F481043

General Info

Members Datasets Scaffolds Average Seq Length
792 364 735 360

Family's Representative Sequence

Representative Sequence 3300049649|Ga0501198_000010|Ga0501198_000010_92305_93447
Length 380
Sequence MERRSFVRGAGLAGVVAGAGALLSACGKKDAQPVAGTAPAAAPAVSTGGSIRWRLASSFPKSLDTIYGAAEVFAKKVGEMTGGKFQISVHAGGELMPPFGVVDGVQKATVEMAHTAPYYFFGKDETFALACAIPFGLNSRQMTAWMYEGNGLKLIREFYAQYNIISFPMGNTGAQMGGWYRKELKSVADMKGLKIRIGGFAGKVIERMGGVPQNIPGGEIYQALEKGTIDATEWVGPYDDQKLGFNKVAPNYYYPGWWEGGPQLDLYVNTAAYQSLSPEYKAVIESAAAYAHTQMQARYDARNPDALRQLVASGTKLFRFPKDVMDAAFKESMALYSELSAKNPNWKKVYEDYAKFRTDQNLWFRFAEAGFDSYMHQQKL

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
11 2643221585 Pelomonas sp. Root662 Isolate Unclassified
12 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
15 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
16 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
17 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
18 2643221656 Pelomonas sp. Root405 Isolate Unclassified
19 2721755523 Delftia sp. HK171 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738541337 Pelomonas sp. BT06 Isolate Unclassified
23 2738543012 Acidovorax sp. CF301 Isolate Unclassified
24 2738543019 Variovorax sp. GV040 Isolate Unclassified
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2831864461 Roseateles noduli HZ7 Isolate Nodule
27 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
28 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
29 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
30 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
31 2899924645 Variovorax sp. 369 Isolate Unclassified
32 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
33 2928037797 Variovorax sp. 1126 Isolate Unclassified
34 2928044640 Variovorax sp. 1128 Isolate Unclassified
35 2928051484 Variovorax sp. 1133 Isolate Unclassified
36 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
37 2928070936 Variovorax gossypii 1167 Isolate Unclassified
38 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
39 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
40 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
41 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
42 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
43 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
44 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
45 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
48 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
49 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
54 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
55 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
56 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
69 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
70 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
71 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
74 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
75 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
76 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
77 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
78 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
83 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
84 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
85 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
86 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
87 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
90 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
95 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
96 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
115 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
126 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
139 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
226 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
227 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
237 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
238 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
239 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
240 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
241 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
246 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
247 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
248 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
253 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
254 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
255 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
256 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
260 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
261 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
262 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
263 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
273 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
274 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
275 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
276 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
277 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
278 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
279 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
280 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
281 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
282 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
283 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
284 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
285 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
286 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
287 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
288 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
289 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
290 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
291 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
292 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
293 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
294 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
295 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
296 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
297 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
298 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
299 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
300 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
301 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
305 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
306 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
307 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
308 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
332 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
333 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
334 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
335 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
336 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
337 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
338 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
339 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
348 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
349 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
350 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
351 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
352 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
353 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
354 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
355 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
358 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
359 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
360 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
361 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
362 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
363 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
364 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.07
Metatranscriptomes 0
Isolates 5.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.48
Nodule 1.01
Rhizoplane 1.77
Rhizosphere 64.52
Stem 0
Stem Tuber 0
Unclassified 9.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009650 3300001979 Bacteria 3765
2 JGI25155J39150_1000005 3300002704 Bacteria 261712
3 JGI25156J39149_1000006 3300002705 Bacteria 261778
4 JGI25154J39366_1000015 3300002738 Bacteria 261778
5 JGI25157J39369_1000111 3300002741 Bacteria 69508
6 JGI25152J39213_1002353 3300002773 Bacteria 7259
7 JGI25152J39213_1003217 3300002773 Bacteria 5679
8 JGI25150J39212_1002625 3300002774 Bacteria 4417
9 JGI25150J39212_1003507 3300002774 Bacteria 3661
10 JGI25150J39212_1005857 3300002774 Bacteria 2584
11 JGI25159J45721_1003156 3300002987 Bacteria 5930
12 JGI25159J45721_1010735 3300002987 Bacteria 2306
13 JGI25151J46595_10025360 3300003187 Bacteria 2414
14 JGI25151J46595_10025978 3300003187 Bacteria 2371
15 JGI25153J46596_10011279 3300003215 Bacteria 3964
16 JGI25153J46596_10025852 3300003215 Bacteria 2089
17 rootL2_10003410 3300003322 Bacteria 24274
18 rootH1_10006954 3300003323 Bacteria 7249
19 rootH1_10024154 3300003323 Bacteria 5841
20 rootH1_10098199 3300003323 Bacteria 4902
21 rootH1_10120714 3300003323 Bacteria 1604
22 JGI26128J50194_1000166 3300003347 Bacteria 2944
23 JGI25160J50197_1000045 3300003354 Bacteria 142992
24 JGI26145J50221_1001536 3300003371 Bacteria 1818
25 JGI25161J50226_1000008 3300003374 Bacteria 239245
26 JGI25161J50226_1005839 3300003374 Bacteria 2314
27 Ga0055535_1000076 3300003761 Bacteria 111203
28 Ga0055542_1000009 3300003762 Bacteria 416550
29 Ga0055526_1003100 3300003771 Bacteria 10787
30 Ga0055526_1004023 3300003771 Bacteria 9034
31 Ga0055526_1004056 3300003771 Bacteria 8990
32 Ga0055526_1005431 3300003771 Bacteria 7330
33 Ga0055537_1000198 3300003773 Bacteria 45289
34 Ga0055537_1007287 3300003773 Bacteria 2683
35 Ga0055524_1000080 3300003775 Bacteria 120203
36 Ga0055524_1000126 3300003775 Bacteria 89985
37 Ga0055524_1002605 3300003775 Bacteria 9176
38 Ga0055524_1013464 3300003775 Bacteria 3082
39 Ga0055536_1004051 3300003781 Bacteria 7630
40 Ga0055536_1005604 3300003781 Bacteria 6083
41 Ga0055534_1007296 3300003784 Bacteria 2652
42 Ga0055534_1008433 3300003784 Bacteria 2334
43 Ga0055528_1000633 3300003790 Bacteria 25778
44 Ga0055530_10000699 3300003791 Bacteria 28341
45 Ga0055530_10001787 3300003791 Bacteria 14951
46 Ga0055530_10003267 3300003791 Bacteria 9431
47 Ga0055540_1000002 3300003792 Bacteria 436954
48 Ga0055540_1000021 3300003792 Bacteria 208733
49 Ga0055531_10000051 3300003794 Bacteria 130125
50 Ga0055531_10001171 3300003794 Bacteria 20185
51 Ga0055531_10001860 3300003794 Bacteria 14814
52 Ga0055531_10002049 3300003794 Bacteria 13902
53 Ga0055531_10005509 3300003794 Bacteria 7398
54 Ga0055531_10009879 3300003794 Bacteria 4826
55 Ga0055543_1000241 3300004625 Bacteria 42294
56 Ga0055543_1004447 3300004625 Bacteria 3827
57 Ga0055543_1006196 3300004625 Bacteria 2929
58 Ga0065165_1000281 3300005262 Bacteria 86863
59 Ga0065165_1001682 3300005262 Bacteria 22357
60 Ga0065165_1002866 3300005262 Bacteria 13317
61 Ga0065165_1019922 3300005262 Bacteria 2379
62 Ga0065704_10114513 3300005289 Bacteria 1889
63 Ga0065704_10119442 3300005289 Bacteria 1796
64 Ga0065707_10081939 3300005295 Bacteria 28637
65 Ga0070676_10024271 3300005328 Bacteria 3414
66 Ga0070676_10070055 3300005328 Bacteria 2103
67 Ga0070683_100052323 3300005329 Bacteria 3783
68 Ga0070683_100071927 3300005329 Bacteria 3228
