F481006

General Info

Members Datasets Scaffolds Average Seq Length
791 497 620 573

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2879083081|2879087501
Length 610
Sequence DLVIRGGTVADGRGGELFEADVAITGGRISEVGKVSAKGKEEIDARGKLVTPGFVDVHTHYDGQVTWSQDITPSSQNGVTTAIMGNCGVGFAPCRPADHTRLIQLMEGVEDIPEPVLSAGIPWAWESFPDYMDWLSKRDFDIDVGAQLPHAALRVYVMGERGARRDPSTAEDNAAMARLAGEAVRSGALGFSTSRTLNHRTSTGDFTPTLKAGEDELTAIAGAMHRQGRSVLQFVLDLSTIHEDLPMMLRVADATKCPISFSITQNDKAPQRWRQTLDEINAAAQRGLSITAQIAARPVGLLLGLELSRNPFQTHPSYKAIAHLPLQERLARLHQSDVRKAILSETATATDDPLFFRPNYDKMFLLGDPPDYEQPPENALGPQARRQGRQPEELAYDAMLSDEGRGMLYVPFLNYSDGNLDATREMLIDPQSVPGLSDGGAHCGIICDASFPTYLLTHWTRDRKRGEKLSIPFVVAAQSRKTALSVGLTDRGLIAPGYKADVNVIDYDRLHLHPPKVHYDLPVGGRRLLQDVXDRVRRGDAAAGRGDRAPAGEADSGRAGGGELAETASETRRPRLNLRVVLAKARTHYPKKKLWHEAGDHNSSQNCFLG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
11 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
12 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
19 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
20 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
21 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
22 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
23 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
24 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
25 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
26 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
27 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
28 2791355199
29 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
30 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
31 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
34 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
35 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
36 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
37 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
38 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
39 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
40 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
41 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
42 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
43 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
44 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
45 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
46 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
47 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
48 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
49 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
50 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
51 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
52 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
53 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
54 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
55 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
56 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
57 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
58 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
59 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
60 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
61 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
62 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
63 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
64 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
65 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
66 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
67 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
68 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
69 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
70 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
71 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
72 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
73 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
74 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
75 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
76 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
77 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
78 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
79 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
80 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
81 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
82 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
83 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
84 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
85 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
86 2904699407
87 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
88 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
89 2906610324
90 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
91 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
92 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
93 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
94 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
95 2922368715
96 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
97 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
98 2922425934
99 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
100 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
101 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
102 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
103 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
104 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
105 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
106 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
107 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
108 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
109 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
110 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
111 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
112 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
113 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
114 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
115 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
116 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
117 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
118 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
119 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
120 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
121 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
122 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
123 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
124 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
125 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
126 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
127 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
128 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
129 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
130 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
131 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
132 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
133 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
134 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
135 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
136 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
137 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
138 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
139 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
140 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
141 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
142 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
143 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
144 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
145 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
146 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
147 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
148 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
149 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
150 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
151 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
152 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
153 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
154 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
155 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
156 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
157 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
158 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
159 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
160 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
161 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
162 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
163 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
164 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
165 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
166 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
167 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
168 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
169 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
170 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
171 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
172 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
173 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
174 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
175 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
176 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
177 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
178 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
179 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
180 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
181 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
182 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
183 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
184 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
185 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
186 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
187 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
188 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
189 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
190 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
191 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
192 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
193 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
194 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
195 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
196 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
197 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
198 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
199 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
200 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
201 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
202 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
203 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
204 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
205 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
206 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
207 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
208 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
209 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
210 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
211 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
212 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
213 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
214 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
215 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
216 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
217 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
218 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
219 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
220 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
221 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
222 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
223 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
224 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
225 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
226 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
227 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
228 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
