292 | 359 |
| 260 | 3300005843 | Ga0068860_100001910 | Ga0068860_10000191019 | 359 |
| 261 | 3300005843 | Ga0068860_100014499 | Ga0068860_1000144996 | 359 |
| 262 | 3300005844 | Ga0068862_100004043 | Ga0068862_10000404310 | 359 |
| 263 | 3300005844 | Ga0068862_100032435 | Ga0068862_1000324353 | 359 |
| 264 | 3300005937 | Ga0081455_10042458 | Ga0081455_100424581 | 359 |
| 265 | 3300006048 | Ga0075363_100042299 | Ga0075363_1000422992 | 359 |
| 266 | 3300006048 | Ga0075363_100076636 | Ga0075363_1000766361 | 359 |
| 267 | 3300006051 | Ga0075364_10042087 | Ga0075364_100420872 | 359 |
| 268 | 3300006051 | Ga0075364_10065652 | Ga0075364_100656521 | 359 |
| 269 | 3300006178 | Ga0075367_10075388 | Ga0075367_100753882 | 359 |
| 270 | 3300006195 | Ga0075366_10001872 | Ga0075366_1000187211 | 359 |
| 271 | 3300006195 | Ga0075366_10002038 | Ga0075366_1000203810 | 359 |
| 272 | 3300006195 | Ga0075366_10002642 | Ga0075366_100026428 | 359 |
| 273 | 3300006195 | Ga0075366_10019111 | Ga0075366_100191113 | 359 |
| 274 | 3300006195 | Ga0075366_10022185 | Ga0075366_100221852 | 359 |
| 275 | 3300006195 | Ga0075366_10036912 | Ga0075366_100369122 | 359 |
| 276 | 3300006237 | Ga0097621_100028821 | Ga0097621_1000288213 | 359 |
| 277 | 3300006237 | Ga0097621_100048534 | Ga0097621_1000485341 | 359 |
| 278 | 3300006353 | Ga0075370_10000167 | Ga0075370_1000016712 | 359 |
| 279 | 3300006353 | Ga0075370_10000719 | Ga0075370_100007192 | 359 |
| 280 | 3300006353 | Ga0075370_10001130 | Ga0075370_1000113010 | 359 |
| 281 | 3300006353 | Ga0075370_10001256 | Ga0075370_100012569 | 359 |
| 282 | 3300006353 | Ga0075370_10003689 | Ga0075370_100036892 | 359 |
| 283 | 3300006353 | Ga0075370_10007483 | Ga0075370_100074831 | 359 |
| 284 | 3300006353 | Ga0075370_10010571 | Ga0075370_100105715 | 359 |
| 285 | 3300006353 | Ga0075370_10010698 | Ga0075370_100106982 | 359 |
| 286 | 3300006353 | Ga0075370_10036557 | Ga0075370_100365572 | 359 |
| 287 | 3300006358 | Ga0068871_100013614 | Ga0068871_1000136142 | 359 |
| 288 | 3300006358 | Ga0068871_100053243 | Ga0068871_1000532432 | 359 |
| 289 | 3300006358 | Ga0068871_100122983 | Ga0068871_1001229832 | 359 |
| 290 | 3300006358 | Ga0068871_100194356 | Ga0068871_1001943562 | 359 |
| 291 | 3300006871 | Ga0075434_100210582 | Ga0075434_1002105822 | 359 |
| 292 | 3300006880 | Ga0075429_100001027 | Ga0075429_1000010276 | 359 |
| 293 | 3300006931 | Ga0097620_100020694 | Ga0097620_1000206942 | 359 |
| 294 | 3300006931 | Ga0097620_100138375 | Ga0097620_1001383752 | 359 |
| 295 | 3300006931 | Ga0097620_100285271 | Ga0097620_1002852712 | 359 |
| 296 | 3300006944 | Ga0099823_1009799 | Ga0099823_10097997 | 359 |
| 297 | 3300006946 | Ga0079104_1000003 | Ga0079104_1000003258 | 359 |
| 298 | 3300006946 | Ga0079104_1000017 | Ga0079104_1000017183 | 359 |
| 299 | 3300009092 | Ga0105250_10006594 | Ga0105250_100065943 | 359 |
| 300 | 3300009093 | Ga0105240_10060587 | Ga0105240_100605874 | 359 |
| 301 | 3300009093 | Ga0105240_10166101 | Ga0105240_101661014 | 359 |
| 302 | 3300009094 | Ga0111539_10558671 | Ga0111539_105586711 | 359 |
| 303 | 3300009148 | Ga0105243_10001185 | Ga0105243_100011857 | 359 |
| 304 | 3300009148 | Ga0105243_10009310 | Ga0105243_100093102 | 359 |
| 305 | 3300009174 | Ga0105241_10050916 | Ga0105241_100509162 | 359 |
| 306 | 3300009176 | Ga0105242_10000453 | Ga0105242_1000045310 | 359 |
| 307 | 3300009176 | Ga0105242_10061013 | Ga0105242_100610132 | 359 |
| 308 | 3300009177 | Ga0105248_10020330 | Ga0105248_100203303 | 359 |
| 309 | 3300009177 | Ga0105248_10026443 | Ga0105248_100264432 | 359 |
| 310 | 3300009177 | Ga0105248_10046549 | Ga0105248_100465492 | 359 |
| 311 | 3300009177 | Ga0105248_10156522 | Ga0105248_101565222 | 359 |
| 312 | 3300009177 | Ga0105248_10193669 | Ga0105248_101936692 | 359 |
| 313 | 3300009177 | Ga0105248_10516871 | Ga0105248_105168712 | 359 |
| 314 | 3300009545 | Ga0105237_10122139 | Ga0105237_101221392 | 359 |
| 315 | 3300009551 | Ga0105238_10018116 | Ga0105238_100181162 | 359 |
| 316 | 3300009551 | Ga0105238_10044211 | Ga0105238_100442115 | 359 |
| 317 | 3300009553 | Ga0105249_10017708 | Ga0105249_100177085 | 359 |
| 318 | 3300009553 | Ga0105249_10038194 | Ga0105249_100381942 | 359 |
| 319 | 3300010375 | Ga0105239_10131653 | Ga0105239_101316532 | 359 |
| 320 | 3300012497 | Ga0157319_1000010 | Ga0157319_100001018 | 359 |
| 321 | 3300012513 | Ga0157326_1001365 | Ga0157326_10013652 | 359 |
| 322 | 3300013102 | Ga0157371_10032792 | Ga0157371_100327922 | 359 |
| 323 | 3300013104 | Ga0157370_10008137 | Ga0157370_100081379 | 359 |
| 324 | 3300013104 | Ga0157370_10314169 | Ga0157370_103141692 | 359 |
| 325 | 3300013105 | Ga0157369_10085797 | Ga0157369_100857972 | 359 |
| 326 | 3300013105 | Ga0157369_10137307 | Ga0157369_101373072 | 359 |
| 327 | 3300013296 | Ga0157374_10020040 | Ga0157374_100200403 | 359 |
| 328 | 3300013296 | Ga0157374_10030533 | Ga0157374_100305334 | 359 |
| 329 | 3300013296 | Ga0157374_10199617 | Ga0157374_101996172 | 359 |
| 330 | 3300013297 | Ga0157378_10000558 | Ga0157378_1000055812 | 359 |