69 Ga0070690_100013344 3300005330 Bacteria 4852
70 Ga0070670_100038495 3300005331 Bacteria 4112
71 Ga0070670_100203478 3300005331 Bacteria 1720
72 Ga0070677_10001509 3300005333 Bacteria 7370
73 Ga0070677_10038033 3300005333 Bacteria 1881
74 Ga0068869_100033038 3300005334 Bacteria 3650
75 Ga0068869_100123908 3300005334 Bacteria 1980
76 Ga0070666_10012908 3300005335 Bacteria 5284
77 Ga0070666_10034478 3300005335 Bacteria 3354
78 Ga0070666_10269555 3300005335 Bacteria 1208
79 Ga0068868_100010659 3300005338 Bacteria 6662
80 Ga0068868_100020394 3300005338 Bacteria 4979
81 Ga0068868_100024897 3300005338 Bacteria 4545
82 Ga0068868_100079151 3300005338 Bacteria 2633
83 Ga0070687_100011369 3300005343 Bacteria 3892
84 Ga0070687_100081563 3300005343 Bacteria 1766
85 Ga0070661_100001480 3300005344 Bacteria 16303
86 Ga0070661_100007936 3300005344 Bacteria 7329
87 Ga0070661_100119931 3300005344 Bacteria 1969
88 Ga0070668_100004749 3300005347 Bacteria 10080
89 Ga0070668_100048819 3300005347 Bacteria 3256
90 Ga0070669_100005812 3300005353 Bacteria 8897
91 Ga0070669_100078644 3300005353 Bacteria 2452
92 Ga0070675_100006120 3300005354 Bacteria 9227
93 Ga0070675_100023293 3300005354 Bacteria 4950
94 Ga0070675_100031516 3300005354 Bacteria 4286
95 Ga0070675_100071647 3300005354 Bacteria 2876
96 Ga0070675_100154830 3300005354 Bacteria 1967
97 Ga0070674_100008402 3300005356 Bacteria 6147
98 Ga0070674_100075724 3300005356 Bacteria 2391
99 Ga0070674_100093906 3300005356 Bacteria 2171
100 Ga0070673_100009720 3300005364 Bacteria 6470
101 Ga0070673_100023472 3300005364 Bacteria 4507
102 Ga0070673_100257388 3300005364 Bacteria 1523
103 Ga0070688_100119227 3300005365 Bacteria 1765
104 Ga0070659_100000895 3300005366 Bacteria 21810
105 Ga0070659_100043221 3300005366 Bacteria 3524
106 Ga0070659_100153206 3300005366 Bacteria 1881
107 Ga0070667_100003317 3300005367 Bacteria 13761
108 Ga0070667_100014226 3300005367 Bacteria 6573
109 Ga0070667_100022123 3300005367 Bacteria 5273
110 Ga0070667_100063120 3300005367 Bacteria 3138
111 Ga0070667_100068630 3300005367 Bacteria 3017
112 Ga0070667_100106220 3300005367 Bacteria 2430
113 Ga0070667_100170864 3300005367 Bacteria 1919
114 Ga0070694_100223237 3300005444 Bacteria 1414
115 Ga0070663_100001333 3300005455 Bacteria 13499
116 Ga0070663_100014640 3300005455 Bacteria 5039
117 Ga0070663_100027849 3300005455 Bacteria 3841
118 Ga0070678_100009248 3300005456 Bacteria 5957
119 Ga0070678_100032205 3300005456 Bacteria 3626
120 Ga0070678_100068262 3300005456 Bacteria 2650
121 Ga0070678_100152233 3300005456 Bacteria 1864
122 Ga0070662_100027320 3300005457 Bacteria 3959
123 Ga0070662_100027728 3300005457 Bacteria 3935
124 Ga0070662_100037558 3300005457 Bacteria 3434
125 Ga0070662_100038825 3300005457 Bacteria 3384
126 Ga0070662_100041597 3300005457 Bacteria 3279
127 Ga0070662_100051987 3300005457 Bacteria 2961
128 Ga0070662_100072755 3300005457 Bacteria 2539
129 Ga0070662_100171740 3300005457 Bacteria 1703
130 Ga0068867_100001695 3300005459 Bacteria 15364
131 Ga0068867_100012152 3300005459 Bacteria 6083
132 Ga0068867_100012224 3300005459 Bacteria 6067
133 Ga0068867_100068070 3300005459 Bacteria 2656
134 Ga0068867_100075899 3300005459 Bacteria 2522
135 Ga0070685_10129182 3300005466 Bacteria 1578
136 Ga0070706_100073922 3300005467 Bacteria 3156
137 Ga0070679_100006195 3300005530 Bacteria 11138
138 Ga0068853_100039596 3300005539 Bacteria 4020
139 Ga0068853_100055956 3300005539 Bacteria 3400
140 Ga0070672_100002003 3300005543 Bacteria 12792
141 Ga0070672_100016349 3300005543 Bacteria 5311
142 Ga0070672_100018179 3300005543 Bacteria 5075
143 Ga0070672_100048771 3300005543 Bacteria 3292
144 Ga0070672_100073007 3300005543 Bacteria 2733
145 Ga0070672_100111880 3300005543 Bacteria 2226
146 Ga0070672_100123330 3300005543 Bacteria 2123
147 Ga0070664_100012448 3300005564 Bacteria 6915
148 Ga0070664_100026777 3300005564 Bacteria 4787
149 Ga0070664_100066596 3300005564 Bacteria 3076
150 Ga0070664_100104387 3300005564 Bacteria 2468
151 Ga0070664_100254324 3300005564 Bacteria 1580
152 Ga0068857_100045560 3300005577 Bacteria 3891
153 Ga0068857_100133456 3300005577 Bacteria 2241
154 Ga0068857_100211746 3300005577 Bacteria 1769
155 Ga0068856_100011617 3300005614 Bacteria 8542
156 Ga0068852_100013224 3300005616 Bacteria 6309
157 Ga0068852_100098100 3300005616 Bacteria 2638
158 Ga0068852_100152189 3300005616 Bacteria 2152
159 Ga0068859_100020694 3300005617 Bacteria 6603
160 Ga0068859_100138376 3300005617 Bacteria 2509
161 Ga0068859_100285296 3300005617 Bacteria 1744
162 Ga0068864_100003870 3300005618 Bacteria 12325
163 Ga0068864_100050348 3300005618 Bacteria 3585
164 Ga0068864_100128344 3300005618 Bacteria 2275
165 Ga0068866_10024439 3300005718 Bacteria 2825
166 Ga0068861_100004497 3300005719 Bacteria 9359
167 Ga0068861_100011784 3300005719 Bacteria 6085
168 Ga0068861_100150581 3300005719 Bacteria 1908
169 Ga0068851_10036782 3300005834 Bacteria 2452
170 Ga0068863_100002141 3300005841 Bacteria 19598
171 Ga0068863_100031883 3300005841 Bacteria 5027
172 Ga0068863_100052117 3300005841 Bacteria 3878
173 Ga0068858_100001584 3300005842 Bacteria 23228
174 Ga0068858_100010943 3300005842 Bacteria 8575
175 Ga0068858_100103729 3300005842 Bacteria 2653
176 Ga0068860_100001910 3300005843 Bacteria 22116
177 Ga0068860_100014499 3300005843 Bacteria 7714
178 Ga0068862_100004043 3300005844 Bacteria 12431
179 Ga0068862_100032435 3300005844 Bacteria 4414
180 Ga0081455_10042458 3300005937 Bacteria 3988
181 Ga0075363_100042299 3300006048 Bacteria 2407
182 Ga0075363_100076636 3300006048 Bacteria 1824
183 Ga0075364_10042087 3300006051 Bacteria 2967
184 Ga0075364_10065652 3300006051 Bacteria 2382
185 Ga0075432_10078022 3300006058 Bacteria 1197
186 Ga0075367_10075388 3300006178 Bacteria 2034
187 Ga0075366_10001872 3300006195 Bacteria 10611
188 Ga0075366_10002038 3300006195 Bacteria 10253
189 Ga0075366_10002642 3300006195 Bacteria 9232
190 Ga0075366_10019111 3300006195 Bacteria 3960
191 Ga0075366_10022185 3300006195 Bacteria 3692
192 Ga0075366_10036912 3300006195 Bacteria 2882
193 Ga0097621_100028821 3300006237 Bacteria 4379
194 Ga0097621_100048534 3300006237 Bacteria 3444
195 Ga0075370_10000167 3300006353 Bacteria 22616
196 Ga0075370_10000719 3300006353 Bacteria 13125
197 Ga0075370_10001130 3300006353 Bacteria 11191
198 Ga0075370_10001256 3300006353 Bacteria 10806
199 Ga0075370_10003689 3300006353 Bacteria 7332
200 Ga0075370_10007483 3300006353 Bacteria 5565
201 Ga0075370_10010571 3300006353 Bacteria 4831
202 Ga0075370_10010698 3300006353 Bacteria 4809
203 Ga0075370_10036557 3300006353 Bacteria 2759
204 Ga0068871_100013614 3300006358 Bacteria 6040
205 Ga0068871_100053243 3300006358 Bacteria 3279
206 Ga0068871_100122983 3300006358 Bacteria 2194
207 Ga0068871_100194356 3300006358 Bacteria 1749
208 Ga0075434_100210582 3300006871 Bacteria 1964
209 Ga0075429_100001027 3300006880 Bacteria 22297
210 Ga0097620_100020694 3300006931 Bacteria 6603
211 Ga0097620_100138375 3300006931 Bacteria 2509
212 Ga0097620_100285271 3300006931 Bacteria 1744
213 Ga0099823_1009799 3300006944 Bacteria 9735
214 Ga0079104_1000003 3300006946 Bacteria 468966
215 Ga0079104_1000017 3300006946 Bacteria 313784
216 Ga0105250_10006594 3300009092 Bacteria 5055
217 Ga0105240_10060587 3300009093 Bacteria 4718
218 Ga0105240_10166101 3300009093 Bacteria 2618
219 Ga0111539_10558671 3300009094 Bacteria 1333
220 Ga0105243_10001185 3300009148 Bacteria 23541
221 Ga0105243_10009310 3300009148 Bacteria 7491
222 Ga0105241_10050916 3300009174 Bacteria 3157
223 Ga0105242_10000453 3300009176 Bacteria 32663
224 Ga0105242_10061013 3300009176 Bacteria 3100
225 Ga0105248_10020330 3300009177 Bacteria 7355
226 Ga0105248_10026443 3300009177 Bacteria 6456
227 Ga0105248_10046549 3300009177 Bacteria 4862
228 Ga0105248_10156522 3300009177 Bacteria 2571
229 Ga0105248_10193669 3300009177 Bacteria 2290
230 Ga0105248_10516871 3300009177 Bacteria 1346
231 Ga0105237_10122139 3300009545 Bacteria 2599
232 Ga0105238_10018116 3300009551 Bacteria 7161
233 Ga0105238_10044211 3300009551 Bacteria 4504
234 Ga0105249_10017708 3300009553 Bacteria 6327
235 Ga0105249_10038194 3300009553 Bacteria 4356
236 Ga0105239_10131653 3300010375 Bacteria 2782
237 Ga0157319_1000010 3300012497 Bacteria 197331
238 Ga0157326_1001365 3300012513 Bacteria 2703
239 Ga0157371_10032792 3300013102 Bacteria 3736
240 Ga0157370_10008137 3300013104 Bacteria 11346
241 Ga0157370_10314169 3300013104 Bacteria 1446
242 Ga0157369_10085797 3300013105 Bacteria 3364
243 Ga0157369_10137307 3300013105 Bacteria 2588
244 Ga0157374_10020040 3300013296 Bacteria 5929
245 Ga0157374_10030533 3300013296 Bacteria 4894
246 Ga0157374_10199617 3300013296 Bacteria 1958
247 Ga0157378_10000558 3300013297 Bacteria 35454
248 Ga0157378_10061097 3300013297 Bacteria 3362
249 Ga0157378_10144207 3300013297 Bacteria 2214
250 Ga0163162_10009181 3300013306 Bacteria 9623
251 Ga0163162_10024807 3300013306 Bacteria 5923
252 Ga0163162_10031794 3300013306 Bacteria 5237
253 Ga0163162_10033157 3300013306 Bacteria 5130
254 Ga0163162_10364771 3300013306 Bacteria 1577
255 Ga0157372_10095120 3300013307 Bacteria 3394
256 Ga0157375_10008783 3300013308 Bacteria 8855
257 Ga0157375_10021275 3300013308 Bacteria 5943
258 Ga0157375_10039281 3300013308 Bacteria 4554
259 Ga0157375_10063774 3300013308 Bacteria 3667
260 Ga0157375_10093518 3300013308 Bacteria 3073
261 Ga0163163_10017948 3300014325 Bacteria 6611
262 Ga0157380_10016835 3300014326 Bacteria 5398
263 Ga0157380_10031042 3300014326 Bacteria 4099
264 Ga0157380_10332189 3300014326 Bacteria 1414
265 Ga0182008_10001333 3300014497 Bacteria 16811
266 Ga0182008_10015908 3300014497 Bacteria 3917
267 Ga0182008_10084691 3300014497 Bacteria 1561
268 Ga0157377_10000028 3300014745 Bacteria 134810
269 Ga0157379_10017086 3300014968 Bacteria 6387
270 Ga0157379_10027080 3300014968 Bacteria 5102
271 Ga0157379_10028234 3300014968 Bacteria 4994
272 Ga0157379_10046145 3300014968 Bacteria 3888
273 Ga0157379_10116340 3300014968 Bacteria 2405
274 Ga0157379_10167652 3300014968 Bacteria 1982
275 Ga0157376_10090511 3300014969 Bacteria 2648
276 Ga0182006_1003396 3300015261 Bacteria 8152
277 Ga0182007_10022577 3300015262 Bacteria 2220
278 Ga0183362_10003 3300015683 Bacteria 977584
279 Ga0163161_10006225 3300017792 Bacteria 8270
280 Ga0163161_10017349 3300017792 Bacteria 5038
281 Ga0163161_10089002 3300017792 Bacteria 2283
282 Ga0163161_10139077 3300017792 Bacteria 1837
283 Ga0209435_100010 3300025206 Bacteria 475373
284 Ga0209672_100628 3300025228 Bacteria 18239
285 Ga0209147_101067 3300025229 Bacteria 11568
286 Ga0209258_100009 3300025242 Bacteria 996276
287 Ga0207425_1000235 3300025245 Bacteria 42925
288 Ga0207425_1000519 3300025245 Bacteria 23496
289 Ga0207425_1002451 3300025245 Bacteria 6518
290 Ga0207425_1007765 3300025245 Bacteria 2800
291 Ga0209646_1000001 3300025246 Bacteria 3092932
292 Ga0209026_1000001 3300025250 Bacteria 1228671
293 Ga0209148_1000007 3300025254 Bacteria 1592273
294 Ga0209759_1000001 3300025256 Bacteria 2799452
295 Ga0209129_1000013 3300025258 Bacteria 524874
296 Ga0209129_1000075 3300025258 Bacteria 201273
297 Ga0209565_1000028 3300025263 Bacteria 348536
298 Ga0209565_1000587 3300025263 Bacteria 24582
299 Ga0209565_1001309 3300025263 Bacteria 11439
300 Ga0209673_1000035 3300025273 Bacteria 328411
301 Ga0209673_1000279 3300025273 Bacteria 96141
302 Ga0209673_1001569 3300025273 Bacteria 20372
303 Ga0209673_1005270 3300025273 Bacteria 6566
304 Ga0209673_1009154 3300025273 Bacteria 4322
305 Ga0209130_1000052 3300025284 Bacteria 216971
306 Ga0209130_1000112 3300025284 Bacteria 131607