229 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
230 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
231 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
234 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
236 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
237 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
238 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
283 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
284 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
285 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
286 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
290 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
291 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
292 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
293 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
294 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
295 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
296 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
297 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
298 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
299 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
300 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
301 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
302 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
303 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
304 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
305 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
306 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
307 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
308 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
309 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
310 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
311 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
312 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
313 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
314 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
315 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
316 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
317 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
318 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
319 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
320 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
321 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
322 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
323 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
324 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
325 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
326 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
327 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
328 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
329 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
330 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
331 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
332 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
333 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
334 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
335 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
336 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
337 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
338 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
339 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
340 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
341 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
342 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
343 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
344 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
345 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
346 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
347 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
348 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
349 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
350 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
351 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
352 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
353 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
354 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
355 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
356 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
357 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
358 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
359 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
360 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
361 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
362 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
363 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
364 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
365 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
366 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
367 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
370 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
371 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
372 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
373 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
374 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
375 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
376 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
377 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
378 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
379 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
380 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
383 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
384 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
385 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
386 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
387 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
390 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
391 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
392 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
393 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
394 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
395 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
400 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
401 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
402 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
405 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
406 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
407 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
408 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
409 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
410 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
413 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
414 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
422 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
423 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
424 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
425 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
426 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
427 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
428 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
429 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
430 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
431 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
432 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
433 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
434 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
435 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
437 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
438 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
439 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
440 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
441 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
442 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
443 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
446 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
447 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
448 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
449 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
450 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
451 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
452 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
453 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
454 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
455 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
456 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
457 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
458 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
459 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
460 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
461 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
462 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
463 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
464 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
465 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
466 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
467 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
468 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
469 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
470 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
471 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
472 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
473 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
474 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
475 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
476 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
477 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
478 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
479 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
480 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
481 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
482 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
483 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
484 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
485 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
486 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
487 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
488 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
489 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
490 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
491 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
492 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
493 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
494 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
495 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
496 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
497 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.75
Metatranscriptomes 0.13
Isolates 21.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 16.18
Rhizoplane 2.15
Rhizosphere 60.94
Stem 0
Stem Tuber 0
Unclassified 12.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000255 3300001904 Bacteria 9757
2 JGI24736J21556_1001954 3300001904 Bacteria 3663
3 JGI24741J21665_1000319 3300001915 Bacteria 14359
4 JGI24740J21852_10002383 3300001979 Bacteria 8550
5 JGI24739J22299_10000140 3300001989 Bacteria 22993
6 JGI24739J22299_10015400 3300001989 Bacteria 2777
7 JGI24735J21928_10000421 3300002067 Bacteria 14823
8 JGI24738J21930_10000172 3300002075 Bacteria 16532
9 JGI24738J21930_10004142 3300002075 Bacteria 3574
10 JGI25406J46586_10000009 3300003203 Bacteria 109818
11 JGI25406J46586_10001070 3300003203 Bacteria 12840
12 JGI25153J46596_10022574 3300003215 Bacteria 2315
13 JGI25404J52841_10001198 3300003659 Bacteria 4450
14 Ga0055531_10005473 3300003794 Bacteria 7432
15 Ga0065165_1001210 3300005262 Bacteria 29773
16 Ga0070658_10000139 3300005327 Bacteria 63781
17 Ga0070683_100008185 3300005329 Bacteria 8883
18 Ga0070683_100011699 3300005329 Bacteria 7598
19 Ga0070680_100121442 3300005336 Bacteria 2181
20 Ga0070682_100057594 3300005337 Bacteria 2449
21 Ga0068868_100031113 3300005338 Bacteria 4096
22 Ga0070660_100057258 3300005339 Bacteria 3018
23 Ga0070660_100129899 3300005339 Bacteria 2015
24 Ga0070661_100000694 3300005344 Bacteria 24691