| 331 | 3300013297 | Ga0157378_10061097 | Ga0157378_100610972 | 359 |
| 332 | 3300013297 | Ga0157378_10144207 | Ga0157378_101442072 | 359 |
| 333 | 3300013306 | Ga0163162_10009181 | Ga0163162_100091816 | 359 |
| 334 | 3300013306 | Ga0163162_10024807 | Ga0163162_100248074 | 359 |
| 335 | 3300013306 | Ga0163162_10031794 | Ga0163162_100317946 | 359 |
| 336 | 3300013306 | Ga0163162_10033157 | Ga0163162_100331572 | 359 |
| 337 | 3300013307 | Ga0157372_10095120 | Ga0157372_100951202 | 359 |
| 338 | 3300013308 | Ga0157375_10008783 | Ga0157375_100087837 | 359 |
| 339 | 3300013308 | Ga0157375_10021275 | Ga0157375_100212756 | 359 |
| 340 | 3300013308 | Ga0157375_10039281 | Ga0157375_100392812 | 359 |
| 341 | 3300013308 | Ga0157375_10063774 | Ga0157375_100637742 | 359 |
| 342 | 3300013308 | Ga0157375_10093518 | Ga0157375_100935182 | 359 |
| 343 | 3300014325 | Ga0163163_10017948 | Ga0163163_100179484 | 359 |
| 344 | 3300014326 | Ga0157380_10016835 | Ga0157380_100168356 | 359 |
| 345 | 3300014326 | Ga0157380_10031042 | Ga0157380_100310425 | 359 |
| 346 | 3300014326 | Ga0157380_10332189 | Ga0157380_103321892 | 359 |
| 347 | 3300014497 | Ga0182008_10001333 | Ga0182008_1000133312 | 359 |
| 348 | 3300014497 | Ga0182008_10015908 | Ga0182008_100159083 | 359 |
| 349 | 3300014497 | Ga0182008_10084691 | Ga0182008_100846911 | 359 |
| 350 | 3300014745 | Ga0157377_10000028 | Ga0157377_100000285 | 359 |
| 351 | 3300014968 | Ga0157379_10017086 | Ga0157379_100170864 | 359 |
| 352 | 3300014968 | Ga0157379_10027080 | Ga0157379_100270806 | 359 |
| 353 | 3300014968 | Ga0157379_10028234 | Ga0157379_100282345 | 359 |
| 354 | 3300014968 | Ga0157379_10046145 | Ga0157379_100461453 | 359 |
| 355 | 3300014968 | Ga0157379_10116340 | Ga0157379_101163402 | 359 |
| 356 | 3300014968 | Ga0157379_10167652 | Ga0157379_101676522 | 359 |
| 357 | 3300014969 | Ga0157376_10090511 | Ga0157376_100905112 | 359 |
| 358 | 3300015261 | Ga0182006_1003396 | Ga0182006_10033965 | 359 |
| 359 | 3300015262 | Ga0182007_10022577 | Ga0182007_100225772 | 359 |
| 360 | 3300015683 | Ga0183362_10003 | Ga0183362_10003379 | 359 |
| 361 | 3300017792 | Ga0163161_10006225 | Ga0163161_100062252 | 359 |
| 362 | 3300017792 | Ga0163161_10017349 | Ga0163161_100173494 | 359 |
| 363 | 3300017792 | Ga0163161_10089002 | Ga0163161_100890022 | 359 |
| 364 | 3300017792 | Ga0163161_10139077 | Ga0163161_101390772 | 359 |
| 365 | 3300025206 | Ga0209435_100010 | Ga0209435_100010239 | 359 |
| 366 | 3300025228 | Ga0209672_100628 | Ga0209672_10062818 | 359 |
| 367 | 3300025229 | Ga0209147_101067 | Ga0209147_1010673 | 359 |
| 368 | 3300025242 | Ga0209258_100009 | Ga0209258_100009447 | 359 |
| 369 | 3300025245 | Ga0207425_1000235 | Ga0207425_100023535 | 359 |
| 370 | 3300025245 | Ga0207425_1000519 | Ga0207425_100051915 | 359 |
| 371 | 3300025245 | Ga0207425_1000519 | Ga0207425_100051916 | 359 |
| 372 | 3300025245 | Ga0207425_1007765 | Ga0207425_10077652 | 359 |
| 373 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011903 | 359 |
| 374 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001557 | 359 |
| 375 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007447 | 359 |
| 376 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011534 | 359 |
| 377 | 3300025258 | Ga0209129_1000013 | Ga0209129_1000013173 | 359 |
| 378 | 3300025258 | Ga0209129_1000075 | Ga0209129_100007517 | 359 |
| 379 | 3300025258 | Ga0209129_1000075 | Ga0209129_100007518 | 359 |
| 380 | 3300025263 | Ga0209565_1000028 | Ga0209565_1000028236 | 359 |
| 381 | 3300025263 | Ga0209565_1000587 | Ga0209565_100058716 | 359 |
| 382 | 3300025263 | Ga0209565_1001309 | Ga0209565_10013092 | 359 |
| 383 | 3300025273 | Ga0209673_1000035 | Ga0209673_100003599 | 359 |
| 384 | 3300025273 | Ga0209673_1000279 | Ga0209673_100027947 | 359 |
| 385 | 3300025273 | Ga0209673_1001569 | Ga0209673_10015698 | 359 |
| 386 | 3300025273 | Ga0209673_1005270 | Ga0209673_10052707 | 359 |
| 387 | 3300025273 | Ga0209673_1009154 | Ga0209673_10091542 | 359 |
| 388 | 3300025284 | Ga0209130_1000052 | Ga0209130_100005234 | 359 |
| 389 | 3300025284 | Ga0209130_1000112 | Ga0209130_100011293 | 359 |
| 390 | 3300025284 | Ga0209130_1000158 | Ga0209130_100015869 | 359 |
| 391 | 3300025284 | Ga0209130_1000363 | Ga0209130_10003638 | 359 |
| 392 | 3300025291 | Ga0209675_1000490 | Ga0209675_100049018 | 359 |
| 393 | 3300025291 | Ga0209675_1000662 | Ga0209675_100066217 | 359 |
| 394 | 3300025292 | Ga0209676_1000069 | Ga0209676_1000069226 | 359 |
| 395 | 3300025292 | Ga0209676_1009320 | Ga0209676_10093204 | 359 |
| 396 | 3300025294 | Ga0209025_1000103 | Ga0209025_100010360 | 359 |
| 397 | 3300025294 | Ga0209025_1000169 | Ga0209025_1000169131 | 359 |
| 398 | 3300025294 | Ga0209025_1005988 | Ga0209025_10059883 | 359 |
| 399 | 3300025294 | Ga0209025_1012424 | Ga0209025_10124242 | 359 |
| 400 | 3300025294 | Ga0209025_1033092 | Ga0209025_10330924 | 359 |
| 401 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003899 | 359 |
| 402 | 3300025295 | Ga0209564_1000046 | Ga0209564_1000046181 | 359 |
| 403 | 3300025295 | Ga0209564_1000046 | Ga0209564_1000046182 | 359 |