307 Ga0209130_1000158 3300025284 Bacteria 101323
308 Ga0209130_1000363 3300025284 Bacteria 51603
309 Ga0209675_1000490 3300025291 Bacteria 29771
310 Ga0209675_1000662 3300025291 Bacteria 24203
311 Ga0209676_1000069 3300025292 Bacteria 312462
312 Ga0209676_1009320 3300025292 Bacteria 4248
313 Ga0209025_1000103 3300025294 Bacteria 228054
314 Ga0209025_1000169 3300025294 Bacteria 161428
315 Ga0209025_1005988 3300025294 Bacteria 9662
316 Ga0209025_1012424 3300025294 Bacteria 5457
317 Ga0209025_1033092 3300025294 Bacteria 2398
318 Ga0209564_1000003 3300025295 Bacteria 1585848
319 Ga0209564_1000046 3300025295 Bacteria 373787
320 Ga0209564_1000822 3300025295 Bacteria 42276
321 Ga0209564_1001252 3300025295 Bacteria 28203
322 Ga0209564_1001892 3300025295 Bacteria 18788
323 Ga0209564_1003304 3300025295 Bacteria 11202
324 Ga0209758_1000052 3300025297 Bacteria 338962
325 Ga0209758_1000067 3300025297 Bacteria 288575
326 Ga0209758_1009236 3300025297 Bacteria 6183
327 Ga0209758_1017756 3300025297 Bacteria 3521
328 Ga0209050_1000023 3300025298 Bacteria 537172
329 Ga0209050_1000202 3300025298 Bacteria 133468
330 Ga0209050_1000919 3300025298 Bacteria 38782
331 Ga0209050_1002480 3300025298 Bacteria 15663
332 Ga0209050_1004530 3300025298 Bacteria 9343
333 Ga0209050_1004531 3300025298 Bacteria 9342
334 Ga0209050_1005114 3300025298 Bacteria 8441
335 Ga0209256_1000003 3300025299 Bacteria 1661127
336 Ga0209256_1000011 3300025299 Bacteria 865309
337 Ga0209256_1000077 3300025299 Bacteria 230410
338 Ga0209256_1000121 3300025299 Bacteria 167299
339 Ga0209256_1000204 3300025299 Bacteria 112000
340 Ga0209256_1004433 3300025299 Bacteria 8822
341 Ga0209256_1025326 3300025299 Bacteria 1730
342 Ga0207426_1000101 3300025302 Bacteria 262096
343 Ga0207426_1000129 3300025302 Bacteria 210930
344 Ga0207426_1000153 3300025302 Bacteria 182839
345 Ga0209051_1000017 3300025303 Bacteria 537172
346 Ga0209051_1000024 3300025303 Bacteria 437007
347 Ga0209051_1001172 3300025303 Bacteria 23803
348 Ga0209051_1002779 3300025303 Bacteria 12066
349 Ga0209051_1005838 3300025303 Bacteria 7082
350 Ga0209257_1000017 3300025304 Bacteria 866287
351 Ga0209257_1000041 3300025304 Bacteria 537172
352 Ga0209257_1000079 3300025304 Bacteria 316420
353 Ga0209257_1001164 3300025304 Bacteria 33458
354 Ga0209257_1002118 3300025304 Bacteria 20730
355 Ga0209257_1002981 3300025304 Bacteria 15411
356 Ga0209257_1005195 3300025304 Bacteria 9349
357 Ga0209257_1010355 3300025304 Bacteria 4739
358 Ga0209257_1014066 3300025304 Bacteria 3480
359 Ga0207697_10016551 3300025315 Bacteria 3037
360 Ga0207697_10021324 3300025315 Bacteria 2653
361 Ga0207656_10008342 3300025321 Bacteria 3809
362 Ga0207656_10013005 3300025321 Bacteria 3172
363 Ga0207656_10015171 3300025321 Bacteria 2979
364 Ga0207696_1010287 3300025711 Bacteria 3438
365 Ga0207655_1007289 3300025728 Bacteria 7194
366 Ga0207682_10002379 3300025893 Bacteria 8471
367 Ga0207682_10008373 3300025893 Bacteria 4091
368 Ga0207682_10019881 3300025893 Bacteria 2633
369 Ga0207645_10007602 3300025907 Bacteria 7638
370 Ga0207645_10026945 3300025907 Bacteria 3714
371 Ga0207645_10101935 3300025907 Bacteria 1852
372 Ga0207705_10048902 3300025909 Bacteria 3043
373 Ga0207671_10120879 3300025914 Bacteria 2002
374 Ga0207660_10145054 3300025917 Bacteria 1818
375 Ga0207662_10022590 3300025918 Bacteria 3608
376 Ga0207662_10086052 3300025918 Bacteria 1926
377 Ga0207657_10216015 3300025919 Bacteria 1537
378 Ga0207649_10001227 3300025920 Bacteria 15398
379 Ga0207649_10071463 3300025920 Bacteria 2216
380 Ga0207652_10002539 3300025921 Bacteria 15323
381 Ga0207681_10011771 3300025923 Bacteria 5381
382 Ga0207681_10185343 3300025923 Bacteria 1588
383 Ga0207694_10021004 3300025924 Bacteria 4942
384 Ga0207650_10006268 3300025925 Bacteria 8104
385 Ga0207650_10007691 3300025925 Bacteria 7340
386 Ga0207650_10076908 3300025925 Bacteria 2522
387 Ga0207659_10003024 3300025926 Bacteria 10030
388 Ga0207659_10010792 3300025926 Bacteria 5749
389 Ga0207659_10037306 3300025926 Bacteria 3373
390 Ga0207659_10050662 3300025926 Bacteria 2951
391 Ga0207659_10064108 3300025926 Bacteria 2658
392 Ga0207659_10231266 3300025926 Bacteria 1491
393 Ga0207659_10305966 3300025926 Bacteria 1307
394 Ga0207644_10061994 3300025931 Bacteria 2710
395 Ga0207690_10005538 3300025932 Bacteria 7454
396 Ga0207706_10000845 3300025933 Bacteria 31549
397 Ga0207706_10021167 3300025933 Bacteria 5844
398 Ga0207706_10046558 3300025933 Bacteria 3840
399 Ga0207706_10087408 3300025933 Bacteria 2741
400 Ga0207706_10123099 3300025933 Bacteria 2282
401 Ga0207706_10124154 3300025933 Bacteria 2271
402 Ga0207706_10156586 3300025933 Bacteria 2003
403 Ga0207686_10004663 3300025934 Bacteria 7346
404 Ga0207686_10017750 3300025934 Bacteria 4015
405 Ga0207686_10062762 3300025934 Bacteria 2361
406 Ga0207709_10000032 3300025935 Bacteria 324478
407 Ga0207709_10001212 3300025935 Bacteria 18545
408 Ga0207709_10002462 3300025935 Bacteria 11620
409 Ga0207709_10025234 3300025935 Bacteria 3402
410 Ga0207669_10009749 3300025937 Bacteria 4590
411 Ga0207669_10035146 3300025937 Bacteria 2848
412 Ga0207669_10047435 3300025937 Bacteria 2545
413 Ga0207669_10148757 3300025937 Bacteria 1637
414 Ga0207704_10003573 3300025938 Bacteria 7066
415 Ga0207704_10019101 3300025938 Bacteria 3594
416 Ga0207704_10190416 3300025938 Bacteria 1492
417 Ga0207691_10000944 3300025940 Bacteria 28788
418 Ga0207691_10010958 3300025940 Bacteria 8700
419 Ga0207691_10011136 3300025940 Bacteria 8632
420 Ga0207691_10018444 3300025940 Bacteria 6613
421 Ga0207691_10044478 3300025940 Bacteria 4088
422 Ga0207691_10044937 3300025940 Bacteria 4063
423 Ga0207691_10089394 3300025940 Bacteria 2762
424 Ga0207691_10099071 3300025940 Bacteria 2603
425 Ga0207691_10177981 3300025940 Bacteria 1859
426 Ga0207691_10227737 3300025940 Bacteria 1615
427 Ga0207711_10013379 3300025941 Bacteria 6816
428 Ga0207711_10046340 3300025941 Bacteria 3714
429 Ga0207711_10056715 3300025941 Bacteria 3366
430 Ga0207711_10081721 3300025941 Bacteria 2824
431 Ga0207689_10000225 3300025942 Bacteria 50122
432 Ga0207689_10156758 3300025942 Bacteria 1877
433 Ga0207679_10000864 3300025945 Bacteria 19388
434 Ga0207679_10021206 3300025945 Bacteria 4400
435 Ga0207679_10029761 3300025945 Bacteria 3805
436 Ga0207679_10094033 3300025945 Bacteria 2326
437 Ga0207651_10006251 3300025960 Bacteria 6208
438 Ga0207651_10061262 3300025960 Bacteria 2616
439 Ga0207712_10142876 3300025961 Bacteria 1839
440 Ga0207668_10014832 3300025972 Bacteria 4830
441 Ga0207668_10173564 3300025972 Bacteria 1693
442 Ga0207658_10003189 3300025986 Bacteria 11689
443 Ga0207658_10006549 3300025986 Bacteria 7942
444 Ga0207658_10021149 3300025986 Bacteria 4512
445 Ga0207658_10116768 3300025986 Bacteria 2120
446 Ga0207677_10003900 3300026023 Bacteria 7942
447 Ga0207677_10035679 3300026023 Bacteria 3232
448 Ga0207677_10088153 3300026023 Bacteria 2249
449 Ga0207703_10001484 3300026035 Bacteria 21390
450 Ga0207703_10032892 3300026035 Bacteria 4107
451 Ga0207703_10089633 3300026035 Bacteria 2583
452 Ga0207703_10144035 3300026035 Bacteria 2071
453 Ga0207639_10166516 3300026041 Bacteria 1863
454 Ga0207639_10191056 3300026041 Bacteria 1749
455 Ga0207639_10271338 3300026041 Bacteria 1488
456 Ga0207639_10309361 3300026041 Bacteria 1399
457 Ga0207678_10012524 3300026067 Bacteria 7448
458 Ga0207678_10065269 3300026067 Bacteria 3126
459 Ga0207678_10117339 3300026067 Bacteria 2271
460 Ga0207678_10172832 3300026067 Bacteria 1845
461 Ga0207702_10036064 3300026078 Bacteria 4135
462 Ga0207641_10008519 3300026088 Bacteria 8470
463 Ga0207641_10021323 3300026088 Bacteria 5326
464 Ga0207648_10000146 3300026089 Bacteria 70573
465 Ga0207648_10002481 3300026089 Bacteria 19810
466 Ga0207648_10005079 3300026089 Bacteria 13337
467 Ga0207648_10033097 3300026089 Bacteria 4560
468 Ga0207648_10145787 3300026089 Bacteria 2088
469 Ga0207648_10153981 3300026089 Bacteria 2029
470 Ga0207676_10016086 3300026095 Bacteria 5410
471 Ga0207676_10019189 3300026095 Bacteria 4983
472 Ga0207676_10026201 3300026095 Bacteria 4335
473 Ga0207676_10162301 3300026095 Bacteria 1937
474 Ga0207676_10222930 3300026095 Bacteria 1680
475 Ga0207674_10021396 3300026116 Bacteria 6963
476 Ga0207674_10050451 3300026116 Bacteria 4251
477 Ga0207674_10149734 3300026116 Bacteria 2291
478 Ga0207675_100004297 3300026118 Bacteria 13767
479 Ga0207675_100007940 3300026118 Bacteria 10008
480 Ga0207675_100125768 3300026118 Bacteria 2428
481 Ga0207683_10012690 3300026121 Bacteria 7187
482 Ga0207683_10013995 3300026121 Bacteria 6840
483 Ga0207683_10103552 3300026121 Bacteria 2543
484 Ga0207683_10113636 3300026121 Bacteria 2425
485 Ga0207683_10126947 3300026121 Bacteria 2292
486 Ga0207683_10137667 3300026121 Bacteria 2198
487 Ga0207683_10192397 3300026121 Bacteria 1852
488 Ga0207698_10001243 3300026142 Bacteria 14895
489 Ga0207698_10030755 3300026142 Bacteria 3866
490 Ga0207698_10074112 3300026142 Bacteria 2714
491 Ga0207698_10190839 3300026142 Bacteria 1825
492 Ga0207698_10261807 3300026142 Bacteria 1589
493 Ga0207698_10406829 3300026142 Bacteria 1302
494 Ga0209281_1000002 3300027111 Bacteria 1924012
495 Ga0209281_1000042 3300027111 Bacteria 344748
496 Ga0209389_1014524 3300027296 Bacteria 7155
497 Ga0209981_1007857 3300027378 Bacteria 1444
498 Ga0209999_1000544 3300027543 Bacteria 5910
499 Ga0209971_1002891 3300027682 Bacteria 4100
500 Ga0209966_1000036 3300027695 Bacteria 55883
501 Ga0209974_10000455 3300027876 Bacteria 13596
502 Ga0268265_10005309 3300028380 Bacteria 8830
503 Ga0268264_10011851 3300028381 Bacteria 7185
504 Ga0268264_10015393 3300028381 Bacteria 6271
505 Ga0307517_10115516 3300028786 Bacteria 2014
506 Ga0307517_10124787 3300028786 Bacteria 1884
507 Ga0307515_10000020 3300028794 Bacteria 411735
508 Ga0307515_10000053 3300028794 Bacteria 266512
509 Ga0307515_10000529 3300028794 Bacteria 90388
510 Ga0307515_10005082 3300028794 Bacteria 26754
511 Ga0307515_10006495 3300028794 Bacteria 23397
512 Ga0307515_10104200 3300028794 Bacteria 3392
513 Ga0307515_10119380 3300028794 Bacteria 3000
514 Ga0265330_10000014 3300031235 Bacteria 175673
515 Ga0265332_10000011 3300031238 Bacteria 284299
516 Ga0265328_10009555 3300031239 Bacteria 3946
517 Ga0265325_10044997 3300031241 Bacteria 2295
518 Ga0265331_10019144 3300031250 Bacteria 3538
519 Ga0265327_10000184 3300031251 Bacteria 133023
520 Ga0265327_10000355 3300031251 Bacteria 87181
521 Ga0307513_10000004 3300031456 Bacteria 558931
522 Ga0307513_10000015 3300031456 Bacteria 296183
523 Ga0307513_10006695 3300031456 Bacteria 15034
524 Ga0307513_10212349 3300031456 Bacteria 1765
525 Ga0307513_10254241 3300031456 Bacteria 1551
526 Ga0307509_10082658 3300031507 Bacteria 3313
527 Ga0307408_100000150 3300031548 Bacteria 77682
528 Ga0307408_100312909 3300031548 Bacteria 1320
529 Ga0307408_100416696 3300031548 Bacteria 1157
530 Ga0307508_10000004 3300031616 Bacteria 287547
531 Ga0307514_10001404 3300031649 Bacteria 29857
532 Ga0307514_10064671 3300031649 Bacteria 2773
533 Ga0265314_10000026 3300031711 Bacteria 284299
534 Ga0265342_10130266 3300031712 Bacteria 1410
535 Ga0307516_10000497 3300031730 Bacteria 52295
536 Ga0307516_10003104 3300031730 Bacteria 21606
537 Ga0307516_10003697 3300031730 Bacteria 19455
538 Ga0307516_10095734 3300031730 Bacteria 2791
539 Ga0307516_10109150 3300031730 Bacteria 2573
540 Ga0307516_10272720 3300031730 Bacteria 1377
541 Ga0307405_10004178 3300031731 Bacteria 6796
542 Ga0307413_10000382 3300031824 Bacteria 14204
543 Ga0307413_10046773 3300031824 Bacteria 2576
544 Ga0307410_10038494 3300031852 Bacteria 3133
545 Ga0307406_10013196 3300031901 Bacteria 4729