25 Ga0070661_100052486 3300005344 Bacteria 2984
26 Ga0070661_100099425 3300005344 Bacteria 2162
27 Ga0070661_100117353 3300005344 Bacteria 1991
28 Ga0070668_100000588 3300005347 Bacteria 24372
29 Ga0070668_100001432 3300005347 Bacteria 17218
30 Ga0070668_100003177 3300005347 Bacteria 12112
31 Ga0070668_100047689 3300005347 Bacteria 3294
32 Ga0070669_100023897 3300005353 Bacteria 4379
33 Ga0070688_100049792 3300005365 Bacteria 2608
34 Ga0070667_100000336 3300005367 Bacteria 52390
35 Ga0070667_100014374 3300005367 Bacteria 6541
36 Ga0070709_10000732 3300005434 Bacteria 18548
37 Ga0070709_10005089 3300005434 Bacteria 7105
38 Ga0070709_10055666 3300005434 Bacteria 2498
39 Ga0070714_100013699 3300005435 Bacteria 6502
40 Ga0070714_100039232 3300005435 Bacteria 3986
41 Ga0070713_100000001 3300005436 Bacteria 257984
42 Ga0070713_100007516 3300005436 Bacteria 7657
43 Ga0070710_10000211 3300005437 Bacteria 27400
44 Ga0070711_100001113 3300005439 Bacteria 14371
45 Ga0070708_100001185 3300005445 Bacteria 20037
46 Ga0070663_100005865 3300005455 Bacteria 7342
47 Ga0070662_100061223 3300005457 Bacteria 2747
48 Ga0070681_10013363 3300005458 Bacteria 8159
49 Ga0068867_100092449 3300005459 Bacteria 2297
50 Ga0070707_100038205 3300005468 Bacteria 4584
51 Ga0070699_100095278 3300005518 Bacteria 2606
52 Ga0070679_100028402 3300005530 Bacteria 5515
53 Ga0070684_100054727 3300005535 Bacteria 3477
54 Ga0068853_100004334 3300005539 Bacteria 10976
55 Ga0068853_100015425 3300005539 Bacteria 6277
56 Ga0068853_100137791 3300005539 Bacteria 2189
57 Ga0070693_100019429 3300005547 Bacteria 3562
58 Ga0070693_100054567 3300005547 Bacteria 2299
59 Ga0070665_100000078 3300005548 Bacteria 188101
60 Ga0070665_100000300 3300005548 Bacteria 77545
61 Ga0070665_100027867 3300005548 Bacteria 5689
62 Ga0070665_100035980 3300005548 Bacteria 4981
63 Ga0068855_100000378 3300005563 Bacteria 55131
64 Ga0068855_100012487 3300005563 Bacteria 10252
65 Ga0068855_100013741 3300005563 Bacteria 9760
66 Ga0068855_100029724 3300005563 Bacteria 6534
67 Ga0068855_100041051 3300005563 Bacteria 5486
68 Ga0068855_100086805 3300005563 Bacteria 3618
69 Ga0068855_100156827 3300005563 Bacteria 2586
70 Ga0070664_100024756 3300005564 Bacteria 4970
71 Ga0070664_100040931 3300005564 Bacteria 3909
72 Ga0068857_100016293 3300005577 Bacteria 6511
73 Ga0068857_100018032 3300005577 Bacteria 6192
74 Ga0068857_100018795 3300005577 Bacteria 6064
75 Ga0068857_100031281 3300005577 Bacteria 4702
76 Ga0068857_100116211 3300005577 Bacteria 2407
77 Ga0068854_100000426 3300005578 Bacteria 26255
78 Ga0068856_100001641 3300005614 Bacteria 23439
79 Ga0068856_100002749 3300005614 Bacteria 18013
80 Ga0068856_100051247 3300005614 Bacteria 4070
81 Ga0068856_100073128 3300005614 Bacteria 3395
82 Ga0068856_100078242 3300005614 Bacteria 3279
83 Ga0068856_100139218 3300005614 Bacteria 2434
84 Ga0068856_100191346 3300005614 Bacteria 2060
85 Ga0068852_100000175 3300005616 Bacteria 43326
86 Ga0068852_100002923 3300005616 Bacteria 11867
87 Ga0068852_100016987 3300005616 Bacteria 5696
88 Ga0068852_100046890 3300005616 Bacteria 3684
89 Ga0068859_100025710 3300005617 Bacteria 5904
90 Ga0068864_100016804 3300005618 Bacteria 6099
91 Ga0068861_100009916 3300005719 Bacteria 6594
92 Ga0068861_100102745 3300005719 Bacteria 2276
93 Ga0068851_10005892 3300005834 Bacteria 5579
94 Ga0068863_100007964 3300005841 Bacteria 10357
95 Ga0068863_100067148 3300005841 Bacteria 3392
96 Ga0068860_100000226 3300005843 Bacteria 87552
97 Ga0068860_100000257 3300005843 Bacteria 78468
98 Ga0068860_100111973 3300005843 Bacteria 2610
99 Ga0068862_100002606 3300005844 Bacteria 15879
100 Ga0068862_100023319 3300005844 Bacteria 5184
101 Ga0068862_100054667 3300005844 Bacteria 3418
102 Ga0081455_10002868 3300005937 Bacteria 20303
103 Ga0081455_10010356 3300005937 Bacteria 9474
104 Ga0081455_10015530 3300005937 Bacteria 7393
105 Ga0081455_10015618 3300005937 Bacteria 7367
106 Ga0081455_10018973 3300005937 Bacteria 6521
107 Ga0081540_1002606 3300005983 Bacteria 14657
108 Ga0081540_1002760 3300005983 Bacteria 14251
109 Ga0081540_1006050 3300005983 Bacteria 8898
110 Ga0081540_1017407 3300005983 Bacteria 4451
111 Ga0081539_10000048 3300005985 Bacteria 272906
112 Ga0081539_10000530 3300005985 Bacteria 79454
113 Ga0081539_10001781 3300005985 Bacteria 34193
114 Ga0075365_10002405 3300006038 Bacteria 9164
115 Ga0075365_10009745 3300006038 Bacteria 5548
116 Ga0075365_10027068 3300006038 Bacteria 3644
117 Ga0075365_10046749 3300006038 Bacteria 2843
118 Ga0075368_10002838 3300006042 Bacteria 5719
119 Ga0075363_100018680 3300006048 Bacteria 3458
120 Ga0075363_100036631 3300006048 Bacteria 2574
121 Ga0075364_10018801 3300006051 Bacteria 4332
122 Ga0075364_10049260 3300006051 Bacteria 2747
123 Ga0075364_10069979 3300006051 Bacteria 2309
124 Ga0070712_100000198 3300006175 Bacteria 33726
125 Ga0070712_100000499 3300006175 Bacteria 22474
126 Ga0070712_100001393 3300006175 Bacteria 14686
127 Ga0070712_100131881 3300006175 Bacteria 1895
128 Ga0075367_10005576 3300006178 Bacteria 6268
129 Ga0075367_10007186 3300006178 Bacteria 5685
130 Ga0075367_10008487 3300006178 Bacteria 5324
131 Ga0075367_10012265 3300006178 Bacteria 4563
132 Ga0075367_10112318 3300006178 Bacteria 1673
133 Ga0075369_10008692 3300006186 Bacteria 3919
134 Ga0075366_10041363 3300006195 Bacteria 2729
135 Ga0075370_10017249 3300006353 Bacteria 3899
136 Ga0075428_100056275 3300006844 Bacteria 4308
137 Ga0075434_100055004 3300006871 Bacteria 3955
138 Ga0075436_100012867 3300006914 Bacteria 5736
139 Ga0075436_100025717 3300006914 Bacteria 4051
140 Ga0075436_100081699 3300006914 Bacteria 2241
141 Ga0097620_100025710 3300006931 Bacteria 5904
142 Ga0099824_1015031 3300006942 Bacteria 7483
143 Ga0099822_1015114 3300006943 Bacteria 8734
144 Ga0099823_1022970 3300006944 Bacteria 5741
145 Ga0105240_10004409 3300009093 Bacteria 21468
146 Ga0105240_10006449 3300009093 Bacteria 17248
147 Ga0105240_10009432 3300009093 Bacteria 13814
148 Ga0105240_10011824 3300009093 Bacteria 12121
149 Ga0105240_10263964 3300009093 Bacteria 1985
150 Ga0111539_10021057 3300009094 Bacteria 8030
151 Ga0114129_10161538 3300009147 Bacteria 3060
152 Ga0114129_10170059 3300009147 Bacteria 2972
153 Ga0105241_10003385 3300009174 Bacteria 11876
154 Ga0105248_10067566 3300009177 Bacteria 4014
155 Ga0105248_10089062 3300009177 Bacteria 3474
156 Ga0105248_10101093 3300009177 Bacteria 3250
157 Ga0105237_10012543 3300009545 Bacteria 8927
158 Ga0105237_10020700 3300009545 Bacteria 6775
159 Ga0105238_10011332 3300009551 Bacteria 8971
160 Ga0105238_10024913 3300009551 Bacteria 6097
161 Ga0105238_10033741 3300009551 Bacteria 5208
162 Ga0105249_10119609 3300009553 Bacteria 2502
163 Ga0099796_10017188 3300010159 Bacteria 2149
164 Ga0105239_10004474 3300010375 Bacteria 16696
165 Ga0105239_10014534 3300010375 Bacteria 8734
166 Ga0105239_10036439 3300010375 Bacteria 5401
167 Ga0105239_10060804 3300010375 Bacteria 4146
168 Ga0157370_10003943 3300013104 Bacteria 17267
169 Ga0157370_10007832 3300013104 Bacteria 11577
170 Ga0157370_10010501 3300013104 Bacteria 9753
171 Ga0157370_10142767 3300013104 Bacteria 2231
172 Ga0157369_10016112 3300013105 Bacteria 8412
173 Ga0157369_10104037 3300013105 Bacteria 3024
174 Ga0157369_10132887 3300013105 Bacteria 2636
175 Ga0163162_10030837 3300013306 Bacteria 5313
176 Ga0157372_10098716 3300013307 Bacteria 3332
177 Ga0157379_10013671 3300014968 Bacteria 7114
178 Ga0213872_10016552 3300021361 Bacteria 3420
179 Ga0213872_10055869 3300021361 Bacteria 1789
180 Ga0213876_10000991 3300021384 Bacteria 18609
181 Ga0224712_10008506 3300022467 Bacteria 3047
182 Ga0209563_101775 3300025230 Bacteria 5420
183 Ga0209677_100351 3300025253 Bacteria 28656
184 Ga0209233_1001962 3300025261 Bacteria 7828
185 Ga0209233_1006063 3300025261 Bacteria 3935
186 Ga0209455_1002928 3300025272 Bacteria 6295
187 Ga0209455_1011707 3300025272 Bacteria 2145
188 Ga0209564_1003394 3300025295 Bacteria 10967
189 Ga0209758_1008915 3300025297 Bacteria 6365
190 Ga0209758_1016969 3300025297 Bacteria 3660
191 Ga0209758_1019265 3300025297 Bacteria 3298
192 Ga0207426_1000201 3300025302 Bacteria 143975
193 Ga0207426_1000617 3300025302 Bacteria 45527
194 Ga0207426_1014838 3300025302 Bacteria 2846
195 Ga0209257_1000440 3300025304 Bacteria 79182
196 Ga0207656_10008793 3300025321 Bacteria 3733
197 Ga0207692_10000494 3300025898 Bacteria 13955
198 Ga0207680_10001139 3300025903 Bacteria 12562
199 Ga0207647_10001008 3300025904 Bacteria 21880
200 Ga0207647_10036497 3300025904 Bacteria 3123
201 Ga0207699_10000096 3300025906 Bacteria 63442
202 Ga0207699_10004161 3300025906 Bacteria 6928
203 Ga0207699_10009117 3300025906 Bacteria 4927
204 Ga0207699_10055717 3300025906 Bacteria 2354
205 Ga0207645_10102983 3300025907 Bacteria 1843
206 Ga0207643_10050478 3300025908 Bacteria 2359
207 Ga0207705_10000009 3300025909 Bacteria 576128
208 Ga0207705_10062433 3300025909 Bacteria 2691
209 Ga0207684_10038515 3300025910 Bacteria 4056
210 Ga0207654_10001821 3300025911 Bacteria 11064
211 Ga0207707_10002611 3300025912 Bacteria 16136
212 Ga0207707_10005017 3300025912 Bacteria 11625
213 Ga0207707_10014215 3300025912 Bacteria 6934
214 Ga0207707_10016113 3300025912 Bacteria 6517
215 Ga0207695_10005145 3300025913 Bacteria 17515
216 Ga0207695_10017517 3300025913 Bacteria 8334
217 Ga0207695_10020475 3300025913 Bacteria 7574
218 Ga0207695_10046036 3300025913 Bacteria 4625
219 Ga0207695_10053694 3300025913 Bacteria 4212
220 Ga0207695_10070362 3300025913 Bacteria 3577
221 Ga0207695_10184871 3300025913 Bacteria 2004
222 Ga0207671_10002722 3300025914 Bacteria 18502
223 Ga0207671_10027264 3300025914 Bacteria 4271
224 Ga0207671_10078398 3300025914 Bacteria 2474
225 Ga0207671_10093117 3300025914 Bacteria 2273
226 Ga0207693_10000094 3300025915 Bacteria 79297
227 Ga0207693_10001776 3300025915 Bacteria 18911
228 Ga0207693_10007348 3300025915 Bacteria 9061
229 Ga0207663_10000356 3300025916 Bacteria 19925
230 Ga0207663_10108814 3300025916 Bacteria 1877
231 Ga0207660_10012408 3300025917 Bacteria 5575
232 Ga0207657_10004425 3300025919 Bacteria 14870
233 Ga0207657_10043683 3300025919 Bacteria 3945
234 Ga0207657_10117356 3300025919 Bacteria 2192
235 Ga0207649_10008646 3300025920 Bacteria 5560
236 Ga0207652_10022596 3300025921 Bacteria 5205
237 Ga0207652_10023805 3300025921 Bacteria 5077
238 Ga0207652_10024973 3300025921 Bacteria 4963
239 Ga0207652_10042328 3300025921 Bacteria 3876
240 Ga0207652_10077235 3300025921 Bacteria 2906
241 Ga0207646_10023005 3300025922 Bacteria 5730
242 Ga0207694_10006266 3300025924 Bacteria 9085
243 Ga0207694_10018576 3300025924 Bacteria 5255
244 Ga0207694_10033146 3300025924 Bacteria 3957
245 Ga0207694_10070539 3300025924 Bacteria 2730
246 Ga0207694_10121213 3300025924 Bacteria 2088
247 Ga0207700_10000015 3300025928 Bacteria 224772
248 Ga0207664_10001702 3300025929 Bacteria 14493
249 Ga0207664_10006879 3300025929 Bacteria 7862
250 Ga0207664_10014340 3300025929 Bacteria 5720
251 Ga0207664_10025212 3300025929 Bacteria 4476
252 Ga0207644_10034127 3300025931 Bacteria 3560
253 Ga0207706_10005065 3300025933 Bacteria 12303
254 Ga0207706_10026306 3300025933 Bacteria 5208
255 Ga0207706_10061276 3300025933 Bacteria 3313
256 Ga0207706_10069306 3300025933 Bacteria 3102
257 Ga0207665_10001832 3300025939 Bacteria 14302
258 Ga0207711_10060400 3300025941 Bacteria 3267
259 Ga0207661_10000678 3300025944 Bacteria 22066
260 Ga0207667_10000328 3300025949 Bacteria 65878
261 Ga0207667_10030736 3300025949 Bacteria 5805
262 Ga0207667_10043643 3300025949 Bacteria 4757
263 Ga0207712_10073265 3300025961 Bacteria 2469
264 Ga0207668_10000206 3300025972 Bacteria 40036
265 Ga0207668_10001729 3300025972 Bacteria 12793
266 Ga0207668_10010032 3300025972 Bacteria 5702
267 Ga0207640_10000287 3300025981 Bacteria 33848
268 Ga0207640_10046274 3300025981 Bacteria 2799
269 Ga0207658_10000493 3300025986 Bacteria 36279
270 Ga0207658_10002058 3300025986 Bacteria 14977
271 Ga0207658_10034048 3300025986 Bacteria 3637
272 Ga0207639_10000716 3300026041 Bacteria 22737
273 Ga0207639_10001766 3300026041 Bacteria 14546
274 Ga0207639_10010687 3300026041 Bacteria 6357
275 Ga0207639_10064344 3300026041 Bacteria 2843
276 Ga0207639_10084776 3300026041 Bacteria 2518
277 Ga0207678_10004673 3300026067 Bacteria 12297
278 Ga0207678_10005720 3300026067 Bacteria 11096
279 Ga0207708_10073069 3300026075 Bacteria 2628
280 Ga0207702_10000011 3300026078 Bacteria 284514
281 Ga0207702_10000056 3300026078 Bacteria 131186
282 Ga0207702_10000465 3300026078 Bacteria 45960
283 Ga0207702_10003834 3300026078 Bacteria 13567
284 Ga0207702_10004629 3300026078 Bacteria 12185
285 Ga0207702_10027318 3300026078 Bacteria 4739
286 Ga0207641_10010473 3300026088 Bacteria 7614
287 Ga0207676_10047316 3300026095 Bacteria 3333