| 404 | 3300025295 | Ga0209564_1000822 | Ga0209564_100082239 | 359 |
| 405 | 3300025295 | Ga0209564_1001252 | Ga0209564_100125220 | 359 |
| 406 | 3300025295 | Ga0209564_1001892 | Ga0209564_100189216 | 359 |
| 407 | 3300025295 | Ga0209564_1003304 | Ga0209564_10033044 | 359 |
| 408 | 3300025297 | Ga0209758_1000052 | Ga0209758_1000052281 | 359 |
| 409 | 3300025297 | Ga0209758_1000052 | Ga0209758_1000052282 | 359 |
| 410 | 3300025297 | Ga0209758_1000067 | Ga0209758_100006782 | 359 |
| 411 | 3300025297 | Ga0209758_1009236 | Ga0209758_10092366 | 359 |
| 412 | 3300025297 | Ga0209758_1017756 | Ga0209758_10177563 | 359 |
| 413 | 3300025297 | Ga0209758_1017756 | Ga0209758_10177564 | 359 |
| 414 | 3300025298 | Ga0209050_1000023 | Ga0209050_1000023401 | 359 |
| 415 | 3300025298 | Ga0209050_1000202 | Ga0209050_100020293 | 359 |
| 416 | 3300025298 | Ga0209050_1002480 | Ga0209050_100248015 | 359 |
| 417 | 3300025298 | Ga0209050_1004530 | Ga0209050_10045306 | 359 |
| 418 | 3300025298 | Ga0209050_1004531 | Ga0209050_10045312 | 359 |
| 419 | 3300025298 | Ga0209050_1005114 | Ga0209050_10051144 | 359 |
| 420 | 3300025299 | Ga0209256_1000003 | Ga0209256_10000031116 | 359 |
| 421 | 3300025299 | Ga0209256_1000011 | Ga0209256_1000011620 | 359 |
| 422 | 3300025299 | Ga0209256_1000077 | Ga0209256_10000778 | 359 |
| 423 | 3300025299 | Ga0209256_1000121 | Ga0209256_1000121131 | 359 |
| 424 | 3300025299 | Ga0209256_1000204 | Ga0209256_100020487 | 359 |
| 425 | 3300025299 | Ga0209256_1004433 | Ga0209256_10044333 | 359 |
| 426 | 3300025299 | Ga0209256_1025326 | Ga0209256_10253261 | 359 |
| 427 | 3300025302 | Ga0207426_1000101 | Ga0207426_1000101173 | 359 |
| 428 | 3300025302 | Ga0207426_1000129 | Ga0207426_1000129155 | 359 |
| 429 | 3300025302 | Ga0207426_1000153 | Ga0207426_100015366 | 359 |
| 430 | 3300025303 | Ga0209051_1000017 | Ga0209051_1000017401 | 359 |
| 431 | 3300025303 | Ga0209051_1001172 | Ga0209051_10011722 | 359 |
| 432 | 3300025303 | Ga0209051_1002779 | Ga0209051_10027796 | 359 |
| 433 | 3300025303 | Ga0209051_1005838 | Ga0209051_10058387 | 359 |
| 434 | 3300025304 | Ga0209257_1000017 | Ga0209257_1000017798 | 359 |
| 435 | 3300025304 | Ga0209257_1000041 | Ga0209257_1000041401 | 359 |
| 436 | 3300025304 | Ga0209257_1001164 | Ga0209257_100116420 | 359 |
| 437 | 3300025304 | Ga0209257_1002118 | Ga0209257_100211815 | 359 |
| 438 | 3300025304 | Ga0209257_1002981 | Ga0209257_100298115 | 359 |
| 439 | 3300025304 | Ga0209257_1005195 | Ga0209257_10051958 | 359 |
| 440 | 3300025304 | Ga0209257_1010355 | Ga0209257_10103554 | 359 |
| 441 | 3300025304 | Ga0209257_1014066 | Ga0209257_10140662 | 359 |
| 442 | 3300025304 | Ga0209257_1014066 | Ga0209257_10140663 | 359 |
| 443 | 3300025315 | Ga0207697_10016551 | Ga0207697_100165512 | 359 |
| 444 | 3300025315 | Ga0207697_10021324 | Ga0207697_100213242 | 359 |
| 445 | 3300025321 | Ga0207656_10008342 | Ga0207656_100083423 | 359 |
| 446 | 3300025321 | Ga0207656_10013005 | Ga0207656_100130052 | 359 |
| 447 | 3300025321 | Ga0207656_10015171 | Ga0207656_100151712 | 359 |
| 448 | 3300025711 | Ga0207696_1010287 | Ga0207696_10102872 | 359 |
| 449 | 3300025728 | Ga0207655_1007289 | Ga0207655_10072895 | 359 |
| 450 | 3300025893 | Ga0207682_10002379 | Ga0207682_100023799 | 359 |
| 451 | 3300025893 | Ga0207682_10008373 | Ga0207682_100083733 | 359 |
| 452 | 3300025893 | Ga0207682_10019881 | Ga0207682_100198812 | 359 |
| 453 | 3300025907 | Ga0207645_10007602 | Ga0207645_100076022 | 359 |
| 454 | 3300025907 | Ga0207645_10026945 | Ga0207645_100269452 | 359 |
| 455 | 3300025907 | Ga0207645_10101935 | Ga0207645_101019352 | 359 |
| 456 | 3300025909 | Ga0207705_10048902 | Ga0207705_100489022 | 359 |
| 457 | 3300025914 | Ga0207671_10120879 | Ga0207671_101208792 | 359 |
| 458 | 3300025917 | Ga0207660_10145054 | Ga0207660_101450541 | 359 |
| 459 | 3300025918 | Ga0207662_10022590 | Ga0207662_100225903 | 359 |
| 460 | 3300025918 | Ga0207662_10086052 | Ga0207662_100860522 | 359 |
| 461 | 3300025919 | Ga0207657_10216015 | Ga0207657_102160151 | 359 |
| 462 | 3300025920 | Ga0207649_10001227 | Ga0207649_100012274 | 359 |
| 463 | 3300025920 | Ga0207649_10071463 | Ga0207649_100714632 | 359 |
| 464 | 3300025921 | Ga0207652_10002539 | Ga0207652_1000253916 | 359 |
| 465 | 3300025923 | Ga0207681_10011771 | Ga0207681_100117712 | 359 |
| 466 | 3300025923 | Ga0207681_10185343 | Ga0207681_101853431 | 359 |
| 467 | 3300025924 | Ga0207694_10021004 | Ga0207694_100210042 | 359 |
| 468 | 3300025925 | Ga0207650_10006268 | Ga0207650_1000626810 | 359 |
| 469 | 3300025925 | Ga0207650_10007691 | Ga0207650_100076918 | 359 |
| 470 | 3300025925 | Ga0207650_10076908 | Ga0207650_100769082 | 359 |
| 471 | 3300025926 | Ga0207659_10003024 | Ga0207659_100030248 | 359 |
| 472 | 3300025926 | Ga0207659_10010792 | Ga0207659_100107922 | 359 |
| 473 | 3300025926 | Ga0207659_10037306 | Ga0207659_100373063 | 359 |
| 474 | 3300025926 | Ga0207659_10050662 | Ga0207659_100506622 | 359 |
| 475 | 3300025926 | Ga0207659_10064108 | Ga0207659_100641082 | 359 |