546 Ga0307406_10028804 3300031901 Bacteria 3358
547 Ga0307406_10046459 3300031901 Bacteria 2732
548 Ga0307412_10024767 3300031911 Bacteria 3708
549 Ga0307409_100000086 3300031995 Bacteria 33256
550 Ga0307409_100030709 3300031995 Bacteria 3865
551 Ga0307409_100167534 3300031995 Bacteria 1930
552 Ga0307416_100070093 3300032002 Bacteria 2905
553 Ga0307416_100085870 3300032002 Bacteria 2680
554 Ga0307416_100117761 3300032002 Bacteria 2359
555 Ga0307416_100315228 3300032002 Bacteria 1563
556 Ga0307416_100324400 3300032002 Bacteria 1544
557 Ga0307416_100383021 3300032002 Bacteria 1437
558 Ga0307411_10000869 3300032005 Bacteria 11391
559 Ga0307411_10003562 3300032005 Bacteria 7250
560 Ga0307415_100009938 3300032126 Bacteria 5365
561 Ga0307415_100066344 3300032126 Bacteria 2518
562 Ga0307507_10007188 3300033179 Bacteria 16399
563 Ga0373948_0010692 3300034817 Bacteria 1608
564 Ga0373950_0006394 3300034818 Bacteria 1795
565 Ga0373939_0000069 3300035114 Bacteria 33328
566 Ga0373960_0014790 3300035121 Bacteria 1982
567 Ga0373931_0001617 3300035691 Bacteria 9757
568 Ga0373927_0076598 3300035695 Bacteria 2166
569 Ga0373937_0051389 3300036401 Bacteria 3778
570 Ga0395899_0014146 3300037312 Bacteria 6090
571 Ga0395900_0000109 3300037418 Bacteria 146053
572 Ga0395900_0022771 3300037418 Bacteria 6410
573 Ga0395900_0110563 3300037418 Bacteria 2823
574 Ga0395898_0000868 3300037466 Bacteria 49428
575 Ga0395898_0038551 3300037466 Bacteria 4735
576 Ga0395905_0000377 3300037471 Bacteria 63595
577 Ga0395905_0003562 3300037471 Bacteria 16585
578 Ga0395905_0028880 3300037471 Bacteria 5227
579 Ga0395905_0029126 3300037471 Bacteria 5204
580 Ga0395905_0045312 3300037471 Bacteria 4125
581 Ga0395905_0050200 3300037471 Bacteria 3909
582 Ga0395905_0066244 3300037471 Bacteria 3382
583 Ga0395905_0071033 3300037471 Bacteria 3264
584 Ga0395905_0127146 3300037471 Bacteria 2396
585 Ga0395905_0134402 3300037471 Bacteria 2326
586 Ga0436365_1492983 3300039437 Bacteria 1255
587 Ga0439465_0063323 3300041413 Bacteria 1228
588 Ga0451789_0948633 3300041443 Bacteria 2267
589 Ga0451800_1194461 3300041459 Bacteria 2440
590 Ga0451802_0797663 3300041460 Bacteria 1669
591 Ga0439449_0054938 3300042007 Bacteria 1471
592 Ga0450917_000395 3300042120 Bacteria 3275
593 Ga0450888_000086 3300042126 Bacteria 7140
594 Ga0450890_000675 3300042127 Bacteria 4973
595 Ga0450890_000986 3300042127 Bacteria 4131
596 Ga0450891_000157 3300042129 Bacteria 6428
597 Ga0450892_000356 3300042130 Bacteria 5426
598 Ga0450898_002712 3300042134 Bacteria 2487
599 Ga0450899_003727 3300042135 Bacteria 1637
600 Ga0450889_000632 3300042144 Bacteria 3897
601 Ga0450918_000026 3300042531 Bacteria 30691
602 Ga0450893_0000069 3300042532 Bacteria 10972
603 Ga0451577_0000142 3300042876 Bacteria 160598
604 Ga0451577_0001509 3300042876 Bacteria 30757
605 Ga0451577_0002068 3300042876 Bacteria 24786
606 Ga0451577_0007013 3300042876 Bacteria 11113
607 Ga0451577_0020090 3300042876 Bacteria 6134
608 Ga0451577_0215815 3300042876 Bacteria 1734
609 Ga0451577_0217043 3300042876 Bacteria 1728
610 Ga0466969_0000385 3300044656 Bacteria 24302
611 Ga0466969_0013212 3300044656 Bacteria 4349
612 Ga0466972_0034233 3300044658 Bacteria 2490
613 Ga0453683_0003599 3300044673 Bacteria 11378
614 Ga0466966_0006769 3300044684 Bacteria 7588
615 Ga0466966_0023138 3300044684 Bacteria 4069
616 Ga0466966_0091990 3300044684 Bacteria 1882
617 Ga0466961_0011070 3300044693 Bacteria 5765
618 Ga0466961_0023583 3300044693 Bacteria 3959
619 Ga0466961_0031065 3300044693 Bacteria 3433
620 Ga0466961_0054701 3300044693 Bacteria 2545
621 Ga0466963_0064455 3300044694 Bacteria 2455
622 Ga0466963_0086826 3300044694 Bacteria 2126
623 Ga0453684_0000126 3300044712 Bacteria 336395
624 Ga0453684_0000694 3300044712 Bacteria 119688
625 Ga0453684_0033107 3300044712 Bacteria 7212
626 Ga0453684_0040850 3300044712 Bacteria 6288
627 Ga0453684_0053731 3300044712 Bacteria 5255
628 Ga0453684_0176775 3300044712 Bacteria 2510
629 Ga0453684_0297008 3300044712 Bacteria 1837
630 Ga0453684_0369110 3300044712 Bacteria 1614
631 Ga0466971_0013038 3300044719 Bacteria 3646
632 Ga0466970_0017336 3300044765 Bacteria 3721
633 Ga0466959_0000371 3300045049 Bacteria 26505
634 Ga0466959_0019290 3300045049 Bacteria 5014
635 Ga0466959_0072253 3300045049 Bacteria 2497
636 Ga0466959_0075169 3300045049 Bacteria 2442
637 Ga0451576_0000909 3300045051 Bacteria 56035
638 Ga0451576_0002187 3300045051 Bacteria 30196
639 Ga0451576_0007327 3300045051 Bacteria 13242
640 Ga0451576_0012822 3300045051 Bacteria 9405
641 Ga0451576_0028892 3300045051 Bacteria 5939
642 Ga0451576_0039865 3300045051 Bacteria 4972
643 Ga0451576_0153533 3300045051 Bacteria 2401
644 Ga0451576_0289442 3300045051 Bacteria 1713
645 Ga0451576_0344039 3300045051 Bacteria 1561
646 Ga0451576_0486235 3300045051 Bacteria 1297
647 Ga0466958_0022478 3300045836 Bacteria 3694
648 Ga0466967_0085582 3300045976 Bacteria 2854
649 Ga0466967_0174591 3300045976 Bacteria 2024
650 Ga0495583_0000193 3300046506 Bacteria 101909
651 Ga0495628_0240274 3300046516 Bacteria 1355
652 Ga0495632_0002146 3300046519 Bacteria 15310
653 Ga0495632_0003371 3300046519 Bacteria 11383
654 Ga0495632_0007855 3300046519 Bacteria 6637
655 Ga0495648_0016379 3300046524 Bacteria 5348
656 Ga0495642_0121997 3300046528 Bacteria 1119
657 Ga0495621_0026108 3300046539 Bacteria 1967
658 Ga0495597_0001551 3300046542 Bacteria 16254
659 Ga0495656_0000062 3300046615 Bacteria 49355
660 Ga0495625_0067071 3300046660 Bacteria 2526
661 Ga0495649_0001518 3300046694 Bacteria 17442
662 Ga0495687_000599 3300047443 Bacteria 42066
663 Ga0495684_0114505 3300047471 Bacteria 2033
664 Ga0495626_0021022 3300048091 Bacteria 3246
665 Ga0496102_0018285 3300048905 Bacteria 6158
666 Ga0496105_0035322 3300048908 Bacteria 4114
667 Ga0496107_0055573 3300048910 Bacteria 2859
668 Ga0496108_0072577 3300048911 Bacteria 2906
669 Ga0496109_0057078 3300048912 Bacteria 3563
670 Ga0496109_0084109 3300048912 Bacteria 2935
671 Ga0496112_0014880 3300048915 Bacteria 7239
672 Ga0496115_0238042 3300048918 Bacteria 1501
673 Ga0496118_0068611 3300048921 Bacteria 2574
674 Ga0496122_0032346 3300048925 Bacteria 4328
675 Ga0496123_0036924 3300048926 Bacteria 3456
676 Ga0496125_0007601 3300048928 Bacteria 11505
677 Ga0496126_0014772 3300048929 Bacteria 7877
678 Ga0496126_0156221 3300048929 Bacteria 1952
679 Ga0501300_004837 3300049523 Bacteria 1991
680 Ga0501036_0317644 3300049572 Bacteria 1302
681 Ga0501043_0000004 3300049579 Bacteria 291085
682 Ga0501046_0000016 3300049580 Bacteria 234374
683 Ga0501047_0000012 3300049581 Bacteria 368824
684 Ga0501198_000010 3300049649 Bacteria 119733
685 Ga0501222_000009 3300049662 Bacteria 118560
686 Ga0501222_001295 3300049662 Bacteria 3510
687 Ga0501223_008470 3300049663 Bacteria 2098
688 Ga0501252_000450 3300049682 Bacteria 3135
689 Ga0501255_002105 3300049684 Bacteria 1706
690 Ga0501229_001888 3300049706 Bacteria 2456
691 Ga0501262_008134 3300049759 Bacteria 1279
692 Ga0501265_000996 3300049762 Bacteria 3187
693 Ga0501272_001530 3300049769 Bacteria 2201
694 Ga0501045_0020428 3300049824 Bacteria 4729
695 Ga0501045_0191008 3300049824 Bacteria 1526
696 nmdc:mga0k408_11976_c1 3300050493 Bacteria 4732
697 nmdc:mga0k408_1332_c1 3300050493 Bacteria 13363
698 nmdc:mga0k408_16177_c2 3300050493 Bacteria 3070
699 nmdc:mga0k408_181937_c1 3300050493 Bacteria 1254
700 nmdc:mga0k408_2245_c1 3300050493 Bacteria 10324
701 nmdc:mga0k408_25138_c1 3300050493 Bacteria 3371
702 nmdc:mga0k408_47091_c1 3300050493 Bacteria 2492
703 nmdc:mga0k408_5225_c1 3300050493 Bacteria 6891
704 nmdc:mga0k408_69768_c1 3300050493 Bacteria 2051
705 nmdc:mga06z11_120738_c1 3300050494 Bacteria 1462
706 nmdc:mga07m45_1111_c1 3300050496 Bacteria 12038
707 nmdc:mga07m45_1313_c1 3300050496 Bacteria 11319
708 nmdc:mga07m45_21568_c1 3300050496 Bacteria 3509
709 nmdc:mga07m45_4922_c1 3300050496 Bacteria 6581
710 nmdc:mga07m45_63_c1 3300050496 Bacteria 41859
711 nmdc:mga05p37_70873_c1 3300050507 Bacteria 4287
712 nmdc:mga09592_3159_c1 3300050508 Bacteria 13376
713 nmdc:mga0sz30_13751_c1 3300050516 Bacteria 3174
714 Ga0495595_0137824 3300053084 Bacteria 1196
715 Ga0500578_0000746 3300053086 Bacteria 38474
716 Ga0500644_0038987 3300053088 Bacteria 1563
717 Ga0500646_0020058 3300053090 Bacteria 1773
718 Ga0500651_0029161 3300053093 Bacteria 3468
719 Ga0500642_0000935 3300053130 Bacteria 8467
720 Ga0500652_000142 3300053131 Bacteria 27284
721 Ga0500652_000807 3300053131 Bacteria 10505
722 Ga0500655_007435 3300053133 Bacteria 1971
723 Ga0500658_0003009 3300053134 Bacteria 6470
724 Ga0500568_0013996 3300053139 Bacteria 3636
725 Ga0500568_0023720 3300053139 Bacteria 2607
726 Ga0500619_000310 3300053154 Bacteria 9550
727 Ga0500622_0000599 3300053156 Bacteria 32760
728 Ga0500622_0000952 3300053156 Bacteria 24620
729 Ga0500622_0002819 3300053156 Bacteria 12189
730 Ga0500622_0014209 3300053156 Bacteria 4280
731 Ga0500634_0037535 3300053161 Bacteria 2635
732 Ga0500636_0000020 3300053177 Bacteria 96868
733 Ga0500645_004363 3300053730 Bacteria 5438
734 Ga0590071_000859 3300059421 Bacteria 8461
735 Ga0466962_0030617 3300061719 Bacteria 2577

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0317644 Ga0501036_0317644_157_1242 325
2 3300049824 Ga0501045_0191008 Ga0501045_0191008_292_1377 325
3 3300046524 Ga0495648_0016379 Ga0495648_0016379_2266_3351 333
4 3300044712 Ga0453684_0040850 Ga0453684_0040850_3694_4776 336
5 3300003791 Ga0055530_10001787 Ga0055530_100017877 340
6 3300003792 Ga0055540_1000002 Ga0055540_1000002268 340
7 3300003794 Ga0055531_10001860 Ga0055531_1000186010 340
8 3300025298 Ga0209050_1000919 Ga0209050_100091920 340
9 3300025303 Ga0209051_1000024 Ga0209051_1000024269 340
10 3300025304 Ga0209257_1000079 Ga0209257_1000079269 340
11 3300003323 rootH1_10006954 rootH1_100069544 341
12 3300042876 Ga0451577_0217043 Ga0451577_0217043_582_1670 341
13 3300044712 Ga0453684_0297008 Ga0453684_0297008_77_1165 341
14 3300045049 Ga0466959_0075169 Ga0466959_0075169_81_1127 342
15 3300042876 Ga0451577_0215815 Ga0451577_0215815_523_1650 343
16 3300044712 Ga0453684_0033107 Ga0453684_0033107_974_2101 345
17 3300025245 Ga0207425_1002451 Ga0207425_10024515 348
18 3300048905 Ga0496102_0018285 Ga0496102_0018285_2784_3866 349
19 3300037312 Ga0395899_0014146 Ga0395899_0014146_3448_4527 353
20 3300037418 Ga0395900_0022771 Ga0395900_0022771_2860_3939 353
21 3300037466 Ga0395898_0038551 Ga0395898_0038551_3442_4521 353
22 3300037471 Ga0395905_0000377 Ga0395905_0000377_31231_32379 353
23 3300037471 Ga0395905_0028880 Ga0395905_0028880_2792_3871 353
24 3300044656 Ga0466969_0013212 Ga0466969_0013212_3013_4152 353
25 3300044684 Ga0466966_0091990 Ga0466966_0091990_271_1350 353
26 3300044693 Ga0466961_0023583 Ga0466961_0023583_1831_2970 353
27 3300044765 Ga0466970_0017336 Ga0466970_0017336_2238_3317 353
28 3300046506 Ga0495583_0000193 Ga0495583_0000193_65523_66620 353
29 3300059421 Ga0590071_000859 Ga0590071_000859_2025_3170 354
30 iso_pu_bacteria 2511231002 2511245208 355
31 iso_pu_bacteria 2513020051 2513227156 355
32 iso_pu_bacteria 2585428057 2587726728 355
33 iso_pu_bacteria 2585428057 2587730179 355
34 iso_pu_bacteria 2585428058 2587733235 355
35 iso_pu_bacteria 2585428058 2587736294 355
36 iso_pu_bacteria 2588253510 2588290827 355
37 iso_pu_bacteria 2588253510 2588294344 355
38 iso_pu_bacteria 2599185214 2599627250 355
39 iso_pu_bacteria 2599185226 2599676665 355
40 iso_pu_bacteria 2599185227 2599680041 355
41 iso_pu_bacteria 2599185229 2599692057 355
42 iso_pu_bacteria 2643221592 2643968674 355
43 iso_pu_bacteria 2643221592 2643969035 355
44 iso_pu_bacteria 2643221625 2644142032 355
45 iso_pu_bacteria 2643221625 2644144166 355
46 iso_pu_bacteria 2643221644 2644245691 355
47 iso_pu_bacteria 2643221648 2644273286 355
48 iso_pu_bacteria 2643221648 2644274124 355
49 iso_pu_bacteria 2721755523 2722885062 355
50 iso_pu_bacteria 2738541277 2738719629 355
51 iso_pu_bacteria 2738541307 2738879936 355
52 iso_pu_bacteria 2738543012 2739245589 355
53 iso_pu_bacteria 2738543019 2739278828 355
54 iso_pu_bacteria 2818991446 2819599376 355
55 iso_pu_bacteria 2831864461 2831868501 355
56 iso_pu_bacteria 2838054893 2838055939 355
57 iso_pu_bacteria 2839138175 2839142889 355
58 iso_pu_bacteria 2842718218 2842719067 355
59 iso_pu_bacteria 2886848708 2886854881 355
60 iso_pu_bacteria 2899924645 2899925884 355
61 iso_pu_bacteria 2904541872 2904544297 355
62 iso_pu_bacteria 2928037797 2928041728 355
63 iso_pu_bacteria 2928044640 2928049292 355
64 iso_pu_bacteria 2928051484 2928052100 355
65 iso_pu_bacteria 2928064002 2928065220 355
66 iso_pu_bacteria 2928070936 2928076645 355
67 iso_pu_bacteria 2928084124 2928089246 355
68 iso_pu_bacteria 2929160207 2929162131 355
69 iso_pu_bacteria 2974320154 2974324303 355
70 iso_pu_bacteria 8002392321 8002392348 355
71 iso_pu_bacteria 2643221544 2643745505 357
72 iso_pu_bacteria 2643221585 2643935904 357
73 iso_pu_bacteria 2643221639 2644221365 357
74 iso_pu_bacteria 2643221646 2644257877 357
75 iso_pu_bacteria 2643221656 2644317687 357
76 iso_pu_bacteria 2738541337 2739057872 357
77 3300005343 Ga0070687_100081563 Ga0070687_1000815632 358
78 3300005444 Ga0070694_100223237 Ga0070694_1002232371 358
79 3300006058 Ga0075432_10078022 Ga0075432_100780221 358
80 3300013306 Ga0163162_10364771 Ga0163162_103647712 358
81 3300027378 Ga0209981_1007857 Ga0209981_10078571 358
82 3300028786 Ga0307517_10124787 Ga0307517_101247871 358
83 3300031730 Ga0307516_10000497 Ga0307516_100004974 358
84 3300044712 Ga0453684_0000694 Ga0453684_0000694_118447_119526 358
85 3300049649 Ga0501198_000010 Ga0501198_000010_92305_93447 358
86 3300049662 Ga0501222_000009 Ga0501222_000009_25063_26205 358
87 3300053177 Ga0500636_0000020 Ga0500636_0000020_36613_37704 358
88 3300001979 JGI24740J21852_10009650 JGI24740J21852_100096504 359
89 3300002704 JGI25155J39150_1000005 JGI25155J39150_1000005229 359
90 3300002705 JGI25156J39149_1000006 JGI25156J39149_1000006229 359
91 3300002738 JGI25154J39366_1000015 JGI25154J39366_100001516 359
92 3300002741 JGI25157J39369_1000111 JGI25157J39369_100011150 359
93 3300002773 JGI25152J39213_1002353 JGI25152J39213_10023532 359
94 3300002773 JGI25152J39213_1002353 JGI25152J39213_10023533 359
95 3300002773 JGI25152J39213_1003217 JGI25152J39213_10032176 359
96 3300002774 JGI25150J39212_1002625 JGI25150J39212_10026253 359
97 3300002774 JGI25150J39212_1003507 JGI25150J39212_10035073 359
98 3300002774 JGI25150J39212_1005857 JGI25150J39212_10058572 359
99 3300002987 JGI25159J45721_1003156 JGI25159J45721_10031562 359
100 3300002987 JGI25159J45721_1010735 JGI25159J45721_10107352 359
101 3300003187 JGI25151J46595_10025360 JGI25151J46595_100253601 359
102 3300003187 JGI25151J46595_10025978 JGI25151J46595_100259781 359
103 3300003215 JGI25153J46596_10011279 JGI25153J46596_100112794 359
104 3300003215 JGI25153J46596_10011279 JGI25153J46596_100112795 359
105 3300003215 JGI25153J46596_10025852 JGI25153J46596_100258521 359
106 3300003322 rootL2_10003410 rootL2_1000341012 359
107 3300003323 rootH1_10024154 rootH1_100241545 359
108 3300003323 rootH1_10098199 rootH1_100981992 359
109 3300003323 rootH1_10120714 rootH1_101207142 359
110 3300003347 JGI26128J50194_1000166 JGI26128J50194_10001662 359
111 3300003354 JGI25160J50197_1000045 JGI25160J50197_1000045104 359
112 3300003371 JGI26145J50221_1001536 JGI26145J50221_10015362 359
113 3300003374 JGI25161J50226_1000008 JGI25161J50226_1000008116 359
114 3300003374 JGI25161J50226_1005839 JGI25161J50226_10058394 359
115 3300003761 Ga0055535_1000076 Ga0055535_10000767 359
116 3300003762 Ga0055542_1000009 Ga0055542_1000009205 359
117 3300003771 Ga0055526_1003100 Ga0055526_10031003 359
118 3300003771 Ga0055526_1004023 Ga0055526_10040238 359
119 3300003771 Ga0055526_1004056 Ga0055526_10040563 359
120 3300003771 Ga0055526_1005431 Ga0055526_10054317 359
121 3300003771 Ga0055526_1005431 Ga0055526_10054318 359
122 3300003773 Ga0055537_1000198 Ga0055537_100019821 359
123 3300003773 Ga0055537_1007287 Ga0055537_10072873 359
124 3300003775 Ga0055524_1000080 Ga0055524_100008053 359
125 3300003775 Ga0055524_1000126 Ga0055524_100012645 359
126 3300003775 Ga0055524_1002605 Ga0055524_10026058 359
127 3300003775 Ga0055524_1013464 Ga0055524_10134642 359
128 3300003781 Ga0055536_1004051 Ga0055536_10040513 359
129 3300003781 Ga0055536_1005604 Ga0055536_10056042 359
130 3300003784 Ga0055534_1007296 Ga0055534_10072962 359
131 3300003784 Ga0055534_1008433 Ga0055534_10084331 359
132 3300003790 Ga0055528_1000633 Ga0055528_100063316 359
133 3300003791 Ga0055530_10000699 Ga0055530_1000069926 359
134 3300003791 Ga0055530_10003267 Ga0055530_100032679 359
135 3300003792 Ga0055540_1000021 Ga0055540_100002171 359
136 3300003794 Ga0055531_10000051 Ga0055531_1000005138 359
137 3300003794 Ga0055531_10001171 Ga0055531_1000117111 359
138 3300003794 Ga0055531_10002049 Ga0055531_100020496 359
139 3300003794 Ga0055531_10005509 Ga0055531_100055097 359
140 3300003794 Ga0055531_10009879 Ga0055531_100098796 359
141 3300004625 Ga0055543_1000241 Ga0055543_100024127 359
142 3300004625 Ga0055543_1004447 Ga0055543_10044474 359
143 3300004625 Ga0055543_1006196 Ga0055543_10061963 359
144 3300005262 Ga0065165_1000281 Ga0065165_100028158 359
145 3300005262 Ga0065165_1001682 Ga0065165_10016829 359
146 3300005262 Ga0065165_1002866 Ga0065165_10028666 359
147 3300005262 Ga0065165_1019922 Ga0065165_10199224 359
148 3300005289 Ga0065704_10114513 Ga0065704_101145132 359
149 3300005289 Ga0065704_10119442 Ga0065704_101194421 359
150 3300005295 Ga0065707_10081939 Ga0065707_100819393 359
151 3300005328 Ga0070676_10024271 Ga0070676_100242712 359
152 3300005328 Ga0070676_10070055 Ga0070676_100700552 359
153 3300005329 Ga0070683_100052323 Ga0070683_1000523232 359
154 3300005329 Ga0070683_100071927 Ga0070683_1000719272 359
155 3300005330 Ga0070690_100013344 Ga0070690_1000133442 359
156 3300005331 Ga0070670_100038495 Ga0070670_1000384952 359
157 3300005331 Ga0070670_100203478 Ga0070670_1002034781 359
158 3300005333 Ga0070677_10001509 Ga0070677_100015093 359
159 3300005333 Ga0070677_10038033 Ga0070677_100380331 359
160 3300005334 Ga0068869_100033038 Ga0068869_1000330382 359
161 3300005334 Ga0068869_100123908 Ga0068869_1001239082 359
162 3300005335 Ga0070666_10012908 Ga0070666_100129085 359
163 3300005335 Ga0070666_10034478 Ga0070666_100344782 359
164 3300005335 Ga0070666_10269555 Ga0070666_102695551 359
165 3300005338 Ga0068868_100010659 Ga0068868_1000106597 359
166 3300005338 Ga0068868_100020394 Ga0068868_1000203942 359
167 3300005338 Ga0068868_100024897 Ga0068868_1000248972 359
168 3300005338 Ga0068868_100079151 Ga0068868_1000791512 359
169 3300005343 Ga0070687_100011369 Ga0070687_1000113692 359
170 3300005344 Ga0070661_100001480 Ga0070661_10000148014 359
171 3300005344 Ga0070661_100007936 Ga0070661_1000079368 359
172 3300005344 Ga0070661_100119931 Ga0070661_1001199312 359
173 3300005347 Ga0070668_100004749 Ga0070668_1000047498 359
174 3300005347 Ga0070668_100048819 Ga0070668_1000488193 359
175 3300005353 Ga0070669_100005812 Ga0070669_1000058122 359
176 3300005353 Ga0070669_100078644 Ga0070669_1000786442 359
177 3300005354 Ga0070675_100006120 Ga0070675_1000061208 359
178 3300005354 Ga0070675_100023293 Ga0070675_1000232934 359
179 3300005354 Ga0070675_100031516 Ga0070675_1000315162 359
180 3300005354 Ga0070675_100071647 Ga0070675_1000716472 359
181 3300005354 Ga0070675_100154830 Ga0070675_1001548302 359
182 3300005356 Ga0070674_100008402 Ga0070674_1000084026 359
183 3300005356 Ga0070674_100075724 Ga0070674_1000757242 359
184 3300005356 Ga0070674_100093906 Ga0070674_1000939062 359
185 3300005364 Ga0070673_100009720 Ga0070673_1000097207 359
186 3300005364 Ga0070673_100023472 Ga0070673_1000234723 359
187 3300005364 Ga0070673_100257388 Ga0070673_1002573881 359
188 3300005365 Ga0070688_100119227 Ga0070688_1001192272 359
189 3300005366 Ga0070659_100000895 Ga0070659_1000008958 359
190 3300005366 Ga0070659_100043221 Ga0070659_1000432213 359
191 3300005366 Ga0070659_100153206 Ga0070659_1001532062 359
192 3300005367 Ga0070667_100003317 Ga0070667_10000331714 359
193 3300005367 Ga0070667_100014226 Ga0070667_1000142266 359
194 3300005367 Ga0070667_100022123 Ga0070667_1000221233 359
195 3300005367 Ga0070667_100063120 Ga0070667_1000631203 359
196 3300005367 Ga0070667_100068630 Ga0070667_1000686302 359
197 3300005367 Ga0070667_100106220 Ga0070667_1001062202 359
198 3300005367 Ga0070667_100170864 Ga0070667_1001708642 359
199 3300005455 Ga0070663_100001333 Ga0070663_1000013339 359
200 3300005455 Ga0070663_100014640 Ga0070663_1000146404 359
201 3300005455 Ga0070663_100027849 Ga0070663_1000278492 359
202 3300005456 Ga0070678_100009248 Ga0070678_1000092482 359
203 3300005456 Ga0070678_100032205 Ga0070678_1000322053 359
204 3300005456 Ga0070678_100068262 Ga0070678_1000682622 359
205 3300005456 Ga0070678_100152233 Ga0070678_1001522332 359
206 3300005457 Ga0070662_100027320 Ga0070662_1000273202 359
207 3300005457 Ga0070662_100027728 Ga0070662_1000277282 359
208 3300005457 Ga0070662_100037558 Ga0070662_1000375582 359
209 3300005457 Ga0070662_100038825 Ga0070662_1000388252 359
210 3300005457 Ga0070662_100041597 Ga0070662_1000415973 359
211 3300005457 Ga0070662_100051987 Ga0070662_1000519872 359
212 3300005457 Ga0070662_100072755 Ga0070662_1000727552 359
213 3300005457 Ga0070662_100171740 Ga0070662_1001717401 359
214 3300005459 Ga0068867_100001695 Ga0068867_1000016959 359
215 3300005459 Ga0068867_100012152 Ga0068867_1000121524 359
216 3300005459 Ga0068867_100012224 Ga0068867_1000122246 359
217 3300005459 Ga0068867_100068070 Ga0068867_1000680702 359
218 3300005459 Ga0068867_100075899 Ga0068867_1000758992 359
219 3300005466 Ga0070685_10129182 Ga0070685_101291822 359
220 3300005467 Ga0070706_100073922 Ga0070706_1000739222 359
221 3300005530 Ga0070679_100006195 Ga0070679_1000061952 359
222 3300005539 Ga0068853_100039596 Ga0068853_1000395962 359
223 3300005539 Ga0068853_100055956 Ga0068853_1000559562 359
224 3300005543 Ga0070672_100002003 Ga0070672_1000020038 359
225 3300005543 Ga0070672_100016349 Ga0070672_1000163492 359
226 3300005543 Ga0070672_100018179 Ga0070672_1000181792 359
227 3300005543 Ga0070672_100048771 Ga0070672_1000487712 359
228 3300005543 Ga0070672_100073007 Ga0070672_1000730072 359
229 3300005543 Ga0070672_100111880 Ga0070672_1001118802 359
230 3300005543 Ga0070672_100123330 Ga0070672_1001233302 359
231 3300005564 Ga0070664_100012448 Ga0070664_1000124488 359
232 3300005564 Ga0070664_100026777 Ga0070664_1000267775 359
233 3300005564 Ga0070664_100066596 Ga0070664_1000665961 359
234 3300005564 Ga0070664_100104387 Ga0070664_1001043872 359
235 3300005564 Ga0070664_100254324 Ga0070664_1002543242 359
236 3300005577 Ga0068857_100045560 Ga0068857_1000455602 359
237 3300005577 Ga0068857_100133456 Ga0068857_1001334562 359
238 3300005577 Ga0068857_100211746 Ga0068857_1002117462 359
239 3300005614 Ga0068856_100011617 Ga0068856_1000116175 359
240 3300005616 Ga0068852_100013224 Ga0068852_1000132244 359
241 3300005616 Ga0068852_100098100 Ga0068852_1000981002 359
242 3300005616 Ga0068852_100152189 Ga0068852_1001521892 359
243 3300005617 Ga0068859_100020694 Ga0068859_1000206942 359
244 3300005617 Ga0068859_100138376 Ga0068859_1001383762 359
245 3300005617 Ga0068859_100285296 Ga0068859_1002852962 359
246 3300005618 Ga0068864_100003870 Ga0068864_1000038708 359
247 3300005618 Ga0068864_100050348 Ga0068864_1000503482 359
248 3300005618 Ga0068864_100128344 Ga0068864_1001283442 359
249 3300005718 Ga0068866_10024439 Ga0068866_100244392 359
250 3300005719 Ga0068861_100004497 Ga0068861_10000449710 359
251 3300005719 Ga0068861_100011784 Ga0068861_1000117845 359
252 3300005719 Ga0068861_100150581 Ga0068861_1001505812 359
253 3300005834 Ga0068851_10036782 Ga0068851_100367822 359
254 3300005841 Ga0068863_100002141 Ga0068863_1000021412 359
255 3300005841 Ga0068863_100031883 Ga0068863_1000318832 359
256 3300005841 Ga0068863_100052117 Ga0068863_1000521172 359
257 3300005842 Ga0068858_100001584 Ga0068858_10000158415 359
258 3300005842 Ga0068858_100010943 Ga0068858_1000109439 359
259 3300005842 Ga0068858_100103729 Ga0068858_1001037292 359
260 3300005843 Ga0068860_100001910 Ga0068860_10000191019 359
261 3300005843 Ga0068860_100014499 Ga0068860_1000144996 359
262 3300005844 Ga0068862_100004043 Ga0068862_10000404310 359
263 3300005844 Ga0068862_100032435 Ga0068862_1000324353 359
264 3300005937 Ga0081455_10042458 Ga0081455_100424581 359
265 3300006048 Ga0075363_100042299 Ga0075363_1000422992 359
266 3300006048 Ga0075363_100076636 Ga0075363_1000766361 359
267 3300006051 Ga0075364_10042087 Ga0075364_100420872 359
268 3300006051 Ga0075364_10065652 Ga0075364_100656521 359
269 3300006178 Ga0075367_10075388 Ga0075367_100753882 359
270 3300006195 Ga0075366_10001872 Ga0075366_1000187211 359
271 3300006195 Ga0075366_10002038 Ga0075366_1000203810 359
272 3300006195 Ga0075366_10002642 Ga0075366_100026428 359
273 3300006195 Ga0075366_10019111 Ga0075366_100191113 359
274 3300006195 Ga0075366_10022185 Ga0075366_100221852 359
275 3300006195 Ga0075366_10036912 Ga0075366_100369122 359
276 3300006237 Ga0097621_100028821 Ga0097621_1000288213 359
277 3300006237 Ga0097621_100048534 Ga0097621_1000485341 359
278 3300006353 Ga0075370_10000167 Ga0075370_1000016712 359
279 3300006353 Ga0075370_10000719 Ga0075370_100007192 359
280 3300006353 Ga0075370_10001130 Ga0075370_1000113010 359
281 3300006353 Ga0075370_10001256 Ga0075370_100012569 359
282 3300006353 Ga0075370_10003689 Ga0075370_100036892 359
283 3300006353 Ga0075370_10007483 Ga0075370_100074831 359
284 3300006353 Ga0075370_10010571 Ga0075370_100105715 359
285 3300006353 Ga0075370_10010698 Ga0075370_100106982 359
286 3300006353 Ga0075370_10036557 Ga0075370_100365572 359
287 3300006358 Ga0068871_100013614 Ga0068871_1000136142 359
288 3300006358 Ga0068871_100053243 Ga0068871_1000532432 359
289 3300006358 Ga0068871_100122983 Ga0068871_1001229832 359
290 3300006358 Ga0068871_100194356 Ga0068871_1001943562 359
291 3300006871 Ga0075434_100210582 Ga0075434_1002105822 359
292 3300006880 Ga0075429_100001027 Ga0075429_1000010276 359
293 3300006931 Ga0097620_100020694 Ga0097620_1000206942 359
294 3300006931 Ga0097620_100138375 Ga0097620_1001383752 359
295 3300006931 Ga0097620_100285271 Ga0097620_1002852712 359
296 3300006944 Ga0099823_1009799 Ga0099823_10097997 359
297 3300006946 Ga0079104_1000003 Ga0079104_1000003258 359
298 3300006946 Ga0079104_1000017 Ga0079104_1000017183 359
299 3300009092 Ga0105250_10006594 Ga0105250_100065943 359
300 3300009093 Ga0105240_10060587 Ga0105240_100605874 359
301 3300009093 Ga0105240_10166101 Ga0105240_101661014 359
302 3300009094 Ga0111539_10558671 Ga0111539_105586711 359
303 3300009148 Ga0105243_10001185 Ga0105243_100011857 359
304 3300009148 Ga0105243_10009310 Ga0105243_100093102 359
305 3300009174 Ga0105241_10050916 Ga0105241_100509162 359
306 3300009176 Ga0105242_10000453 Ga0105242_1000045310 359
307 3300009176 Ga0105242_10061013 Ga0105242_100610132 359
308 3300009177 Ga0105248_10020330 Ga0105248_100203303 359
309 3300009177 Ga0105248_10026443 Ga0105248_100264432 359
310 3300009177 Ga0105248_10046549 Ga0105248_100465492 359
311 3300009177 Ga0105248_10156522 Ga0105248_101565222 359
312 3300009177 Ga0105248_10193669 Ga0105248_101936692 359
313 3300009177 Ga0105248_10516871 Ga0105248_105168712 359
314 3300009545 Ga0105237_10122139 Ga0105237_101221392 359
315 3300009551 Ga0105238_10018116 Ga0105238_100181162 359
316 3300009551 Ga0105238_10044211 Ga0105238_100442115 359
317 3300009553 Ga0105249_10017708 Ga0105249_100177085 359
318 3300009553 Ga0105249_10038194 Ga0105249_100381942 359
319 3300010375 Ga0105239_10131653 Ga0105239_101316532 359
320 3300012497 Ga0157319_1000010 Ga0157319_100001018 359
321 3300012513 Ga0157326_1001365 Ga0157326_10013652 359
322 3300013102 Ga0157371_10032792 Ga0157371_100327922 359
323 3300013104 Ga0157370_10008137 Ga0157370_100081379 359
324 3300013104 Ga0157370_10314169 Ga0157370_103141692 359
325 3300013105 Ga0157369_10085797 Ga0157369_100857972 359
326 3300013105 Ga0157369_10137307 Ga0157369_101373072 359
327 3300013296 Ga0157374_10020040 Ga0157374_100200403 359
328 3300013296 Ga0157374_10030533 Ga0157374_100305334 359
329 3300013296 Ga0157374_10199617 Ga0157374_101996172 359
330 3300013297 Ga0157378_10000558 Ga0157378_1000055812 359
331 3300013297 Ga0157378_10061097 Ga0157378_100610972 359
332 3300013297 Ga0157378_10144207 Ga0157378_101442072 359
333 3300013306 Ga0163162_10009181 Ga0163162_100091816 359
334 3300013306 Ga0163162_10024807 Ga0163162_100248074 359
335 3300013306 Ga0163162_10031794 Ga0163162_100317946 359
336 3300013306 Ga0163162_10033157 Ga0163162_100331572 359
337 3300013307 Ga0157372_10095120 Ga0157372_100951202 359
338 3300013308 Ga0157375_10008783 Ga0157375_100087837 359
339 3300013308 Ga0157375_10021275 Ga0157375_100212756 359
340 3300013308 Ga0157375_10039281 Ga0157375_100392812 359
341 3300013308 Ga0157375_10063774 Ga0157375_100637742 359
342 3300013308 Ga0157375_10093518 Ga0157375_100935182 359
343 3300014325 Ga0163163_10017948 Ga0163163_100179484 359
344 3300014326 Ga0157380_10016835 Ga0157380_100168356 359
345 3300014326 Ga0157380_10031042 Ga0157380_100310425 359
346 3300014326 Ga0157380_10332189 Ga0157380_103321892 359
347 3300014497 Ga0182008_10001333 Ga0182008_1000133312 359
348 3300014497 Ga0182008_10015908 Ga0182008_100159083 359
349 3300014497 Ga0182008_10084691 Ga0182008_100846911 359
350 3300014745 Ga0157377_10000028 Ga0157377_100000285 359
351 3300014968 Ga0157379_10017086 Ga0157379_100170864 359
352 3300014968 Ga0157379_10027080 Ga0157379_100270806 359
353 3300014968 Ga0157379_10028234 Ga0157379_100282345 359
354 3300014968 Ga0157379_10046145 Ga0157379_100461453 359
355 3300014968 Ga0157379_10116340 Ga0157379_101163402 359
356 3300014968 Ga0157379_10167652 Ga0157379_101676522 359
357 3300014969 Ga0157376_10090511 Ga0157376_100905112 359
358 3300015261 Ga0182006_1003396 Ga0182006_10033965 359
359 3300015262 Ga0182007_10022577 Ga0182007_100225772 359
360 3300015683 Ga0183362_10003 Ga0183362_10003379 359
361 3300017792 Ga0163161_10006225 Ga0163161_100062252 359
362 3300017792 Ga0163161_10017349 Ga0163161_100173494 359
363 3300017792 Ga0163161_10089002 Ga0163161_100890022 359
364 3300017792 Ga0163161_10139077 Ga0163161_101390772 359
365 3300025206 Ga0209435_100010 Ga0209435_100010239 359
366 3300025228 Ga0209672_100628 Ga0209672_10062818 359
367 3300025229 Ga0209147_101067 Ga0209147_1010673 359
368 3300025242 Ga0209258_100009 Ga0209258_100009447 359
369 3300025245 Ga0207425_1000235 Ga0207425_100023535 359
370 3300025245 Ga0207425_1000519 Ga0207425_100051915 359
371 3300025245 Ga0207425_1000519 Ga0207425_100051916 359
372 3300025245 Ga0207425_1007765 Ga0207425_10077652 359
373 3300025246 Ga0209646_1000001 Ga0209646_10000011903 359
374 3300025250 Ga0209026_1000001 Ga0209026_1000001557 359
375 3300025254 Ga0209148_1000007 Ga0209148_1000007447 359
376 3300025256 Ga0209759_1000001 Ga0209759_10000011534 359
377 3300025258 Ga0209129_1000013 Ga0209129_1000013173 359
378 3300025258 Ga0209129_1000075 Ga0209129_100007517 359
379 3300025258 Ga0209129_1000075 Ga0209129_100007518 359
380 3300025263 Ga0209565_1000028 Ga0209565_1000028236 359
381 3300025263 Ga0209565_1000587 Ga0209565_100058716 359
382 3300025263 Ga0209565_1001309 Ga0209565_10013092 359
383 3300025273 Ga0209673_1000035 Ga0209673_100003599 359
384 3300025273 Ga0209673_1000279 Ga0209673_100027947 359
385 3300025273 Ga0209673_1001569 Ga0209673_10015698 359
386 3300025273 Ga0209673_1005270 Ga0209673_10052707 359
387 3300025273 Ga0209673_1009154 Ga0209673_10091542 359
388 3300025284 Ga0209130_1000052 Ga0209130_100005234 359
389 3300025284 Ga0209130_1000112 Ga0209130_100011293 359
390 3300025284 Ga0209130_1000158 Ga0209130_100015869 359
391 3300025284 Ga0209130_1000363 Ga0209130_10003638 359
392 3300025291 Ga0209675_1000490 Ga0209675_100049018 359
393 3300025291 Ga0209675_1000662 Ga0209675_100066217 359
394 3300025292 Ga0209676_1000069 Ga0209676_1000069226 359
395 3300025292 Ga0209676_1009320 Ga0209676_10093204 359
396 3300025294 Ga0209025_1000103 Ga0209025_100010360 359
397 3300025294 Ga0209025_1000169 Ga0209025_1000169131 359
398 3300025294 Ga0209025_1005988 Ga0209025_10059883 359
399 3300025294 Ga0209025_1012424 Ga0209025_10124242 359
400 3300025294 Ga0209025_1033092 Ga0209025_10330924 359
401 3300025295 Ga0209564_1000003 Ga0209564_1000003899 359
402 3300025295 Ga0209564_1000046 Ga0209564_1000046181 359
403 3300025295 Ga0209564_1000046 Ga0209564_1000046182 359
404 3300025295 Ga0209564_1000822 Ga0209564_100082239 359
405 3300025295 Ga0209564_1001252 Ga0209564_100125220 359
406 3300025295 Ga0209564_1001892 Ga0209564_100189216 359
407 3300025295 Ga0209564_1003304 Ga0209564_10033044 359
408 3300025297 Ga0209758_1000052 Ga0209758_1000052281 359
409 3300025297 Ga0209758_1000052 Ga0209758_1000052282 359
410 3300025297 Ga0209758_1000067 Ga0209758_100006782 359
411 3300025297 Ga0209758_1009236 Ga0209758_10092366 359
412 3300025297 Ga0209758_1017756 Ga0209758_10177563 359
413 3300025297 Ga0209758_1017756 Ga0209758_10177564 359
414 3300025298 Ga0209050_1000023 Ga0209050_1000023401 359
415 3300025298 Ga0209050_1000202 Ga0209050_100020293 359
416 3300025298 Ga0209050_1002480 Ga0209050_100248015 359
417 3300025298 Ga0209050_1004530 Ga0209050_10045306 359
418 3300025298 Ga0209050_1004531 Ga0209050_10045312 359
419 3300025298 Ga0209050_1005114 Ga0209050_10051144 359
420 3300025299 Ga0209256_1000003 Ga0209256_10000031116 359
421 3300025299 Ga0209256_1000011 Ga0209256_1000011620 359
422 3300025299 Ga0209256_1000077 Ga0209256_10000778 359
423 3300025299 Ga0209256_1000121 Ga0209256_1000121131 359
424 3300025299 Ga0209256_1000204 Ga0209256_100020487 359
425 3300025299 Ga0209256_1004433 Ga0209256_10044333 359
426 3300025299 Ga0209256_1025326 Ga0209256_10253261 359
427 3300025302 Ga0207426_1000101 Ga0207426_1000101173 359
428 3300025302 Ga0207426_1000129 Ga0207426_1000129155 359
429 3300025302 Ga0207426_1000153 Ga0207426_100015366 359
430 3300025303 Ga0209051_1000017 Ga0209051_1000017401 359
431 3300025303 Ga0209051_1001172 Ga0209051_10011722 359
432 3300025303 Ga0209051_1002779 Ga0209051_10027796 359
433 3300025303 Ga0209051_1005838 Ga0209051_10058387 359
434 3300025304 Ga0209257_1000017 Ga0209257_1000017798 359
435 3300025304 Ga0209257_1000041 Ga0209257_1000041401 359
436 3300025304 Ga0209257_1001164 Ga0209257_100116420 359
437 3300025304 Ga0209257_1002118 Ga0209257_100211815 359
438 3300025304 Ga0209257_1002981 Ga0209257_100298115 359
439 3300025304 Ga0209257_1005195 Ga0209257_10051958 359
440 3300025304 Ga0209257_1010355 Ga0209257_10103554 359
441 3300025304 Ga0209257_1014066 Ga0209257_10140662 359
442 3300025304 Ga0209257_1014066 Ga0209257_10140663 359
443 3300025315 Ga0207697_10016551 Ga0207697_100165512 359
444 3300025315 Ga0207697_10021324 Ga0207697_100213242 359
445 3300025321 Ga0207656_10008342 Ga0207656_100083423 359
446 3300025321 Ga0207656_10013005 Ga0207656_100130052 359
447 3300025321 Ga0207656_10015171 Ga0207656_100151712 359
448 3300025711 Ga0207696_1010287 Ga0207696_10102872 359
449 3300025728 Ga0207655_1007289 Ga0207655_10072895 359
450 3300025893 Ga0207682_10002379 Ga0207682_100023799 359
451 3300025893 Ga0207682_10008373 Ga0207682_100083733 359
452 3300025893 Ga0207682_10019881 Ga0207682_100198812 359
453 3300025907 Ga0207645_10007602 Ga0207645_100076022 359
454 3300025907 Ga0207645_10026945 Ga0207645_100269452 359
455 3300025907 Ga0207645_10101935 Ga0207645_101019352 359
456 3300025909 Ga0207705_10048902 Ga0207705_100489022 359
457 3300025914 Ga0207671_10120879 Ga0207671_101208792 359
458 3300025917 Ga0207660_10145054 Ga0207660_101450541 359
459 3300025918 Ga0207662_10022590 Ga0207662_100225903 359
460 3300025918 Ga0207662_10086052 Ga0207662_100860522 359
461 3300025919 Ga0207657_10216015 Ga0207657_102160151 359
462 3300025920 Ga0207649_10001227 Ga0207649_100012274 359
463 3300025920 Ga0207649_10071463 Ga0207649_100714632 359
464 3300025921 Ga0207652_10002539 Ga0207652_1000253916 359
465 3300025923 Ga0207681_10011771 Ga0207681_100117712 359
466 3300025923 Ga0207681_10185343 Ga0207681_101853431 359
467 3300025924 Ga0207694_10021004 Ga0207694_100210042 359
468 3300025925 Ga0207650_10006268 Ga0207650_1000626810 359
469 3300025925 Ga0207650_10007691 Ga0207650_100076918 359
470 3300025925 Ga0207650_10076908 Ga0207650_100769082 359
471 3300025926 Ga0207659_10003024 Ga0207659_100030248 359
472 3300025926 Ga0207659_10010792 Ga0207659_100107922 359
473 3300025926 Ga0207659_10037306 Ga0207659_100373063 359
474 3300025926 Ga0207659_10050662 Ga0207659_100506622 359
475 3300025926 Ga0207659_10064108 Ga0207659_100641082 359
476 3300025926 Ga0207659_10231266 Ga0207659_102312661 359
477 3300025926 Ga0207659_10305966 Ga0207659_103059661 359
478 3300025931 Ga0207644_10061994 Ga0207644_100619941 359
479 3300025932 Ga0207690_10005538 Ga0207690_100055388 359
480 3300025933 Ga0207706_10000845 Ga0207706_1000084517 359
481 3300025933 Ga0207706_10021167 Ga0207706_100211674 359
482 3300025933 Ga0207706_10046558 Ga0207706_100465582 359
483 3300025933 Ga0207706_10087408 Ga0207706_100874082 359
484 3300025933 Ga0207706_10123099 Ga0207706_101230991 359
485 3300025933 Ga0207706_10124154 Ga0207706_101241542 359
486 3300025933 Ga0207706_10156586 Ga0207706_101565862 359
487 3300025934 Ga0207686_10004663 Ga0207686_100046638 359
488 3300025934 Ga0207686_10017750 Ga0207686_100177502 359
489 3300025934 Ga0207686_10062762 Ga0207686_100627622 359
490 3300025935 Ga0207709_10000032 Ga0207709_10000032146 359
491 3300025935 Ga0207709_10001212 Ga0207709_1000121213 359
492 3300025935 Ga0207709_10002462 Ga0207709_100024628 359
493 3300025935 Ga0207709_10025234 Ga0207709_100252342 359
494 3300025937 Ga0207669_10009749 Ga0207669_100097494 359
495 3300025937 Ga0207669_10035146 Ga0207669_100351462 359
496 3300025937 Ga0207669_10047435 Ga0207669_100474352 359
497 3300025937 Ga0207669_10148757 Ga0207669_101487571 359
498 3300025938 Ga0207704_10003573 Ga0207704_100035737 359
499 3300025938 Ga0207704_10019101 Ga0207704_100191012 359
500 3300025938 Ga0207704_10190416 Ga0207704_101904162 359
501 3300025940 Ga0207691_10000944 Ga0207691_100009442 359
502 3300025940 Ga0207691_10010958 Ga0207691_100109582 359
503 3300025940 Ga0207691_10011136 Ga0207691_100111367 359
504 3300025940 Ga0207691_10018444 Ga0207691_100184442 359
505 3300025940 Ga0207691_10044478 Ga0207691_100444783 359
506 3300025940 Ga0207691_10044937 Ga0207691_100449373 359
507 3300025940 Ga0207691_10089394 Ga0207691_100893942 359
508 3300025940 Ga0207691_10099071 Ga0207691_100990712 359
509 3300025940 Ga0207691_10177981 Ga0207691_101779812 359
510 3300025940 Ga0207691_10227737 Ga0207691_102277372 359
511 3300025941 Ga0207711_10013379 Ga0207711_100133796 359
512 3300025941 Ga0207711_10046340 Ga0207711_100463403 359
513 3300025941 Ga0207711_10056715 Ga0207711_100567152 359
514 3300025941 Ga0207711_10081721 Ga0207711_100817212 359
515 3300025942 Ga0207689_10000225 Ga0207689_1000022539 359
516 3300025942 Ga0207689_10156758 Ga0207689_101567582 359
517 3300025945 Ga0207679_10000864 Ga0207679_100008645 359
518 3300025945 Ga0207679_10021206 Ga0207679_100212062 359
519 3300025945 Ga0207679_10029761 Ga0207679_100297612 359
520 3300025945 Ga0207679_10094033 Ga0207679_100940332 359
521 3300025960 Ga0207651_10006251 Ga0207651_100062512 359
522 3300025960 Ga0207651_10061262 Ga0207651_100612622 359
523 3300025961 Ga0207712_10142876 Ga0207712_101428762 359
524 3300025972 Ga0207668_10014832 Ga0207668_100148324 359
525 3300025972 Ga0207668_10173564 Ga0207668_101735642 359
526 3300025986 Ga0207658_10003189 Ga0207658_100031892 359
527 3300025986 Ga0207658_10006549 Ga0207658_100065498 359
528 3300025986 Ga0207658_10021149 Ga0207658_100211492 359
529 3300025986 Ga0207658_10116768 Ga0207658_101167681 359
530 3300026023 Ga0207677_10003900 Ga0207677_100039008 359
531 3300026023 Ga0207677_10035679 Ga0207677_100356792 359
532 3300026023 Ga0207677_10088153 Ga0207677_100881532 359
533 3300026035 Ga0207703_10001484 Ga0207703_100014843 359
534 3300026035 Ga0207703_10032892 Ga0207703_100328922 359
535 3300026035 Ga0207703_10089633 Ga0207703_100896332 359
536 3300026035 Ga0207703_10144035 Ga0207703_101440352 359
537 3300026041 Ga0207639_10166516 Ga0207639_101665162 359
538 3300026041 Ga0207639_10191056 Ga0207639_101910562 359
539 3300026041 Ga0207639_10271338 Ga0207639_102713382 359
540 3300026041 Ga0207639_10309361 Ga0207639_103093612 359
541 3300026067 Ga0207678_10012524 Ga0207678_100125245 359
542 3300026067 Ga0207678_10065269 Ga0207678_100652692 359
543 3300026067 Ga0207678_10117339 Ga0207678_101173391 359
544 3300026067 Ga0207678_10172832 Ga0207678_101728322 359
545 3300026078 Ga0207702_10036064 Ga0207702_100360643 359
546 3300026088 Ga0207641_10008519 Ga0207641_100085192 359
547 3300026088 Ga0207641_10021323 Ga0207641_100213232 359
548 3300026089 Ga0207648_10000146 Ga0207648_1000014667 359
549 3300026089 Ga0207648_10002481 Ga0207648_100024818 359
550 3300026089 Ga0207648_10005079 Ga0207648_100050798 359
551 3300026089 Ga0207648_10033097 Ga0207648_100330974 359
552 3300026089 Ga0207648_10145787 Ga0207648_101457871 359
553 3300026089 Ga0207648_10153981 Ga0207648_101539812 359
554 3300026095 Ga0207676_10016086 Ga0207676_100160861 359
555 3300026095 Ga0207676_10019189 Ga0207676_100191895 359
556 3300026095 Ga0207676_10026201 Ga0207676_100262012 359
557 3300026095 Ga0207676_10162301 Ga0207676_101623012 359
558 3300026095 Ga0207676_10222930 Ga0207676_102229302 359
559 3300026116 Ga0207674_10021396 Ga0207674_100213968 359
560 3300026116 Ga0207674_10050451 Ga0207674_100504513 359
561 3300026116 Ga0207674_10149734 Ga0207674_101497342 359
562 3300026118 Ga0207675_100004297 Ga0207675_1000042978 359
563 3300026118 Ga0207675_100007940 Ga0207675_1000079402 359
564 3300026118 Ga0207675_100125768 Ga0207675_1001257682 359
565 3300026121 Ga0207683_10012690 Ga0207683_100126904 359
566 3300026121 Ga0207683_10013995 Ga0207683_100139952 359
567 3300026121 Ga0207683_10103552 Ga0207683_101035522 359
568 3300026121 Ga0207683_10113636 Ga0207683_101136362 359
569 3300026121 Ga0207683_10126947 Ga0207683_101269471 359
570 3300026121 Ga0207683_10137667 Ga0207683_101376671 359
571 3300026121 Ga0207683_10192397 Ga0207683_101923972 359
572 3300026142 Ga0207698_10001243 Ga0207698_100012438 359
573 3300026142 Ga0207698_10030755 Ga0207698_100307552 359
574 3300026142 Ga0207698_10074112 Ga0207698_100741122 359
575 3300026142 Ga0207698_10190839 Ga0207698_101908391 359
576 3300026142 Ga0207698_10261807 Ga0207698_102618072 359
577 3300026142 Ga0207698_10406829 Ga0207698_104068291 359
578 3300027111 Ga0209281_1000002 Ga0209281_10000021472 359
579 3300027111 Ga0209281_1000042 Ga0209281_1000042166 359
580 3300027296 Ga0209389_1014524 Ga0209389_10145242 359
581 3300027543 Ga0209999_1000544 Ga0209999_10005442 359
582 3300027682 Ga0209971_1002891 Ga0209971_10028912 359
583 3300027695 Ga0209966_1000036 Ga0209966_100003636 359
584 3300027876 Ga0209974_10000455 Ga0209974_100004557 359
585 3300028380 Ga0268265_10005309 Ga0268265_100053093 359
586 3300028381 Ga0268264_10011851 Ga0268264_100118514 359
587 3300028381 Ga0268264_10015393 Ga0268264_100153933 359
588 3300028786 Ga0307517_10115516 Ga0307517_101155161 359
589 3300028794 Ga0307515_10000020 Ga0307515_10000020306 359
590 3300028794 Ga0307515_10000053 Ga0307515_10000053107 359
591 3300028794 Ga0307515_10000529 Ga0307515_1000052912 359
592 3300028794 Ga0307515_10005082 Ga0307515_1000508210 359
593 3300028794 Ga0307515_10006495 Ga0307515_100064957 359
594 3300028794 Ga0307515_10104200 Ga0307515_101042002 359
595 3300028794 Ga0307515_10119380 Ga0307515_101193802 359
596 3300031235 Ga0265330_10000014 Ga0265330_1000001459 359
597 3300031238 Ga0265332_10000011 Ga0265332_10000011180 359
598 3300031239 Ga0265328_10009555 Ga0265328_100095553 359
599 3300031241 Ga0265325_10044997 Ga0265325_100449972 359
600 3300031250 Ga0265331_10019144 Ga0265331_100191443 359
601 3300031251 Ga0265327_10000184 Ga0265327_1000018494 359
602 3300031251 Ga0265327_10000355 Ga0265327_100003559 359
603 3300031456 Ga0307513_10000004 Ga0307513_10000004292 359
604 3300031456 Ga0307513_10000015 Ga0307513_1000001524 359
605 3300031456 Ga0307513_10006695 Ga0307513_1000669513 359
606 3300031456 Ga0307513_10212349 Ga0307513_102123492 359
607 3300031456 Ga0307513_10254241 Ga0307513_102542412 359
608 3300031507 Ga0307509_10082658 Ga0307509_100826581 359
609 3300031548 Ga0307408_100000150 Ga0307408_10000015010 359
610 3300031548 Ga0307408_100312909 Ga0307408_1003129091 359
611 3300031548 Ga0307408_100416696 Ga0307408_1004166961 359
612 3300031616 Ga0307508_10000004 Ga0307508_1000000452 359
613 3300031649 Ga0307514_10001404 Ga0307514_1000140423 359
614 3300031649 Ga0307514_10064671 Ga0307514_100646712 359
615 3300031711 Ga0265314_10000026 Ga0265314_1000002688 359
616 3300031712 Ga0265342_10130266 Ga0265342_101302661 359
617 3300031730 Ga0307516_10003104 Ga0307516_100031046 359
618 3300031730 Ga0307516_10003697 Ga0307516_1000369712 359
619 3300031730 Ga0307516_10095734 Ga0307516_100957342 359
620 3300031730 Ga0307516_10109150 Ga0307516_101091502 359
621 3300031730 Ga0307516_10272720 Ga0307516_102727201 359
622 3300031731 Ga0307405_10004178 Ga0307405_100041787 359
623 3300031824 Ga0307413_10000382 Ga0307413_100003825 359
624 3300031824 Ga0307413_10046773 Ga0307413_100467733 359
625 3300031852 Ga0307410_10038494 Ga0307410_100384942 359
626 3300031901 Ga0307406_10013196 Ga0307406_100131964 359
627 3300031901 Ga0307406_10028804 Ga0307406_100288042 359
628 3300031901 Ga0307406_10046459 Ga0307406_100464592 359
629 3300031911 Ga0307412_10024767 Ga0307412_100247672 359
630 3300031995 Ga0307409_100000086 Ga0307409_1000000862 359
631 3300031995 Ga0307409_100030709 Ga0307409_1000307093 359
632 3300031995 Ga0307409_100167534 Ga0307409_1001675342 359
633 3300032002 Ga0307416_100070093 Ga0307416_1000700932 359
634 3300032002 Ga0307416_100085870 Ga0307416_1000858702 359
635 3300032002 Ga0307416_100117761 Ga0307416_1001177612 359
636 3300032002 Ga0307416_100315228 Ga0307416_1003152282 359
637 3300032002 Ga0307416_100324400 Ga0307416_1003244001 359
638 3300032002 Ga0307416_100383021 Ga0307416_1003830211 359
639 3300032005 Ga0307411_10000869 Ga0307411_1000086910 359
640 3300032005 Ga0307411_10003562 Ga0307411_100035627 359
641 3300032126 Ga0307415_100009938 Ga0307415_1000099383 359
642 3300032126 Ga0307415_100066344 Ga0307415_1000663442 359
643 3300033179 Ga0307507_10007188 Ga0307507_100071887 359
644 3300034817 Ga0373948_0010692 Ga0373948_0010692_275_1357 359
645 3300034818 Ga0373950_0006394 Ga0373950_0006394_605_1687 359
646 3300035114 Ga0373939_0000069 Ga0373939_0000069_14726_15808 359
647 3300035121 Ga0373960_0014790 Ga0373960_0014790_587_1669 359
648 3300035691 Ga0373931_0001617 Ga0373931_0001617_1281_2363 359
649 3300035695 Ga0373927_0076598 Ga0373927_0076598_421_1503 359
650 3300036401 Ga0373937_0051389 Ga0373937_0051389_1212_2294 359
651 3300037418 Ga0395900_0000109 Ga0395900_0000109_102068_103150 359
652 3300037418 Ga0395900_0110563 Ga0395900_0110563_1169_2248 359
653 3300037466 Ga0395898_0000868 Ga0395898_0000868_21380_22462 359
654 3300037471 Ga0395905_0003562 Ga0395905_0003562_12213_13295 359
655 3300037471 Ga0395905_0029126 Ga0395905_0029126_2735_3823 359
656 3300037471 Ga0395905_0045312 Ga0395905_0045312_1767_2849 359
657 3300037471 Ga0395905_0045312 Ga0395905_0045312_509_1591 359
658 3300037471 Ga0395905_0050200 Ga0395905_0050200_2661_3743 359
659 3300037471 Ga0395905_0066244 Ga0395905_0066244_428_1519 359
660 3300037471 Ga0395905_0071033 Ga0395905_0071033_2136_3215 359
661 3300037471 Ga0395905_0127146 Ga0395905_0127146_1125_2207 359
662 3300037471 Ga0395905_0134402 Ga0395905_0134402_1051_2133 359
663 3300039437 Ga0436365_1492983 Ga0436365_1492983_151_1233 359
664 3300041413 Ga0439465_0063323 Ga0439465_0063323_75_1154 359
665 3300041443 Ga0451789_0948633 Ga0451789_0948633_241_1323 359
666 3300041459 Ga0451800_1194461 Ga0451800_1194461_993_2075 359
667 3300041460 Ga0451802_0797663 Ga0451802_0797663_146_1228 359
668 3300042007 Ga0439449_0054938 Ga0439449_0054938_12_1094 359
669 3300042120 Ga0450917_000395 Ga0450917_000395_1474_2562 359
670 3300042126 Ga0450888_000086 Ga0450888_000086_3041_4129 359
671 3300042127 Ga0450890_000675 Ga0450890_000675_1615_2736 359
672 3300042127 Ga0450890_000986 Ga0450890_000986_446_1534 359
673 3300042129 Ga0450891_000157 Ga0450891_000157_1384_2472 359
674 3300042130 Ga0450892_000356 Ga0450892_000356_802_1890 359
675 3300042134 Ga0450898_002712 Ga0450898_002712_243_1322 359
676 3300042135 Ga0450899_003727 Ga0450899_003727_518_1600 359
677 3300042144 Ga0450889_000632 Ga0450889_000632_2590_3678 359
678 3300042531 Ga0450918_000026 Ga0450918_000026_5813_6895 359
679 3300042532 Ga0450893_0000069 Ga0450893_0000069_1889_2977 359
680 3300042876 Ga0451577_0000142 Ga0451577_0000142_30090_31169 359
681 3300042876 Ga0451577_0001509 Ga0451577_0001509_20768_21850 359
682 3300042876 Ga0451577_0002068 Ga0451577_0002068_11727_12809 359
683 3300042876 Ga0451577_0007013 Ga0451577_0007013_7581_8663 359
684 3300042876 Ga0451577_0020090 Ga0451577_0020090_1442_2557 359
685 3300044656 Ga0466969_0000385 Ga0466969_0000385_19011_20093 359
686 3300044658 Ga0466972_0034233 Ga0466972_0034233_201_1280 359
687 3300044673 Ga0453683_0003599 Ga0453683_0003599_8438_9520 359
688 3300044684 Ga0466966_0006769 Ga0466966_0006769_2300_3382 359
689 3300044684 Ga0466966_0023138 Ga0466966_0023138_2173_3255 359
690 3300044693 Ga0466961_0011070 Ga0466961_0011070_4605_5687 359
691 3300044693 Ga0466961_0031065 Ga0466961_0031065_1692_2774 359
692 3300044693 Ga0466961_0054701 Ga0466961_0054701_1045_2127 359
693 3300044694 Ga0466963_0064455 Ga0466963_0064455_1114_2196 359
694 3300044694 Ga0466963_0086826 Ga0466963_0086826_339_1421 359
695 3300044712 Ga0453684_0000126 Ga0453684_0000126_205887_206966 359
696 3300044712 Ga0453684_0053731 Ga0453684_0053731_3653_4735 359
697 3300044712 Ga0453684_0176775 Ga0453684_0176775_578_1660 359
698 3300044712 Ga0453684_0369110 Ga0453684_0369110_318_1397 359
699 3300044719 Ga0466971_0013038 Ga0466971_0013038_2371_3453 359
700 3300045049 Ga0466959_0000371 Ga0466959_0000371_20169_21251 359
701 3300045049 Ga0466959_0019290 Ga0466959_0019290_3426_4508 359
702 3300045049 Ga0466959_0072253 Ga0466959_0072253_785_1867 359
703 3300045051 Ga0451576_0000909 Ga0451576_0000909_28112_29203 359
704 3300045051 Ga0451576_0002187 Ga0451576_0002187_17530_18609 359
705 3300045051 Ga0451576_0007327 Ga0451576_0007327_8954_10033 359
706 3300045051 Ga0451576_0012822 Ga0451576_0012822_5441_6523 359
707 3300045051 Ga0451576_0028892 Ga0451576_0028892_4350_5465 359
708 3300045051 Ga0451576_0039865 Ga0451576_0039865_2786_3925 359
709 3300045051 Ga0451576_0153533 Ga0451576_0153533_1145_2227 359
710 3300045051 Ga0451576_0289442 Ga0451576_0289442_222_1301 359
711 3300045051 Ga0451576_0344039 Ga0451576_0344039_140_1228 359
712 3300045051 Ga0451576_0486235 Ga0451576_0486235_184_1266 359
713 3300045836 Ga0466958_0022478 Ga0466958_0022478_124_1206 359
714 3300045976 Ga0466967_0085582 Ga0466967_0085582_895_1977 359
715 3300045976 Ga0466967_0174591 Ga0466967_0174591_624_1706 359
716 3300046516 Ga0495628_0240274 Ga0495628_0240274_246_1328 359
717 3300046519 Ga0495632_0002146 Ga0495632_0002146_7580_8662 359
718 3300046519 Ga0495632_0003371 Ga0495632_0003371_1716_2798 359
719 3300046519 Ga0495632_0007855 Ga0495632_0007855_1230_2312 359
720 3300046528 Ga0495642_0121997 Ga0495642_0121997_10_1092 359
721 3300046539 Ga0495621_0026108 Ga0495621_0026108_834_1916 359
722 3300046542 Ga0495597_0001551 Ga0495597_0001551_14391_15470 359
723 3300046615 Ga0495656_0000062 Ga0495656_0000062_47134_48213 359
724 3300046660 Ga0495625_0067071 Ga0495625_0067071_1286_2368 359
725 3300046694 Ga0495649_0001518 Ga0495649_0001518_4914_5996 359
726 3300047443 Ga0495687_000599 Ga0495687_000599_29231_30313 359
727 3300047471 Ga0495684_0114505 Ga0495684_0114505_158_1240 359
728 3300048091 Ga0495626_0021022 Ga0495626_0021022_643_1725 359
729 3300048908 Ga0496105_0035322 Ga0496105_0035322_812_1894 359
730 3300048910 Ga0496107_0055573 Ga0496107_0055573_1118_2200 359
731 3300048911 Ga0496108_0072577 Ga0496108_0072577_519_1601 359
732 3300048912 Ga0496109_0057078 Ga0496109_0057078_1360_2442 359
733 3300048912 Ga0496109_0084109 Ga0496109_0084109_128_1210 359
734 3300048915 Ga0496112_0014880 Ga0496112_0014880_3505_4587 359
735 3300048918 Ga0496115_0238042 Ga0496115_0238042_58_1140 359
736 3300048921 Ga0496118_0068611 Ga0496118_0068611_854_1933 359
737 3300048925 Ga0496122_0032346 Ga0496122_0032346_2533_3612 359
738 3300048926 Ga0496123_0036924 Ga0496123_0036924_1564_2643 359
739 3300048928 Ga0496125_0007601 Ga0496125_0007601_2917_3996 359
740 3300048929 Ga0496126_0014772 Ga0496126_0014772_171_1250 359
741 3300048929 Ga0496126_0156221 Ga0496126_0156221_187_1266 359
742 3300049523 Ga0501300_004837 Ga0501300_004837_66_1154 359
743 3300049579 Ga0501043_0000004 Ga0501043_0000004_134745_135827 359
744 3300049580 Ga0501046_0000016 Ga0501046_0000016_156009_157091 359
745 3300049581 Ga0501047_0000012 Ga0501047_0000012_155689_156771 359
746 3300049662 Ga0501222_001295 Ga0501222_001295_525_1613 359
747 3300049663 Ga0501223_008470 Ga0501223_008470_554_1642 359
748 3300049682 Ga0501252_000450 Ga0501252_000450_1416_2498 359
749 3300049684 Ga0501255_002105 Ga0501255_002105_118_1206 359
750 3300049706 Ga0501229_001888 Ga0501229_001888_911_1993 359
751 3300049759 Ga0501262_008134 Ga0501262_008134_133_1215 359
752 3300049762 Ga0501265_000996 Ga0501265_000996_454_1536 359
753 3300049769 Ga0501272_001530 Ga0501272_001530_1094_2182 359
754 3300049824 Ga0501045_0020428 Ga0501045_0020428_2669_3751 359
755 3300050493 nmdc:mga0k408_11976_c1 nmdc:mga0k408_11976_c1_2521_3603 359
756 3300050493 nmdc:mga0k408_1332_c1 nmdc:mga0k408_1332_c1_10363_11445 359
757 3300050493 nmdc:mga0k408_16177_c2 nmdc:mga0k408_16177_c2_1203_2285 359
758 3300050493 nmdc:mga0k408_181937_c1 nmdc:mga0k408_181937_c1_103_1185 359
759 3300050493 nmdc:mga0k408_2245_c1 nmdc:mga0k408_2245_c1_8244_9326 359
760 3300050493 nmdc:mga0k408_25138_c1 nmdc:mga0k408_25138_c1_1590_2672 359
761 3300050493 nmdc:mga0k408_47091_c1 nmdc:mga0k408_47091_c1_683_1765 359
762 3300050493 nmdc:mga0k408_5225_c1 nmdc:mga0k408_5225_c1_2533_3615 359
763 3300050493 nmdc:mga0k408_69768_c1 nmdc:mga0k408_69768_c1_454_1536 359
764 3300050494 nmdc:mga06z11_120738_c1 nmdc:mga06z11_120738_c1_309_1391 359
765 3300050496 nmdc:mga07m45_1111_c1 nmdc:mga07m45_1111_c1_3212_4294 359
766 3300050496 nmdc:mga07m45_1313_c1 nmdc:mga07m45_1313_c1_8537_9619 359
767 3300050496 nmdc:mga07m45_21568_c1 nmdc:mga07m45_21568_c1_1739_2821 359
768 3300050496 nmdc:mga07m45_4922_c1 nmdc:mga07m45_4922_c1_349_1431 359
769 3300050496 nmdc:mga07m45_63_c1 nmdc:mga07m45_63_c1_281_1363 359
770 3300050507 nmdc:mga05p37_70873_c1 nmdc:mga05p37_70873_c1_1972_3051 359
771 3300050508 nmdc:mga09592_3159_c1 nmdc:mga09592_3159_c1_8620_9702 359
772 3300050516 nmdc:mga0sz30_13751_c1 nmdc:mga0sz30_13751_c1_732_1814 359
773 3300053084 Ga0495595_0137824 Ga0495595_0137824_62_1156 359
774 3300053086 Ga0500578_0000746 Ga0500578_0000746_35903_36985 359
775 3300053088 Ga0500644_0038987 Ga0500644_0038987_394_1476 359
776 3300053090 Ga0500646_0020058 Ga0500646_0020058_201_1283 359
777 3300053093 Ga0500651_0029161 Ga0500651_0029161_1289_2371 359
778 3300053130 Ga0500642_0000935 Ga0500642_0000935_6372_7454 359
779 3300053131 Ga0500652_000142 Ga0500652_000142_25923_27005 359
780 3300053131 Ga0500652_000807 Ga0500652_000807_6185_7267 359
781 3300053133 Ga0500655_007435 Ga0500655_007435_388_1470 359
782 3300053134 Ga0500658_0003009 Ga0500658_0003009_4850_5932 359
783 3300053139 Ga0500568_0013996 Ga0500568_0013996_2435_3517 359
784 3300053139 Ga0500568_0023720 Ga0500568_0023720_615_1697 359
785 3300053154 Ga0500619_000310 Ga0500619_000310_868_1950 359
786 3300053156 Ga0500622_0000599 Ga0500622_0000599_12697_13779 359
787 3300053156 Ga0500622_0000952 Ga0500622_0000952_22025_23107 359
788 3300053156 Ga0500622_0002819 Ga0500622_0002819_3007_4122 359
789 3300053156 Ga0500622_0014209 Ga0500622_0014209_2859_3941 359
790 3300053161 Ga0500634_0037535 Ga0500634_0037535_237_1319 359
791 3300053730 Ga0500645_004363 Ga0500645_004363_3767_4846 359
792 3300061719 Ga0466962_0030617 Ga0466962_0030617_343_1425 359

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

56

343

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hzl-assembly1.cif.gz_A crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms 0.9833 30 355
4yzz-assembly1.cif.gz_A crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site 0.9824 29 354
7ug8-assembly1.cif.gz_A crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium 0.9778 29 352
4pet-assembly1.cif.gz_B crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate 0.9666 29 350
7ug8-assembly1.cif.gz_A crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium 0.9603 29 352
ID Description Score Start End Superfamily
4yzzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9761 29 354 3.40.190.170
2hzkC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9748 30 357 3.40.190.170
2hzkC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9658 30 357 3.40.190.170
4yzzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9409 29 354 3.40.190.170
4yicB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9334 152 321 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A3N5FTX4-F1-model_v4 ABC transporter substrate-binding protein 0.9934 48 359 GO:0055085
AF-A0A0D7EEV2-F1-model_v4 ABC transporter substrate-binding protein 0.9897 30 354 GO:0015849
GO:0031317
GO:0043177
GO:0046872
GO:0055085
AF-A0A259GDW1-F1-model_v4 ABC transporter substrate-binding protein 0.9891 22 355 GO:0015849
GO:0031317
GO:0043177
GO:0046872
GO:0055085
AF-A0A3N5FTX4-F1-model_v4 ABC transporter substrate-binding protein 0.984 48 359 GO:0055085
AF-A0A537VVV0-F1-model_v4 ABC transporter substrate-binding protein 0.9808 72 359 GO:0055085

Feature Viewer

pLDDT pTM Quality
91.19 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map