288 Ga0207674_10000002 3300026116 Bacteria 279738
289 Ga0207674_10011854 3300026116 Bacteria 9773
290 Ga0207674_10018427 3300026116 Bacteria 7587
291 Ga0207674_10041082 3300026116 Bacteria 4785
292 Ga0207674_10044321 3300026116 Bacteria 4581
293 Ga0207674_10053198 3300026116 Bacteria 4128
294 Ga0207675_100019629 3300026118 Bacteria 6309
295 Ga0207683_10005111 3300026121 Bacteria 11262
296 Ga0207698_10000200 3300026142 Bacteria 37521
297 Ga0207698_10013801 3300026142 Bacteria 5346
298 Ga0207698_10060721 3300026142 Bacteria 2941
299 Ga0207698_10094597 3300026142 Bacteria 2457
300 Ga0209389_1000029 3300027296 Bacteria 140337
301 Ga0209389_1000076 3300027296 Bacteria 92447
302 Ga0209589_1000012 3300027357 Bacteria 229451
303 Ga0209589_1000013 3300027357 Bacteria 229273
304 Ga0209589_1000017 3300027357 Bacteria 215546
305 Ga0209489_100013 3300027361 Bacteria 229831
306 Ga0209489_100018 3300027361 Bacteria 215546
307 Ga0209489_100416 3300027361 Bacteria 77981
308 Ga0209700_100014 3300027363 Bacteria 299349
309 Ga0209700_100028 3300027363 Bacteria 215546
310 Ga0268266_10001512 3300028379 Bacteria 27338
311 Ga0268266_10002705 3300028379 Bacteria 18600
312 Ga0268266_10007460 3300028379 Bacteria 9865
313 Ga0268266_10007480 3300028379 Bacteria 9845
314 Ga0268266_10016799 3300028379 Bacteria 6256
315 Ga0268266_10067389 3300028379 Bacteria 3098
316 Ga0268265_10001536 3300028380 Bacteria 19196
317 Ga0268265_10006531 3300028380 Bacteria 7901
318 Ga0268265_10023588 3300028380 Bacteria 4339
319 Ga0268265_10040483 3300028380 Bacteria 3442
320 Ga0268264_10000049 3300028381 Bacteria 329992
321 Ga0268264_10000110 3300028381 Bacteria 206663
322 Ga0268264_10092696 3300028381 Bacteria 2608
323 Ga0265337_1006176 3300028556 Bacteria 4655
324 Ga0265326_10002792 3300028558 Bacteria 5848
325 Ga0265319_1009715 3300028563 Bacteria 4070
326 Ga0265334_10000250 3300028573 Bacteria 30819
327 Ga0265334_10003782 3300028573 Bacteria 6840
328 Ga0265334_10025471 3300028573 Bacteria 2394
329 Ga0265323_10007852 3300028653 Bacteria 4414
330 Ga0265336_10000430 3300028666 Bacteria 25854
331 Ga0265338_10000024 3300028800 Bacteria 297778
332 Ga0265324_10017100 3300029957 Bacteria 2638
333 Ga0307511_10028194 3300030521 Bacteria 5106
334 Ga0265330_10007390 3300031235 Bacteria 5360
335 Ga0265320_10000594 3300031240 Bacteria 27815
336 Ga0265325_10001297 3300031241 Bacteria 17699
337 Ga0265325_10002005 3300031241 Bacteria 13988
338 Ga0265340_10002628 3300031247 Bacteria 10217
339 Ga0265339_10001140 3300031249 Bacteria 20068
340 Ga0265327_10022936 3300031251 Bacteria 3713
341 Ga0307509_10000606 3300031507 Bacteria 61010
342 Ga0307509_10048794 3300031507 Bacteria 4544
343 Ga0307509_10096831 3300031507 Bacteria 3001
344 Ga0307408_100001451 3300031548 Bacteria 17634
345 Ga0307408_100086651 3300031548 Bacteria 2354
346 Ga0265313_10001099 3300031595 Bacteria 25965
347 Ga0265314_10000900 3300031711 Bacteria 35261
348 Ga0265342_10027107 3300031712 Bacteria 3586
349 Ga0265342_10035094 3300031712 Bacteria 3072
350 Ga0316576_10047899 3300031727 Bacteria 3098
351 Ga0307516_10000019 3300031730 Bacteria 196679
352 Ga0307516_10000022 3300031730 Bacteria 191854
353 Ga0307516_10015603 3300031730 Bacteria 7985
354 Ga0307516_10051214 3300031730 Bacteria 4048
355 Ga0307405_10020376 3300031731 Bacteria 3704
356 Ga0307405_10046204 3300031731 Bacteria 2673
357 Ga0307410_10012623 3300031852 Bacteria 4893
358 Ga0307416_100101138 3300032002 Bacteria 2509
359 Ga0307414_10000290 3300032004 Bacteria 29508
360 Ga0307507_10020473 3300033179 Bacteria 7405
361 Ga0307510_10018815 3300033180 Bacteria 8110
362 Ga0307510_10071464 3300033180 Bacteria 3455
363 Ga0315911_1000033 3300033442 Bacteria 67159
364 Ga0373926_0024371 3300035083 Bacteria 2107
365 Ga0373923_0002084 3300035111 Bacteria 6054
366 Ga0373945_0009195 3300035116 Bacteria 3234
367 Ga0373954_0002205 3300035118 Bacteria 8088
368 Ga0373954_0059527 3300035118 Bacteria 1800
369 Ga0373956_0002935 3300035119 Bacteria 6901
370 Ga0373956_0016925 3300035119 Bacteria 3066
371 Ga0373957_0019136 3300035120 Bacteria 2405
372 Ga0373955_0001794 3300035172 Bacteria 9223
373 Ga0373955_0067773 3300035172 Bacteria 1987
374 Ga0373924_0024589 3300035410 Bacteria 2374
375 Ga0373935_0000229 3300035692 Bacteria 27393
376 Ga0373935_0003845 3300035692 Bacteria 8759
377 Ga0373927_0000071 3300035695 Bacteria 73794
378 Ga0373927_0057240 3300035695 Bacteria 2521
379 Ga0373933_0000114 3300035724 Bacteria 52016
380 Ga0373933_0001425 3300035724 Bacteria 14028
381 Ga0373933_0020486 3300035724 Bacteria 3749
382 Ga0373947_0001708 3300035725 Bacteria 13470
383 Ga0373947_0006904 3300035725 Bacteria 6582
384 Ga0373947_0019069 3300035725 Bacteria 3953
385 Ga0373947_0056547 3300035725 Bacteria 2371
386 Ga0373937_0012158 3300036401 Bacteria 7557
387 Ga0373937_0026032 3300036401 Bacteria 5285
388 Ga0373937_0035451 3300036401 Bacteria 4541
389 Ga0373937_0046477 3300036401 Bacteria 3970
390 Ga0373937_0088287 3300036401 Bacteria 2870
391 Ga0373925_0010883 3300037068 Bacteria 6599
392 Ga0373925_0065052 3300037068 Bacteria 2746
393 Ga0373925_0070478 3300037068 Bacteria 2643
394 Ga0395899_0018305 3300037312 Bacteria 5326
395 Ga0395900_0003234 3300037418 Bacteria 17637
396 Ga0395900_0005520 3300037418 Bacteria 13242
397 Ga0395900_0010634 3300037418 Bacteria 9410
398 Ga0395900_0046530 3300037418 Bacteria 4468
399 Ga0395900_0065380 3300037418 Bacteria 3736
400 Ga0395898_0003112 3300037466 Bacteria 18739
401 Ga0395898_0006599 3300037466 Bacteria 12370
402 Ga0395905_0016353 3300037471 Bacteria 7049
403 Ga0395901_0010773 3300038443 Bacteria 9269
404 Ga0395901_0012472 3300038443 Bacteria 8624
405 Ga0395901_0033187 3300038443 Bacteria 5327
406 Ga0436365_0650112 3300039437 Bacteria 58550
407 Ga0436365_0675289 3300039437 Bacteria 5759
408 Ga0436365_0814378 3300039437 Bacteria 9894
409 Ga0436365_1132543 3300039437 Bacteria 4959
410 Ga0436365_1157676 3300039437 Bacteria 6249
411 Ga0436365_1417024 3300039437 Bacteria 4984
412 Ga0436365_1771573 3300039437 Bacteria 5105
413 Ga0436360_0130148 3300039438 Bacteria 2301
414 Ga0436361_0413058 3300039447 Bacteria 6307
415 Ga0436361_0842658 3300039447 Bacteria 7066
416 Ga0436362_0631557 3300039453 Bacteria 6192
417 Ga0439432_027879 3300042006 Bacteria 1842
418 Ga0466969_0015098 3300044656 Bacteria 4051
419 Ga0466972_0000103 3300044658 Bacteria 75095
420 Ga0466961_0000129 3300044693 Bacteria 50353
421 Ga0466963_0064444 3300044694 Bacteria 2455
422 Ga0466957_0065165 3300044842 Bacteria 2243
423 Ga0466959_0005547 3300045049 Bacteria 8659
424 Ga0495592_0010990 3300046454 Bacteria 6831
425 Ga0495592_0019851 3300046454 Bacteria 5110
426 Ga0495603_0000035 3300046455 Bacteria 57510
427 Ga0495603_0004736 3300046455 Bacteria 8123
428 Ga0495603_0006447 3300046455 Bacteria 7026
429 Ga0495629_0000081 3300046459 Bacteria 85305
430 Ga0495629_0001069 3300046459 Bacteria 21887
431 Ga0495629_0030711 3300046459 Bacteria 3807
432 Ga0495638_0002281 3300046460 Bacteria 15850
433 Ga0495641_0003571 3300046461 Bacteria 11545
434 Ga0495651_0038836 3300046462 Bacteria 3706
435 Ga0495653_0001526 3300046463 Bacteria 18106
436 Ga0495580_0072374 3300046472 Bacteria 2407
437 Ga0495582_0000235 3300046473 Bacteria 30725
438 Ga0495639_0000010 3300046475 Bacteria 93685
439 Ga0495662_0000034 3300046476 Bacteria 46636
440 Ga0495664_0001969 3300046477 Bacteria 10934
441 Ga0495664_0003381 3300046477 Bacteria 8667
442 Ga0495664_0011375 3300046477 Bacteria 5016
443 Ga0495664_0049053 3300046477 Bacteria 2506
444 Ga0495594_0004984 3300046499 Bacteria 6833
445 Ga0495606_0000265 3300046507 Bacteria 92526
446 Ga0495608_0016408 3300046511 Bacteria 5124
447 Ga0495608_0063039 3300046511 Bacteria 2434
448 Ga0495628_0027454 3300046516 Bacteria 4632
449 Ga0495648_0009380 3300046524 Bacteria 7594
450 Ga0495652_0009826 3300046529 Bacteria 8673
451 Ga0495652_0024834 3300046529 Bacteria 5303
452 Ga0495665_0000005 3300046531 Bacteria 86491
453 Ga0495640_0010386 3300046533 Bacteria 7202
454 Ga0495640_0037694 3300046533 Bacteria 3408
455 Ga0495587_0046397 3300046536 Bacteria 2579
456 Ga0495645_0011016 3300046543 Bacteria 6354
457 Ga0495645_0022979 3300046543 Bacteria 4513
458 Ga0495622_0034865 3300046557 Bacteria 2347
459 Ga0495667_0058742 3300046559 Bacteria 2525
460 Ga0495634_0000261 3300046642 Bacteria 49735
461 Ga0495634_0006809 3300046642 Bacteria 8649
462 Ga0495625_0022319 3300046660 Bacteria 4855
463 Ga0495635_0000963 3300046663 Bacteria 19001
464 Ga0495635_0005971 3300046663 Bacteria 8496
465 Ga0495588_0013281 3300046674 Bacteria 3921
466 Ga0495657_0009210 3300046675 Bacteria 7492
467 Ga0495599_0053766 3300046678 Bacteria 2522
468 Ga0495623_0006918 3300046679 Bacteria 7372
469 Ga0495623_0007565 3300046679 Bacteria 7049
470 Ga0495646_0004493 3300046680 Bacteria 8787
471 Ga0495646_0009132 3300046680 Bacteria 6289
472 Ga0495647_0000500 3300046681 Bacteria 11389
473 Ga0495658_0041467 3300046683 Bacteria 2564
474 Ga0495669_0028465 3300046684 Bacteria 2448
475 Ga0495613_0008391 3300046689 Bacteria 7672
476 Ga0495624_0001342 3300046690 Bacteria 19226
477 Ga0495624_0042704 3300046690 Bacteria 2897
478 Ga0495624_0091395 3300046690 Bacteria 1878
479 Ga0495600_0004451 3300046809 Bacteria 8384
480 Ga0495600_0055991 3300046809 Bacteria 2575
481 Ga0495581_0000018 3300047315 Bacteria 58791
482 Ga0495581_0036620 3300047315 Bacteria 2839
483 Ga0495604_0002997 3300047317 Bacteria 13512
484 Ga0495604_0080115 3300047317 Bacteria 2447
485 Ga0495674_0000134 3300047319 Bacteria 56618
486 Ga0495674_0012971 3300047319 Bacteria 7845
487 Ga0495674_0041857 3300047319 Bacteria 4089
488 Ga0495672_0062529 3300047320 Bacteria 2141
489 Ga0495672_0074204 3300047320 Bacteria 1916
490 Ga0495676_0032360 3300047321 Bacteria 4415
491 Ga0495680_0010209 3300047322 Bacteria 8384
492 Ga0495675_0049780 3300047444 Bacteria 2662
493 Ga0495675_0094325 3300047444 Bacteria 1877
494 Ga0495673_0005038 3300047469 Bacteria 8092
495 Ga0495684_0004918 3300047471 Bacteria 10430
496 Ga0495593_0000072 3300047673 Bacteria 43039
497 Ga0495593_0000214 3300047673 Bacteria 30567
498 Ga0495593_0021124 3300047673 Bacteria 3639
499 Ga0495593_0073114 3300047673 Bacteria 1779
500 Ga0495602_0017685 3300048088 Bacteria 7139
501 Ga0495602_0073491 3300048088 Bacteria 2910
502 Ga0495614_0014011 3300048089 Bacteria 3516
503 Ga0496100_0047806 3300048903 Bacteria 2759
504 Ga0496102_0067320 3300048905 Bacteria 3285
505 Ga0496102_0093512 3300048905 Bacteria 2785
506 Ga0496104_0010370 3300048907 Bacteria 8323
507 Ga0496104_0061130 3300048907 Bacteria 3570
508 Ga0496104_0101667 3300048907 Bacteria 2752
509 Ga0496106_0001870 3300048909 Bacteria 15762
510 Ga0496106_0024272 3300048909 Bacteria 4506
511 Ga0496108_0037528 3300048911 Bacteria 4036
512 Ga0496108_0104266 3300048911 Bacteria 2420
513 Ga0496110_0032951 3300048913 Bacteria 4479
514 Ga0496112_0000019 3300048915 Bacteria 185531
515 Ga0496114_0003712 3300048917 Bacteria 11753
516 Ga0496114_0003910 3300048917 Bacteria 11491
517 Ga0496115_0001711 3300048918 Bacteria 15732
518 Ga0496115_0026064 3300048918 Bacteria 4559
519 Ga0496117_0004399 3300048920 Bacteria 15594
520 Ga0496118_0005557 3300048921 Bacteria 14287
521 Ga0496119_0000091 3300048922 Bacteria 133090
522 Ga0496119_0010439 3300048922 Bacteria 7816
523 Ga0496119_0017281 3300048922 Bacteria 5433
524 Ga0496120_0003831 3300048923 Bacteria 13223
525 Ga0496120_0023981 3300048923 Bacteria 3811
526 Ga0496121_0000091 3300048924 Bacteria 216685
527 Ga0496121_0000716 3300048924 Bacteria 61451
528 Ga0496121_0018322 3300048924 Bacteria 7067
529 Ga0496124_0001529 3300048927 Bacteria 33656
530 Ga0496125_0042313 3300048928 Bacteria 3882
531 Ga0496125_0064515 3300048928 Bacteria 2910
532 Ga0496125_0065592 3300048928 Bacteria 2875
533 Ga0496125_0069831 3300048928 Bacteria 2753
534 Ga0496126_0000782 3300048929 Bacteria 57324
535 Ga0496126_0006097 3300048929 Bacteria 13518
536 Ga0496126_0010543 3300048929 Bacteria 9675
537 Ga0496126_0016855 3300048929 Bacteria 7293
538 Ga0496126_0028105 3300048929 Bacteria 5363
539 Ga0496126_0043595 3300048929 Bacteria 4137
540 Ga0496126_0046200 3300048929 Bacteria 3996
541 Ga0496126_0047952 3300048929 Bacteria 3908
542 Ga0501033_0087905 3300049570 Bacteria 2274
543 Ga0501034_0001464 3300049571 Bacteria 31260
544 Ga0501034_0030391 3300049571 Bacteria 5491
545 Ga0501036_0056784 3300049572 Bacteria 3317
546 Ga0501036_0152539 3300049572 Bacteria 1949
547 Ga0501043_0035129 3300049579 Bacteria 3943
548 Ga0501047_0001429 3300049581 Bacteria 23465
549 Ga0501047_0001651 3300049581 Bacteria 21724
550 Ga0501047_0037701 3300049581 Bacteria 4675
551 Ga0501048_0084968 3300049582 Bacteria 2232
552 Ga0501067_0008884 3300049583 Bacteria 5566
553 Ga0501067_0017156 3300049583 Bacteria 4002
554 Ga0501068_0000679 3300049584 Bacteria 17414