| 476 | 3300025926 | Ga0207659_10231266 | Ga0207659_102312661 | 359 |
| 477 | 3300025926 | Ga0207659_10305966 | Ga0207659_103059661 | 359 |
| 478 | 3300025931 | Ga0207644_10061994 | Ga0207644_100619941 | 359 |
| 479 | 3300025932 | Ga0207690_10005538 | Ga0207690_100055388 | 359 |
| 480 | 3300025933 | Ga0207706_10000845 | Ga0207706_1000084517 | 359 |
| 481 | 3300025933 | Ga0207706_10021167 | Ga0207706_100211674 | 359 |
| 482 | 3300025933 | Ga0207706_10046558 | Ga0207706_100465582 | 359 |
| 483 | 3300025933 | Ga0207706_10087408 | Ga0207706_100874082 | 359 |
| 484 | 3300025933 | Ga0207706_10123099 | Ga0207706_101230991 | 359 |
| 485 | 3300025933 | Ga0207706_10124154 | Ga0207706_101241542 | 359 |
| 486 | 3300025933 | Ga0207706_10156586 | Ga0207706_101565862 | 359 |
| 487 | 3300025934 | Ga0207686_10004663 | Ga0207686_100046638 | 359 |
| 488 | 3300025934 | Ga0207686_10017750 | Ga0207686_100177502 | 359 |
| 489 | 3300025934 | Ga0207686_10062762 | Ga0207686_100627622 | 359 |
| 490 | 3300025935 | Ga0207709_10000032 | Ga0207709_10000032146 | 359 |
| 491 | 3300025935 | Ga0207709_10001212 | Ga0207709_1000121213 | 359 |
| 492 | 3300025935 | Ga0207709_10002462 | Ga0207709_100024628 | 359 |
| 493 | 3300025935 | Ga0207709_10025234 | Ga0207709_100252342 | 359 |
| 494 | 3300025937 | Ga0207669_10009749 | Ga0207669_100097494 | 359 |
| 495 | 3300025937 | Ga0207669_10035146 | Ga0207669_100351462 | 359 |
| 496 | 3300025937 | Ga0207669_10047435 | Ga0207669_100474352 | 359 |
| 497 | 3300025937 | Ga0207669_10148757 | Ga0207669_101487571 | 359 |
| 498 | 3300025938 | Ga0207704_10003573 | Ga0207704_100035737 | 359 |
| 499 | 3300025938 | Ga0207704_10019101 | Ga0207704_100191012 | 359 |
| 500 | 3300025938 | Ga0207704_10190416 | Ga0207704_101904162 | 359 |
| 501 | 3300025940 | Ga0207691_10000944 | Ga0207691_100009442 | 359 |
| 502 | 3300025940 | Ga0207691_10010958 | Ga0207691_100109582 | 359 |
| 503 | 3300025940 | Ga0207691_10011136 | Ga0207691_100111367 | 359 |
| 504 | 3300025940 | Ga0207691_10018444 | Ga0207691_100184442 | 359 |
| 505 | 3300025940 | Ga0207691_10044478 | Ga0207691_100444783 | 359 |
| 506 | 3300025940 | Ga0207691_10044937 | Ga0207691_100449373 | 359 |
| 507 | 3300025940 | Ga0207691_10089394 | Ga0207691_100893942 | 359 |
| 508 | 3300025940 | Ga0207691_10099071 | Ga0207691_100990712 | 359 |
| 509 | 3300025940 | Ga0207691_10177981 | Ga0207691_101779812 | 359 |
| 510 | 3300025940 | Ga0207691_10227737 | Ga0207691_102277372 | 359 |
| 511 | 3300025941 | Ga0207711_10013379 | Ga0207711_100133796 | 359 |
| 512 | 3300025941 | Ga0207711_10046340 | Ga0207711_100463403 | 359 |
| 513 | 3300025941 | Ga0207711_10056715 | Ga0207711_100567152 | 359 |
| 514 | 3300025941 | Ga0207711_10081721 | Ga0207711_100817212 | 359 |
| 515 | 3300025942 | Ga0207689_10000225 | Ga0207689_1000022539 | 359 |
| 516 | 3300025942 | Ga0207689_10156758 | Ga0207689_101567582 | 359 |
| 517 | 3300025945 | Ga0207679_10000864 | Ga0207679_100008645 | 359 |
| 518 | 3300025945 | Ga0207679_10021206 | Ga0207679_100212062 | 359 |
| 519 | 3300025945 | Ga0207679_10029761 | Ga0207679_100297612 | 359 |
| 520 | 3300025945 | Ga0207679_10094033 | Ga0207679_100940332 | 359 |
| 521 | 3300025960 | Ga0207651_10006251 | Ga0207651_100062512 | 359 |
| 522 | 3300025960 | Ga0207651_10061262 | Ga0207651_100612622 | 359 |
| 523 | 3300025961 | Ga0207712_10142876 | Ga0207712_101428762 | 359 |
| 524 | 3300025972 | Ga0207668_10014832 | Ga0207668_100148324 | 359 |
| 525 | 3300025972 | Ga0207668_10173564 | Ga0207668_101735642 | 359 |
| 526 | 3300025986 | Ga0207658_10003189 | Ga0207658_100031892 | 359 |
| 527 | 3300025986 | Ga0207658_10006549 | Ga0207658_100065498 | 359 |
| 528 | 3300025986 | Ga0207658_10021149 | Ga0207658_100211492 | 359 |
| 529 | 3300025986 | Ga0207658_10116768 | Ga0207658_101167681 | 359 |
| 530 | 3300026023 | Ga0207677_10003900 | Ga0207677_100039008 | 359 |
| 531 | 3300026023 | Ga0207677_10035679 | Ga0207677_100356792 | 359 |
| 532 | 3300026023 | Ga0207677_10088153 | Ga0207677_100881532 | 359 |
| 533 | 3300026035 | Ga0207703_10001484 | Ga0207703_100014843 | 359 |
| 534 | 3300026035 | Ga0207703_10032892 | Ga0207703_100328922 | 359 |
| 535 | 3300026035 | Ga0207703_10089633 | Ga0207703_100896332 | 359 |
| 536 | 3300026035 | Ga0207703_10144035 | Ga0207703_101440352 | 359 |
| 537 | 3300026041 | Ga0207639_10166516 | Ga0207639_101665162 | 359 |
| 538 | 3300026041 | Ga0207639_10191056 | Ga0207639_101910562 | 359 |
| 539 | 3300026041 | Ga0207639_10271338 | Ga0207639_102713382 | 359 |
| 540 | 3300026041 | Ga0207639_10309361 | Ga0207639_103093612 | 359 |
| 541 | 3300026067 | Ga0207678_10012524 | Ga0207678_100125245 | 359 |
| 542 | 3300026067 | Ga0207678_10065269 | Ga0207678_100652692 | 359 |
| 543 | 3300026067 | Ga0207678_10117339 | Ga0207678_101173391 | 359 |
| 544 | 3300026067 | Ga0207678_10172832 | Ga0207678_101728322 | 359 |
| 545 | 3300026078 | Ga0207702_10036064 | Ga0207702_100360643 | 359 |
| 546 | 3300026088 | Ga0207641_10008519 | Ga0207641_100085192 | 359 |
| 547 | 3300026088 | Ga0207641_10021323 | Ga0207641_100213232 | 359 |
| 548 | 3300026089 | Ga0207648_10000146 | Ga0207648_1000014667 | 359 |
| 549 | 3300026089 | Ga0207648_10002481 | Ga0207648_100024818 | 359 |
| 550 | 3300026089 | Ga0207648_10005079 | Ga0207648_100050798 | 359 |
| 551 | 3300026089 | Ga0207648_10033097 | Ga0207648_100330974 | 359 |
| 552 | 3300026089 | Ga0207648_10145787 | Ga0207648_101457871 | 359 |
| 553 | 3300026089 | Ga0207648_10153981 | Ga0207648_101539812 | 359 |
| 554 | 3300026095 | Ga0207676_10016086 | Ga0207676_100160861 | 359 |
| 555 | 3300026095 | Ga0207676_10019189 | Ga0207676_100191895 | 359 |
| 556 | 3300026095 | Ga0207676_10026201 | Ga0207676_100262012 | 359 |
| 557 | 3300026095 | Ga0207676_10162301 | Ga0207676_101623012 | 359 |
| 558 | 3300026095 | Ga0207676_10222930 | Ga0207676_102229302 | 359 |
| 559 | 3300026116 | Ga0207674_10021396 | Ga0207674_100213968 | 359 |
| 560 | 3300026116 | Ga0207674_10050451 | Ga0207674_100504513 | 359 |
| 561 | 3300026116 | Ga0207674_10149734 | Ga0207674_101497342 | 359 |
| 562 | 3300026118 | Ga0207675_100004297 | Ga0207675_1000042978 | 359 |
| 563 | 3300026118 | Ga0207675_100007940 | Ga0207675_1000079402 | 359 |
| 564 | 3300026118 | Ga0207675_100125768 | Ga0207675_1001257682 | 359 |
| 565 | 3300026121 | Ga0207683_10012690 | Ga0207683_100126904 | 359 |
| 566 | 3300026121 | Ga0207683_10013995 | Ga0207683_100139952 | 359 |
| 567 | 3300026121 | Ga0207683_10103552 | Ga0207683_101035522 | 359 |
| 568 | 3300026121 | Ga0207683_10113636 | Ga0207683_101136362 | 359 |
| 569 | 3300026121 | Ga0207683_10126947 | Ga0207683_101269471 | 359 |
| 570 | 3300026121 | Ga0207683_10137667 | Ga0207683_101376671 | 359 |
| 571 | 3300026121 | Ga0207683_10192397 | Ga0207683_101923972 | 359 |
| 572 | 3300026142 | Ga0207698_10001243 | Ga0207698_100012438 | 359 |
| 573 | 3300026142 | Ga0207698_10030755 | Ga0207698_100307552 | 359 |
| 574 | 3300026142 | Ga0207698_10074112 | Ga0207698_100741122 | 359 |
| 575 | 3300026142 | Ga0207698_10190839 | Ga0207698_101908391 | 359 |
| 576 | 3300026142 | Ga0207698_10261807 | Ga0207698_102618072 | 359 |
| 577 | 3300026142 | Ga0207698_10406829 | Ga0207698_104068291 | 359 |
| 578 | 3300027111 | Ga0209281_1000002 | Ga0209281_10000021472 | 359 |
| 579 | 3300027111 | Ga0209281_1000042 | Ga0209281_1000042166 | 359 |
| 580 | 3300027296 | Ga0209389_1014524 | Ga0209389_10145242 | 359 |
| 581 | 3300027543 | Ga0209999_1000544 | Ga0209999_10005442 | 359 |
| 582 | 3300027682 | Ga0209971_1002891 | Ga0209971_10028912 | 359 |
| 583 | 3300027695 | Ga0209966_1000036 | Ga0209966_100003636 | 359 |
| 584 | 3300027876 | Ga0209974_10000455 | Ga0209974_100004557 | 359 |
| 585 | 3300028380 | Ga0268265_10005309 | Ga0268265_100053093 | 359 |
| 586 | 3300028381 | Ga0268264_10011851 | Ga0268264_100118514 | 359 |
| 587 | 3300028381 | Ga0268264_10015393 | Ga0268264_100153933 | 359 |
| 588 | 3300028786 | Ga0307517_10115516 | Ga0307517_101155161 | 359 |
| 589 | 3300028794 | Ga0307515_10000020 | Ga0307515_10000020306 | 359 |
| 590 | 3300028794 | Ga0307515_10000053 | Ga0307515_10000053107 | 359 |
| 591 | 3300028794 | Ga0307515_10000529 | Ga0307515_1000052912 | 359 |
| 592 | 3300028794 | Ga0307515_10005082 | Ga0307515_1000508210 | 359 |
| 593 | 3300028794 | Ga0307515_10006495 | Ga0307515_100064957 | 359 |
| 594 | 3300028794 | Ga0307515_10104200 | Ga0307515_101042002 | 359 |
| 595 | 3300028794 | Ga0307515_10119380 | Ga0307515_101193802 | 359 |
| 596 | 3300031235 | Ga0265330_10000014 | Ga0265330_1000001459 | 359 |
| 597 | 3300031238 | Ga0265332_10000011 | Ga0265332_10000011180 | 359 |
| 598 | 3300031239 | Ga0265328_10009555 | Ga0265328_100095553 | 359 |
| 599 | 3300031241 | Ga0265325_10044997 | Ga0265325_100449972 | 359 |
| 600 | 3300031250 | Ga0265331_10019144 | Ga0265331_100191443 | 359 |
| 601 | 3300031251 | Ga0265327_10000184 | Ga0265327_1000018494 | 359 |
| 602 | 3300031251 | Ga0265327_10000355 | Ga0265327_100003559 | 359 |
| 603 | 3300031456 | Ga0307513_10000004 | Ga0307513_10000004292 | 359 |
| 604 | 3300031456 | Ga0307513_10000015 | Ga0307513_1000001524 | 359 |
| 605 | 3300031456 | Ga0307513_10006695 | Ga0307513_1000669513 | 359 |
| 606 | 3300031456 | Ga0307513_10212349 | Ga0307513_102123492 | 359 |
| 607 | 3300031456 | Ga0307513_10254241 | Ga0307513_102542412 | 359 |
| 608 | 3300031507 | Ga0307509_10082658 | Ga0307509_100826581 | 359 |
| 609 | 3300031548 | Ga0307408_100000150 | Ga0307408_10000015010 | 359 |
| 610 | 3300031548 | Ga0307408_100312909 | Ga0307408_1003129091 | 359 |
| 611 | 3300031548 | Ga0307408_100416696 | Ga0307408_1004166961 | 359 |
| 612 | 3300031616 | Ga0307508_10000004 | Ga0307508_1000000452 | 359 |
| 613 | 3300031649 | Ga0307514_10001404 | Ga0307514_1000140423 | 359 |
| 614 | 3300031649 | Ga0307514_10064671 | Ga0307514_100646712 | 359 |
| 615 | 3300031711 | Ga0265314_10000026 | Ga0265314_1000002688 | 359 |
| 616 | 3300031712 | Ga0265342_10130266 | Ga0265342_101302661 | 359 |
| 617 | 3300031730 | Ga0307516_10003104 | Ga0307516_100031046 | 359 |
| 618 | 3300031730 | Ga0307516_10003697 | Ga0307516_1000369712 | 359 |