555 Ga0501068_0001428 3300049584 Bacteria 12676
556 Ga0501070_0010935 3300049586 Bacteria 7664
557 Ga0501072_0000021 3300049588 Bacteria 152489
558 Ga0501073_0009160 3300049589 Bacteria 7302
559 Ga0501074_0004795 3300049590 Bacteria 9697
560 Ga0501223_000074 3300049663 Bacteria 30267
561 Ga0501224_000017 3300049664 Bacteria 81060
562 Ga0501233_000110 3300049668 Bacteria 11068
563 Ga0501235_000012 3300049669 Bacteria 34235
564 Ga0501257_005430 3300049686 Bacteria 2810
565 Ga0501225_0000007 3300049705 Bacteria 107771
566 Ga0501234_000212 3300049707 Bacteria 8345
567 Ga0501083_0060386 3300049744 Bacteria 2532
568 Ga0501044_0010517 3300049823 Bacteria 10042
569 Ga0501044_0019290 3300049823 Bacteria 7296
570 Ga0501044_0041197 3300049823 Bacteria 4808
571 Ga0501044_0081101 3300049823 Bacteria 3285
572 Ga0501044_0277106 3300049823 Bacteria 1612
573 Ga0501226_000040 3300049853 Bacteria 60590
574 nmdc:mga03683_18071_c1 3300050489 Bacteria 2676
575 nmdc:mga03n38_12398_c1 3300050490 Bacteria 3207
576 nmdc:mga03n38_2102_c1 3300050490 Bacteria 6040
577 nmdc:mga00v17_805_c1 3300050491 Bacteria 17081
578 nmdc:mga00v17_9491_c1 3300050491 Bacteria 5269
579 nmdc:mga0yw44_35166_c1 3300050492 Bacteria 2942
580 nmdc:mga0yw44_36418_c1 3300050492 Bacteria 2899
581 nmdc:mga0k408_58214_c1 3300050493 Bacteria 2244
582 nmdc:mga06z11_2594_c1 3300050494 Bacteria 6922
583 nmdc:mga06z11_32378_c1 3300050494 Bacteria 2549
584 nmdc:mga06z11_8832_c1 3300050494 Bacteria 4221
585 nmdc:mga07m45_10790_c1 3300050496 Bacteria 4784
586 nmdc:mga08y16_30177_c1 3300050511 Bacteria 5707
587 nmdc:mga0n895_17840_c1 3300050512 Bacteria 6553
588 nmdc:mga08x19_23544_c1 3300050514 Bacteria 3821
589 nmdc:mga08x19_31771_c2 3300050514 Bacteria 2299
590 nmdc:mga08x19_41_c1 3300050514 Bacteria 151756
591 nmdc:mga0sz30_13616_c1 3300050516 Bacteria 3188
592 Ga0495601_0044676 3300053077 Bacteria 2785
593 Ga0500635_0014926 3300053080 Bacteria 2285
594 Ga0495595_0000449 3300053084 Bacteria 15558
595 Ga0495619_0001763 3300053085 Bacteria 14401
596 Ga0500643_005623 3300053087 Bacteria 5366
597 Ga0500566_0000065 3300053094 Bacteria 50325
598 Ga0500566_0017390 3300053094 Bacteria 4226
599 Ga0500572_001831 3300053111 Bacteria 5410
600 Ga0500572_004048 3300053111 Bacteria 3334
601 Ga0500595_002516 3300053119 Bacteria 9048
602 Ga0500595_007200 3300053119 Bacteria 4635
603 Ga0500642_0012341 3300053130 Bacteria 3094
604 Ga0500559_0001232 3300053136 Bacteria 15083
605 Ga0500559_0012818 3300053136 Bacteria 3557
606 Ga0500568_0004447 3300053139 Bacteria 7487
607 Ga0500568_0014217 3300053139 Bacteria 3601
608 Ga0500603_000165 3300053150 Bacteria 16608
609 Ga0500616_0000385 3300053153 Bacteria 61815
610 Ga0500638_000128 3300053162 Bacteria 14722
611 Ga0500637_0000334 3300053178 Bacteria 17776
612 Ga0500637_0018015 3300053178 Bacteria 3789
613 Ga0500599_001487 3300053736 Bacteria 2702
614 Ga0500601_000231 3300053737 Bacteria 11058
615 Ga0501084_0001764 3300054114 Bacteria 17205
616 Ga0501084_0077355 3300054114 Bacteria 2789
617 Ga0500661_002743 3300055283 Bacteria 3322
618 Ga0501082_0000370 3300060353 Bacteria 39717
619 Ga0501082_0031737 3300060353 Bacteria 4556
620 Ga0530510_0014036 3300061734 Bacteria 5647

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0001969 Ga0495664_0001969_160_1584 457
2 3300006178 Ga0075367_10007186 Ga0075367_100071864 466
3 3300035118 Ga0373954_0059527 Ga0373954_0059527_325_1773 466
4 3300054114 Ga0501084_0077355 Ga0501084_0077355_1302_2759 471
5 3300031548 Ga0307408_100086651 Ga0307408_1000866512 474
6 iso_pu_bacteria 8019565922 8019573102 478
7 3300049823 Ga0501044_0277106 Ga0501044_0277106_15_1505 483
8 iso_pu_bacteria 8016548790 8016557204 486
9 3300006178 Ga0075367_10112318 Ga0075367_101123181 514
10 3300026142 Ga0207698_10013801 Ga0207698_100138012 517
11 3300025914 Ga0207671_10078398 Ga0207671_100783983 527
12 3300005937 Ga0081455_10002868 Ga0081455_1000286820 529
13 3300031251 Ga0265327_10022936 Ga0265327_100229363 535
14 3300028573 Ga0265334_10000250 Ga0265334_1000025021 541
15 3300009551 Ga0105238_10024913 Ga0105238_100249133 542
16 3300009093 Ga0105240_10263964 Ga0105240_102639642 543
17 3300005563 Ga0068855_100156827 Ga0068855_1001568273 544
18 3300049686 Ga0501257_005430 Ga0501257_005430_203_1912 545
19 3300005329 Ga0070683_100008185 Ga0070683_1000081857 546
20 3300005614 Ga0068856_100002749 Ga0068856_1000027492 546
21 3300025921 Ga0207652_10077235 Ga0207652_100772352 546
22 3300026078 Ga0207702_10000056 Ga0207702_1000005621 546
23 3300025921 Ga0207652_10022596 Ga0207652_100225962 548
24 3300045049 Ga0466959_0005547 Ga0466959_0005547_2551_4293 548
25 3300047320 Ga0495672_0074204 Ga0495672_0074204_132_1874 549
26 3300048905 Ga0496102_0067320 Ga0496102_0067320_313_2055 549
27 3300005468 Ga0070707_100038205 Ga0070707_1000382052 550
28 3300009147 Ga0114129_10170059 Ga0114129_101700593 550
29 3300025922 Ga0207646_10023005 Ga0207646_100230057 550
30 3300005937 Ga0081455_10015618 Ga0081455_100156189 551
31 3300035725 Ga0373947_0001708 Ga0373947_0001708_6742_8472 551
32 3300046455 Ga0495603_0004736 Ga0495603_0004736_1751_3481 551
33 3300047315 Ga0495581_0036620 Ga0495581_0036620_258_2000 551
34 iso_pu_bacteria 2894772417 2894772632 551
35 3300035119 Ga0373956_0016925 Ga0373956_0016925_161_1867 552
36 3300035695 Ga0373927_0057240 Ga0373927_0057240_288_1994 552
37 3300035724 Ga0373933_0020486 Ga0373933_0020486_525_2231 552
38 3300049581 Ga0501047_0001429 Ga0501047_0001429_15123_16868 552
39 3300049583 Ga0501067_0008884 Ga0501067_0008884_454_2199 552
40 3300049584 Ga0501068_0000679 Ga0501068_0000679_4903_6648 552
41 3300049588 Ga0501072_0000021 Ga0501072_0000021_63345_65090 552
42 3300049589 Ga0501073_0009160 Ga0501073_0009160_4402_6147 552
43 3300049590 Ga0501074_0004795 Ga0501074_0004795_3368_5113 552
44 3300049823 Ga0501044_0019290 Ga0501044_0019290_124_1869 552
45 3300054114 Ga0501084_0001764 Ga0501084_0001764_4694_6439 552
46 3300060353 Ga0501082_0000370 Ga0501082_0000370_5298_7043 552
47 3300061734 Ga0530510_0014036 Ga0530510_0014036_664_2409 552
48 iso_pu_bacteria 2929199973 2929200630 552
49 iso_pu_bacteria 8055909800 8055913838 552
50 3300005367 Ga0070667_100000336 Ga0070667_10000033646 553
51 3300005539 Ga0068853_100015425 Ga0068853_1000154255 553
52 3300005841 Ga0068863_100007964 Ga0068863_1000079644 553
53 3300005843 Ga0068860_100111973 Ga0068860_1001119731 553
54 3300025986 Ga0207658_10000493 Ga0207658_100004939 553
55 3300026041 Ga0207639_10001766 Ga0207639_100017665 553
56 3300026088 Ga0207641_10010473 Ga0207641_100104732 553
57 3300028381 Ga0268264_10092696 Ga0268264_100926961 553
58 3300036401 Ga0373937_0012158 Ga0373937_0012158_2896_4671 553
59 3300047673 Ga0495593_0073114 Ga0495593_0073114_70_1767 553
60 3300048924 Ga0496121_0000091 Ga0496121_0000091_188567_190288 553
61 3300053119 Ga0500595_002516 Ga0500595_002516_7245_8966 553
62 iso_pu_bacteria 2841966195 2841969245 553
63 iso_pu_bacteria 2874612657 2874617912 553
64 iso_pu_bacteria 2879083081 2879087501 553
65 iso_pu_bacteria 2941531003 2941532361 553
66 3300005618 Ga0068864_100016804 Ga0068864_1000168042 554
67 3300005844 Ga0068862_100054667 Ga0068862_1000546672 554
68 3300006175 Ga0070712_100001393 Ga0070712_1000013939 554
69 3300006186 Ga0075369_10008692 Ga0075369_100086922 554
70 3300009177 Ga0105248_10089062 Ga0105248_100890622 554
71 3300013105 Ga0157369_10104037 Ga0157369_101040373 554
72 3300025915 Ga0207693_10001776 Ga0207693_100017768 554
73 3300025972 Ga0207668_10010032 Ga0207668_100100322 554
74 3300028380 Ga0268265_10040483 Ga0268265_100404833 554
75 3300037312 Ga0395899_0018305 Ga0395899_0018305_1609_3324 554
76 3300037418 Ga0395900_0010634 Ga0395900_0010634_6086_7801 554
77 3300037466 Ga0395898_0006599 Ga0395898_0006599_7975_9690 554
78 3300038443 Ga0395901_0010773 Ga0395901_0010773_2003_3718 554
79 3300038443 Ga0395901_0033187 Ga0395901_0033187_110_1825 554
80 3300048922 Ga0496119_0010439 Ga0496119_0010439_5152_6867 554
81 3300048923 Ga0496120_0023981 Ga0496120_0023981_1197_2912 554
82 3300049571 Ga0501034_0001464 Ga0501034_0001464_7059_8774 554
83 3300049584 Ga0501068_0001428 Ga0501068_0001428_3720_5435 554
84 3300050494 nmdc:mga06z11_32378_c1 nmdc:mga06z11_32378_c1_773_2488 554
85 3300005347 Ga0070668_100000588 Ga0070668_1000005885 555
86 3300005347 Ga0070668_100047689 Ga0070668_1000476892 555
87 3300005353 Ga0070669_100023897 Ga0070669_1000238972 555
88 3300005518 Ga0070699_100095278 Ga0070699_1000952781 555
89 3300005548 Ga0070665_100027867 Ga0070665_1000278675 555
90 3300005577 Ga0068857_100016293 Ga0068857_1000162935 555
91 3300005616 Ga0068852_100016987 Ga0068852_1000169874 555
92 3300005617 Ga0068859_100025710 Ga0068859_1000257105 555
93 3300005719 Ga0068861_100009916 Ga0068861_1000099162 555
94 3300005834 Ga0068851_10005892 Ga0068851_100058925 555
95 3300005843 Ga0068860_100000226 Ga0068860_10000022662 555
96 3300005844 Ga0068862_100002606 Ga0068862_10000260613 555
97 3300005985 Ga0081539_10001781 Ga0081539_100017817 555
98 3300006051 Ga0075364_10049260 Ga0075364_100492603 555
99 3300006931 Ga0097620_100025710 Ga0097620_1000257105 555
100 3300009177 Ga0105248_10067566 Ga0105248_100675662 555
101 3300009553 Ga0105249_10119609 Ga0105249_101196092 555
102 3300025302 Ga0207426_1014838 Ga0207426_10148382 555
103 3300025903 Ga0207680_10001139 Ga0207680_100011392 555
104 3300025907 Ga0207645_10102983 Ga0207645_101029831 555
105 3300025961 Ga0207712_10073265 Ga0207712_100732652 555
106 3300025972 Ga0207668_10001729 Ga0207668_100017299 555
107 3300025986 Ga0207658_10034048 Ga0207658_100340482 555
108 3300026095 Ga0207676_10047316 Ga0207676_100473162 555
109 3300026116 Ga0207674_10011854 Ga0207674_100118542 555
110 3300026118 Ga0207675_100019629 Ga0207675_1000196295 555
111 3300028379 Ga0268266_10016799 Ga0268266_100167996 555
112 3300028380 Ga0268265_10001536 Ga0268265_100015367 555
113 3300028380 Ga0268265_10006531 Ga0268265_100065315 555
114 3300028381 Ga0268264_10000110 Ga0268264_10000110143 555
115 3300036401 Ga0373937_0046477 Ga0373937_0046477_386_2101 555
116 3300037068 Ga0373925_0010883 Ga0373925_0010883_1943_3661 555
117 3300037418 Ga0395900_0065380 Ga0395900_0065380_1226_2944 555
118 3300042006 Ga0439432_027879 Ga0439432_027879_16_1734 555
119 3300050516 nmdc:mga0sz30_13616_c1 nmdc:mga0sz30_13616_c1_201_1919 555
120 3300053139 Ga0500568_0004447 Ga0500568_0004447_235_1953 555
121 3300053153 Ga0500616_0000385 Ga0500616_0000385_46205_47923 555
122 3300053162 Ga0500638_000128 Ga0500638_000128_5652_7430 555
123 3300053178 Ga0500637_0000334 Ga0500637_0000334_13920_15698 555
124 3300055283 Ga0500661_002743 Ga0500661_002743_561_2339 555
125 iso_pu_bacteria 2511231028 2511395463 555
126 iso_pu_bacteria 2513237092 2513625432 555
127 iso_pu_bacteria 2513237102 2513703359 555
128 iso_pu_bacteria 2513237139 2513873906 555
129 iso_pu_bacteria 2524023205 2524435751 555
130 iso_pu_bacteria 2617270735 2617351709 555
131 iso_pu_bacteria 2744054633 2745079047 555
132 iso_pu_bacteria 2791355196 2793063111 555
133 iso_pu_bacteria 2802429603 2805915989 555
134 iso_pu_bacteria 2824600985 2824602582 555
135 iso_pu_bacteria 2824609381 2824612638 555
136 iso_pu_bacteria 2824617872 2824621100 555
137 iso_pu_bacteria 2824626560 2824630107 555
138 iso_pu_bacteria 2824635225 2824640738 555
139 iso_pu_bacteria 2824644064 2824649815 555
140 iso_pu_bacteria 2824653114 2824654453 555
141 iso_pu_bacteria 2824696289 2824697644 555
142 iso_pu_bacteria 2824704595 2824709670 555
143 iso_pu_bacteria 2824714736 2824719820 555
144 iso_pu_bacteria 2824723954 2824727924 555
145 iso_pu_bacteria 2824753945 2824757106 555
146 iso_pu_bacteria 2824763712 2824768442 555
147 iso_pu_bacteria 2841957949 2841964606 555
148 iso_pu_bacteria 2842038055 2842043876 555
149 iso_pu_bacteria 2842045827 2842052134 555
150 iso_pu_bacteria 2844315083 2844321830 555
151 iso_pu_bacteria 2847939898 2847941760 555
152 iso_pu_bacteria 2849076700 2849082682 555
153 iso_pu_bacteria 2857509624 2857511575 555
154 iso_pu_bacteria 2874620515 2874624428 555
155 iso_pu_bacteria 2874628541 2874636715 555
156 iso_pu_bacteria 2881364244 2881370995 555
157 iso_pu_bacteria 2881665667 2881665703 555
158 iso_pu_bacteria 2888388044 2888391035 555
159 iso_pu_bacteria 2888419890 2888420765 555
160 iso_pu_bacteria 2903727486 2903727620 555
161 iso_pu_bacteria 2904666416 2904672233 555
162 iso_pu_bacteria 2904711408 2904716191 555
163 iso_pu_bacteria 2906602504 2906602890 555
164 iso_pu_bacteria 2932784394 2932786353 555
165 iso_pu_bacteria 2932828146 2932829591 555
166 iso_pu_bacteria 2935616580 2935618109 555
167 iso_pu_bacteria 2935638405 2935641493 555
168 iso_pu_bacteria 2935665750 2935669449 555
169 iso_pu_bacteria 2935694250 2935701809 555
170 iso_pu_bacteria 2935703347 2935707274 555
171 iso_pu_bacteria 2935769743 2935772764 555
172 iso_pu_bacteria 2935777560 2935778099 555
173 iso_pu_bacteria 2935785616 2935787327 555
174 iso_pu_bacteria 2935793552 2935795885 555
175 iso_pu_bacteria 2935801545 2935804347 555
176 iso_pu_bacteria 2935827899 2935831224 555
177 iso_pu_bacteria 2935837841 2935841833 555
178 iso_pu_bacteria 2935855204 2935856392 555
179 iso_pu_bacteria 2935864058 2935871085 555
180 iso_pu_bacteria 2935873716 2935874582 555
181 iso_pu_bacteria 2935992306 2935994043 555
182 iso_pu_bacteria 2936002035 2936004946 555
183 iso_pu_bacteria 2941538514 2941543906 555
184 iso_pu_bacteria 3005594810 3005602178 555
185 iso_pu_bacteria 8016511872 8016518619 555
186 iso_pu_bacteria 8016522445 8016526589 555
187 iso_pu_bacteria 8016539877 8016544873 555
188 iso_pu_bacteria 8016557553 8016565556 555
189 iso_pu_bacteria 8016575299 8016582523 555
190 iso_pu_bacteria 8016595262 8016603173 555
191 iso_pu_bacteria 8016613128 8016617974 555
192 iso_pu_bacteria 8016622563 8016623599 555
193 iso_pu_bacteria 8017057580 8017058051 555
194 iso_pu_bacteria 8019530166 8019531496 555
195 iso_pu_bacteria 8019538911 8019540035 555
196 iso_pu_bacteria 8019576017 8019577683 555
197 iso_pu_bacteria 8019586578 8019595782 555
198 iso_pu_bacteria 8019597564 8019605976 555
199 iso_pu_bacteria 8019608314 8019612554 555
200 iso_pu_bacteria 8056967851 8056970923 555
201 3300025912 Ga0207707_10005017 Ga0207707_100050172 556
202 3300025921 Ga0207652_10023805 Ga0207652_100238052 556
203 3300035083 Ga0373926_0024371 Ga0373926_0024371_138_1853 556
204 3300035692 Ga0373935_0003845 Ga0373935_0003845_5505_7220 556
205 3300035725 Ga0373947_0019069 Ga0373947_0019069_23_1738 556
206 3300046543 Ga0495645_0011016 Ga0495645_0011016_2674_4395 556
207 3300049581 Ga0501047_0037701 Ga0501047_0037701_2489_4207 556
208 iso_pu_bacteria 2513237095 2513647955 556
209 iso_pu_bacteria 2513237096 2513658217 556
210 iso_pu_bacteria 2513237098 2513677505 556
211 iso_pu_bacteria 2513237137 2513862953 556
212 iso_pu_bacteria 2513237145 2513920291 556
213 iso_pu_bacteria 2513237161 2514012877 556
214 iso_pu_bacteria 2517093001 2517102379 556
215 iso_pu_bacteria 2517572143 2517889290 556
216 iso_pu_bacteria 2524023210 2524470329 556
217 iso_pu_bacteria 2524023228 2524536444 556
218 iso_pu_bacteria 2667528175 2671121432 556
219 iso_pu_bacteria 2728368998 2728755345 556
220 iso_pu_bacteria 2791355197 2793070946 556
221 iso_pu_bacteria 2816332527 2818237287 556
222 iso_pu_bacteria 2824661429 2824664736 556
223 iso_pu_bacteria 2824679649 2824683551 556
224 iso_pu_bacteria 2824773399 2824774934 556
225 iso_pu_bacteria 2838122688 2838131027 556
226 iso_pu_bacteria 2841941048 2841944469 556
227 iso_pu_bacteria 2841949485 2841951609 556
228 iso_pu_bacteria 2841974524 2841983008 556
229 iso_pu_bacteria 2841983080 2841991008 556
230 iso_pu_bacteria 2847930680 2847931462 556
231 iso_pu_bacteria 2876761206 2876766406 556
232 iso_pu_bacteria 2879099564 2879107232 556
233 iso_pu_bacteria 2885374607 2885377926 556
234 iso_pu_bacteria 2885409591 2885411726 556
235 iso_pu_bacteria 2888378607 2888379956 556
236 iso_pu_bacteria 2903748898 2903750240 556
237 iso_pu_bacteria 2903768456 2903773113 556
238 iso_pu_bacteria 2904699407 2904709157 556
239 iso_pu_bacteria 2906610324 2906613235 556
240 iso_pu_bacteria 2906635258 2906635473 556
241 iso_pu_bacteria 2906660503 2906668604 556
242 iso_pu_bacteria 2908739725 2908747888 556
243 iso_pu_bacteria 2922368715 2922378342 556
244 iso_pu_bacteria 2922393267 2922400791 556
245 iso_pu_bacteria 2929615660 2929622557 556
246 iso_pu_bacteria 2929624759 2929631225 556
247 iso_pu_bacteria 2932809354 2932812572 556
248 iso_pu_bacteria 2932818245 2932822934 556
249 iso_pu_bacteria 2933577622 2933584364 556
250 iso_pu_bacteria 2935630451 2935634776 556
251 iso_pu_bacteria 2935675223 2935677953 556
252 iso_pu_bacteria 2935684952 2935689596 556
253 iso_pu_bacteria 2935713505 2935717115 556
254 iso_pu_bacteria 2935722832 2935730051 556
255 iso_pu_bacteria 2935732158 2935738530 556
256 iso_pu_bacteria 2935741537 2935749222 556
257 iso_pu_bacteria 2935750917 2935756949 556
258 iso_pu_bacteria 2935760218 2935764437 556
259 iso_pu_bacteria 2935959822 2935964137 556
260 iso_pu_bacteria 2940556831 2940562863 556
261 iso_pu_bacteria 2941507105 2941511894 556
262 iso_pu_bacteria 2941515067 2941519596 556
263 iso_pu_bacteria 2941523033 2941527712 556
264 iso_pu_bacteria 3005474847 3005475525 556
265 iso_pu_bacteria 8006933436 8006935771 556
266 iso_pu_bacteria 8006973647 8006975690 556
267 iso_pu_bacteria 8055742211 8055751008 556
268 3300006051 Ga0075364_10018801 Ga0075364_100188015 557
269 3300006178 Ga0075367_10008487 Ga0075367_100084873 557
270 3300006178 Ga0075367_10012265 Ga0075367_100122652 557
271 3300006195 Ga0075366_10041363 Ga0075366_100413632 557
272 3300031730 Ga0307516_10000019 Ga0307516_1000001926 557
273 3300031730 Ga0307516_10000022 Ga0307516_10000022162 557
274 3300048922 Ga0496119_0000091 Ga0496119_0000091_121187_122899 557
275 3300048923 Ga0496120_0003831 Ga0496120_0003831_246_1958 557
276 3300048929 Ga0496126_0028105 Ga0496126_0028105_2641_4365 557
277 3300049823 Ga0501044_0081101 Ga0501044_0081101_22_1734 557
278 3300050491 nmdc:mga00v17_9491_c1 nmdc:mga00v17_9491_c1_564_2300 557
279 3300050492 nmdc:mga0yw44_35166_c1 nmdc:mga0yw44_35166_c1_277_1989 557
280 3300050493 nmdc:mga0k408_58214_c1 nmdc:mga0k408_58214_c1_46_1767 557
281 3300050494 nmdc:mga06z11_8832_c1 nmdc:mga06z11_8832_c1_750_2462 557
282 iso_pu_bacteria 2508501128 2509149805 557
283 iso_pu_bacteria 2513237141 2513889788 557
284 iso_pu_bacteria 2922425934 2922433733 557
285 3300005327 Ga0070658_10000139 Ga0070658_1000013911 558
286 3300005578 Ga0068854_100000426 Ga0068854_10000042617 558
287 3300005614 Ga0068856_100001641 Ga0068856_1000016412 558
288 3300005614 Ga0068856_100078242 Ga0068856_1000782422 558
289 3300005616 Ga0068852_100000175 Ga0068852_10000017518 558
290 3300009551 Ga0105238_10011332 Ga0105238_100113325 558
291 3300025909 Ga0207705_10000009 Ga0207705_1000000946 558
292 3300025910 Ga0207684_10038515 Ga0207684_100385152 558
293 3300025913 Ga0207695_10070362 Ga0207695_100703622 558
294 3300025924 Ga0207694_10033146 Ga0207694_100331462 558
295 3300025949 Ga0207667_10000328 Ga0207667_100003285 558
296 3300025981 Ga0207640_10000287 Ga0207640_1000028710 558
297 3300026078 Ga0207702_10027318 Ga0207702_100273183 558
298 3300026142 Ga0207698_10000200 Ga0207698_1000020017 558
299 3300039437 Ga0436365_0814378 Ga0436365_0814378_1868_3568 558
300 3300048929 Ga0496126_0000782 Ga0496126_0000782_32216_33931 558
301 iso_pu_bacteria 2883577096 2883580005 558
302 iso_pu_bacteria 8019555841 8019563023 558
303 3300003215 JGI25153J46596_10022574 JGI25153J46596_100225742 559
304 3300003794 Ga0055531_10005473 Ga0055531_100054734 559
305 3300005262 Ga0065165_1001210 Ga0065165_10012104 559
306 3300005344 Ga0070661_100117353 Ga0070661_1001173531 559
307 3300005539 Ga0068853_100137791 Ga0068853_1001377911 559
308 3300005563 Ga0068855_100000378 Ga0068855_10000037840 559
309 3300005564 Ga0070664_100024756 Ga0070664_1000247563 559
310 3300005614 Ga0068856_100139218 Ga0068856_1001392182 559
311 3300006038 Ga0075365_10009745 Ga0075365_100097454 559
312 3300006038 Ga0075365_10046749 Ga0075365_100467492 559
313 3300006048 Ga0075363_100018680 Ga0075363_1000186803 559
314 3300006051 Ga0075364_10069979 Ga0075364_100699792 559
315 3300006942 Ga0099824_1015031 Ga0099824_10150312 559
316 3300009094 Ga0111539_10021057 Ga0111539_100210577 559
317 3300009147 Ga0114129_10161538 Ga0114129_101615381 559
318 3300010375 Ga0105239_10014534 Ga0105239_100145344 559
319 3300025230 Ga0209563_101775 Ga0209563_1017753 559
320 3300025261 Ga0209233_1001962 Ga0209233_10019625 559
321 3300025272 Ga0209455_1002928 Ga0209455_10029283 559
322 3300025297 Ga0209758_1016969 Ga0209758_10169692 559
323 3300025297 Ga0209758_1019265 Ga0209758_10192652 559
324 3300025302 Ga0207426_1000617 Ga0207426_100061721 559
325 3300025304 Ga0209257_1000440 Ga0209257_100044040 559
326 3300025913 Ga0207695_10005145 Ga0207695_100051455 559
327 3300025919 Ga0207657_10117356 Ga0207657_101173562 559
328 3300025933 Ga0207706_10026306 Ga0207706_100263064 559
329 3300026041 Ga0207639_10064344 Ga0207639_100643442 559
330 3300027296 Ga0209389_1000029 Ga0209389_100002984 559
331 3300027357 Ga0209589_1000012 Ga0209589_100001261 559
332 3300027357 Ga0209589_1000013 Ga0209589_1000013145 559
333 3300027361 Ga0209489_100013 Ga0209489_10001362 559
334 3300028379 Ga0268266_10067389 Ga0268266_100673891 559
335 3300033180 Ga0307510_10071464 Ga0307510_100714642 559
336 3300037471 Ga0395905_0016353 Ga0395905_0016353_3717_5432 559
337 3300038443 Ga0395901_0012472 Ga0395901_0012472_794_2557 559
338 3300044658 Ga0466972_0000103 Ga0466972_0000103_56377_58092 559
339 3300044693 Ga0466961_0000129 Ga0466961_0000129_20642_22357 559
340 3300046454 Ga0495592_0019851 Ga0495592_0019851_1071_2786 559
341 3300046459 Ga0495629_0030711 Ga0495629_0030711_82_1797 559
342 3300046460 Ga0495638_0002281 Ga0495638_0002281_1596_3311 559
343 3300046477 Ga0495664_0011375 Ga0495664_0011375_917_2632 559
344 3300046524 Ga0495648_0009380 Ga0495648_0009380_1733_3448 559
345 3300046529 Ga0495652_0024834 Ga0495652_0024834_2435_4150 559
346 3300046533 Ga0495640_0037694 Ga0495640_0037694_337_2052 559
347 3300046557 Ga0495622_0034865 Ga0495622_0034865_574_2289 559
348 3300046663 Ga0495635_0005971 Ga0495635_0005971_460_2175 559
349 3300046675 Ga0495657_0009210 Ga0495657_0009210_4395_6110 559
350 3300046679 Ga0495623_0006918 Ga0495623_0006918_2273_3988 559
351 3300046690 Ga0495624_0091395 Ga0495624_0091395_64_1779 559
352 3300046809 Ga0495600_0055991 Ga0495600_0055991_39_1754 559
353 3300047317 Ga0495604_0002997 Ga0495604_0002997_10375_12090 559
354 3300047319 Ga0495674_0041857 Ga0495674_0041857_2325_4040 559
355 3300047321 Ga0495676_0032360 Ga0495676_0032360_2439_4154 559
356 3300047444 Ga0495675_0094325 Ga0495675_0094325_45_1760 559
357 3300047469 Ga0495673_0005038 Ga0495673_0005038_285_2003 559
358 3300048088 Ga0495602_0017685 Ga0495602_0017685_5392_7107 559
359 3300048907 Ga0496104_0010370 Ga0496104_0010370_4050_5765 559
360 3300048907 Ga0496104_0061130 Ga0496104_0061130_1607_3322 559
361 3300048918 Ga0496115_0026064 Ga0496115_0026064_1241_2956 559
362 3300048922 Ga0496119_0017281 Ga0496119_0017281_1629_3344 559
363 3300048928 Ga0496125_0064515 Ga0496125_0064515_1153_2868 559
364 3300048929 Ga0496126_0006097 Ga0496126_0006097_2026_3741 559
365 3300049744 Ga0501083_0060386 Ga0501083_0060386_87_1823 559
366 3300050489 nmdc:mga03683_18071_c1 nmdc:mga03683_18071_c1_43_1758 559
367 3300050490 nmdc:mga03n38_12398_c1 nmdc:mga03n38_12398_c1_289_2004 559
368 3300050491 nmdc:mga00v17_805_c1 nmdc:mga00v17_805_c1_15331_17049 559
369 3300050492 nmdc:mga0yw44_36418_c1 nmdc:mga0yw44_36418_c1_38_1756 559
370 3300050511 nmdc:mga08y16_30177_c1 nmdc:mga08y16_30177_c1_2809_4524 559
371 3300053094 Ga0500566_0017390 Ga0500566_0017390_2378_4132 559
372 3300053136 Ga0500559_0012818 Ga0500559_0012818_204_1919 559
373 3300053139 Ga0500568_0014217 Ga0500568_0014217_594_2297 559
374 3300053736 Ga0500599_001487 Ga0500599_001487_307_2022 559
375 3300053737 Ga0500601_000231 Ga0500601_000231_6273_7988 559
376 3300060353 Ga0501082_0031737 Ga0501082_0031737_321_2057 559
377 iso_pu_bacteria 2885383462 2885391991 559
378 3300005344 Ga0070661_100000694 Ga0070661_1000006944 560
379 3300005434 Ga0070709_10000732 Ga0070709_1000073215 560
380 3300005437 Ga0070710_10000211 Ga0070710_1000021127 560
381 3300005439 Ga0070711_100001113 Ga0070711_1000011134 560
382 3300005548 Ga0070665_100000078 Ga0070665_100000078127 560
383 3300006042 Ga0075368_10002838 Ga0075368_100028381 560
384 3300006943 Ga0099822_1015114 Ga0099822_10151144 560
385 3300006944 Ga0099823_1022970 Ga0099823_10229705 560
386 3300010375 Ga0105239_10060804 Ga0105239_100608043 560
387 3300021384 Ga0213876_10000991 Ga0213876_100009912 560
388 3300025253 Ga0209677_100351 Ga0209677_10035122 560
389 3300025261 Ga0209233_1006063 Ga0209233_10060632 560
390 3300025272 Ga0209455_1011707 Ga0209455_10117071 560
391 3300025295 Ga0209564_1003394 Ga0209564_10033945 560
392 3300025297 Ga0209758_1008915 Ga0209758_10089152 560
393 3300025302 Ga0207426_1000201 Ga0207426_100020112 560
394 3300025898 Ga0207692_10000494 Ga0207692_1000049411 560
395 3300025906 Ga0207699_10004161 Ga0207699_100041614 560
396 3300025913 Ga0207695_10053694 Ga0207695_100536942 560
397 3300025914 Ga0207671_10093117 Ga0207671_100931171 560
398 3300025916 Ga0207663_10000356 Ga0207663_100003564 560
399 3300025929 Ga0207664_10001702 Ga0207664_100017026 560
400 3300025931 Ga0207644_10034127 Ga0207644_100341271 560
401 3300025939 Ga0207665_10001832 Ga0207665_100018322 560
402 3300026067 Ga0207678_10004673 Ga0207678_100046736 560
403 3300027296 Ga0209389_1000076 Ga0209389_100007619 560
404 3300027357 Ga0209589_1000017 Ga0209589_100001790 560
405 3300027361 Ga0209489_100018 Ga0209489_10001890 560
406 3300027361 Ga0209489_100416 Ga0209489_10041619 560
407 3300027363 Ga0209700_100014 Ga0209700_100014107 560
408 3300027363 Ga0209700_100028 Ga0209700_10002890 560
409 3300028379 Ga0268266_10002705 Ga0268266_100027053 560
410 3300028556 Ga0265337_1006176 Ga0265337_10061762 560
411 3300028558 Ga0265326_10002792 Ga0265326_100027922 560
412 3300028563 Ga0265319_1009715 Ga0265319_10097152 560
413 3300028573 Ga0265334_10003782 Ga0265334_100037822 560
414 3300028653 Ga0265323_10007852 Ga0265323_100078522 560
415 3300028666 Ga0265336_10000430 Ga0265336_100004303 560
416 3300028800 Ga0265338_10000024 Ga0265338_1000002490 560
417 3300029957 Ga0265324_10017100 Ga0265324_100171002 560
418 3300031507 Ga0307509_10000606 Ga0307509_1000060646 560
419 3300031712 Ga0265342_10027107 Ga0265342_100271072 560
420 3300031730 Ga0307516_10051214 Ga0307516_100512143 560
421 3300033442 Ga0315911_1000033 Ga0315911_10000332 560
422 3300037418 Ga0395900_0046530 Ga0395900_0046530_1976_3754 560
423 3300039437 Ga0436365_0650112 Ga0436365_0650112_41886_43604 560
424 3300039437 Ga0436365_1771573 Ga0436365_1771573_1823_3541 560
425 3300039453 Ga0436362_0631557 Ga0436362_0631557_610_2328 560
426 3300044656 Ga0466969_0015098 Ga0466969_0015098_798_2516 560
427 3300044842 Ga0466957_0065165 Ga0466957_0065165_27_1745 560
428 3300048911 Ga0496108_0104266 Ga0496108_0104266_391_2109 560
429 3300048924 Ga0496121_0018322 Ga0496121_0018322_779_2497 560
430 3300048928 Ga0496125_0069831 Ga0496125_0069831_971_2689 560
431 3300048929 Ga0496126_0010543 Ga0496126_0010543_7291_9009 560
432 3300049571 Ga0501034_0030391 Ga0501034_0030391_2389_4107 560
433 3300049572 Ga0501036_0056784 Ga0501036_0056784_740_2458 560
434 3300053130 Ga0500642_0012341 Ga0500642_0012341_160_1878 560
435 iso_pu_bacteria 8056681323 8056685165 560
436 3300005336 Ga0070680_100121442 Ga0070680_1001214422 561
437 3300005339 Ga0070660_100129899 Ga0070660_1001298991 561
438 3300005344 Ga0070661_100099425 Ga0070661_1000994251 561
439 3300005445 Ga0070708_100001185 Ga0070708_1000011854 561
440 3300005563 Ga0068855_100012487 Ga0068855_1000124875 561
441 3300005563 Ga0068855_100041051 Ga0068855_1000410512 561
442 3300005577 Ga0068857_100116211 Ga0068857_1001162112 561
443 3300005616 Ga0068852_100002923 Ga0068852_1000029232 561
444 3300005616 Ga0068852_100046890 Ga0068852_1000468903 561
445 3300006175 Ga0070712_100131881 Ga0070712_1001318811 561
446 3300006844 Ga0075428_100056275 Ga0075428_1000562752 561
447 3300009093 Ga0105240_10004409 Ga0105240_1000440914 561
448 3300009093 Ga0105240_10009432 Ga0105240_100094325 561
449 3300009545 Ga0105237_10012543 Ga0105237_100125436 561
450 3300010375 Ga0105239_10004474 Ga0105239_1000447413 561
451 3300013104 Ga0157370_10142767 Ga0157370_101427672 561
452 3300013105 Ga0157369_10132887 Ga0157369_101328872 561
453 3300021361 Ga0213872_10016552 Ga0213872_100165522 561
454 3300021361 Ga0213872_10055869 Ga0213872_100558691 561
455 3300025912 Ga0207707_10016113 Ga0207707_100161133 561
456 3300025913 Ga0207695_10020475 Ga0207695_100204752 561
457 3300025917 Ga0207660_10012408 Ga0207660_100124082 561
458 3300025919 Ga0207657_10004425 Ga0207657_100044252 561
459 3300025920 Ga0207649_10008646 Ga0207649_100086466 561
460 3300025921 Ga0207652_10042328 Ga0207652_100423283 561
461 3300026116 Ga0207674_10018427 Ga0207674_100184271 561
462 3300026142 Ga0207698_10060721 Ga0207698_100607211 561
463 3300031711 Ga0265314_10000900 Ga0265314_100009002 561
464 3300031712 Ga0265342_10035094 Ga0265342_100350942 561
465 3300037418 Ga0395900_0005520 Ga0395900_0005520_8704_10425 561
466 3300039437 Ga0436365_0675289 Ga0436365_0675289_2640_4364 561
467 3300039438 Ga0436360_0130148 Ga0436360_0130148_167_1888 561
468 3300039447 Ga0436361_0413058 Ga0436361_0413058_2837_4558 561
469 3300039447 Ga0436361_0842658 Ga0436361_0842658_2116_3837 561
470 3300044694 Ga0466963_0064444 Ga0466963_0064444_452_2173 561
471 3300046674 Ga0495588_0013281 Ga0495588_0013281_192_1913 561
472 3300047320 Ga0495672_0062529 Ga0495672_0062529_141_1877 561
473 3300048911 Ga0496108_0037528 Ga0496108_0037528_92_1813 561
474 3300049570 Ga0501033_0087905 Ga0501033_0087905_437_2161 561
475 3300053087 Ga0500643_005623 Ga0500643_005623_391_2133 561
476 3300053094 Ga0500566_0000065 Ga0500566_0000065_45046_46779 561
477 3300053111 Ga0500572_001831 Ga0500572_001831_3567_5288 561
478 3300053111 Ga0500572_004048 Ga0500572_004048_817_2550 561
479 3300053136 Ga0500559_0001232 Ga0500559_0001232_19_1740 561
480 iso_pu_bacteria 8056673599 8056678655 561
481 3300035111 Ga0373923_0002084 Ga0373923_0002084_4095_5873 562
482 3300035116 Ga0373945_0009195 Ga0373945_0009195_1366_3108 562
483 3300035118 Ga0373954_0002205 Ga0373954_0002205_217_1995 562
484 3300035119 Ga0373956_0002935 Ga0373956_0002935_223_2001 562
485 3300035120 Ga0373957_0019136 Ga0373957_0019136_137_1915 562
486 3300035172 Ga0373955_0001794 Ga0373955_0001794_213_1991 562
487 3300035410 Ga0373924_0024589 Ga0373924_0024589_118_1896 562
488 3300035724 Ga0373933_0001425 Ga0373933_0001425_6872_8650 562
489 3300035725 Ga0373947_0056547 Ga0373947_0056547_149_1891 562
490 3300036401 Ga0373937_0035451 Ga0373937_0035451_2552_4330 562
491 3300037068 Ga0373925_0065052 Ga0373925_0065052_871_2613 562
492 3300046454 Ga0495592_0010990 Ga0495592_0010990_185_1963 562
493 3300046459 Ga0495629_0001069 Ga0495629_0001069_201_1979 562
494 3300046462 Ga0495651_0038836 Ga0495651_0038836_1831_3609 562
495 3300046463 Ga0495653_0001526 Ga0495653_0001526_185_1963 562
496 3300046472 Ga0495580_0072374 Ga0495580_0072374_622_2364 562
497 3300046477 Ga0495664_0049053 Ga0495664_0049053_251_1993 562
498 3300046511 Ga0495608_0016408 Ga0495608_0016408_1516_3294 562
499 3300046511 Ga0495608_0063039 Ga0495608_0063039_185_1927 562
500 3300046529 Ga0495652_0009826 Ga0495652_0009826_201_1979 562
501 3300046536 Ga0495587_0046397 Ga0495587_0046397_585_2363 562
502 3300046543 Ga0495645_0022979 Ga0495645_0022979_185_1963 562
503 3300046559 Ga0495667_0058742 Ga0495667_0058742_457_2235 562
504 3300046642 Ga0495634_0006809 Ga0495634_0006809_2161_3939 562
505 3300046663 Ga0495635_0000963 Ga0495635_0000963_199_1977 562
506 3300046678 Ga0495599_0053766 Ga0495599_0053766_213_1991 562
507 3300046679 Ga0495623_0007565 Ga0495623_0007565_5059_6837 562
508 3300046680 Ga0495646_0004493 Ga0495646_0004493_5136_6914 562
509 3300046690 Ga0495624_0042704 Ga0495624_0042704_1043_2785 562
510 3300046809 Ga0495600_0004451 Ga0495600_0004451_217_1995 562
511 3300047317 Ga0495604_0080115 Ga0495604_0080115_213_1991 562
512 3300047319 Ga0495674_0012971 Ga0495674_0012971_189_1967 562
513 3300047322 Ga0495680_0010209 Ga0495680_0010209_217_1995 562
514 3300047444 Ga0495675_0049780 Ga0495675_0049780_787_2565 562
515 3300047471 Ga0495684_0004918 Ga0495684_0004918_7172_8950 562
516 3300047673 Ga0495593_0000214 Ga0495593_0000214_28605_30383 562
517 3300047673 Ga0495593_0021124 Ga0495593_0021124_516_2258 562
518 3300048088 Ga0495602_0073491 Ga0495602_0073491_186_1964 562
519 3300048928 Ga0496125_0065592 Ga0496125_0065592_699_2432 562
520 3300053084 Ga0495595_0000449 Ga0495595_0000449_8108_9886 562
521 3300053085 Ga0495619_0001763 Ga0495619_0001763_209_1987 562
522 iso_pu_bacteria 2824687955 2824690837 562
523 3300005347 Ga0070668_100001432 Ga0070668_10000143214 563
524 3300013306 Ga0163162_10030837 Ga0163162_100308374 563
525 3300031727 Ga0316576_10047899 Ga0316576_100478991 563
526 3300049586 Ga0501070_0010935 Ga0501070_0010935_2840_4567 563
527 3300049823 Ga0501044_0041197 Ga0501044_0041197_1558_3285 563
528 iso_pu_bacteria 2643221541 2643729739 563
529 iso_pu_bacteria 2643221606 2644044099 563
530 iso_pu_bacteria 2643221671 2644392568 563
531 iso_pu_bacteria 2721755755 2723842011 563
532 iso_pu_bacteria 2791355199 2793077440 563
533 iso_pu_bacteria 2874604998 2874610379 563
534 iso_pu_bacteria 2879110137 2879111698 563
535 iso_pu_bacteria 2889033259 2889035091 563
536 iso_pu_bacteria 2904690495 2904692518 563
537 iso_pu_bacteria 2908756301 2908756786 563
538 iso_pu_bacteria 2922361189 2922363351 563
539 iso_pu_bacteria 2922386360 2922388628 563
540 iso_pu_bacteria 8006964411 8006968296 563
541 iso_pu_bacteria 8006984368 8006985969 563
542 iso_pu_bacteria 8006994254 8007000226 563
543 iso_pu_bacteria 8056673599 8056677711 563
544 iso_pu_bacteria 8056689827 8056694126 563
545 3300005434 Ga0070709_10005089 Ga0070709_100050893 564
546 3300005436 Ga0070713_100000001 Ga0070713_100000001101 564
547 3300005539 Ga0068853_100004334 Ga0068853_1000043343 564
548 3300005547 Ga0070693_100019429 Ga0070693_1000194293 564
549 3300005547 Ga0070693_100054567 Ga0070693_1000545671 564
550 3300005577 Ga0068857_100018032 Ga0068857_1000180322 564
551 3300005614 Ga0068856_100051247 Ga0068856_1000512473 564
552 3300006175 Ga0070712_100000198 Ga0070712_10000019833 564
553 3300006175 Ga0070712_100000499 Ga0070712_1000004992 564
554 3300006871 Ga0075434_100055004 Ga0075434_1000550042 564
555 3300006914 Ga0075436_100012867 Ga0075436_1000128673 564
556 3300006914 Ga0075436_100025717 Ga0075436_1000257173 564
557 3300006914 Ga0075436_100081699 Ga0075436_1000816992 564
558 3300009093 Ga0105240_10006449 Ga0105240_100064496 564
559 3300009545 Ga0105237_10020700 Ga0105237_100207004 564
560 3300010375 Ga0105239_10036439 Ga0105239_100364393 564
561 3300013104 Ga0157370_10003943 Ga0157370_100039438 564
562 3300014968 Ga0157379_10013671 Ga0157379_100136713 564
563 3300025906 Ga0207699_10000096 Ga0207699_100000964 564
564 3300025915 Ga0207693_10000094 Ga0207693_1000009442 564
565 3300025928 Ga0207700_10000015 Ga0207700_10000015165 564
566 3300025949 Ga0207667_10030736 Ga0207667_100307363 564
567 3300026078 Ga0207702_10000011 Ga0207702_10000011160 564
568 3300026078 Ga0207702_10000465 Ga0207702_1000046533 564
569 3300026116 Ga0207674_10000002 Ga0207674_10000002163 564
570 3300026142 Ga0207698_10094597 Ga0207698_100945972 564
571 3300031241 Ga0265325_10001297 Ga0265325_1000129712 564
572 3300031249 Ga0265339_10001140 Ga0265339_1000114018 564
573 3300031595 Ga0265313_10001099 Ga0265313_100010999 564
574 3300035172 Ga0373955_0067773 Ga0373955_0067773_218_1951 564
575 3300036401 Ga0373937_0088287 Ga0373937_0088287_280_2013 564
576 3300037068 Ga0373925_0070478 Ga0373925_0070478_794_2527 564
577 3300039437 Ga0436365_1157676 Ga0436365_1157676_693_2426 564
578 3300049572 Ga0501036_0152539 Ga0501036_0152539_38_1780 564
579 3300049579 Ga0501043_0035129 Ga0501043_0035129_1564_3306 564
580 3300049581 Ga0501047_0001651 Ga0501047_0001651_8191_9933 564
581 3300049582 Ga0501048_0084968 Ga0501048_0084968_115_1857 564
582 3300050512 nmdc:mga0n895_17840_c1 nmdc:mga0n895_17840_c1_2453_4186 564
583 3300050514 nmdc:mga08x19_23544_c1 nmdc:mga08x19_23544_c1_2077_3810 564
584 3300050514 nmdc:mga08x19_31771_c2 nmdc:mga08x19_31771_c2_94_1827 564
585 3300050514 nmdc:mga08x19_41_c1 nmdc:mga08x19_41_c1_41039_42772 564
586 3300005841 Ga0068863_100067148 Ga0068863_1000671482 565
587 3300005843 Ga0068860_100000257 Ga0068860_10000025746 565
588 3300025908 Ga0207643_10050478 Ga0207643_100504782 565
589 3300025914 Ga0207671_10027264 Ga0207671_100272642 565
590 3300028381 Ga0268264_10000049 Ga0268264_10000049238 565
591 3300031240 Ga0265320_10000594 Ga0265320_100005942 565
592 3300031507 Ga0307509_10048794 Ga0307509_100487944 565
593 3300031730 Ga0307516_10015603 Ga0307516_100156035 565
594 3300033179 Ga0307507_10020473 Ga0307507_100204732 565
595 3300048909 Ga0496106_0001870 Ga0496106_0001870_5840_7579 565
596 3300048920 Ga0496117_0004399 Ga0496117_0004399_11852_13591 565
597 3300048921 Ga0496118_0005557 Ga0496118_0005557_8978_10717 565
598 3300048924 Ga0496121_0000716 Ga0496121_0000716_43346_45085 565
599 3300048927 Ga0496124_0001529 Ga0496124_0001529_16250_17989 565
600 3300048928 Ga0496125_0042313 Ga0496125_0042313_463_2202 565
601 3300048929 Ga0496126_0016855 Ga0496126_0016855_2470_4209 565
602 3300005435 Ga0070714_100013699 Ga0070714_1000136992 566
603 3300006038 Ga0075365_10002405 Ga0075365_100024057 566
604 3300006048 Ga0075363_100036631 Ga0075363_1000366311 566
605 3300006178 Ga0075367_10005576 Ga0075367_100055766 566
606 3300013105 Ga0157369_10016112 Ga0157369_100161122 566
607 3300022467 Ga0224712_10008506 Ga0224712_100085061 566
608 3300025929 Ga0207664_10006879 Ga0207664_100068795 566
609 3300037418 Ga0395900_0003234 Ga0395900_0003234_6316_8055 566
610 3300037466 Ga0395898_0003112 Ga0395898_0003112_2259_3998 566
611 3300039437 Ga0436365_1132543 Ga0436365_1132543_3165_4904 566
612 3300039437 Ga0436365_1417024 Ga0436365_1417024_844_2583 566
613 3300048929 Ga0496126_0046200 Ga0496126_0046200_252_1997 566
614 3300050490 nmdc:mga03n38_2102_c1 nmdc:mga03n38_2102_c1_3965_5701 566
615 3300050494 nmdc:mga06z11_2594_c1 nmdc:mga06z11_2594_c1_1068_2804 566
616 3300003203 JGI25406J46586_10000009 JGI25406J46586_1000000973 567
617 3300003203 JGI25406J46586_10001070 JGI25406J46586_1000107011 567
618 3300003659 JGI25404J52841_10001198 JGI25404J52841_100011983 567
619 3300005329 Ga0070683_100011699 Ga0070683_1000116995 567
620 3300005338 Ga0068868_100031113 Ga0068868_1000311132 567
621 3300005365 Ga0070688_100049792 Ga0070688_1000497921 567
622 3300005436 Ga0070713_100007516 Ga0070713_1000075164 567
623 3300005455 Ga0070663_100005865 Ga0070663_1000058653 567
624 3300005458 Ga0070681_10013363 Ga0070681_100133635 567
625 3300005459 Ga0068867_100092449 Ga0068867_1000924491 567
626 3300005530 Ga0070679_100028402 Ga0070679_1000284022 567
627 3300005535 Ga0070684_100054727 Ga0070684_1000547272 567
628 3300005548 Ga0070665_100035980 Ga0070665_1000359803 567
629 3300005563 Ga0068855_100013741 Ga0068855_1000137419 567
630 3300005563 Ga0068855_100029724 Ga0068855_1000297245 567
631 3300005577 Ga0068857_100031281 Ga0068857_1000312812 567
632 3300005614 Ga0068856_100191346 Ga0068856_1001913462 567
633 3300005719 Ga0068861_100102745 Ga0068861_1001027452 567
634 3300005937 Ga0081455_10010356 Ga0081455_100103564 567
635 3300005937 Ga0081455_10015530 Ga0081455_100155302 567
636 3300005937 Ga0081455_10018973 Ga0081455_100189735 567
637 3300005983 Ga0081540_1002606 Ga0081540_10026064 567
638 3300005983 Ga0081540_1002760 Ga0081540_100276012 567
639 3300005983 Ga0081540_1006050 Ga0081540_10060507 567
640 3300005983 Ga0081540_1017407 Ga0081540_10174074 567
641 3300005985 Ga0081539_10000048 Ga0081539_1000004873 567
642 3300005985 Ga0081539_10000530 Ga0081539_1000053029 567
643 3300006038 Ga0075365_10027068 Ga0075365_100270683 567
644 3300009093 Ga0105240_10011824 Ga0105240_100118248 567
645 3300009551 Ga0105238_10033741 Ga0105238_100337414 567
646 3300010159 Ga0099796_10017188 Ga0099796_100171882 567
647 3300013104 Ga0157370_10007832 Ga0157370_100078323 567
648 3300025904 Ga0207647_10036497 Ga0207647_100364972 567
649 3300025906 Ga0207699_10009117 Ga0207699_100091172 567
650 3300025912 Ga0207707_10002611 Ga0207707_100026119 567
651 3300025912 Ga0207707_10014215 Ga0207707_100142153 567
652 3300025913 Ga0207695_10046036 Ga0207695_100460362 567
653 3300025915 Ga0207693_10007348 Ga0207693_100073485 567
654 3300025916 Ga0207663_10108814 Ga0207663_101088141 567
655 3300025921 Ga0207652_10024973 Ga0207652_100249734 567
656 3300025924 Ga0207694_10018576 Ga0207694_100185764 567
657 3300025924 Ga0207694_10070539 Ga0207694_100705392 567
658 3300025933 Ga0207706_10061276 Ga0207706_100612762 567
659 3300025944 Ga0207661_10000678 Ga0207661_1000067823 567
660 3300025949 Ga0207667_10043643 Ga0207667_100436434 567
661 3300026067 Ga0207678_10005720 Ga0207678_100057204 567
662 3300026075 Ga0207708_10073069 Ga0207708_100730692 567
663 3300026116 Ga0207674_10041082 Ga0207674_100410823 567
664 3300026116 Ga0207674_10044321 Ga0207674_100443212 567
665 3300026121 Ga0207683_10005111 Ga0207683_100051112 567
666 3300028379 Ga0268266_10007460 Ga0268266_100074607 567
667 3300028379 Ga0268266_10007480 Ga0268266_100074802 567
668 3300028573 Ga0265334_10025471 Ga0265334_100254712 567
669 3300031235 Ga0265330_10007390 Ga0265330_100073907 567
670 3300031241 Ga0265325_10002005 Ga0265325_100020054 567
671 3300031247 Ga0265340_10002628 Ga0265340_100026282 567
672 3300031507 Ga0307509_10096831 Ga0307509_100968312 567
673 3300033180 Ga0307510_10018815 Ga0307510_100188151 567
674 3300035692 Ga0373935_0000229 Ga0373935_0000229_5603_7345 567
675 3300035695 Ga0373927_0000071 Ga0373927_0000071_28402_30144 567
676 3300035724 Ga0373933_0000114 Ga0373933_0000114_8453_10258 567
677 3300035725 Ga0373947_0006904 Ga0373947_0006904_4484_6226 567
678 3300036401 Ga0373937_0026032 Ga0373937_0026032_2627_4369 567
679 3300046455 Ga0495603_0000035 Ga0495603_0000035_24764_26506 567
680 3300046455 Ga0495603_0006447 Ga0495603_0006447_185_1927 567
681 3300046459 Ga0495629_0000081 Ga0495629_0000081_54588_56330 567
682 3300046461 Ga0495641_0003571 Ga0495641_0003571_8663_10405 567
683 3300046473 Ga0495582_0000235 Ga0495582_0000235_9831_11573 567
684 3300046475 Ga0495639_0000010 Ga0495639_0000010_20658_22400 567
685 3300046476 Ga0495662_0000034 Ga0495662_0000034_1020_2762 567
686 3300046477 Ga0495664_0003381 Ga0495664_0003381_3470_5212 567
687 3300046499 Ga0495594_0004984 Ga0495594_0004984_2282_4024 567
688 3300046507 Ga0495606_0000265 Ga0495606_0000265_60850_62592 567
689 3300046516 Ga0495628_0027454 Ga0495628_0027454_1107_2849 567
690 3300046531 Ga0495665_0000005 Ga0495665_0000005_7785_9527 567
691 3300046533 Ga0495640_0010386 Ga0495640_0010386_5313_7055 567
692 3300046642 Ga0495634_0000261 Ga0495634_0000261_24140_25882 567
693 3300046660 Ga0495625_0022319 Ga0495625_0022319_1725_3476 567
694 3300046680 Ga0495646_0009132 Ga0495646_0009132_4068_5810 567
695 3300046681 Ga0495647_0000500 Ga0495647_0000500_2931_4673 567
696 3300046683 Ga0495658_0041467 Ga0495658_0041467_448_2190 567
697 3300046684 Ga0495669_0028465 Ga0495669_0028465_411_2153 567
698 3300046689 Ga0495613_0008391 Ga0495613_0008391_5605_7347 567
699 3300046690 Ga0495624_0001342 Ga0495624_0001342_4619_6361 567
700 3300047315 Ga0495581_0000018 Ga0495581_0000018_23042_24784 567
701 3300047319 Ga0495674_0000134 Ga0495674_0000134_9420_11162 567
702 3300047673 Ga0495593_0000072 Ga0495593_0000072_27582_29324 567
703 3300048089 Ga0495614_0014011 Ga0495614_0014011_297_2039 567
704 3300048903 Ga0496100_0047806 Ga0496100_0047806_336_2078 567
705 3300048905 Ga0496102_0093512 Ga0496102_0093512_509_2251 567
706 3300048907 Ga0496104_0101667 Ga0496104_0101667_271_2013 567
707 3300048909 Ga0496106_0024272 Ga0496106_0024272_2442_4184 567
708 3300048913 Ga0496110_0032951 Ga0496110_0032951_2407_4149 567
709 3300048915 Ga0496112_0000019 Ga0496112_0000019_130842_132593 567
710 3300048917 Ga0496114_0003712 Ga0496114_0003712_5134_6876 567
711 3300048917 Ga0496114_0003910 Ga0496114_0003910_3485_5227 567
712 3300048918 Ga0496115_0001711 Ga0496115_0001711_6074_7816 567
713 3300048929 Ga0496126_0043595 Ga0496126_0043595_1242_3020 567
714 3300048929 Ga0496126_0047952 Ga0496126_0047952_1215_2966 567
715 3300049583 Ga0501067_0017156 Ga0501067_0017156_1356_3116 567
716 3300050496 nmdc:mga07m45_10790_c1 nmdc:mga07m45_10790_c1_797_2548 567
717 3300053077 Ga0495601_0044676 Ga0495601_0044676_658_2400 567
718 3300053080 Ga0500635_0014926 Ga0500635_0014926_391_2133 567
719 3300053119 Ga0500595_007200 Ga0500595_007200_2795_4546 567
720 3300053150 Ga0500603_000165 Ga0500603_000165_14685_16427 567
721 3300053178 Ga0500637_0018015 Ga0500637_0018015_150_1892 567
722 3300005435 Ga0070714_100039232 Ga0070714_1000392323 568
723 3300005563 Ga0068855_100086805 Ga0068855_1000868053 568
724 3300005614 Ga0068856_100073128 Ga0068856_1000731282 568
725 3300025929 Ga0207664_10025212 Ga0207664_100252123 568
726 3300026041 Ga0207639_10084776 Ga0207639_100847762 568
727 3300006353 Ga0075370_10017249 Ga0075370_100172492 569
728 3300030521 Ga0307511_10028194 Ga0307511_100281945 569
729 3300049823 Ga0501044_0010517 Ga0501044_0010517_3475_5226 569
730 3300005434 Ga0070709_10055666 Ga0070709_100556662 570
731 3300025906 Ga0207699_10055717 Ga0207699_100557172 570
732 3300025929 Ga0207664_10014340 Ga0207664_100143402 570
733 3300005347 Ga0070668_100003177 Ga0070668_1000031779 576
734 3300005367 Ga0070667_100014374 Ga0070667_1000143743 576
735 3300005548 Ga0070665_100000300 Ga0070665_10000030038 576
736 3300005844 Ga0068862_100023319 Ga0068862_1000233192 576
737 3300009177 Ga0105248_10101093 Ga0105248_101010933 576
738 3300025941 Ga0207711_10060400 Ga0207711_100604001 576
739 3300025972 Ga0207668_10000206 Ga0207668_1000020635 576
740 3300025986 Ga0207658_10002058 Ga0207658_1000205811 576
741 3300028379 Ga0268266_10001512 Ga0268266_1000151225 576
742 3300028380 Ga0268265_10023588 Ga0268265_100235883 576
743 3300001904 JGI24736J21556_1000255 JGI24736J21556_10002554 580
744 3300001904 JGI24736J21556_1001954 JGI24736J21556_10019543 580
745 3300001915 JGI24741J21665_1000319 JGI24741J21665_10003192 580
746 3300001979 JGI24740J21852_10002383 JGI24740J21852_100023836 580
747 3300001989 JGI24739J22299_10000140 JGI24739J22299_100001404 580
748 3300001989 JGI24739J22299_10015400 JGI24739J22299_100154002 580
749 3300002067 JGI24735J21928_10000421 JGI24735J21928_100004217 580
750 3300002075 JGI24738J21930_10000172 JGI24738J21930_1000017216 580
751 3300002075 JGI24738J21930_10004142 JGI24738J21930_100041422 580
752 3300005337 Ga0070682_100057594 Ga0070682_1000575942 580
753 3300005339 Ga0070660_100057258 Ga0070660_1000572581 580
754 3300005344 Ga0070661_100052486 Ga0070661_1000524862 580
755 3300005457 Ga0070662_100061223 Ga0070662_1000612233 580
756 3300005564 Ga0070664_100040931 Ga0070664_1000409313 580
757 3300005577 Ga0068857_100018795 Ga0068857_1000187955 580
758 3300009174 Ga0105241_10003385 Ga0105241_100033852 580
759 3300013104 Ga0157370_10010501 Ga0157370_100105016 580
760 3300013307 Ga0157372_10098716 Ga0157372_100987162 580
761 3300025321 Ga0207656_10008793 Ga0207656_100087932 580
762 3300025904 Ga0207647_10001008 Ga0207647_1000100810 580
763 3300025909 Ga0207705_10062433 Ga0207705_100624332 580
764 3300025911 Ga0207654_10001821 Ga0207654_100018212 580
765 3300025913 Ga0207695_10017517 Ga0207695_100175171 580
766 3300025913 Ga0207695_10184871 Ga0207695_101848712 580
767 3300025914 Ga0207671_10002722 Ga0207671_100027229 580
768 3300025919 Ga0207657_10043683 Ga0207657_100436833 580
769 3300025924 Ga0207694_10006266 Ga0207694_100062662 580
770 3300025924 Ga0207694_10121213 Ga0207694_101212132 580
771 3300025933 Ga0207706_10005065 Ga0207706_1000506510 580
772 3300025933 Ga0207706_10069306 Ga0207706_100693062 580
773 3300025981 Ga0207640_10046274 Ga0207640_100462742 580
774 3300026041 Ga0207639_10000716 Ga0207639_1000071616 580
775 3300026041 Ga0207639_10010687 Ga0207639_100106876 580
776 3300026078 Ga0207702_10003834 Ga0207702_100038344 580
777 3300026078 Ga0207702_10004629 Ga0207702_1000462911 580
778 3300026116 Ga0207674_10053198 Ga0207674_100531984 580
779 3300031548 Ga0307408_100001451 Ga0307408_1000014518 580
780 3300031731 Ga0307405_10020376 Ga0307405_100203762 580
781 3300031731 Ga0307405_10046204 Ga0307405_100462042 580
782 3300031852 Ga0307410_10012623 Ga0307410_100126231 580
783 3300032002 Ga0307416_100101138 Ga0307416_1001011382 580
784 3300032004 Ga0307414_10000290 Ga0307414_1000029018 580
785 3300049663 Ga0501223_000074 Ga0501223_000074_5473_7215 580
786 3300049664 Ga0501224_000017 Ga0501224_000017_23045_24787 580
787 3300049668 Ga0501233_000110 Ga0501233_000110_2626_4368 580
788 3300049669 Ga0501235_000012 Ga0501235_000012_26419_28161 580
789 3300049705 Ga0501225_0000007 Ga0501225_0000007_23051_24793 580
790 3300049707 Ga0501234_000212 Ga0501234_000212_2622_4364 580
791 3300049853 Ga0501226_000040 Ga0501226_000040_2622_4364 580

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07969

Amidohydro_3

Amidohydrolase family

41

536

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gip-assembly2.cif.gz_B crystal structure of n-acyl-d-glutamate deacylase from bordetella bronchiseptica complexed with zinc, acetate and formate ions. 0.7713 5 563
3gip-assembly2.cif.gz_B crystal structure of n-acyl-d-glutamate deacylase from bordetella bronchiseptica complexed with zinc, acetate and formate ions. 0.7652 5 563
1v4y-assembly1.cif.gz_A the functional role of the binuclear metal center in d-aminoacylase. one-metal activation and second-metal attenuation 0.7388 5 563
1rk6-assembly1.cif.gz_A the enzyme in complex with 50mm cdcl2 0.7362 5 563
1rk5-assembly1.cif.gz_A the d-aminoacylase mutant d366a in complex with 100mm cucl2 0.7361 5 563
ID Description Score Start End Superfamily
1rjrA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9335 5 55 2.30.40.10
af_P77671_2_52_2.30.40.10 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9222 4 54 2.30.40.10
1nfgD01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9137 6 57 2.30.40.10
3e74D01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.91 4 56 2.30.40.10
1nfgB01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9059 6 54 2.30.40.10
ID Description Score Start End GO Terms
AF-A0A7I0KHE5-F1-model_v4 deleted 0.9896 57 206
AF-X7XNI6-F1-model_v4 Amidohydrolase family protein 0.9855 57 180 GO:0016787
AF-A0A4Q3CNI2-F1-model_v4 D-aminoacylase 0.9845 5 218 GO:0005829
GO:0016812
AF-A0A349J4A3-F1-model_v4 Amidohydrolase 0.9833 3 264 GO:0005829
GO:0016812
AF-A0A3D1GG47-F1-model_v4 deleted 0.9833 3 225

Feature Viewer

pLDDT pTM Quality
91.95 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map