| 619 | 3300031730 | Ga0307516_10095734 | Ga0307516_100957342 | 359 |
| 620 | 3300031730 | Ga0307516_10109150 | Ga0307516_101091502 | 359 |
| 621 | 3300031730 | Ga0307516_10272720 | Ga0307516_102727201 | 359 |
| 622 | 3300031731 | Ga0307405_10004178 | Ga0307405_100041787 | 359 |
| 623 | 3300031824 | Ga0307413_10000382 | Ga0307413_100003825 | 359 |
| 624 | 3300031824 | Ga0307413_10046773 | Ga0307413_100467733 | 359 |
| 625 | 3300031852 | Ga0307410_10038494 | Ga0307410_100384942 | 359 |
| 626 | 3300031901 | Ga0307406_10013196 | Ga0307406_100131964 | 359 |
| 627 | 3300031901 | Ga0307406_10028804 | Ga0307406_100288042 | 359 |
| 628 | 3300031901 | Ga0307406_10046459 | Ga0307406_100464592 | 359 |
| 629 | 3300031911 | Ga0307412_10024767 | Ga0307412_100247672 | 359 |
| 630 | 3300031995 | Ga0307409_100000086 | Ga0307409_1000000862 | 359 |
| 631 | 3300031995 | Ga0307409_100030709 | Ga0307409_1000307093 | 359 |
| 632 | 3300031995 | Ga0307409_100167534 | Ga0307409_1001675342 | 359 |
| 633 | 3300032002 | Ga0307416_100070093 | Ga0307416_1000700932 | 359 |
| 634 | 3300032002 | Ga0307416_100085870 | Ga0307416_1000858702 | 359 |
| 635 | 3300032002 | Ga0307416_100117761 | Ga0307416_1001177612 | 359 |
| 636 | 3300032002 | Ga0307416_100315228 | Ga0307416_1003152282 | 359 |
| 637 | 3300032002 | Ga0307416_100324400 | Ga0307416_1003244001 | 359 |
| 638 | 3300032002 | Ga0307416_100383021 | Ga0307416_1003830211 | 359 |
| 639 | 3300032005 | Ga0307411_10000869 | Ga0307411_1000086910 | 359 |
| 640 | 3300032005 | Ga0307411_10003562 | Ga0307411_100035627 | 359 |
| 641 | 3300032126 | Ga0307415_100009938 | Ga0307415_1000099383 | 359 |
| 642 | 3300032126 | Ga0307415_100066344 | Ga0307415_1000663442 | 359 |
| 643 | 3300033179 | Ga0307507_10007188 | Ga0307507_100071887 | 359 |
| 644 | 3300034817 | Ga0373948_0010692 | Ga0373948_0010692_275_1357 | 359 |
| 645 | 3300034818 | Ga0373950_0006394 | Ga0373950_0006394_605_1687 | 359 |
| 646 | 3300035114 | Ga0373939_0000069 | Ga0373939_0000069_14726_15808 | 359 |
| 647 | 3300035121 | Ga0373960_0014790 | Ga0373960_0014790_587_1669 | 359 |
| 648 | 3300035691 | Ga0373931_0001617 | Ga0373931_0001617_1281_2363 | 359 |
| 649 | 3300035695 | Ga0373927_0076598 | Ga0373927_0076598_421_1503 | 359 |
| 650 | 3300036401 | Ga0373937_0051389 | Ga0373937_0051389_1212_2294 | 359 |
| 651 | 3300037418 | Ga0395900_0000109 | Ga0395900_0000109_102068_103150 | 359 |
| 652 | 3300037418 | Ga0395900_0110563 | Ga0395900_0110563_1169_2248 | 359 |
| 653 | 3300037466 | Ga0395898_0000868 | Ga0395898_0000868_21380_22462 | 359 |
| 654 | 3300037471 | Ga0395905_0003562 | Ga0395905_0003562_12213_13295 | 359 |
| 655 | 3300037471 | Ga0395905_0029126 | Ga0395905_0029126_2735_3823 | 359 |
| 656 | 3300037471 | Ga0395905_0045312 | Ga0395905_0045312_1767_2849 | 359 |
| 657 | 3300037471 | Ga0395905_0045312 | Ga0395905_0045312_509_1591 | 359 |
| 658 | 3300037471 | Ga0395905_0050200 | Ga0395905_0050200_2661_3743 | 359 |
| 659 | 3300037471 | Ga0395905_0066244 | Ga0395905_0066244_428_1519 | 359 |
| 660 | 3300037471 | Ga0395905_0071033 | Ga0395905_0071033_2136_3215 | 359 |
| 661 | 3300037471 | Ga0395905_0127146 | Ga0395905_0127146_1125_2207 | 359 |
| 662 | 3300037471 | Ga0395905_0134402 | Ga0395905_0134402_1051_2133 | 359 |
| 663 | 3300039437 | Ga0436365_1492983 | Ga0436365_1492983_151_1233 | 359 |
| 664 | 3300041413 | Ga0439465_0063323 | Ga0439465_0063323_75_1154 | 359 |
| 665 | 3300041443 | Ga0451789_0948633 | Ga0451789_0948633_241_1323 | 359 |
| 666 | 3300041459 | Ga0451800_1194461 | Ga0451800_1194461_993_2075 | 359 |
| 667 | 3300041460 | Ga0451802_0797663 | Ga0451802_0797663_146_1228 | 359 |
| 668 | 3300042007 | Ga0439449_0054938 | Ga0439449_0054938_12_1094 | 359 |
| 669 | 3300042120 | Ga0450917_000395 | Ga0450917_000395_1474_2562 | 359 |
| 670 | 3300042126 | Ga0450888_000086 | Ga0450888_000086_3041_4129 | 359 |
| 671 | 3300042127 | Ga0450890_000675 | Ga0450890_000675_1615_2736 | 359 |
| 672 | 3300042127 | Ga0450890_000986 | Ga0450890_000986_446_1534 | 359 |
| 673 | 3300042129 | Ga0450891_000157 | Ga0450891_000157_1384_2472 | 359 |
| 674 | 3300042130 | Ga0450892_000356 | Ga0450892_000356_802_1890 | 359 |
| 675 | 3300042134 | Ga0450898_002712 | Ga0450898_002712_243_1322 | 359 |
| 676 | 3300042135 | Ga0450899_003727 | Ga0450899_003727_518_1600 | 359 |
| 677 | 3300042144 | Ga0450889_000632 | Ga0450889_000632_2590_3678 | 359 |
| 678 | 3300042531 | Ga0450918_000026 | Ga0450918_000026_5813_6895 | 359 |
| 679 | 3300042532 | Ga0450893_0000069 | Ga0450893_0000069_1889_2977 | 359 |
| 680 | 3300042876 | Ga0451577_0000142 | Ga0451577_0000142_30090_31169 | 359 |
| 681 | 3300042876 | Ga0451577_0001509 | Ga0451577_0001509_20768_21850 | 359 |
| 682 | 3300042876 | Ga0451577_0002068 | Ga0451577_0002068_11727_12809 | 359 |
| 683 | 3300042876 | Ga0451577_0007013 | Ga0451577_0007013_7581_8663 | 359 |
| 684 | 3300042876 | Ga0451577_0020090 | Ga0451577_0020090_1442_2557 | 359 |
| 685 | 3300044656 | Ga0466969_0000385 | Ga0466969_0000385_19011_20093 | 359 |
| 686 | 3300044658 | Ga0466972_0034233 | Ga0466972_0034233_201_1280 | 359 |
| 687 | 3300044673 | Ga0453683_0003599 | Ga0453683_0003599_8438_9520 | 359 |
| 688 | 3300044684 | Ga0466966_0006769 | Ga0466966_0006769_2300_3382 | 359 |
| 689 | 3300044684 | Ga0466966_0023138 | Ga0466966_0023138_2173_3255 | 359 |
| 690 | 3300044693 | Ga0466961_0011070 | Ga0466961_0011070_4605_5687 | 359 |
| 691 | 3300044693 | Ga0466961_0031065 | Ga0466961_0031065_1692_2774 | 359 |
| 692 | 3300044693 | Ga0466961_0054701 | Ga0466961_0054701_1045_2127 | 359 |
| 693 | 3300044694 | Ga0466963_0064455 | Ga0466963_0064455_1114_2196 | 359 |
| 694 | 3300044694 | Ga0466963_0086826 | Ga0466963_0086826_339_1421 | 359 |
| 695 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_205887_206966 | 359 |
| 696 | 3300044712 | Ga0453684_0053731 | Ga0453684_0053731_3653_4735 | 359 |
| 697 | 3300044712 | Ga0453684_0176775 | Ga0453684_0176775_578_1660 | 359 |
| 698 | 3300044712 | Ga0453684_0369110 | Ga0453684_0369110_318_1397 | 359 |
| 699 | 3300044719 | Ga0466971_0013038 | Ga0466971_0013038_2371_3453 | 359 |
| 700 | 3300045049 | Ga0466959_0000371 | Ga0466959_0000371_20169_21251 | 359 |
| 701 | 3300045049 | Ga0466959_0019290 | Ga0466959_0019290_3426_4508 | 359 |
| 702 | 3300045049 | Ga0466959_0072253 | Ga0466959_0072253_785_1867 | 359 |
| 703 | 3300045051 | Ga0451576_0000909 | Ga0451576_0000909_28112_29203 | 359 |
| 704 | 3300045051 | Ga0451576_0002187 | Ga0451576_0002187_17530_18609 | 359 |
| 705 | 3300045051 | Ga0451576_0007327 | Ga0451576_0007327_8954_10033 | 359 |
| 706 | 3300045051 | Ga0451576_0012822 | Ga0451576_0012822_5441_6523 | 359 |
| 707 | 3300045051 | Ga0451576_0028892 | Ga0451576_0028892_4350_5465 | 359 |
| 708 | 3300045051 | Ga0451576_0039865 | Ga0451576_0039865_2786_3925 | 359 |
| 709 | 3300045051 | Ga0451576_0153533 | Ga0451576_0153533_1145_2227 | 359 |
| 710 | 3300045051 | Ga0451576_0289442 | Ga0451576_0289442_222_1301 | 359 |
| 711 | 3300045051 | Ga0451576_0344039 | Ga0451576_0344039_140_1228 | 359 |
| 712 | 3300045051 | Ga0451576_0486235 | Ga0451576_0486235_184_1266 | 359 |
| 713 | 3300045836 | Ga0466958_0022478 | Ga0466958_0022478_124_1206 | 359 |
| 714 | 3300045976 | Ga0466967_0085582 | Ga0466967_0085582_895_1977 | 359 |
| 715 | 3300045976 | Ga0466967_0174591 | Ga0466967_0174591_624_1706 | 359 |
| 716 | 3300046516 | Ga0495628_0240274 | Ga0495628_0240274_246_1328 | 359 |
| 717 | 3300046519 | Ga0495632_0002146 | Ga0495632_0002146_7580_8662 | 359 |
| 718 | 3300046519 | Ga0495632_0003371 | Ga0495632_0003371_1716_2798 | 359 |
| 719 | 3300046519 | Ga0495632_0007855 | Ga0495632_0007855_1230_2312 | 359 |
| 720 | 3300046528 | Ga0495642_0121997 | Ga0495642_0121997_10_1092 | 359 |
| 721 | 3300046539 | Ga0495621_0026108 | Ga0495621_0026108_834_1916 | 359 |
| 722 | 3300046542 | Ga0495597_0001551 | Ga0495597_0001551_14391_15470 | 359 |
| 723 | 3300046615 | Ga0495656_0000062 | Ga0495656_0000062_47134_48213 | 359 |
| 724 | 3300046660 | Ga0495625_0067071 | Ga0495625_0067071_1286_2368 | 359 |
| 725 | 3300046694 | Ga0495649_0001518 | Ga0495649_0001518_4914_5996 | 359 |
| 726 | 3300047443 | Ga0495687_000599 | Ga0495687_000599_29231_30313 | 359 |
| 727 | 3300047471 | Ga0495684_0114505 | Ga0495684_0114505_158_1240 | 359 |
| 728 | 3300048091 | Ga0495626_0021022 | Ga0495626_0021022_643_1725 | 359 |
| 729 | 3300048908 | Ga0496105_0035322 | Ga0496105_0035322_812_1894 | 359 |
| 730 | 3300048910 | Ga0496107_0055573 | Ga0496107_0055573_1118_2200 | 359 |
| 731 | 3300048911 | Ga0496108_0072577 | Ga0496108_0072577_519_1601 | 359 |
| 732 | 3300048912 | Ga0496109_0057078 | Ga0496109_0057078_1360_2442 | 359 |
| 733 | 3300048912 | Ga0496109_0084109 | Ga0496109_0084109_128_1210 | 359 |
| 734 | 3300048915 | Ga0496112_0014880 | Ga0496112_0014880_3505_4587 | 359 |
| 735 | 3300048918 | Ga0496115_0238042 | Ga0496115_0238042_58_1140 | 359 |
| 736 | 3300048921 | Ga0496118_0068611 | Ga0496118_0068611_854_1933 | 359 |
| 737 | 3300048925 | Ga0496122_0032346 | Ga0496122_0032346_2533_3612 | 359 |
| 738 | 3300048926 | Ga0496123_0036924 | Ga0496123_0036924_1564_2643 | 359 |
| 739 | 3300048928 | Ga0496125_0007601 | Ga0496125_0007601_2917_3996 | 359 |
| 740 | 3300048929 | Ga0496126_0014772 | Ga0496126_0014772_171_1250 | 359 |
| 741 | 3300048929 | Ga0496126_0156221 | Ga0496126_0156221_187_1266 | 359 |
| 742 | 3300049523 | Ga0501300_004837 | Ga0501300_004837_66_1154 | 359 |
| 743 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_134745_135827 | 359 |
| 744 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_156009_157091 | 359 |
| 745 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_155689_156771 | 359 |
| 746 | 3300049662 | Ga0501222_001295 | Ga0501222_001295_525_1613 | 359 |
| 747 | 3300049663 | Ga0501223_008470 | Ga0501223_008470_554_1642 | 359 |
| 748 | 3300049682 | Ga0501252_000450 | Ga0501252_000450_1416_2498 | 359 |
| 749 | 3300049684 | Ga0501255_002105 | Ga0501255_002105_118_1206 | 359 |
| 750 | 3300049706 | Ga0501229_001888 | Ga0501229_001888_911_1993 | 359 |
| 751 | 3300049759 | Ga0501262_008134 | Ga0501262_008134_133_1215 | 359 |
| 752 | 3300049762 | Ga0501265_000996 | Ga0501265_000996_454_1536 | 359 |
| 753 | 3300049769 | Ga0501272_001530 | Ga0501272_001530_1094_2182 | 359 |
| 754 | 3300049824 | Ga0501045_0020428 | Ga0501045_0020428_2669_3751 | 359 |
| 755 | 3300050493 | nmdc:mga0k408_11976_c1 | nmdc:mga0k408_11976_c1_2521_3603 | 359 |
| 756 | 3300050493 | nmdc:mga0k408_1332_c1 | nmdc:mga0k408_1332_c1_10363_11445 | 359 |
| 757 | 3300050493 | nmdc:mga0k408_16177_c2 | nmdc:mga0k408_16177_c2_1203_2285 | 359 |
| 758 | 3300050493 | nmdc:mga0k408_181937_c1 | nmdc:mga0k408_181937_c1_103_1185 | 359 |
| 759 | 3300050493 | nmdc:mga0k408_2245_c1 | nmdc:mga0k408_2245_c1_8244_9326 | 359 |
| 760 | 3300050493 | nmdc:mga0k408_25138_c1 | nmdc:mga0k408_25138_c1_1590_2672 | 359 |
| 761 | 3300050493 | nmdc:mga0k408_47091_c1 | nmdc:mga0k408_47091_c1_683_1765 | 359 |
| 762 | 3300050493 | nmdc:mga0k408_5225_c1 | nmdc:mga0k408_5225_c1_2533_3615 | 359 |
| 763 | 3300050493 | nmdc:mga0k408_69768_c1 | nmdc:mga0k408_69768_c1_454_1536 | 359 |
| 764 | 3300050494 | nmdc:mga06z11_120738_c1 | nmdc:mga06z11_120738_c1_309_1391 | 359 |
| 765 | 3300050496 | nmdc:mga07m45_1111_c1 | nmdc:mga07m45_1111_c1_3212_4294 | 359 |
| 766 | 3300050496 | nmdc:mga07m45_1313_c1 | nmdc:mga07m45_1313_c1_8537_9619 | 359 |
| 767 | 3300050496 | nmdc:mga07m45_21568_c1 | nmdc:mga07m45_21568_c1_1739_2821 | 359 |
| 768 | 3300050496 | nmdc:mga07m45_4922_c1 | nmdc:mga07m45_4922_c1_349_1431 | 359 |
| 769 | 3300050496 | nmdc:mga07m45_63_c1 | nmdc:mga07m45_63_c1_281_1363 | 359 |
| 770 | 3300050507 | nmdc:mga05p37_70873_c1 | nmdc:mga05p37_70873_c1_1972_3051 | 359 |
| 771 | 3300050508 | nmdc:mga09592_3159_c1 | nmdc:mga09592_3159_c1_8620_9702 | 359 |
| 772 | 3300050516 | nmdc:mga0sz30_13751_c1 | nmdc:mga0sz30_13751_c1_732_1814 | 359 |
| 773 | 3300053084 | Ga0495595_0137824 | Ga0495595_0137824_62_1156 | 359 |
| 774 | 3300053086 | Ga0500578_0000746 | Ga0500578_0000746_35903_36985 | 359 |
| 775 | 3300053088 | Ga0500644_0038987 | Ga0500644_0038987_394_1476 | 359 |
| 776 | 3300053090 | Ga0500646_0020058 | Ga0500646_0020058_201_1283 | 359 |
| 777 | 3300053093 | Ga0500651_0029161 | Ga0500651_0029161_1289_2371 | 359 |
| 778 | 3300053130 | Ga0500642_0000935 | Ga0500642_0000935_6372_7454 | 359 |
| 779 | 3300053131 | Ga0500652_000142 | Ga0500652_000142_25923_27005 | 359 |
| 780 | 3300053131 | Ga0500652_000807 | Ga0500652_000807_6185_7267 | 359 |
| 781 | 3300053133 | Ga0500655_007435 | Ga0500655_007435_388_1470 | 359 |
| 782 | 3300053134 | Ga0500658_0003009 | Ga0500658_0003009_4850_5932 | 359 |
| 783 | 3300053139 | Ga0500568_0013996 | Ga0500568_0013996_2435_3517 | 359 |
| 784 | 3300053139 | Ga0500568_0023720 | Ga0500568_0023720_615_1697 | 359 |
| 785 | 3300053154 | Ga0500619_000310 | Ga0500619_000310_868_1950 | 359 |
| 786 | 3300053156 | Ga0500622_0000599 | Ga0500622_0000599_12697_13779 | 359 |
| 787 | 3300053156 | Ga0500622_0000952 | Ga0500622_0000952_22025_23107 | 359 |
| 788 | 3300053156 | Ga0500622_0002819 | Ga0500622_0002819_3007_4122 | 359 |
| 789 | 3300053156 | Ga0500622_0014209 | Ga0500622_0014209_2859_3941 | 359 |
| 790 | 3300053161 | Ga0500634_0037535 | Ga0500634_0037535_237_1319 | 359 |
| 791 | 3300053730 | Ga0500645_004363 | Ga0500645_004363_3767_4846 | 359 |
| 792 | 3300061719 | Ga0466962_0030617 | Ga0466962_0030617_343_1425 | 359 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hzl-assembly1.cif.gz_A | crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms | 0.9833 | 30 | 355 |
| 4yzz-assembly1.cif.gz_A | crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site | 0.9824 | 29 | 354 |
| 7ug8-assembly1.cif.gz_A | crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium | 0.9778 | 29 | 352 |
| 4pet-assembly1.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate | 0.9666 | 29 | 350 |
| 7ug8-assembly1.cif.gz_A | crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium | 0.9603 | 29 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4yzzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9761 | 29 | 354 | 3.40.190.170 |
| 2hzkC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9748 | 30 | 357 | 3.40.190.170 |
| 2hzkC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9658 | 30 | 357 | 3.40.190.170 |
| 4yzzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9409 | 29 | 354 | 3.40.190.170 |
| 4yicB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9334 | 152 | 321 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5FTX4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9934 | 48 | 359 |
GO:0055085
|
| AF-A0A0D7EEV2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9897 | 30 | 354 |
GO:0015849
GO:0031317 GO:0043177 GO:0046872 GO:0055085 |
| AF-A0A259GDW1-F1-model_v4 | ABC transporter substrate-binding protein | 0.9891 | 22 | 355 |
GO:0015849
GO:0031317 GO:0043177 GO:0046872 GO:0055085 |
| AF-A0A3N5FTX4-F1-model_v4 | ABC transporter substrate-binding protein | 0.984 | 48 | 359 |
GO:0055085
|
| AF-A0A537VVV0-F1-model_v4 | ABC transporter substrate-binding protein | 0.9808 | 72 | 359 |
GO:0055085
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar