F481006
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 791 | 497 | 620 | 573 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2879083081|2879087501 |
| Length | 610 |
| Sequence | DLVIRGGTVADGRGGELFEADVAITGGRISEVGKVSAKGKEEIDARGKLVTPGFVDVHTHYDGQVTWSQDITPSSQNGVTTAIMGNCGVGFAPCRPADHTRLIQLMEGVEDIPEPVLSAGIPWAWESFPDYMDWLSKRDFDIDVGAQLPHAALRVYVMGERGARRDPSTAEDNAAMARLAGEAVRSGALGFSTSRTLNHRTSTGDFTPTLKAGEDELTAIAGAMHRQGRSVLQFVLDLSTIHEDLPMMLRVADATKCPISFSITQNDKAPQRWRQTLDEINAAAQRGLSITAQIAARPVGLLLGLELSRNPFQTHPSYKAIAHLPLQERLARLHQSDVRKAILSETATATDDPLFFRPNYDKMFLLGDPPDYEQPPENALGPQARRQGRQPEELAYDAMLSDEGRGMLYVPFLNYSDGNLDATREMLIDPQSVPGLSDGGAHCGIICDASFPTYLLTHWTRDRKRGEKLSIPFVVAAQSRKTALSVGLTDRGLIAPGYKADVNVIDYDRLHLHPPKVHYDLPVGGRRLLQDVXDRVRRGDAAAGRGDRAPAGEADSGRAGGGELAETASETRRPRLNLRVVLAKARTHYPKKKLWHEAGDHNSSQNCFLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 3 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 6 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 11 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 12 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 15 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 16 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 19 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 20 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 21 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 22 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 23 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 24 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 25 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 26 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 27 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 28 | 2791355199 | |||
| 29 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 30 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 31 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 32 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 33 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 34 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 35 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 36 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 37 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 38 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 39 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 40 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 41 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 42 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 43 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 44 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 45 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 46 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 47 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 48 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 49 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 50 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 51 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 52 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 53 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 54 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 55 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 56 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 57 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 58 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 59 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 60 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 61 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 62 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 63 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 64 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 65 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 66 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 67 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 68 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 69 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 70 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 71 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 72 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 73 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 74 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 75 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 76 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 77 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 78 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 79 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 80 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 81 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 82 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 83 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 84 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 85 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 86 | 2904699407 | |||
| 87 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 88 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 89 | 2906610324 | |||
| 90 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 91 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 92 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 93 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 94 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 95 | 2922368715 | |||
| 96 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 97 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 98 | 2922425934 | |||
| 99 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 100 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 101 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 102 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 103 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 104 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 105 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 106 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 107 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 108 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 109 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 110 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 111 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 112 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 113 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 114 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 115 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 116 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 117 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 118 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 119 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 120 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 121 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 122 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 123 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 124 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 125 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 126 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 127 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 128 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 129 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 130 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 131 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 132 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 133 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 134 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 135 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 136 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 137 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 138 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 139 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 140 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 141 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 142 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 143 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 144 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 145 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 146 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 147 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 148 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 149 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 150 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 151 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 152 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 153 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 155 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 156 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 157 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 158 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 163 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 165 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 168 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 173 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 174 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 175 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 177 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 178 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 179 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 182 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 184 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 185 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 186 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 187 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 188 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 189 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 190 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 191 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 192 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 193 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 194 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 195 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 196 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 197 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 198 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 199 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 200 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 201 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 202 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 203 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 204 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 205 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 206 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 207 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 208 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 209 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 211 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 212 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 213 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 222 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 229 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 230 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 231 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 236 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 283 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 284 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 285 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 286 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 290 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 291 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 292 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 293 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 294 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 295 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 296 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 297 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 298 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 299 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 300 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 301 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 302 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 303 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 304 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 305 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 306 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 307 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 308 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 309 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 310 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 311 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 312 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 313 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 314 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 315 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 316 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 317 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 318 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 319 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 320 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 321 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 322 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 323 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 324 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 325 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 326 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 327 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 328 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 329 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 330 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 331 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 332 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 333 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 334 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 335 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 336 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 337 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 338 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 339 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 340 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 341 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 342 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 343 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 344 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 345 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 346 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 347 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 348 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 400 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 401 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 402 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 406 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 407 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 408 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 409 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 410 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 411 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 412 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 413 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 414 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 415 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 428 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 429 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 430 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 431 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 432 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 433 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 434 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 437 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 438 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 439 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 440 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 441 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 442 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 443 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 444 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 448 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 450 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 453 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 454 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 455 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 456 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 457 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 458 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 459 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 460 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 461 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 462 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 463 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 464 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 465 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 467 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 469 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 470 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 471 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 472 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 473 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 474 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 475 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 476 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 477 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 478 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 479 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 480 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 481 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 482 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 483 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 484 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 485 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 486 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 487 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 488 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 489 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 490 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 491 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 492 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 493 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 494 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 495 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 496 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 497 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.75 |
| Metatranscriptomes | 0.13 |
| Isolates | 21.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.72 |
| Nodule | 16.18 |
| Rhizoplane | 2.15 |
| Rhizosphere | 60.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000255 | 3300001904 | Bacteria | 9757 |
| 2 | JGI24736J21556_1001954 | 3300001904 | Bacteria | 3663 |
| 3 | JGI24741J21665_1000319 | 3300001915 | Bacteria | 14359 |
| 4 | JGI24740J21852_10002383 | 3300001979 | Bacteria | 8550 |
| 5 | JGI24739J22299_10000140 | 3300001989 | Bacteria | 22993 |
| 6 | JGI24739J22299_10015400 | 3300001989 | Bacteria | 2777 |
| 7 | JGI24735J21928_10000421 | 3300002067 | Bacteria | 14823 |
| 8 | JGI24738J21930_10000172 | 3300002075 | Bacteria | 16532 |
| 9 | JGI24738J21930_10004142 | 3300002075 | Bacteria | 3574 |
| 10 | JGI25406J46586_10000009 | 3300003203 | Bacteria | 109818 |
| 11 | JGI25406J46586_10001070 | 3300003203 | Bacteria | 12840 |
| 12 | JGI25153J46596_10022574 | 3300003215 | Bacteria | 2315 |
| 13 | JGI25404J52841_10001198 | 3300003659 | Bacteria | 4450 |
| 14 | Ga0055531_10005473 | 3300003794 | Bacteria | 7432 |
| 15 | Ga0065165_1001210 | 3300005262 | Bacteria | 29773 |
| 16 | Ga0070658_10000139 | 3300005327 | Bacteria | 63781 |
| 17 | Ga0070683_100008185 | 3300005329 | Bacteria | 8883 |
| 18 | Ga0070683_100011699 | 3300005329 | Bacteria | 7598 |
| 19 | Ga0070680_100121442 | 3300005336 | Bacteria | 2181 |
| 20 | Ga0070682_100057594 | 3300005337 | Bacteria | 2449 |
| 21 | Ga0068868_100031113 | 3300005338 | Bacteria | 4096 |
| 22 | Ga0070660_100057258 | 3300005339 | Bacteria | 3018 |
| 23 | Ga0070660_100129899 | 3300005339 | Bacteria | 2015 |
| 24 | Ga0070661_100000694 | 3300005344 | Bacteria | 24691 |
| 25 | Ga0070661_100052486 | 3300005344 | Bacteria | 2984 |
| 26 | Ga0070661_100099425 | 3300005344 | Bacteria | 2162 |
| 27 | Ga0070661_100117353 | 3300005344 | Bacteria | 1991 |
| 28 | Ga0070668_100000588 | 3300005347 | Bacteria | 24372 |
| 29 | Ga0070668_100001432 | 3300005347 | Bacteria | 17218 |
| 30 | Ga0070668_100003177 | 3300005347 | Bacteria | 12112 |
| 31 | Ga0070668_100047689 | 3300005347 | Bacteria | 3294 |
| 32 | Ga0070669_100023897 | 3300005353 | Bacteria | 4379 |
| 33 | Ga0070688_100049792 | 3300005365 | Bacteria | 2608 |
| 34 | Ga0070667_100000336 | 3300005367 | Bacteria | 52390 |
| 35 | Ga0070667_100014374 | 3300005367 | Bacteria | 6541 |
| 36 | Ga0070709_10000732 | 3300005434 | Bacteria | 18548 |
| 37 | Ga0070709_10005089 | 3300005434 | Bacteria | 7105 |
| 38 | Ga0070709_10055666 | 3300005434 | Bacteria | 2498 |
| 39 | Ga0070714_100013699 | 3300005435 | Bacteria | 6502 |
| 40 | Ga0070714_100039232 | 3300005435 | Bacteria | 3986 |
| 41 | Ga0070713_100000001 | 3300005436 | Bacteria | 257984 |
| 42 | Ga0070713_100007516 | 3300005436 | Bacteria | 7657 |
| 43 | Ga0070710_10000211 | 3300005437 | Bacteria | 27400 |
| 44 | Ga0070711_100001113 | 3300005439 | Bacteria | 14371 |
| 45 | Ga0070708_100001185 | 3300005445 | Bacteria | 20037 |
| 46 | Ga0070663_100005865 | 3300005455 | Bacteria | 7342 |
| 47 | Ga0070662_100061223 | 3300005457 | Bacteria | 2747 |
| 48 | Ga0070681_10013363 | 3300005458 | Bacteria | 8159 |
| 49 | Ga0068867_100092449 | 3300005459 | Bacteria | 2297 |
| 50 | Ga0070707_100038205 | 3300005468 | Bacteria | 4584 |
| 51 | Ga0070699_100095278 | 3300005518 | Bacteria | 2606 |
| 52 | Ga0070679_100028402 | 3300005530 | Bacteria | 5515 |
| 53 | Ga0070684_100054727 | 3300005535 | Bacteria | 3477 |
| 54 | Ga0068853_100004334 | 3300005539 | Bacteria | 10976 |
| 55 | Ga0068853_100015425 | 3300005539 | Bacteria | 6277 |
| 56 | Ga0068853_100137791 | 3300005539 | Bacteria | 2189 |
| 57 | Ga0070693_100019429 | 3300005547 | Bacteria | 3562 |
| 58 | Ga0070693_100054567 | 3300005547 | Bacteria | 2299 |
| 59 | Ga0070665_100000078 | 3300005548 | Bacteria | 188101 |
| 60 | Ga0070665_100000300 | 3300005548 | Bacteria | 77545 |
| 61 | Ga0070665_100027867 | 3300005548 | Bacteria | 5689 |
| 62 | Ga0070665_100035980 | 3300005548 | Bacteria | 4981 |
| 63 | Ga0068855_100000378 | 3300005563 | Bacteria | 55131 |
| 64 | Ga0068855_100012487 | 3300005563 | Bacteria | 10252 |
| 65 | Ga0068855_100013741 | 3300005563 | Bacteria | 9760 |
| 66 | Ga0068855_100029724 | 3300005563 | Bacteria | 6534 |
| 67 | Ga0068855_100041051 | 3300005563 | Bacteria | 5486 |
| 68 | Ga0068855_100086805 | 3300005563 | Bacteria | 3618 |
| 69 | Ga0068855_100156827 | 3300005563 | Bacteria | 2586 |
| 70 | Ga0070664_100024756 | 3300005564 | Bacteria | 4970 |
| 71 | Ga0070664_100040931 | 3300005564 | Bacteria | 3909 |
| 72 | Ga0068857_100016293 | 3300005577 | Bacteria | 6511 |
| 73 | Ga0068857_100018032 | 3300005577 | Bacteria | 6192 |
| 74 | Ga0068857_100018795 | 3300005577 | Bacteria | 6064 |
| 75 | Ga0068857_100031281 | 3300005577 | Bacteria | 4702 |
| 76 | Ga0068857_100116211 | 3300005577 | Bacteria | 2407 |
| 77 | Ga0068854_100000426 | 3300005578 | Bacteria | 26255 |
| 78 | Ga0068856_100001641 | 3300005614 | Bacteria | 23439 |
| 79 | Ga0068856_100002749 | 3300005614 | Bacteria | 18013 |
| 80 | Ga0068856_100051247 | 3300005614 | Bacteria | 4070 |
| 81 | Ga0068856_100073128 | 3300005614 | Bacteria | 3395 |
| 82 | Ga0068856_100078242 | 3300005614 | Bacteria | 3279 |
| 83 | Ga0068856_100139218 | 3300005614 | Bacteria | 2434 |
| 84 | Ga0068856_100191346 | 3300005614 | Bacteria | 2060 |
| 85 | Ga0068852_100000175 | 3300005616 | Bacteria | 43326 |
| 86 | Ga0068852_100002923 | 3300005616 | Bacteria | 11867 |
| 87 | Ga0068852_100016987 | 3300005616 | Bacteria | 5696 |
| 88 | Ga0068852_100046890 | 3300005616 | Bacteria | 3684 |
| 89 | Ga0068859_100025710 | 3300005617 | Bacteria | 5904 |
| 90 | Ga0068864_100016804 | 3300005618 | Bacteria | 6099 |
| 91 | Ga0068861_100009916 | 3300005719 | Bacteria | 6594 |
| 92 | Ga0068861_100102745 | 3300005719 | Bacteria | 2276 |
| 93 | Ga0068851_10005892 | 3300005834 | Bacteria | 5579 |
| 94 | Ga0068863_100007964 | 3300005841 | Bacteria | 10357 |
| 95 | Ga0068863_100067148 | 3300005841 | Bacteria | 3392 |
| 96 | Ga0068860_100000226 | 3300005843 | Bacteria | 87552 |
| 97 | Ga0068860_100000257 | 3300005843 | Bacteria | 78468 |
| 98 | Ga0068860_100111973 | 3300005843 | Bacteria | 2610 |
| 99 | Ga0068862_100002606 | 3300005844 | Bacteria | 15879 |
| 100 | Ga0068862_100023319 | 3300005844 | Bacteria | 5184 |
| 101 | Ga0068862_100054667 | 3300005844 | Bacteria | 3418 |
| 102 | Ga0081455_10002868 | 3300005937 | Bacteria | 20303 |
| 103 | Ga0081455_10010356 | 3300005937 | Bacteria | 9474 |
| 104 | Ga0081455_10015530 | 3300005937 | Bacteria | 7393 |
| 105 | Ga0081455_10015618 | 3300005937 | Bacteria | 7367 |
| 106 | Ga0081455_10018973 | 3300005937 | Bacteria | 6521 |
| 107 | Ga0081540_1002606 | 3300005983 | Bacteria | 14657 |
| 108 | Ga0081540_1002760 | 3300005983 | Bacteria | 14251 |
| 109 | Ga0081540_1006050 | 3300005983 | Bacteria | 8898 |
| 110 | Ga0081540_1017407 | 3300005983 | Bacteria | 4451 |
| 111 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 112 | Ga0081539_10000530 | 3300005985 | Bacteria | 79454 |
| 113 | Ga0081539_10001781 | 3300005985 | Bacteria | 34193 |
| 114 | Ga0075365_10002405 | 3300006038 | Bacteria | 9164 |
| 115 | Ga0075365_10009745 | 3300006038 | Bacteria | 5548 |
| 116 | Ga0075365_10027068 | 3300006038 | Bacteria | 3644 |
| 117 | Ga0075365_10046749 | 3300006038 | Bacteria | 2843 |
| 118 | Ga0075368_10002838 | 3300006042 | Bacteria | 5719 |
| 119 | Ga0075363_100018680 | 3300006048 | Bacteria | 3458 |
| 120 | Ga0075363_100036631 | 3300006048 | Bacteria | 2574 |
| 121 | Ga0075364_10018801 | 3300006051 | Bacteria | 4332 |
| 122 | Ga0075364_10049260 | 3300006051 | Bacteria | 2747 |
| 123 | Ga0075364_10069979 | 3300006051 | Bacteria | 2309 |
| 124 | Ga0070712_100000198 | 3300006175 | Bacteria | 33726 |
| 125 | Ga0070712_100000499 | 3300006175 | Bacteria | 22474 |
| 126 | Ga0070712_100001393 | 3300006175 | Bacteria | 14686 |
| 127 | Ga0070712_100131881 | 3300006175 | Bacteria | 1895 |
| 128 | Ga0075367_10005576 | 3300006178 | Bacteria | 6268 |
| 129 | Ga0075367_10007186 | 3300006178 | Bacteria | 5685 |
| 130 | Ga0075367_10008487 | 3300006178 | Bacteria | 5324 |
| 131 | Ga0075367_10012265 | 3300006178 | Bacteria | 4563 |
| 132 | Ga0075367_10112318 | 3300006178 | Bacteria | 1673 |
| 133 | Ga0075369_10008692 | 3300006186 | Bacteria | 3919 |
| 134 | Ga0075366_10041363 | 3300006195 | Bacteria | 2729 |
| 135 | Ga0075370_10017249 | 3300006353 | Bacteria | 3899 |
| 136 | Ga0075428_100056275 | 3300006844 | Bacteria | 4308 |
| 137 | Ga0075434_100055004 | 3300006871 | Bacteria | 3955 |
| 138 | Ga0075436_100012867 | 3300006914 | Bacteria | 5736 |
| 139 | Ga0075436_100025717 | 3300006914 | Bacteria | 4051 |
| 140 | Ga0075436_100081699 | 3300006914 | Bacteria | 2241 |
| 141 | Ga0097620_100025710 | 3300006931 | Bacteria | 5904 |
| 142 | Ga0099824_1015031 | 3300006942 | Bacteria | 7483 |
| 143 | Ga0099822_1015114 | 3300006943 | Bacteria | 8734 |
| 144 | Ga0099823_1022970 | 3300006944 | Bacteria | 5741 |
| 145 | Ga0105240_10004409 | 3300009093 | Bacteria | 21468 |
| 146 | Ga0105240_10006449 | 3300009093 | Bacteria | 17248 |
| 147 | Ga0105240_10009432 | 3300009093 | Bacteria | 13814 |
| 148 | Ga0105240_10011824 | 3300009093 | Bacteria | 12121 |
| 149 | Ga0105240_10263964 | 3300009093 | Bacteria | 1985 |
| 150 | Ga0111539_10021057 | 3300009094 | Bacteria | 8030 |
| 151 | Ga0114129_10161538 | 3300009147 | Bacteria | 3060 |
| 152 | Ga0114129_10170059 | 3300009147 | Bacteria | 2972 |
| 153 | Ga0105241_10003385 | 3300009174 | Bacteria | 11876 |
| 154 | Ga0105248_10067566 | 3300009177 | Bacteria | 4014 |
| 155 | Ga0105248_10089062 | 3300009177 | Bacteria | 3474 |
| 156 | Ga0105248_10101093 | 3300009177 | Bacteria | 3250 |
| 157 | Ga0105237_10012543 | 3300009545 | Bacteria | 8927 |
| 158 | Ga0105237_10020700 | 3300009545 | Bacteria | 6775 |
| 159 | Ga0105238_10011332 | 3300009551 | Bacteria | 8971 |
| 160 | Ga0105238_10024913 | 3300009551 | Bacteria | 6097 |
| 161 | Ga0105238_10033741 | 3300009551 | Bacteria | 5208 |
| 162 | Ga0105249_10119609 | 3300009553 | Bacteria | 2502 |
| 163 | Ga0099796_10017188 | 3300010159 | Bacteria | 2149 |
| 164 | Ga0105239_10004474 | 3300010375 | Bacteria | 16696 |
| 165 | Ga0105239_10014534 | 3300010375 | Bacteria | 8734 |
| 166 | Ga0105239_10036439 | 3300010375 | Bacteria | 5401 |
| 167 | Ga0105239_10060804 | 3300010375 | Bacteria | 4146 |
| 168 | Ga0157370_10003943 | 3300013104 | Bacteria | 17267 |
| 169 | Ga0157370_10007832 | 3300013104 | Bacteria | 11577 |
| 170 | Ga0157370_10010501 | 3300013104 | Bacteria | 9753 |
| 171 | Ga0157370_10142767 | 3300013104 | Bacteria | 2231 |
| 172 | Ga0157369_10016112 | 3300013105 | Bacteria | 8412 |
| 173 | Ga0157369_10104037 | 3300013105 | Bacteria | 3024 |
| 174 | Ga0157369_10132887 | 3300013105 | Bacteria | 2636 |
| 175 | Ga0163162_10030837 | 3300013306 | Bacteria | 5313 |
| 176 | Ga0157372_10098716 | 3300013307 | Bacteria | 3332 |
| 177 | Ga0157379_10013671 | 3300014968 | Bacteria | 7114 |
| 178 | Ga0213872_10016552 | 3300021361 | Bacteria | 3420 |
| 179 | Ga0213872_10055869 | 3300021361 | Bacteria | 1789 |
| 180 | Ga0213876_10000991 | 3300021384 | Bacteria | 18609 |
| 181 | Ga0224712_10008506 | 3300022467 | Bacteria | 3047 |
| 182 | Ga0209563_101775 | 3300025230 | Bacteria | 5420 |
| 183 | Ga0209677_100351 | 3300025253 | Bacteria | 28656 |
| 184 | Ga0209233_1001962 | 3300025261 | Bacteria | 7828 |
| 185 | Ga0209233_1006063 | 3300025261 | Bacteria | 3935 |
| 186 | Ga0209455_1002928 | 3300025272 | Bacteria | 6295 |
| 187 | Ga0209455_1011707 | 3300025272 | Bacteria | 2145 |
| 188 | Ga0209564_1003394 | 3300025295 | Bacteria | 10967 |
| 189 | Ga0209758_1008915 | 3300025297 | Bacteria | 6365 |
| 190 | Ga0209758_1016969 | 3300025297 | Bacteria | 3660 |
| 191 | Ga0209758_1019265 | 3300025297 | Bacteria | 3298 |
| 192 | Ga0207426_1000201 | 3300025302 | Bacteria | 143975 |
| 193 | Ga0207426_1000617 | 3300025302 | Bacteria | 45527 |
| 194 | Ga0207426_1014838 | 3300025302 | Bacteria | 2846 |
| 195 | Ga0209257_1000440 | 3300025304 | Bacteria | 79182 |
| 196 | Ga0207656_10008793 | 3300025321 | Bacteria | 3733 |
| 197 | Ga0207692_10000494 | 3300025898 | Bacteria | 13955 |
| 198 | Ga0207680_10001139 | 3300025903 | Bacteria | 12562 |
| 199 | Ga0207647_10001008 | 3300025904 | Bacteria | 21880 |
| 200 | Ga0207647_10036497 | 3300025904 | Bacteria | 3123 |
| 201 | Ga0207699_10000096 | 3300025906 | Bacteria | 63442 |
| 202 | Ga0207699_10004161 | 3300025906 | Bacteria | 6928 |
| 203 | Ga0207699_10009117 | 3300025906 | Bacteria | 4927 |
| 204 | Ga0207699_10055717 | 3300025906 | Bacteria | 2354 |
| 205 | Ga0207645_10102983 | 3300025907 | Bacteria | 1843 |
| 206 | Ga0207643_10050478 | 3300025908 | Bacteria | 2359 |
| 207 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 208 | Ga0207705_10062433 | 3300025909 | Bacteria | 2691 |
| 209 | Ga0207684_10038515 | 3300025910 | Bacteria | 4056 |
| 210 | Ga0207654_10001821 | 3300025911 | Bacteria | 11064 |
| 211 | Ga0207707_10002611 | 3300025912 | Bacteria | 16136 |
| 212 | Ga0207707_10005017 | 3300025912 | Bacteria | 11625 |
| 213 | Ga0207707_10014215 | 3300025912 | Bacteria | 6934 |
| 214 | Ga0207707_10016113 | 3300025912 | Bacteria | 6517 |
| 215 | Ga0207695_10005145 | 3300025913 | Bacteria | 17515 |
| 216 | Ga0207695_10017517 | 3300025913 | Bacteria | 8334 |
| 217 | Ga0207695_10020475 | 3300025913 | Bacteria | 7574 |
| 218 | Ga0207695_10046036 | 3300025913 | Bacteria | 4625 |
| 219 | Ga0207695_10053694 | 3300025913 | Bacteria | 4212 |
| 220 | Ga0207695_10070362 | 3300025913 | Bacteria | 3577 |
| 221 | Ga0207695_10184871 | 3300025913 | Bacteria | 2004 |
| 222 | Ga0207671_10002722 | 3300025914 | Bacteria | 18502 |
| 223 | Ga0207671_10027264 | 3300025914 | Bacteria | 4271 |
| 224 | Ga0207671_10078398 | 3300025914 | Bacteria | 2474 |
| 225 | Ga0207671_10093117 | 3300025914 | Bacteria | 2273 |
| 226 | Ga0207693_10000094 | 3300025915 | Bacteria | 79297 |
| 227 | Ga0207693_10001776 | 3300025915 | Bacteria | 18911 |
| 228 | Ga0207693_10007348 | 3300025915 | Bacteria | 9061 |
| 229 | Ga0207663_10000356 | 3300025916 | Bacteria | 19925 |
| 230 | Ga0207663_10108814 | 3300025916 | Bacteria | 1877 |
| 231 | Ga0207660_10012408 | 3300025917 | Bacteria | 5575 |
| 232 | Ga0207657_10004425 | 3300025919 | Bacteria | 14870 |
| 233 | Ga0207657_10043683 | 3300025919 | Bacteria | 3945 |
| 234 | Ga0207657_10117356 | 3300025919 | Bacteria | 2192 |
| 235 | Ga0207649_10008646 | 3300025920 | Bacteria | 5560 |
| 236 | Ga0207652_10022596 | 3300025921 | Bacteria | 5205 |
| 237 | Ga0207652_10023805 | 3300025921 | Bacteria | 5077 |
| 238 | Ga0207652_10024973 | 3300025921 | Bacteria | 4963 |
| 239 | Ga0207652_10042328 | 3300025921 | Bacteria | 3876 |
| 240 | Ga0207652_10077235 | 3300025921 | Bacteria | 2906 |
| 241 | Ga0207646_10023005 | 3300025922 | Bacteria | 5730 |
| 242 | Ga0207694_10006266 | 3300025924 | Bacteria | 9085 |
| 243 | Ga0207694_10018576 | 3300025924 | Bacteria | 5255 |
| 244 | Ga0207694_10033146 | 3300025924 | Bacteria | 3957 |
| 245 | Ga0207694_10070539 | 3300025924 | Bacteria | 2730 |
| 246 | Ga0207694_10121213 | 3300025924 | Bacteria | 2088 |
| 247 | Ga0207700_10000015 | 3300025928 | Bacteria | 224772 |
| 248 | Ga0207664_10001702 | 3300025929 | Bacteria | 14493 |
| 249 | Ga0207664_10006879 | 3300025929 | Bacteria | 7862 |
| 250 | Ga0207664_10014340 | 3300025929 | Bacteria | 5720 |
| 251 | Ga0207664_10025212 | 3300025929 | Bacteria | 4476 |
| 252 | Ga0207644_10034127 | 3300025931 | Bacteria | 3560 |
| 253 | Ga0207706_10005065 | 3300025933 | Bacteria | 12303 |
| 254 | Ga0207706_10026306 | 3300025933 | Bacteria | 5208 |
| 255 | Ga0207706_10061276 | 3300025933 | Bacteria | 3313 |
| 256 | Ga0207706_10069306 | 3300025933 | Bacteria | 3102 |
| 257 | Ga0207665_10001832 | 3300025939 | Bacteria | 14302 |
| 258 | Ga0207711_10060400 | 3300025941 | Bacteria | 3267 |
| 259 | Ga0207661_10000678 | 3300025944 | Bacteria | 22066 |
| 260 | Ga0207667_10000328 | 3300025949 | Bacteria | 65878 |
| 261 | Ga0207667_10030736 | 3300025949 | Bacteria | 5805 |
| 262 | Ga0207667_10043643 | 3300025949 | Bacteria | 4757 |
| 263 | Ga0207712_10073265 | 3300025961 | Bacteria | 2469 |
| 264 | Ga0207668_10000206 | 3300025972 | Bacteria | 40036 |
| 265 | Ga0207668_10001729 | 3300025972 | Bacteria | 12793 |
| 266 | Ga0207668_10010032 | 3300025972 | Bacteria | 5702 |
| 267 | Ga0207640_10000287 | 3300025981 | Bacteria | 33848 |
| 268 | Ga0207640_10046274 | 3300025981 | Bacteria | 2799 |
| 269 | Ga0207658_10000493 | 3300025986 | Bacteria | 36279 |
| 270 | Ga0207658_10002058 | 3300025986 | Bacteria | 14977 |
| 271 | Ga0207658_10034048 | 3300025986 | Bacteria | 3637 |
| 272 | Ga0207639_10000716 | 3300026041 | Bacteria | 22737 |
| 273 | Ga0207639_10001766 | 3300026041 | Bacteria | 14546 |
| 274 | Ga0207639_10010687 | 3300026041 | Bacteria | 6357 |
| 275 | Ga0207639_10064344 | 3300026041 | Bacteria | 2843 |
| 276 | Ga0207639_10084776 | 3300026041 | Bacteria | 2518 |
| 277 | Ga0207678_10004673 | 3300026067 | Bacteria | 12297 |
| 278 | Ga0207678_10005720 | 3300026067 | Bacteria | 11096 |
| 279 | Ga0207708_10073069 | 3300026075 | Bacteria | 2628 |
| 280 | Ga0207702_10000011 | 3300026078 | Bacteria | 284514 |
| 281 | Ga0207702_10000056 | 3300026078 | Bacteria | 131186 |
| 282 | Ga0207702_10000465 | 3300026078 | Bacteria | 45960 |
| 283 | Ga0207702_10003834 | 3300026078 | Bacteria | 13567 |
| 284 | Ga0207702_10004629 | 3300026078 | Bacteria | 12185 |
| 285 | Ga0207702_10027318 | 3300026078 | Bacteria | 4739 |
| 286 | Ga0207641_10010473 | 3300026088 | Bacteria | 7614 |
| 287 | Ga0207676_10047316 | 3300026095 | Bacteria | 3333 |
| 288 | Ga0207674_10000002 | 3300026116 | Bacteria | 279738 |
| 289 | Ga0207674_10011854 | 3300026116 | Bacteria | 9773 |
| 290 | Ga0207674_10018427 | 3300026116 | Bacteria | 7587 |
| 291 | Ga0207674_10041082 | 3300026116 | Bacteria | 4785 |
| 292 | Ga0207674_10044321 | 3300026116 | Bacteria | 4581 |
| 293 | Ga0207674_10053198 | 3300026116 | Bacteria | 4128 |
| 294 | Ga0207675_100019629 | 3300026118 | Bacteria | 6309 |
| 295 | Ga0207683_10005111 | 3300026121 | Bacteria | 11262 |
| 296 | Ga0207698_10000200 | 3300026142 | Bacteria | 37521 |
| 297 | Ga0207698_10013801 | 3300026142 | Bacteria | 5346 |
| 298 | Ga0207698_10060721 | 3300026142 | Bacteria | 2941 |
| 299 | Ga0207698_10094597 | 3300026142 | Bacteria | 2457 |
| 300 | Ga0209389_1000029 | 3300027296 | Bacteria | 140337 |
| 301 | Ga0209389_1000076 | 3300027296 | Bacteria | 92447 |
| 302 | Ga0209589_1000012 | 3300027357 | Bacteria | 229451 |
| 303 | Ga0209589_1000013 | 3300027357 | Bacteria | 229273 |
| 304 | Ga0209589_1000017 | 3300027357 | Bacteria | 215546 |
| 305 | Ga0209489_100013 | 3300027361 | Bacteria | 229831 |
| 306 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 307 | Ga0209489_100416 | 3300027361 | Bacteria | 77981 |
| 308 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 309 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 310 | Ga0268266_10001512 | 3300028379 | Bacteria | 27338 |
| 311 | Ga0268266_10002705 | 3300028379 | Bacteria | 18600 |
| 312 | Ga0268266_10007460 | 3300028379 | Bacteria | 9865 |
| 313 | Ga0268266_10007480 | 3300028379 | Bacteria | 9845 |
| 314 | Ga0268266_10016799 | 3300028379 | Bacteria | 6256 |
| 315 | Ga0268266_10067389 | 3300028379 | Bacteria | 3098 |
| 316 | Ga0268265_10001536 | 3300028380 | Bacteria | 19196 |
| 317 | Ga0268265_10006531 | 3300028380 | Bacteria | 7901 |
| 318 | Ga0268265_10023588 | 3300028380 | Bacteria | 4339 |
| 319 | Ga0268265_10040483 | 3300028380 | Bacteria | 3442 |
| 320 | Ga0268264_10000049 | 3300028381 | Bacteria | 329992 |
| 321 | Ga0268264_10000110 | 3300028381 | Bacteria | 206663 |
| 322 | Ga0268264_10092696 | 3300028381 | Bacteria | 2608 |
| 323 | Ga0265337_1006176 | 3300028556 | Bacteria | 4655 |
| 324 | Ga0265326_10002792 | 3300028558 | Bacteria | 5848 |
| 325 | Ga0265319_1009715 | 3300028563 | Bacteria | 4070 |
| 326 | Ga0265334_10000250 | 3300028573 | Bacteria | 30819 |
| 327 | Ga0265334_10003782 | 3300028573 | Bacteria | 6840 |
| 328 | Ga0265334_10025471 | 3300028573 | Bacteria | 2394 |
| 329 | Ga0265323_10007852 | 3300028653 | Bacteria | 4414 |
| 330 | Ga0265336_10000430 | 3300028666 | Bacteria | 25854 |
| 331 | Ga0265338_10000024 | 3300028800 | Bacteria | 297778 |
| 332 | Ga0265324_10017100 | 3300029957 | Bacteria | 2638 |
| 333 | Ga0307511_10028194 | 3300030521 | Bacteria | 5106 |
| 334 | Ga0265330_10007390 | 3300031235 | Bacteria | 5360 |
| 335 | Ga0265320_10000594 | 3300031240 | Bacteria | 27815 |
| 336 | Ga0265325_10001297 | 3300031241 | Bacteria | 17699 |
| 337 | Ga0265325_10002005 | 3300031241 | Bacteria | 13988 |
| 338 | Ga0265340_10002628 | 3300031247 | Bacteria | 10217 |
| 339 | Ga0265339_10001140 | 3300031249 | Bacteria | 20068 |
| 340 | Ga0265327_10022936 | 3300031251 | Bacteria | 3713 |
| 341 | Ga0307509_10000606 | 3300031507 | Bacteria | 61010 |
| 342 | Ga0307509_10048794 | 3300031507 | Bacteria | 4544 |
| 343 | Ga0307509_10096831 | 3300031507 | Bacteria | 3001 |
| 344 | Ga0307408_100001451 | 3300031548 | Bacteria | 17634 |
| 345 | Ga0307408_100086651 | 3300031548 | Bacteria | 2354 |
| 346 | Ga0265313_10001099 | 3300031595 | Bacteria | 25965 |
| 347 | Ga0265314_10000900 | 3300031711 | Bacteria | 35261 |
| 348 | Ga0265342_10027107 | 3300031712 | Bacteria | 3586 |
| 349 | Ga0265342_10035094 | 3300031712 | Bacteria | 3072 |
| 350 | Ga0316576_10047899 | 3300031727 | Bacteria | 3098 |
| 351 | Ga0307516_10000019 | 3300031730 | Bacteria | 196679 |
| 352 | Ga0307516_10000022 | 3300031730 | Bacteria | 191854 |
| 353 | Ga0307516_10015603 | 3300031730 | Bacteria | 7985 |
| 354 | Ga0307516_10051214 | 3300031730 | Bacteria | 4048 |
| 355 | Ga0307405_10020376 | 3300031731 | Bacteria | 3704 |
| 356 | Ga0307405_10046204 | 3300031731 | Bacteria | 2673 |
| 357 | Ga0307410_10012623 | 3300031852 | Bacteria | 4893 |
| 358 | Ga0307416_100101138 | 3300032002 | Bacteria | 2509 |
| 359 | Ga0307414_10000290 | 3300032004 | Bacteria | 29508 |
| 360 | Ga0307507_10020473 | 3300033179 | Bacteria | 7405 |
| 361 | Ga0307510_10018815 | 3300033180 | Bacteria | 8110 |
| 362 | Ga0307510_10071464 | 3300033180 | Bacteria | 3455 |
| 363 | Ga0315911_1000033 | 3300033442 | Bacteria | 67159 |
| 364 | Ga0373926_0024371 | 3300035083 | Bacteria | 2107 |
| 365 | Ga0373923_0002084 | 3300035111 | Bacteria | 6054 |
| 366 | Ga0373945_0009195 | 3300035116 | Bacteria | 3234 |
| 367 | Ga0373954_0002205 | 3300035118 | Bacteria | 8088 |
| 368 | Ga0373954_0059527 | 3300035118 | Bacteria | 1800 |
| 369 | Ga0373956_0002935 | 3300035119 | Bacteria | 6901 |
| 370 | Ga0373956_0016925 | 3300035119 | Bacteria | 3066 |
| 371 | Ga0373957_0019136 | 3300035120 | Bacteria | 2405 |
| 372 | Ga0373955_0001794 | 3300035172 | Bacteria | 9223 |
| 373 | Ga0373955_0067773 | 3300035172 | Bacteria | 1987 |
| 374 | Ga0373924_0024589 | 3300035410 | Bacteria | 2374 |
| 375 | Ga0373935_0000229 | 3300035692 | Bacteria | 27393 |
| 376 | Ga0373935_0003845 | 3300035692 | Bacteria | 8759 |
| 377 | Ga0373927_0000071 | 3300035695 | Bacteria | 73794 |
| 378 | Ga0373927_0057240 | 3300035695 | Bacteria | 2521 |
| 379 | Ga0373933_0000114 | 3300035724 | Bacteria | 52016 |
| 380 | Ga0373933_0001425 | 3300035724 | Bacteria | 14028 |
| 381 | Ga0373933_0020486 | 3300035724 | Bacteria | 3749 |
| 382 | Ga0373947_0001708 | 3300035725 | Bacteria | 13470 |
| 383 | Ga0373947_0006904 | 3300035725 | Bacteria | 6582 |
| 384 | Ga0373947_0019069 | 3300035725 | Bacteria | 3953 |
| 385 | Ga0373947_0056547 | 3300035725 | Bacteria | 2371 |
| 386 | Ga0373937_0012158 | 3300036401 | Bacteria | 7557 |
| 387 | Ga0373937_0026032 | 3300036401 | Bacteria | 5285 |
| 388 | Ga0373937_0035451 | 3300036401 | Bacteria | 4541 |
| 389 | Ga0373937_0046477 | 3300036401 | Bacteria | 3970 |
| 390 | Ga0373937_0088287 | 3300036401 | Bacteria | 2870 |
| 391 | Ga0373925_0010883 | 3300037068 | Bacteria | 6599 |
| 392 | Ga0373925_0065052 | 3300037068 | Bacteria | 2746 |
| 393 | Ga0373925_0070478 | 3300037068 | Bacteria | 2643 |
| 394 | Ga0395899_0018305 | 3300037312 | Bacteria | 5326 |
| 395 | Ga0395900_0003234 | 3300037418 | Bacteria | 17637 |
| 396 | Ga0395900_0005520 | 3300037418 | Bacteria | 13242 |
| 397 | Ga0395900_0010634 | 3300037418 | Bacteria | 9410 |
| 398 | Ga0395900_0046530 | 3300037418 | Bacteria | 4468 |
| 399 | Ga0395900_0065380 | 3300037418 | Bacteria | 3736 |
| 400 | Ga0395898_0003112 | 3300037466 | Bacteria | 18739 |
| 401 | Ga0395898_0006599 | 3300037466 | Bacteria | 12370 |
| 402 | Ga0395905_0016353 | 3300037471 | Bacteria | 7049 |
| 403 | Ga0395901_0010773 | 3300038443 | Bacteria | 9269 |
| 404 | Ga0395901_0012472 | 3300038443 | Bacteria | 8624 |
| 405 | Ga0395901_0033187 | 3300038443 | Bacteria | 5327 |
| 406 | Ga0436365_0650112 | 3300039437 | Bacteria | 58550 |
| 407 | Ga0436365_0675289 | 3300039437 | Bacteria | 5759 |
| 408 | Ga0436365_0814378 | 3300039437 | Bacteria | 9894 |
| 409 | Ga0436365_1132543 | 3300039437 | Bacteria | 4959 |
| 410 | Ga0436365_1157676 | 3300039437 | Bacteria | 6249 |
| 411 | Ga0436365_1417024 | 3300039437 | Bacteria | 4984 |
| 412 | Ga0436365_1771573 | 3300039437 | Bacteria | 5105 |
| 413 | Ga0436360_0130148 | 3300039438 | Bacteria | 2301 |
| 414 | Ga0436361_0413058 | 3300039447 | Bacteria | 6307 |
| 415 | Ga0436361_0842658 | 3300039447 | Bacteria | 7066 |
| 416 | Ga0436362_0631557 | 3300039453 | Bacteria | 6192 |
| 417 | Ga0439432_027879 | 3300042006 | Bacteria | 1842 |
| 418 | Ga0466969_0015098 | 3300044656 | Bacteria | 4051 |
| 419 | Ga0466972_0000103 | 3300044658 | Bacteria | 75095 |
| 420 | Ga0466961_0000129 | 3300044693 | Bacteria | 50353 |
| 421 | Ga0466963_0064444 | 3300044694 | Bacteria | 2455 |
| 422 | Ga0466957_0065165 | 3300044842 | Bacteria | 2243 |
| 423 | Ga0466959_0005547 | 3300045049 | Bacteria | 8659 |
| 424 | Ga0495592_0010990 | 3300046454 | Bacteria | 6831 |
| 425 | Ga0495592_0019851 | 3300046454 | Bacteria | 5110 |
| 426 | Ga0495603_0000035 | 3300046455 | Bacteria | 57510 |
| 427 | Ga0495603_0004736 | 3300046455 | Bacteria | 8123 |
| 428 | Ga0495603_0006447 | 3300046455 | Bacteria | 7026 |
| 429 | Ga0495629_0000081 | 3300046459 | Bacteria | 85305 |
| 430 | Ga0495629_0001069 | 3300046459 | Bacteria | 21887 |
| 431 | Ga0495629_0030711 | 3300046459 | Bacteria | 3807 |
| 432 | Ga0495638_0002281 | 3300046460 | Bacteria | 15850 |
| 433 | Ga0495641_0003571 | 3300046461 | Bacteria | 11545 |
| 434 | Ga0495651_0038836 | 3300046462 | Bacteria | 3706 |
| 435 | Ga0495653_0001526 | 3300046463 | Bacteria | 18106 |
| 436 | Ga0495580_0072374 | 3300046472 | Bacteria | 2407 |
| 437 | Ga0495582_0000235 | 3300046473 | Bacteria | 30725 |
| 438 | Ga0495639_0000010 | 3300046475 | Bacteria | 93685 |
| 439 | Ga0495662_0000034 | 3300046476 | Bacteria | 46636 |
| 440 | Ga0495664_0001969 | 3300046477 | Bacteria | 10934 |
| 441 | Ga0495664_0003381 | 3300046477 | Bacteria | 8667 |
| 442 | Ga0495664_0011375 | 3300046477 | Bacteria | 5016 |
| 443 | Ga0495664_0049053 | 3300046477 | Bacteria | 2506 |
| 444 | Ga0495594_0004984 | 3300046499 | Bacteria | 6833 |
| 445 | Ga0495606_0000265 | 3300046507 | Bacteria | 92526 |
| 446 | Ga0495608_0016408 | 3300046511 | Bacteria | 5124 |
| 447 | Ga0495608_0063039 | 3300046511 | Bacteria | 2434 |
| 448 | Ga0495628_0027454 | 3300046516 | Bacteria | 4632 |
| 449 | Ga0495648_0009380 | 3300046524 | Bacteria | 7594 |
| 450 | Ga0495652_0009826 | 3300046529 | Bacteria | 8673 |
| 451 | Ga0495652_0024834 | 3300046529 | Bacteria | 5303 |
| 452 | Ga0495665_0000005 | 3300046531 | Bacteria | 86491 |
| 453 | Ga0495640_0010386 | 3300046533 | Bacteria | 7202 |
| 454 | Ga0495640_0037694 | 3300046533 | Bacteria | 3408 |
| 455 | Ga0495587_0046397 | 3300046536 | Bacteria | 2579 |
| 456 | Ga0495645_0011016 | 3300046543 | Bacteria | 6354 |
| 457 | Ga0495645_0022979 | 3300046543 | Bacteria | 4513 |
| 458 | Ga0495622_0034865 | 3300046557 | Bacteria | 2347 |
| 459 | Ga0495667_0058742 | 3300046559 | Bacteria | 2525 |
| 460 | Ga0495634_0000261 | 3300046642 | Bacteria | 49735 |
| 461 | Ga0495634_0006809 | 3300046642 | Bacteria | 8649 |
| 462 | Ga0495625_0022319 | 3300046660 | Bacteria | 4855 |
| 463 | Ga0495635_0000963 | 3300046663 | Bacteria | 19001 |
| 464 | Ga0495635_0005971 | 3300046663 | Bacteria | 8496 |
| 465 | Ga0495588_0013281 | 3300046674 | Bacteria | 3921 |
| 466 | Ga0495657_0009210 | 3300046675 | Bacteria | 7492 |
| 467 | Ga0495599_0053766 | 3300046678 | Bacteria | 2522 |
| 468 | Ga0495623_0006918 | 3300046679 | Bacteria | 7372 |
| 469 | Ga0495623_0007565 | 3300046679 | Bacteria | 7049 |
| 470 | Ga0495646_0004493 | 3300046680 | Bacteria | 8787 |
| 471 | Ga0495646_0009132 | 3300046680 | Bacteria | 6289 |
| 472 | Ga0495647_0000500 | 3300046681 | Bacteria | 11389 |
| 473 | Ga0495658_0041467 | 3300046683 | Bacteria | 2564 |
| 474 | Ga0495669_0028465 | 3300046684 | Bacteria | 2448 |
| 475 | Ga0495613_0008391 | 3300046689 | Bacteria | 7672 |
| 476 | Ga0495624_0001342 | 3300046690 | Bacteria | 19226 |
| 477 | Ga0495624_0042704 | 3300046690 | Bacteria | 2897 |
| 478 | Ga0495624_0091395 | 3300046690 | Bacteria | 1878 |
| 479 | Ga0495600_0004451 | 3300046809 | Bacteria | 8384 |
| 480 | Ga0495600_0055991 | 3300046809 | Bacteria | 2575 |
| 481 | Ga0495581_0000018 | 3300047315 | Bacteria | 58791 |
| 482 | Ga0495581_0036620 | 3300047315 | Bacteria | 2839 |
| 483 | Ga0495604_0002997 | 3300047317 | Bacteria | 13512 |
| 484 | Ga0495604_0080115 | 3300047317 | Bacteria | 2447 |
| 485 | Ga0495674_0000134 | 3300047319 | Bacteria | 56618 |
| 486 | Ga0495674_0012971 | 3300047319 | Bacteria | 7845 |
| 487 | Ga0495674_0041857 | 3300047319 | Bacteria | 4089 |
| 488 | Ga0495672_0062529 | 3300047320 | Bacteria | 2141 |
| 489 | Ga0495672_0074204 | 3300047320 | Bacteria | 1916 |
| 490 | Ga0495676_0032360 | 3300047321 | Bacteria | 4415 |
| 491 | Ga0495680_0010209 | 3300047322 | Bacteria | 8384 |
| 492 | Ga0495675_0049780 | 3300047444 | Bacteria | 2662 |
| 493 | Ga0495675_0094325 | 3300047444 | Bacteria | 1877 |
| 494 | Ga0495673_0005038 | 3300047469 | Bacteria | 8092 |
| 495 | Ga0495684_0004918 | 3300047471 | Bacteria | 10430 |
| 496 | Ga0495593_0000072 | 3300047673 | Bacteria | 43039 |
| 497 | Ga0495593_0000214 | 3300047673 | Bacteria | 30567 |
| 498 | Ga0495593_0021124 | 3300047673 | Bacteria | 3639 |
| 499 | Ga0495593_0073114 | 3300047673 | Bacteria | 1779 |
| 500 | Ga0495602_0017685 | 3300048088 | Bacteria | 7139 |
| 501 | Ga0495602_0073491 | 3300048088 | Bacteria | 2910 |
| 502 | Ga0495614_0014011 | 3300048089 | Bacteria | 3516 |
| 503 | Ga0496100_0047806 | 3300048903 | Bacteria | 2759 |
| 504 | Ga0496102_0067320 | 3300048905 | Bacteria | 3285 |
| 505 | Ga0496102_0093512 | 3300048905 | Bacteria | 2785 |
| 506 | Ga0496104_0010370 | 3300048907 | Bacteria | 8323 |
| 507 | Ga0496104_0061130 | 3300048907 | Bacteria | 3570 |
| 508 | Ga0496104_0101667 | 3300048907 | Bacteria | 2752 |
| 509 | Ga0496106_0001870 | 3300048909 | Bacteria | 15762 |
| 510 | Ga0496106_0024272 | 3300048909 | Bacteria | 4506 |
| 511 | Ga0496108_0037528 | 3300048911 | Bacteria | 4036 |
| 512 | Ga0496108_0104266 | 3300048911 | Bacteria | 2420 |
| 513 | Ga0496110_0032951 | 3300048913 | Bacteria | 4479 |
| 514 | Ga0496112_0000019 | 3300048915 | Bacteria | 185531 |
| 515 | Ga0496114_0003712 | 3300048917 | Bacteria | 11753 |
| 516 | Ga0496114_0003910 | 3300048917 | Bacteria | 11491 |
| 517 | Ga0496115_0001711 | 3300048918 | Bacteria | 15732 |
| 518 | Ga0496115_0026064 | 3300048918 | Bacteria | 4559 |
| 519 | Ga0496117_0004399 | 3300048920 | Bacteria | 15594 |
| 520 | Ga0496118_0005557 | 3300048921 | Bacteria | 14287 |
| 521 | Ga0496119_0000091 | 3300048922 | Bacteria | 133090 |
| 522 | Ga0496119_0010439 | 3300048922 | Bacteria | 7816 |
| 523 | Ga0496119_0017281 | 3300048922 | Bacteria | 5433 |
| 524 | Ga0496120_0003831 | 3300048923 | Bacteria | 13223 |
| 525 | Ga0496120_0023981 | 3300048923 | Bacteria | 3811 |
| 526 | Ga0496121_0000091 | 3300048924 | Bacteria | 216685 |
| 527 | Ga0496121_0000716 | 3300048924 | Bacteria | 61451 |
| 528 | Ga0496121_0018322 | 3300048924 | Bacteria | 7067 |
| 529 | Ga0496124_0001529 | 3300048927 | Bacteria | 33656 |
| 530 | Ga0496125_0042313 | 3300048928 | Bacteria | 3882 |
| 531 | Ga0496125_0064515 | 3300048928 | Bacteria | 2910 |
| 532 | Ga0496125_0065592 | 3300048928 | Bacteria | 2875 |
| 533 | Ga0496125_0069831 | 3300048928 | Bacteria | 2753 |
| 534 | Ga0496126_0000782 | 3300048929 | Bacteria | 57324 |
| 535 | Ga0496126_0006097 | 3300048929 | Bacteria | 13518 |
| 536 | Ga0496126_0010543 | 3300048929 | Bacteria | 9675 |
| 537 | Ga0496126_0016855 | 3300048929 | Bacteria | 7293 |
| 538 | Ga0496126_0028105 | 3300048929 | Bacteria | 5363 |
| 539 | Ga0496126_0043595 | 3300048929 | Bacteria | 4137 |
| 540 | Ga0496126_0046200 | 3300048929 | Bacteria | 3996 |
| 541 | Ga0496126_0047952 | 3300048929 | Bacteria | 3908 |
| 542 | Ga0501033_0087905 | 3300049570 | Bacteria | 2274 |
| 543 | Ga0501034_0001464 | 3300049571 | Bacteria | 31260 |
| 544 | Ga0501034_0030391 | 3300049571 | Bacteria | 5491 |
| 545 | Ga0501036_0056784 | 3300049572 | Bacteria | 3317 |
| 546 | Ga0501036_0152539 | 3300049572 | Bacteria | 1949 |
| 547 | Ga0501043_0035129 | 3300049579 | Bacteria | 3943 |
| 548 | Ga0501047_0001429 | 3300049581 | Bacteria | 23465 |
| 549 | Ga0501047_0001651 | 3300049581 | Bacteria | 21724 |
| 550 | Ga0501047_0037701 | 3300049581 | Bacteria | 4675 |
| 551 | Ga0501048_0084968 | 3300049582 | Bacteria | 2232 |
| 552 | Ga0501067_0008884 | 3300049583 | Bacteria | 5566 |
| 553 | Ga0501067_0017156 | 3300049583 | Bacteria | 4002 |
| 554 | Ga0501068_0000679 | 3300049584 | Bacteria | 17414 |
| 555 | Ga0501068_0001428 | 3300049584 | Bacteria | 12676 |
| 556 | Ga0501070_0010935 | 3300049586 | Bacteria | 7664 |
| 557 | Ga0501072_0000021 | 3300049588 | Bacteria | 152489 |
| 558 | Ga0501073_0009160 | 3300049589 | Bacteria | 7302 |
| 559 | Ga0501074_0004795 | 3300049590 | Bacteria | 9697 |
| 560 | Ga0501223_000074 | 3300049663 | Bacteria | 30267 |
| 561 | Ga0501224_000017 | 3300049664 | Bacteria | 81060 |
| 562 | Ga0501233_000110 | 3300049668 | Bacteria | 11068 |
| 563 | Ga0501235_000012 | 3300049669 | Bacteria | 34235 |
| 564 | Ga0501257_005430 | 3300049686 | Bacteria | 2810 |
| 565 | Ga0501225_0000007 | 3300049705 | Bacteria | 107771 |
| 566 | Ga0501234_000212 | 3300049707 | Bacteria | 8345 |
| 567 | Ga0501083_0060386 | 3300049744 | Bacteria | 2532 |
| 568 | Ga0501044_0010517 | 3300049823 | Bacteria | 10042 |
| 569 | Ga0501044_0019290 | 3300049823 | Bacteria | 7296 |
| 570 | Ga0501044_0041197 | 3300049823 | Bacteria | 4808 |
| 571 | Ga0501044_0081101 | 3300049823 | Bacteria | 3285 |
| 572 | Ga0501044_0277106 | 3300049823 | Bacteria | 1612 |
| 573 | Ga0501226_000040 | 3300049853 | Bacteria | 60590 |
| 574 | nmdc:mga03683_18071_c1 | 3300050489 | Bacteria | 2676 |
| 575 | nmdc:mga03n38_12398_c1 | 3300050490 | Bacteria | 3207 |
| 576 | nmdc:mga03n38_2102_c1 | 3300050490 | Bacteria | 6040 |
| 577 | nmdc:mga00v17_805_c1 | 3300050491 | Bacteria | 17081 |
| 578 | nmdc:mga00v17_9491_c1 | 3300050491 | Bacteria | 5269 |
| 579 | nmdc:mga0yw44_35166_c1 | 3300050492 | Bacteria | 2942 |
| 580 | nmdc:mga0yw44_36418_c1 | 3300050492 | Bacteria | 2899 |
| 581 | nmdc:mga0k408_58214_c1 | 3300050493 | Bacteria | 2244 |
| 582 | nmdc:mga06z11_2594_c1 | 3300050494 | Bacteria | 6922 |
| 583 | nmdc:mga06z11_32378_c1 | 3300050494 | Bacteria | 2549 |
| 584 | nmdc:mga06z11_8832_c1 | 3300050494 | Bacteria | 4221 |
| 585 | nmdc:mga07m45_10790_c1 | 3300050496 | Bacteria | 4784 |
| 586 | nmdc:mga08y16_30177_c1 | 3300050511 | Bacteria | 5707 |
| 587 | nmdc:mga0n895_17840_c1 | 3300050512 | Bacteria | 6553 |
| 588 | nmdc:mga08x19_23544_c1 | 3300050514 | Bacteria | 3821 |
| 589 | nmdc:mga08x19_31771_c2 | 3300050514 | Bacteria | 2299 |
| 590 | nmdc:mga08x19_41_c1 | 3300050514 | Bacteria | 151756 |
| 591 | nmdc:mga0sz30_13616_c1 | 3300050516 | Bacteria | 3188 |
| 592 | Ga0495601_0044676 | 3300053077 | Bacteria | 2785 |
| 593 | Ga0500635_0014926 | 3300053080 | Bacteria | 2285 |
| 594 | Ga0495595_0000449 | 3300053084 | Bacteria | 15558 |
| 595 | Ga0495619_0001763 | 3300053085 | Bacteria | 14401 |
| 596 | Ga0500643_005623 | 3300053087 | Bacteria | 5366 |
| 597 | Ga0500566_0000065 | 3300053094 | Bacteria | 50325 |
| 598 | Ga0500566_0017390 | 3300053094 | Bacteria | 4226 |
| 599 | Ga0500572_001831 | 3300053111 | Bacteria | 5410 |
| 600 | Ga0500572_004048 | 3300053111 | Bacteria | 3334 |
| 601 | Ga0500595_002516 | 3300053119 | Bacteria | 9048 |
| 602 | Ga0500595_007200 | 3300053119 | Bacteria | 4635 |
| 603 | Ga0500642_0012341 | 3300053130 | Bacteria | 3094 |
| 604 | Ga0500559_0001232 | 3300053136 | Bacteria | 15083 |
| 605 | Ga0500559_0012818 | 3300053136 | Bacteria | 3557 |
| 606 | Ga0500568_0004447 | 3300053139 | Bacteria | 7487 |
| 607 | Ga0500568_0014217 | 3300053139 | Bacteria | 3601 |
| 608 | Ga0500603_000165 | 3300053150 | Bacteria | 16608 |
| 609 | Ga0500616_0000385 | 3300053153 | Bacteria | 61815 |
| 610 | Ga0500638_000128 | 3300053162 | Bacteria | 14722 |
| 611 | Ga0500637_0000334 | 3300053178 | Bacteria | 17776 |
| 612 | Ga0500637_0018015 | 3300053178 | Bacteria | 3789 |
| 613 | Ga0500599_001487 | 3300053736 | Bacteria | 2702 |
| 614 | Ga0500601_000231 | 3300053737 | Bacteria | 11058 |
| 615 | Ga0501084_0001764 | 3300054114 | Bacteria | 17205 |
| 616 | Ga0501084_0077355 | 3300054114 | Bacteria | 2789 |
| 617 | Ga0500661_002743 | 3300055283 | Bacteria | 3322 |
| 618 | Ga0501082_0000370 | 3300060353 | Bacteria | 39717 |
| 619 | Ga0501082_0031737 | 3300060353 | Bacteria | 4556 |
| 620 | Ga0530510_0014036 | 3300061734 | Bacteria | 5647 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046477 | Ga0495664_0001969 | Ga0495664_0001969_160_1584 | 457 |
| 2 | 3300006178 | Ga0075367_10007186 | Ga0075367_100071864 | 466 |
| 3 | 3300035118 | Ga0373954_0059527 | Ga0373954_0059527_325_1773 | 466 |
| 4 | 3300054114 | Ga0501084_0077355 | Ga0501084_0077355_1302_2759 | 471 |
| 5 | 3300031548 | Ga0307408_100086651 | Ga0307408_1000866512 | 474 |
| 6 | iso_pu_bacteria | 8019565922 | 8019573102 | 478 |
| 7 | 3300049823 | Ga0501044_0277106 | Ga0501044_0277106_15_1505 | 483 |
| 8 | iso_pu_bacteria | 8016548790 | 8016557204 | 486 |
| 9 | 3300006178 | Ga0075367_10112318 | Ga0075367_101123181 | 514 |
| 10 | 3300026142 | Ga0207698_10013801 | Ga0207698_100138012 | 517 |
| 11 | 3300025914 | Ga0207671_10078398 | Ga0207671_100783983 | 527 |
| 12 | 3300005937 | Ga0081455_10002868 | Ga0081455_1000286820 | 529 |
| 13 | 3300031251 | Ga0265327_10022936 | Ga0265327_100229363 | 535 |
| 14 | 3300028573 | Ga0265334_10000250 | Ga0265334_1000025021 | 541 |
| 15 | 3300009551 | Ga0105238_10024913 | Ga0105238_100249133 | 542 |
| 16 | 3300009093 | Ga0105240_10263964 | Ga0105240_102639642 | 543 |
| 17 | 3300005563 | Ga0068855_100156827 | Ga0068855_1001568273 | 544 |
| 18 | 3300049686 | Ga0501257_005430 | Ga0501257_005430_203_1912 | 545 |
| 19 | 3300005329 | Ga0070683_100008185 | Ga0070683_1000081857 | 546 |
| 20 | 3300005614 | Ga0068856_100002749 | Ga0068856_1000027492 | 546 |
| 21 | 3300025921 | Ga0207652_10077235 | Ga0207652_100772352 | 546 |
| 22 | 3300026078 | Ga0207702_10000056 | Ga0207702_1000005621 | 546 |
| 23 | 3300025921 | Ga0207652_10022596 | Ga0207652_100225962 | 548 |
| 24 | 3300045049 | Ga0466959_0005547 | Ga0466959_0005547_2551_4293 | 548 |
| 25 | 3300047320 | Ga0495672_0074204 | Ga0495672_0074204_132_1874 | 549 |
| 26 | 3300048905 | Ga0496102_0067320 | Ga0496102_0067320_313_2055 | 549 |
| 27 | 3300005468 | Ga0070707_100038205 | Ga0070707_1000382052 | 550 |
| 28 | 3300009147 | Ga0114129_10170059 | Ga0114129_101700593 | 550 |
| 29 | 3300025922 | Ga0207646_10023005 | Ga0207646_100230057 | 550 |
| 30 | 3300005937 | Ga0081455_10015618 | Ga0081455_100156189 | 551 |
| 31 | 3300035725 | Ga0373947_0001708 | Ga0373947_0001708_6742_8472 | 551 |
| 32 | 3300046455 | Ga0495603_0004736 | Ga0495603_0004736_1751_3481 | 551 |
| 33 | 3300047315 | Ga0495581_0036620 | Ga0495581_0036620_258_2000 | 551 |
| 34 | iso_pu_bacteria | 2894772417 | 2894772632 | 551 |
| 35 | 3300035119 | Ga0373956_0016925 | Ga0373956_0016925_161_1867 | 552 |
| 36 | 3300035695 | Ga0373927_0057240 | Ga0373927_0057240_288_1994 | 552 |
| 37 | 3300035724 | Ga0373933_0020486 | Ga0373933_0020486_525_2231 | 552 |
| 38 | 3300049581 | Ga0501047_0001429 | Ga0501047_0001429_15123_16868 | 552 |
| 39 | 3300049583 | Ga0501067_0008884 | Ga0501067_0008884_454_2199 | 552 |
| 40 | 3300049584 | Ga0501068_0000679 | Ga0501068_0000679_4903_6648 | 552 |
| 41 | 3300049588 | Ga0501072_0000021 | Ga0501072_0000021_63345_65090 | 552 |
| 42 | 3300049589 | Ga0501073_0009160 | Ga0501073_0009160_4402_6147 | 552 |
| 43 | 3300049590 | Ga0501074_0004795 | Ga0501074_0004795_3368_5113 | 552 |
| 44 | 3300049823 | Ga0501044_0019290 | Ga0501044_0019290_124_1869 | 552 |
| 45 | 3300054114 | Ga0501084_0001764 | Ga0501084_0001764_4694_6439 | 552 |
| 46 | 3300060353 | Ga0501082_0000370 | Ga0501082_0000370_5298_7043 | 552 |
| 47 | 3300061734 | Ga0530510_0014036 | Ga0530510_0014036_664_2409 | 552 |
| 48 | iso_pu_bacteria | 2929199973 | 2929200630 | 552 |
| 49 | iso_pu_bacteria | 8055909800 | 8055913838 | 552 |
| 50 | 3300005367 | Ga0070667_100000336 | Ga0070667_10000033646 | 553 |
| 51 | 3300005539 | Ga0068853_100015425 | Ga0068853_1000154255 | 553 |
| 52 | 3300005841 | Ga0068863_100007964 | Ga0068863_1000079644 | 553 |
| 53 | 3300005843 | Ga0068860_100111973 | Ga0068860_1001119731 | 553 |
| 54 | 3300025986 | Ga0207658_10000493 | Ga0207658_100004939 | 553 |
| 55 | 3300026041 | Ga0207639_10001766 | Ga0207639_100017665 | 553 |
| 56 | 3300026088 | Ga0207641_10010473 | Ga0207641_100104732 | 553 |
| 57 | 3300028381 | Ga0268264_10092696 | Ga0268264_100926961 | 553 |
| 58 | 3300036401 | Ga0373937_0012158 | Ga0373937_0012158_2896_4671 | 553 |
| 59 | 3300047673 | Ga0495593_0073114 | Ga0495593_0073114_70_1767 | 553 |
| 60 | 3300048924 | Ga0496121_0000091 | Ga0496121_0000091_188567_190288 | 553 |
| 61 | 3300053119 | Ga0500595_002516 | Ga0500595_002516_7245_8966 | 553 |
| 62 | iso_pu_bacteria | 2841966195 | 2841969245 | 553 |
| 63 | iso_pu_bacteria | 2874612657 | 2874617912 | 553 |
| 64 | iso_pu_bacteria | 2879083081 | 2879087501 | 553 |
| 65 | iso_pu_bacteria | 2941531003 | 2941532361 | 553 |
| 66 | 3300005618 | Ga0068864_100016804 | Ga0068864_1000168042 | 554 |
| 67 | 3300005844 | Ga0068862_100054667 | Ga0068862_1000546672 | 554 |
| 68 | 3300006175 | Ga0070712_100001393 | Ga0070712_1000013939 | 554 |
| 69 | 3300006186 | Ga0075369_10008692 | Ga0075369_100086922 | 554 |
| 70 | 3300009177 | Ga0105248_10089062 | Ga0105248_100890622 | 554 |
| 71 | 3300013105 | Ga0157369_10104037 | Ga0157369_101040373 | 554 |
| 72 | 3300025915 | Ga0207693_10001776 | Ga0207693_100017768 | 554 |
| 73 | 3300025972 | Ga0207668_10010032 | Ga0207668_100100322 | 554 |
| 74 | 3300028380 | Ga0268265_10040483 | Ga0268265_100404833 | 554 |
| 75 | 3300037312 | Ga0395899_0018305 | Ga0395899_0018305_1609_3324 | 554 |
| 76 | 3300037418 | Ga0395900_0010634 | Ga0395900_0010634_6086_7801 | 554 |
| 77 | 3300037466 | Ga0395898_0006599 | Ga0395898_0006599_7975_9690 | 554 |
| 78 | 3300038443 | Ga0395901_0010773 | Ga0395901_0010773_2003_3718 | 554 |
| 79 | 3300038443 | Ga0395901_0033187 | Ga0395901_0033187_110_1825 | 554 |
| 80 | 3300048922 | Ga0496119_0010439 | Ga0496119_0010439_5152_6867 | 554 |
| 81 | 3300048923 | Ga0496120_0023981 | Ga0496120_0023981_1197_2912 | 554 |
| 82 | 3300049571 | Ga0501034_0001464 | Ga0501034_0001464_7059_8774 | 554 |
| 83 | 3300049584 | Ga0501068_0001428 | Ga0501068_0001428_3720_5435 | 554 |
| 84 | 3300050494 | nmdc:mga06z11_32378_c1 | nmdc:mga06z11_32378_c1_773_2488 | 554 |
| 85 | 3300005347 | Ga0070668_100000588 | Ga0070668_1000005885 | 555 |
| 86 | 3300005347 | Ga0070668_100047689 | Ga0070668_1000476892 | 555 |
| 87 | 3300005353 | Ga0070669_100023897 | Ga0070669_1000238972 | 555 |
| 88 | 3300005518 | Ga0070699_100095278 | Ga0070699_1000952781 | 555 |
| 89 | 3300005548 | Ga0070665_100027867 | Ga0070665_1000278675 | 555 |
| 90 | 3300005577 | Ga0068857_100016293 | Ga0068857_1000162935 | 555 |
| 91 | 3300005616 | Ga0068852_100016987 | Ga0068852_1000169874 | 555 |
| 92 | 3300005617 | Ga0068859_100025710 | Ga0068859_1000257105 | 555 |
| 93 | 3300005719 | Ga0068861_100009916 | Ga0068861_1000099162 | 555 |
| 94 | 3300005834 | Ga0068851_10005892 | Ga0068851_100058925 | 555 |
| 95 | 3300005843 | Ga0068860_100000226 | Ga0068860_10000022662 | 555 |
| 96 | 3300005844 | Ga0068862_100002606 | Ga0068862_10000260613 | 555 |
| 97 | 3300005985 | Ga0081539_10001781 | Ga0081539_100017817 | 555 |
| 98 | 3300006051 | Ga0075364_10049260 | Ga0075364_100492603 | 555 |
| 99 | 3300006931 | Ga0097620_100025710 | Ga0097620_1000257105 | 555 |
| 100 | 3300009177 | Ga0105248_10067566 | Ga0105248_100675662 | 555 |
| 101 | 3300009553 | Ga0105249_10119609 | Ga0105249_101196092 | 555 |
| 102 | 3300025302 | Ga0207426_1014838 | Ga0207426_10148382 | 555 |
| 103 | 3300025903 | Ga0207680_10001139 | Ga0207680_100011392 | 555 |
| 104 | 3300025907 | Ga0207645_10102983 | Ga0207645_101029831 | 555 |
| 105 | 3300025961 | Ga0207712_10073265 | Ga0207712_100732652 | 555 |
| 106 | 3300025972 | Ga0207668_10001729 | Ga0207668_100017299 | 555 |
| 107 | 3300025986 | Ga0207658_10034048 | Ga0207658_100340482 | 555 |
| 108 | 3300026095 | Ga0207676_10047316 | Ga0207676_100473162 | 555 |
| 109 | 3300026116 | Ga0207674_10011854 | Ga0207674_100118542 | 555 |
| 110 | 3300026118 | Ga0207675_100019629 | Ga0207675_1000196295 | 555 |
| 111 | 3300028379 | Ga0268266_10016799 | Ga0268266_100167996 | 555 |
| 112 | 3300028380 | Ga0268265_10001536 | Ga0268265_100015367 | 555 |
| 113 | 3300028380 | Ga0268265_10006531 | Ga0268265_100065315 | 555 |
| 114 | 3300028381 | Ga0268264_10000110 | Ga0268264_10000110143 | 555 |
| 115 | 3300036401 | Ga0373937_0046477 | Ga0373937_0046477_386_2101 | 555 |
| 116 | 3300037068 | Ga0373925_0010883 | Ga0373925_0010883_1943_3661 | 555 |
| 117 | 3300037418 | Ga0395900_0065380 | Ga0395900_0065380_1226_2944 | 555 |
| 118 | 3300042006 | Ga0439432_027879 | Ga0439432_027879_16_1734 | 555 |
| 119 | 3300050516 | nmdc:mga0sz30_13616_c1 | nmdc:mga0sz30_13616_c1_201_1919 | 555 |
| 120 | 3300053139 | Ga0500568_0004447 | Ga0500568_0004447_235_1953 | 555 |
| 121 | 3300053153 | Ga0500616_0000385 | Ga0500616_0000385_46205_47923 | 555 |
| 122 | 3300053162 | Ga0500638_000128 | Ga0500638_000128_5652_7430 | 555 |
| 123 | 3300053178 | Ga0500637_0000334 | Ga0500637_0000334_13920_15698 | 555 |
| 124 | 3300055283 | Ga0500661_002743 | Ga0500661_002743_561_2339 | 555 |
| 125 | iso_pu_bacteria | 2511231028 | 2511395463 | 555 |
| 126 | iso_pu_bacteria | 2513237092 | 2513625432 | 555 |
| 127 | iso_pu_bacteria | 2513237102 | 2513703359 | 555 |
| 128 | iso_pu_bacteria | 2513237139 | 2513873906 | 555 |
| 129 | iso_pu_bacteria | 2524023205 | 2524435751 | 555 |
| 130 | iso_pu_bacteria | 2617270735 | 2617351709 | 555 |
| 131 | iso_pu_bacteria | 2744054633 | 2745079047 | 555 |
| 132 | iso_pu_bacteria | 2791355196 | 2793063111 | 555 |
| 133 | iso_pu_bacteria | 2802429603 | 2805915989 | 555 |
| 134 | iso_pu_bacteria | 2824600985 | 2824602582 | 555 |
| 135 | iso_pu_bacteria | 2824609381 | 2824612638 | 555 |
| 136 | iso_pu_bacteria | 2824617872 | 2824621100 | 555 |
| 137 | iso_pu_bacteria | 2824626560 | 2824630107 | 555 |
| 138 | iso_pu_bacteria | 2824635225 | 2824640738 | 555 |
| 139 | iso_pu_bacteria | 2824644064 | 2824649815 | 555 |
| 140 | iso_pu_bacteria | 2824653114 | 2824654453 | 555 |
| 141 | iso_pu_bacteria | 2824696289 | 2824697644 | 555 |
| 142 | iso_pu_bacteria | 2824704595 | 2824709670 | 555 |
| 143 | iso_pu_bacteria | 2824714736 | 2824719820 | 555 |
| 144 | iso_pu_bacteria | 2824723954 | 2824727924 | 555 |
| 145 | iso_pu_bacteria | 2824753945 | 2824757106 | 555 |
| 146 | iso_pu_bacteria | 2824763712 | 2824768442 | 555 |
| 147 | iso_pu_bacteria | 2841957949 | 2841964606 | 555 |
| 148 | iso_pu_bacteria | 2842038055 | 2842043876 | 555 |
| 149 | iso_pu_bacteria | 2842045827 | 2842052134 | 555 |
| 150 | iso_pu_bacteria | 2844315083 | 2844321830 | 555 |
| 151 | iso_pu_bacteria | 2847939898 | 2847941760 | 555 |
| 152 | iso_pu_bacteria | 2849076700 | 2849082682 | 555 |
| 153 | iso_pu_bacteria | 2857509624 | 2857511575 | 555 |
| 154 | iso_pu_bacteria | 2874620515 | 2874624428 | 555 |
| 155 | iso_pu_bacteria | 2874628541 | 2874636715 | 555 |
| 156 | iso_pu_bacteria | 2881364244 | 2881370995 | 555 |
| 157 | iso_pu_bacteria | 2881665667 | 2881665703 | 555 |
| 158 | iso_pu_bacteria | 2888388044 | 2888391035 | 555 |
| 159 | iso_pu_bacteria | 2888419890 | 2888420765 | 555 |
| 160 | iso_pu_bacteria | 2903727486 | 2903727620 | 555 |
| 161 | iso_pu_bacteria | 2904666416 | 2904672233 | 555 |
| 162 | iso_pu_bacteria | 2904711408 | 2904716191 | 555 |
| 163 | iso_pu_bacteria | 2906602504 | 2906602890 | 555 |
| 164 | iso_pu_bacteria | 2932784394 | 2932786353 | 555 |
| 165 | iso_pu_bacteria | 2932828146 | 2932829591 | 555 |
| 166 | iso_pu_bacteria | 2935616580 | 2935618109 | 555 |
| 167 | iso_pu_bacteria | 2935638405 | 2935641493 | 555 |
| 168 | iso_pu_bacteria | 2935665750 | 2935669449 | 555 |
| 169 | iso_pu_bacteria | 2935694250 | 2935701809 | 555 |
| 170 | iso_pu_bacteria | 2935703347 | 2935707274 | 555 |
| 171 | iso_pu_bacteria | 2935769743 | 2935772764 | 555 |
| 172 | iso_pu_bacteria | 2935777560 | 2935778099 | 555 |
| 173 | iso_pu_bacteria | 2935785616 | 2935787327 | 555 |
| 174 | iso_pu_bacteria | 2935793552 | 2935795885 | 555 |
| 175 | iso_pu_bacteria | 2935801545 | 2935804347 | 555 |
| 176 | iso_pu_bacteria | 2935827899 | 2935831224 | 555 |
| 177 | iso_pu_bacteria | 2935837841 | 2935841833 | 555 |
| 178 | iso_pu_bacteria | 2935855204 | 2935856392 | 555 |
| 179 | iso_pu_bacteria | 2935864058 | 2935871085 | 555 |
| 180 | iso_pu_bacteria | 2935873716 | 2935874582 | 555 |
| 181 | iso_pu_bacteria | 2935992306 | 2935994043 | 555 |
| 182 | iso_pu_bacteria | 2936002035 | 2936004946 | 555 |
| 183 | iso_pu_bacteria | 2941538514 | 2941543906 | 555 |
| 184 | iso_pu_bacteria | 3005594810 | 3005602178 | 555 |
| 185 | iso_pu_bacteria | 8016511872 | 8016518619 | 555 |
| 186 | iso_pu_bacteria | 8016522445 | 8016526589 | 555 |
| 187 | iso_pu_bacteria | 8016539877 | 8016544873 | 555 |
| 188 | iso_pu_bacteria | 8016557553 | 8016565556 | 555 |
| 189 | iso_pu_bacteria | 8016575299 | 8016582523 | 555 |
| 190 | iso_pu_bacteria | 8016595262 | 8016603173 | 555 |
| 191 | iso_pu_bacteria | 8016613128 | 8016617974 | 555 |
| 192 | iso_pu_bacteria | 8016622563 | 8016623599 | 555 |
| 193 | iso_pu_bacteria | 8017057580 | 8017058051 | 555 |
| 194 | iso_pu_bacteria | 8019530166 | 8019531496 | 555 |
| 195 | iso_pu_bacteria | 8019538911 | 8019540035 | 555 |
| 196 | iso_pu_bacteria | 8019576017 | 8019577683 | 555 |
| 197 | iso_pu_bacteria | 8019586578 | 8019595782 | 555 |
| 198 | iso_pu_bacteria | 8019597564 | 8019605976 | 555 |
| 199 | iso_pu_bacteria | 8019608314 | 8019612554 | 555 |
| 200 | iso_pu_bacteria | 8056967851 | 8056970923 | 555 |
| 201 | 3300025912 | Ga0207707_10005017 | Ga0207707_100050172 | 556 |
| 202 | 3300025921 | Ga0207652_10023805 | Ga0207652_100238052 | 556 |
| 203 | 3300035083 | Ga0373926_0024371 | Ga0373926_0024371_138_1853 | 556 |
| 204 | 3300035692 | Ga0373935_0003845 | Ga0373935_0003845_5505_7220 | 556 |
| 205 | 3300035725 | Ga0373947_0019069 | Ga0373947_0019069_23_1738 | 556 |
| 206 | 3300046543 | Ga0495645_0011016 | Ga0495645_0011016_2674_4395 | 556 |
| 207 | 3300049581 | Ga0501047_0037701 | Ga0501047_0037701_2489_4207 | 556 |
| 208 | iso_pu_bacteria | 2513237095 | 2513647955 | 556 |
| 209 | iso_pu_bacteria | 2513237096 | 2513658217 | 556 |
| 210 | iso_pu_bacteria | 2513237098 | 2513677505 | 556 |
| 211 | iso_pu_bacteria | 2513237137 | 2513862953 | 556 |
| 212 | iso_pu_bacteria | 2513237145 | 2513920291 | 556 |
| 213 | iso_pu_bacteria | 2513237161 | 2514012877 | 556 |
| 214 | iso_pu_bacteria | 2517093001 | 2517102379 | 556 |
| 215 | iso_pu_bacteria | 2517572143 | 2517889290 | 556 |
| 216 | iso_pu_bacteria | 2524023210 | 2524470329 | 556 |
| 217 | iso_pu_bacteria | 2524023228 | 2524536444 | 556 |
| 218 | iso_pu_bacteria | 2667528175 | 2671121432 | 556 |
| 219 | iso_pu_bacteria | 2728368998 | 2728755345 | 556 |
| 220 | iso_pu_bacteria | 2791355197 | 2793070946 | 556 |
| 221 | iso_pu_bacteria | 2816332527 | 2818237287 | 556 |
| 222 | iso_pu_bacteria | 2824661429 | 2824664736 | 556 |
| 223 | iso_pu_bacteria | 2824679649 | 2824683551 | 556 |
| 224 | iso_pu_bacteria | 2824773399 | 2824774934 | 556 |
| 225 | iso_pu_bacteria | 2838122688 | 2838131027 | 556 |
| 226 | iso_pu_bacteria | 2841941048 | 2841944469 | 556 |
| 227 | iso_pu_bacteria | 2841949485 | 2841951609 | 556 |
| 228 | iso_pu_bacteria | 2841974524 | 2841983008 | 556 |
| 229 | iso_pu_bacteria | 2841983080 | 2841991008 | 556 |
| 230 | iso_pu_bacteria | 2847930680 | 2847931462 | 556 |
| 231 | iso_pu_bacteria | 2876761206 | 2876766406 | 556 |
| 232 | iso_pu_bacteria | 2879099564 | 2879107232 | 556 |
| 233 | iso_pu_bacteria | 2885374607 | 2885377926 | 556 |
| 234 | iso_pu_bacteria | 2885409591 | 2885411726 | 556 |
| 235 | iso_pu_bacteria | 2888378607 | 2888379956 | 556 |
| 236 | iso_pu_bacteria | 2903748898 | 2903750240 | 556 |
| 237 | iso_pu_bacteria | 2903768456 | 2903773113 | 556 |
| 238 | iso_pu_bacteria | 2904699407 | 2904709157 | 556 |
| 239 | iso_pu_bacteria | 2906610324 | 2906613235 | 556 |
| 240 | iso_pu_bacteria | 2906635258 | 2906635473 | 556 |
| 241 | iso_pu_bacteria | 2906660503 | 2906668604 | 556 |
| 242 | iso_pu_bacteria | 2908739725 | 2908747888 | 556 |
| 243 | iso_pu_bacteria | 2922368715 | 2922378342 | 556 |
| 244 | iso_pu_bacteria | 2922393267 | 2922400791 | 556 |
| 245 | iso_pu_bacteria | 2929615660 | 2929622557 | 556 |
| 246 | iso_pu_bacteria | 2929624759 | 2929631225 | 556 |
| 247 | iso_pu_bacteria | 2932809354 | 2932812572 | 556 |
| 248 | iso_pu_bacteria | 2932818245 | 2932822934 | 556 |
| 249 | iso_pu_bacteria | 2933577622 | 2933584364 | 556 |
| 250 | iso_pu_bacteria | 2935630451 | 2935634776 | 556 |
| 251 | iso_pu_bacteria | 2935675223 | 2935677953 | 556 |
| 252 | iso_pu_bacteria | 2935684952 | 2935689596 | 556 |
| 253 | iso_pu_bacteria | 2935713505 | 2935717115 | 556 |
| 254 | iso_pu_bacteria | 2935722832 | 2935730051 | 556 |
| 255 | iso_pu_bacteria | 2935732158 | 2935738530 | 556 |
| 256 | iso_pu_bacteria | 2935741537 | 2935749222 | 556 |
| 257 | iso_pu_bacteria | 2935750917 | 2935756949 | 556 |
| 258 | iso_pu_bacteria | 2935760218 | 2935764437 | 556 |
| 259 | iso_pu_bacteria | 2935959822 | 2935964137 | 556 |
| 260 | iso_pu_bacteria | 2940556831 | 2940562863 | 556 |
| 261 | iso_pu_bacteria | 2941507105 | 2941511894 | 556 |
| 262 | iso_pu_bacteria | 2941515067 | 2941519596 | 556 |
| 263 | iso_pu_bacteria | 2941523033 | 2941527712 | 556 |
| 264 | iso_pu_bacteria | 3005474847 | 3005475525 | 556 |
| 265 | iso_pu_bacteria | 8006933436 | 8006935771 | 556 |
| 266 | iso_pu_bacteria | 8006973647 | 8006975690 | 556 |
| 267 | iso_pu_bacteria | 8055742211 | 8055751008 | 556 |
| 268 | 3300006051 | Ga0075364_10018801 | Ga0075364_100188015 | 557 |
| 269 | 3300006178 | Ga0075367_10008487 | Ga0075367_100084873 | 557 |
| 270 | 3300006178 | Ga0075367_10012265 | Ga0075367_100122652 | 557 |
| 271 | 3300006195 | Ga0075366_10041363 | Ga0075366_100413632 | 557 |
| 272 | 3300031730 | Ga0307516_10000019 | Ga0307516_1000001926 | 557 |
| 273 | 3300031730 | Ga0307516_10000022 | Ga0307516_10000022162 | 557 |
| 274 | 3300048922 | Ga0496119_0000091 | Ga0496119_0000091_121187_122899 | 557 |
| 275 | 3300048923 | Ga0496120_0003831 | Ga0496120_0003831_246_1958 | 557 |
| 276 | 3300048929 | Ga0496126_0028105 | Ga0496126_0028105_2641_4365 | 557 |
| 277 | 3300049823 | Ga0501044_0081101 | Ga0501044_0081101_22_1734 | 557 |
| 278 | 3300050491 | nmdc:mga00v17_9491_c1 | nmdc:mga00v17_9491_c1_564_2300 | 557 |
| 279 | 3300050492 | nmdc:mga0yw44_35166_c1 | nmdc:mga0yw44_35166_c1_277_1989 | 557 |
| 280 | 3300050493 | nmdc:mga0k408_58214_c1 | nmdc:mga0k408_58214_c1_46_1767 | 557 |
| 281 | 3300050494 | nmdc:mga06z11_8832_c1 | nmdc:mga06z11_8832_c1_750_2462 | 557 |
| 282 | iso_pu_bacteria | 2508501128 | 2509149805 | 557 |
| 283 | iso_pu_bacteria | 2513237141 | 2513889788 | 557 |
| 284 | iso_pu_bacteria | 2922425934 | 2922433733 | 557 |
| 285 | 3300005327 | Ga0070658_10000139 | Ga0070658_1000013911 | 558 |
| 286 | 3300005578 | Ga0068854_100000426 | Ga0068854_10000042617 | 558 |
| 287 | 3300005614 | Ga0068856_100001641 | Ga0068856_1000016412 | 558 |
| 288 | 3300005614 | Ga0068856_100078242 | Ga0068856_1000782422 | 558 |
| 289 | 3300005616 | Ga0068852_100000175 | Ga0068852_10000017518 | 558 |
| 290 | 3300009551 | Ga0105238_10011332 | Ga0105238_100113325 | 558 |
| 291 | 3300025909 | Ga0207705_10000009 | Ga0207705_1000000946 | 558 |
| 292 | 3300025910 | Ga0207684_10038515 | Ga0207684_100385152 | 558 |
| 293 | 3300025913 | Ga0207695_10070362 | Ga0207695_100703622 | 558 |
| 294 | 3300025924 | Ga0207694_10033146 | Ga0207694_100331462 | 558 |
| 295 | 3300025949 | Ga0207667_10000328 | Ga0207667_100003285 | 558 |
| 296 | 3300025981 | Ga0207640_10000287 | Ga0207640_1000028710 | 558 |
| 297 | 3300026078 | Ga0207702_10027318 | Ga0207702_100273183 | 558 |
| 298 | 3300026142 | Ga0207698_10000200 | Ga0207698_1000020017 | 558 |
| 299 | 3300039437 | Ga0436365_0814378 | Ga0436365_0814378_1868_3568 | 558 |
| 300 | 3300048929 | Ga0496126_0000782 | Ga0496126_0000782_32216_33931 | 558 |
| 301 | iso_pu_bacteria | 2883577096 | 2883580005 | 558 |
| 302 | iso_pu_bacteria | 8019555841 | 8019563023 | 558 |
| 303 | 3300003215 | JGI25153J46596_10022574 | JGI25153J46596_100225742 | 559 |
| 304 | 3300003794 | Ga0055531_10005473 | Ga0055531_100054734 | 559 |
| 305 | 3300005262 | Ga0065165_1001210 | Ga0065165_10012104 | 559 |
| 306 | 3300005344 | Ga0070661_100117353 | Ga0070661_1001173531 | 559 |
| 307 | 3300005539 | Ga0068853_100137791 | Ga0068853_1001377911 | 559 |
| 308 | 3300005563 | Ga0068855_100000378 | Ga0068855_10000037840 | 559 |
| 309 | 3300005564 | Ga0070664_100024756 | Ga0070664_1000247563 | 559 |
| 310 | 3300005614 | Ga0068856_100139218 | Ga0068856_1001392182 | 559 |
| 311 | 3300006038 | Ga0075365_10009745 | Ga0075365_100097454 | 559 |
| 312 | 3300006038 | Ga0075365_10046749 | Ga0075365_100467492 | 559 |
| 313 | 3300006048 | Ga0075363_100018680 | Ga0075363_1000186803 | 559 |
| 314 | 3300006051 | Ga0075364_10069979 | Ga0075364_100699792 | 559 |
| 315 | 3300006942 | Ga0099824_1015031 | Ga0099824_10150312 | 559 |
| 316 | 3300009094 | Ga0111539_10021057 | Ga0111539_100210577 | 559 |
| 317 | 3300009147 | Ga0114129_10161538 | Ga0114129_101615381 | 559 |
| 318 | 3300010375 | Ga0105239_10014534 | Ga0105239_100145344 | 559 |
| 319 | 3300025230 | Ga0209563_101775 | Ga0209563_1017753 | 559 |
| 320 | 3300025261 | Ga0209233_1001962 | Ga0209233_10019625 | 559 |
| 321 | 3300025272 | Ga0209455_1002928 | Ga0209455_10029283 | 559 |
| 322 | 3300025297 | Ga0209758_1016969 | Ga0209758_10169692 | 559 |
| 323 | 3300025297 | Ga0209758_1019265 | Ga0209758_10192652 | 559 |
| 324 | 3300025302 | Ga0207426_1000617 | Ga0207426_100061721 | 559 |
| 325 | 3300025304 | Ga0209257_1000440 | Ga0209257_100044040 | 559 |
| 326 | 3300025913 | Ga0207695_10005145 | Ga0207695_100051455 | 559 |
| 327 | 3300025919 | Ga0207657_10117356 | Ga0207657_101173562 | 559 |
| 328 | 3300025933 | Ga0207706_10026306 | Ga0207706_100263064 | 559 |
| 329 | 3300026041 | Ga0207639_10064344 | Ga0207639_100643442 | 559 |
| 330 | 3300027296 | Ga0209389_1000029 | Ga0209389_100002984 | 559 |
| 331 | 3300027357 | Ga0209589_1000012 | Ga0209589_100001261 | 559 |
| 332 | 3300027357 | Ga0209589_1000013 | Ga0209589_1000013145 | 559 |
| 333 | 3300027361 | Ga0209489_100013 | Ga0209489_10001362 | 559 |
| 334 | 3300028379 | Ga0268266_10067389 | Ga0268266_100673891 | 559 |
| 335 | 3300033180 | Ga0307510_10071464 | Ga0307510_100714642 | 559 |
| 336 | 3300037471 | Ga0395905_0016353 | Ga0395905_0016353_3717_5432 | 559 |
| 337 | 3300038443 | Ga0395901_0012472 | Ga0395901_0012472_794_2557 | 559 |
| 338 | 3300044658 | Ga0466972_0000103 | Ga0466972_0000103_56377_58092 | 559 |
| 339 | 3300044693 | Ga0466961_0000129 | Ga0466961_0000129_20642_22357 | 559 |
| 340 | 3300046454 | Ga0495592_0019851 | Ga0495592_0019851_1071_2786 | 559 |
| 341 | 3300046459 | Ga0495629_0030711 | Ga0495629_0030711_82_1797 | 559 |
| 342 | 3300046460 | Ga0495638_0002281 | Ga0495638_0002281_1596_3311 | 559 |
| 343 | 3300046477 | Ga0495664_0011375 | Ga0495664_0011375_917_2632 | 559 |
| 344 | 3300046524 | Ga0495648_0009380 | Ga0495648_0009380_1733_3448 | 559 |
| 345 | 3300046529 | Ga0495652_0024834 | Ga0495652_0024834_2435_4150 | 559 |
| 346 | 3300046533 | Ga0495640_0037694 | Ga0495640_0037694_337_2052 | 559 |
| 347 | 3300046557 | Ga0495622_0034865 | Ga0495622_0034865_574_2289 | 559 |
| 348 | 3300046663 | Ga0495635_0005971 | Ga0495635_0005971_460_2175 | 559 |
| 349 | 3300046675 | Ga0495657_0009210 | Ga0495657_0009210_4395_6110 | 559 |
| 350 | 3300046679 | Ga0495623_0006918 | Ga0495623_0006918_2273_3988 | 559 |
| 351 | 3300046690 | Ga0495624_0091395 | Ga0495624_0091395_64_1779 | 559 |
| 352 | 3300046809 | Ga0495600_0055991 | Ga0495600_0055991_39_1754 | 559 |
| 353 | 3300047317 | Ga0495604_0002997 | Ga0495604_0002997_10375_12090 | 559 |
| 354 | 3300047319 | Ga0495674_0041857 | Ga0495674_0041857_2325_4040 | 559 |
| 355 | 3300047321 | Ga0495676_0032360 | Ga0495676_0032360_2439_4154 | 559 |
| 356 | 3300047444 | Ga0495675_0094325 | Ga0495675_0094325_45_1760 | 559 |
| 357 | 3300047469 | Ga0495673_0005038 | Ga0495673_0005038_285_2003 | 559 |
| 358 | 3300048088 | Ga0495602_0017685 | Ga0495602_0017685_5392_7107 | 559 |
| 359 | 3300048907 | Ga0496104_0010370 | Ga0496104_0010370_4050_5765 | 559 |
| 360 | 3300048907 | Ga0496104_0061130 | Ga0496104_0061130_1607_3322 | 559 |
| 361 | 3300048918 | Ga0496115_0026064 | Ga0496115_0026064_1241_2956 | 559 |
| 362 | 3300048922 | Ga0496119_0017281 | Ga0496119_0017281_1629_3344 | 559 |
| 363 | 3300048928 | Ga0496125_0064515 | Ga0496125_0064515_1153_2868 | 559 |
| 364 | 3300048929 | Ga0496126_0006097 | Ga0496126_0006097_2026_3741 | 559 |
| 365 | 3300049744 | Ga0501083_0060386 | Ga0501083_0060386_87_1823 | 559 |
| 366 | 3300050489 | nmdc:mga03683_18071_c1 | nmdc:mga03683_18071_c1_43_1758 | 559 |
| 367 | 3300050490 | nmdc:mga03n38_12398_c1 | nmdc:mga03n38_12398_c1_289_2004 | 559 |
| 368 | 3300050491 | nmdc:mga00v17_805_c1 | nmdc:mga00v17_805_c1_15331_17049 | 559 |
| 369 | 3300050492 | nmdc:mga0yw44_36418_c1 | nmdc:mga0yw44_36418_c1_38_1756 | 559 |
| 370 | 3300050511 | nmdc:mga08y16_30177_c1 | nmdc:mga08y16_30177_c1_2809_4524 | 559 |
| 371 | 3300053094 | Ga0500566_0017390 | Ga0500566_0017390_2378_4132 | 559 |
| 372 | 3300053136 | Ga0500559_0012818 | Ga0500559_0012818_204_1919 | 559 |
| 373 | 3300053139 | Ga0500568_0014217 | Ga0500568_0014217_594_2297 | 559 |
| 374 | 3300053736 | Ga0500599_001487 | Ga0500599_001487_307_2022 | 559 |
| 375 | 3300053737 | Ga0500601_000231 | Ga0500601_000231_6273_7988 | 559 |
| 376 | 3300060353 | Ga0501082_0031737 | Ga0501082_0031737_321_2057 | 559 |
| 377 | iso_pu_bacteria | 2885383462 | 2885391991 | 559 |
| 378 | 3300005344 | Ga0070661_100000694 | Ga0070661_1000006944 | 560 |
| 379 | 3300005434 | Ga0070709_10000732 | Ga0070709_1000073215 | 560 |
| 380 | 3300005437 | Ga0070710_10000211 | Ga0070710_1000021127 | 560 |
| 381 | 3300005439 | Ga0070711_100001113 | Ga0070711_1000011134 | 560 |
| 382 | 3300005548 | Ga0070665_100000078 | Ga0070665_100000078127 | 560 |
| 383 | 3300006042 | Ga0075368_10002838 | Ga0075368_100028381 | 560 |
| 384 | 3300006943 | Ga0099822_1015114 | Ga0099822_10151144 | 560 |
| 385 | 3300006944 | Ga0099823_1022970 | Ga0099823_10229705 | 560 |
| 386 | 3300010375 | Ga0105239_10060804 | Ga0105239_100608043 | 560 |
| 387 | 3300021384 | Ga0213876_10000991 | Ga0213876_100009912 | 560 |
| 388 | 3300025253 | Ga0209677_100351 | Ga0209677_10035122 | 560 |
| 389 | 3300025261 | Ga0209233_1006063 | Ga0209233_10060632 | 560 |
| 390 | 3300025272 | Ga0209455_1011707 | Ga0209455_10117071 | 560 |
| 391 | 3300025295 | Ga0209564_1003394 | Ga0209564_10033945 | 560 |
| 392 | 3300025297 | Ga0209758_1008915 | Ga0209758_10089152 | 560 |
| 393 | 3300025302 | Ga0207426_1000201 | Ga0207426_100020112 | 560 |
| 394 | 3300025898 | Ga0207692_10000494 | Ga0207692_1000049411 | 560 |
| 395 | 3300025906 | Ga0207699_10004161 | Ga0207699_100041614 | 560 |
| 396 | 3300025913 | Ga0207695_10053694 | Ga0207695_100536942 | 560 |
| 397 | 3300025914 | Ga0207671_10093117 | Ga0207671_100931171 | 560 |
| 398 | 3300025916 | Ga0207663_10000356 | Ga0207663_100003564 | 560 |
| 399 | 3300025929 | Ga0207664_10001702 | Ga0207664_100017026 | 560 |
| 400 | 3300025931 | Ga0207644_10034127 | Ga0207644_100341271 | 560 |
| 401 | 3300025939 | Ga0207665_10001832 | Ga0207665_100018322 | 560 |
| 402 | 3300026067 | Ga0207678_10004673 | Ga0207678_100046736 | 560 |
| 403 | 3300027296 | Ga0209389_1000076 | Ga0209389_100007619 | 560 |
| 404 | 3300027357 | Ga0209589_1000017 | Ga0209589_100001790 | 560 |
| 405 | 3300027361 | Ga0209489_100018 | Ga0209489_10001890 | 560 |
| 406 | 3300027361 | Ga0209489_100416 | Ga0209489_10041619 | 560 |
| 407 | 3300027363 | Ga0209700_100014 | Ga0209700_100014107 | 560 |
| 408 | 3300027363 | Ga0209700_100028 | Ga0209700_10002890 | 560 |
| 409 | 3300028379 | Ga0268266_10002705 | Ga0268266_100027053 | 560 |
| 410 | 3300028556 | Ga0265337_1006176 | Ga0265337_10061762 | 560 |
| 411 | 3300028558 | Ga0265326_10002792 | Ga0265326_100027922 | 560 |
| 412 | 3300028563 | Ga0265319_1009715 | Ga0265319_10097152 | 560 |
| 413 | 3300028573 | Ga0265334_10003782 | Ga0265334_100037822 | 560 |
| 414 | 3300028653 | Ga0265323_10007852 | Ga0265323_100078522 | 560 |
| 415 | 3300028666 | Ga0265336_10000430 | Ga0265336_100004303 | 560 |
| 416 | 3300028800 | Ga0265338_10000024 | Ga0265338_1000002490 | 560 |
| 417 | 3300029957 | Ga0265324_10017100 | Ga0265324_100171002 | 560 |
| 418 | 3300031507 | Ga0307509_10000606 | Ga0307509_1000060646 | 560 |
| 419 | 3300031712 | Ga0265342_10027107 | Ga0265342_100271072 | 560 |
| 420 | 3300031730 | Ga0307516_10051214 | Ga0307516_100512143 | 560 |
| 421 | 3300033442 | Ga0315911_1000033 | Ga0315911_10000332 | 560 |
| 422 | 3300037418 | Ga0395900_0046530 | Ga0395900_0046530_1976_3754 | 560 |
| 423 | 3300039437 | Ga0436365_0650112 | Ga0436365_0650112_41886_43604 | 560 |
| 424 | 3300039437 | Ga0436365_1771573 | Ga0436365_1771573_1823_3541 | 560 |
| 425 | 3300039453 | Ga0436362_0631557 | Ga0436362_0631557_610_2328 | 560 |
| 426 | 3300044656 | Ga0466969_0015098 | Ga0466969_0015098_798_2516 | 560 |
| 427 | 3300044842 | Ga0466957_0065165 | Ga0466957_0065165_27_1745 | 560 |
| 428 | 3300048911 | Ga0496108_0104266 | Ga0496108_0104266_391_2109 | 560 |
| 429 | 3300048924 | Ga0496121_0018322 | Ga0496121_0018322_779_2497 | 560 |
| 430 | 3300048928 | Ga0496125_0069831 | Ga0496125_0069831_971_2689 | 560 |
| 431 | 3300048929 | Ga0496126_0010543 | Ga0496126_0010543_7291_9009 | 560 |
| 432 | 3300049571 | Ga0501034_0030391 | Ga0501034_0030391_2389_4107 | 560 |
| 433 | 3300049572 | Ga0501036_0056784 | Ga0501036_0056784_740_2458 | 560 |
| 434 | 3300053130 | Ga0500642_0012341 | Ga0500642_0012341_160_1878 | 560 |
| 435 | iso_pu_bacteria | 8056681323 | 8056685165 | 560 |
| 436 | 3300005336 | Ga0070680_100121442 | Ga0070680_1001214422 | 561 |
| 437 | 3300005339 | Ga0070660_100129899 | Ga0070660_1001298991 | 561 |
| 438 | 3300005344 | Ga0070661_100099425 | Ga0070661_1000994251 | 561 |
| 439 | 3300005445 | Ga0070708_100001185 | Ga0070708_1000011854 | 561 |
| 440 | 3300005563 | Ga0068855_100012487 | Ga0068855_1000124875 | 561 |
| 441 | 3300005563 | Ga0068855_100041051 | Ga0068855_1000410512 | 561 |
| 442 | 3300005577 | Ga0068857_100116211 | Ga0068857_1001162112 | 561 |
| 443 | 3300005616 | Ga0068852_100002923 | Ga0068852_1000029232 | 561 |
| 444 | 3300005616 | Ga0068852_100046890 | Ga0068852_1000468903 | 561 |
| 445 | 3300006175 | Ga0070712_100131881 | Ga0070712_1001318811 | 561 |
| 446 | 3300006844 | Ga0075428_100056275 | Ga0075428_1000562752 | 561 |
| 447 | 3300009093 | Ga0105240_10004409 | Ga0105240_1000440914 | 561 |
| 448 | 3300009093 | Ga0105240_10009432 | Ga0105240_100094325 | 561 |
| 449 | 3300009545 | Ga0105237_10012543 | Ga0105237_100125436 | 561 |
| 450 | 3300010375 | Ga0105239_10004474 | Ga0105239_1000447413 | 561 |
| 451 | 3300013104 | Ga0157370_10142767 | Ga0157370_101427672 | 561 |
| 452 | 3300013105 | Ga0157369_10132887 | Ga0157369_101328872 | 561 |
| 453 | 3300021361 | Ga0213872_10016552 | Ga0213872_100165522 | 561 |
| 454 | 3300021361 | Ga0213872_10055869 | Ga0213872_100558691 | 561 |
| 455 | 3300025912 | Ga0207707_10016113 | Ga0207707_100161133 | 561 |
| 456 | 3300025913 | Ga0207695_10020475 | Ga0207695_100204752 | 561 |
| 457 | 3300025917 | Ga0207660_10012408 | Ga0207660_100124082 | 561 |
| 458 | 3300025919 | Ga0207657_10004425 | Ga0207657_100044252 | 561 |
| 459 | 3300025920 | Ga0207649_10008646 | Ga0207649_100086466 | 561 |
| 460 | 3300025921 | Ga0207652_10042328 | Ga0207652_100423283 | 561 |
| 461 | 3300026116 | Ga0207674_10018427 | Ga0207674_100184271 | 561 |
| 462 | 3300026142 | Ga0207698_10060721 | Ga0207698_100607211 | 561 |
| 463 | 3300031711 | Ga0265314_10000900 | Ga0265314_100009002 | 561 |
| 464 | 3300031712 | Ga0265342_10035094 | Ga0265342_100350942 | 561 |
| 465 | 3300037418 | Ga0395900_0005520 | Ga0395900_0005520_8704_10425 | 561 |
| 466 | 3300039437 | Ga0436365_0675289 | Ga0436365_0675289_2640_4364 | 561 |
| 467 | 3300039438 | Ga0436360_0130148 | Ga0436360_0130148_167_1888 | 561 |
| 468 | 3300039447 | Ga0436361_0413058 | Ga0436361_0413058_2837_4558 | 561 |
| 469 | 3300039447 | Ga0436361_0842658 | Ga0436361_0842658_2116_3837 | 561 |
| 470 | 3300044694 | Ga0466963_0064444 | Ga0466963_0064444_452_2173 | 561 |
| 471 | 3300046674 | Ga0495588_0013281 | Ga0495588_0013281_192_1913 | 561 |
| 472 | 3300047320 | Ga0495672_0062529 | Ga0495672_0062529_141_1877 | 561 |
| 473 | 3300048911 | Ga0496108_0037528 | Ga0496108_0037528_92_1813 | 561 |
| 474 | 3300049570 | Ga0501033_0087905 | Ga0501033_0087905_437_2161 | 561 |
| 475 | 3300053087 | Ga0500643_005623 | Ga0500643_005623_391_2133 | 561 |
| 476 | 3300053094 | Ga0500566_0000065 | Ga0500566_0000065_45046_46779 | 561 |
| 477 | 3300053111 | Ga0500572_001831 | Ga0500572_001831_3567_5288 | 561 |
| 478 | 3300053111 | Ga0500572_004048 | Ga0500572_004048_817_2550 | 561 |
| 479 | 3300053136 | Ga0500559_0001232 | Ga0500559_0001232_19_1740 | 561 |
| 480 | iso_pu_bacteria | 8056673599 | 8056678655 | 561 |
| 481 | 3300035111 | Ga0373923_0002084 | Ga0373923_0002084_4095_5873 | 562 |
| 482 | 3300035116 | Ga0373945_0009195 | Ga0373945_0009195_1366_3108 | 562 |
| 483 | 3300035118 | Ga0373954_0002205 | Ga0373954_0002205_217_1995 | 562 |
| 484 | 3300035119 | Ga0373956_0002935 | Ga0373956_0002935_223_2001 | 562 |
| 485 | 3300035120 | Ga0373957_0019136 | Ga0373957_0019136_137_1915 | 562 |
| 486 | 3300035172 | Ga0373955_0001794 | Ga0373955_0001794_213_1991 | 562 |
| 487 | 3300035410 | Ga0373924_0024589 | Ga0373924_0024589_118_1896 | 562 |
| 488 | 3300035724 | Ga0373933_0001425 | Ga0373933_0001425_6872_8650 | 562 |
| 489 | 3300035725 | Ga0373947_0056547 | Ga0373947_0056547_149_1891 | 562 |
| 490 | 3300036401 | Ga0373937_0035451 | Ga0373937_0035451_2552_4330 | 562 |
| 491 | 3300037068 | Ga0373925_0065052 | Ga0373925_0065052_871_2613 | 562 |
| 492 | 3300046454 | Ga0495592_0010990 | Ga0495592_0010990_185_1963 | 562 |
| 493 | 3300046459 | Ga0495629_0001069 | Ga0495629_0001069_201_1979 | 562 |
| 494 | 3300046462 | Ga0495651_0038836 | Ga0495651_0038836_1831_3609 | 562 |
| 495 | 3300046463 | Ga0495653_0001526 | Ga0495653_0001526_185_1963 | 562 |
| 496 | 3300046472 | Ga0495580_0072374 | Ga0495580_0072374_622_2364 | 562 |
| 497 | 3300046477 | Ga0495664_0049053 | Ga0495664_0049053_251_1993 | 562 |
| 498 | 3300046511 | Ga0495608_0016408 | Ga0495608_0016408_1516_3294 | 562 |
| 499 | 3300046511 | Ga0495608_0063039 | Ga0495608_0063039_185_1927 | 562 |
| 500 | 3300046529 | Ga0495652_0009826 | Ga0495652_0009826_201_1979 | 562 |
| 501 | 3300046536 | Ga0495587_0046397 | Ga0495587_0046397_585_2363 | 562 |
| 502 | 3300046543 | Ga0495645_0022979 | Ga0495645_0022979_185_1963 | 562 |
| 503 | 3300046559 | Ga0495667_0058742 | Ga0495667_0058742_457_2235 | 562 |
| 504 | 3300046642 | Ga0495634_0006809 | Ga0495634_0006809_2161_3939 | 562 |
| 505 | 3300046663 | Ga0495635_0000963 | Ga0495635_0000963_199_1977 | 562 |
| 506 | 3300046678 | Ga0495599_0053766 | Ga0495599_0053766_213_1991 | 562 |
| 507 | 3300046679 | Ga0495623_0007565 | Ga0495623_0007565_5059_6837 | 562 |
| 508 | 3300046680 | Ga0495646_0004493 | Ga0495646_0004493_5136_6914 | 562 |
| 509 | 3300046690 | Ga0495624_0042704 | Ga0495624_0042704_1043_2785 | 562 |
| 510 | 3300046809 | Ga0495600_0004451 | Ga0495600_0004451_217_1995 | 562 |
| 511 | 3300047317 | Ga0495604_0080115 | Ga0495604_0080115_213_1991 | 562 |
| 512 | 3300047319 | Ga0495674_0012971 | Ga0495674_0012971_189_1967 | 562 |
| 513 | 3300047322 | Ga0495680_0010209 | Ga0495680_0010209_217_1995 | 562 |
| 514 | 3300047444 | Ga0495675_0049780 | Ga0495675_0049780_787_2565 | 562 |
| 515 | 3300047471 | Ga0495684_0004918 | Ga0495684_0004918_7172_8950 | 562 |
| 516 | 3300047673 | Ga0495593_0000214 | Ga0495593_0000214_28605_30383 | 562 |
| 517 | 3300047673 | Ga0495593_0021124 | Ga0495593_0021124_516_2258 | 562 |
| 518 | 3300048088 | Ga0495602_0073491 | Ga0495602_0073491_186_1964 | 562 |
| 519 | 3300048928 | Ga0496125_0065592 | Ga0496125_0065592_699_2432 | 562 |
| 520 | 3300053084 | Ga0495595_0000449 | Ga0495595_0000449_8108_9886 | 562 |
| 521 | 3300053085 | Ga0495619_0001763 | Ga0495619_0001763_209_1987 | 562 |
| 522 | iso_pu_bacteria | 2824687955 | 2824690837 | 562 |
| 523 | 3300005347 | Ga0070668_100001432 | Ga0070668_10000143214 | 563 |
| 524 | 3300013306 | Ga0163162_10030837 | Ga0163162_100308374 | 563 |
| 525 | 3300031727 | Ga0316576_10047899 | Ga0316576_100478991 | 563 |
| 526 | 3300049586 | Ga0501070_0010935 | Ga0501070_0010935_2840_4567 | 563 |
| 527 | 3300049823 | Ga0501044_0041197 | Ga0501044_0041197_1558_3285 | 563 |
| 528 | iso_pu_bacteria | 2643221541 | 2643729739 | 563 |
| 529 | iso_pu_bacteria | 2643221606 | 2644044099 | 563 |
| 530 | iso_pu_bacteria | 2643221671 | 2644392568 | 563 |
| 531 | iso_pu_bacteria | 2721755755 | 2723842011 | 563 |
| 532 | iso_pu_bacteria | 2791355199 | 2793077440 | 563 |
| 533 | iso_pu_bacteria | 2874604998 | 2874610379 | 563 |
| 534 | iso_pu_bacteria | 2879110137 | 2879111698 | 563 |
| 535 | iso_pu_bacteria | 2889033259 | 2889035091 | 563 |
| 536 | iso_pu_bacteria | 2904690495 | 2904692518 | 563 |
| 537 | iso_pu_bacteria | 2908756301 | 2908756786 | 563 |
| 538 | iso_pu_bacteria | 2922361189 | 2922363351 | 563 |
| 539 | iso_pu_bacteria | 2922386360 | 2922388628 | 563 |
| 540 | iso_pu_bacteria | 8006964411 | 8006968296 | 563 |
| 541 | iso_pu_bacteria | 8006984368 | 8006985969 | 563 |
| 542 | iso_pu_bacteria | 8006994254 | 8007000226 | 563 |
| 543 | iso_pu_bacteria | 8056673599 | 8056677711 | 563 |
| 544 | iso_pu_bacteria | 8056689827 | 8056694126 | 563 |
| 545 | 3300005434 | Ga0070709_10005089 | Ga0070709_100050893 | 564 |
| 546 | 3300005436 | Ga0070713_100000001 | Ga0070713_100000001101 | 564 |
| 547 | 3300005539 | Ga0068853_100004334 | Ga0068853_1000043343 | 564 |
| 548 | 3300005547 | Ga0070693_100019429 | Ga0070693_1000194293 | 564 |
| 549 | 3300005547 | Ga0070693_100054567 | Ga0070693_1000545671 | 564 |
| 550 | 3300005577 | Ga0068857_100018032 | Ga0068857_1000180322 | 564 |
| 551 | 3300005614 | Ga0068856_100051247 | Ga0068856_1000512473 | 564 |
| 552 | 3300006175 | Ga0070712_100000198 | Ga0070712_10000019833 | 564 |
| 553 | 3300006175 | Ga0070712_100000499 | Ga0070712_1000004992 | 564 |
| 554 | 3300006871 | Ga0075434_100055004 | Ga0075434_1000550042 | 564 |
| 555 | 3300006914 | Ga0075436_100012867 | Ga0075436_1000128673 | 564 |
| 556 | 3300006914 | Ga0075436_100025717 | Ga0075436_1000257173 | 564 |
| 557 | 3300006914 | Ga0075436_100081699 | Ga0075436_1000816992 | 564 |
| 558 | 3300009093 | Ga0105240_10006449 | Ga0105240_100064496 | 564 |
| 559 | 3300009545 | Ga0105237_10020700 | Ga0105237_100207004 | 564 |
| 560 | 3300010375 | Ga0105239_10036439 | Ga0105239_100364393 | 564 |
| 561 | 3300013104 | Ga0157370_10003943 | Ga0157370_100039438 | 564 |
| 562 | 3300014968 | Ga0157379_10013671 | Ga0157379_100136713 | 564 |
| 563 | 3300025906 | Ga0207699_10000096 | Ga0207699_100000964 | 564 |
| 564 | 3300025915 | Ga0207693_10000094 | Ga0207693_1000009442 | 564 |
| 565 | 3300025928 | Ga0207700_10000015 | Ga0207700_10000015165 | 564 |
| 566 | 3300025949 | Ga0207667_10030736 | Ga0207667_100307363 | 564 |
| 567 | 3300026078 | Ga0207702_10000011 | Ga0207702_10000011160 | 564 |
| 568 | 3300026078 | Ga0207702_10000465 | Ga0207702_1000046533 | 564 |
| 569 | 3300026116 | Ga0207674_10000002 | Ga0207674_10000002163 | 564 |
| 570 | 3300026142 | Ga0207698_10094597 | Ga0207698_100945972 | 564 |
| 571 | 3300031241 | Ga0265325_10001297 | Ga0265325_1000129712 | 564 |
| 572 | 3300031249 | Ga0265339_10001140 | Ga0265339_1000114018 | 564 |
| 573 | 3300031595 | Ga0265313_10001099 | Ga0265313_100010999 | 564 |
| 574 | 3300035172 | Ga0373955_0067773 | Ga0373955_0067773_218_1951 | 564 |
| 575 | 3300036401 | Ga0373937_0088287 | Ga0373937_0088287_280_2013 | 564 |
| 576 | 3300037068 | Ga0373925_0070478 | Ga0373925_0070478_794_2527 | 564 |
| 577 | 3300039437 | Ga0436365_1157676 | Ga0436365_1157676_693_2426 | 564 |
| 578 | 3300049572 | Ga0501036_0152539 | Ga0501036_0152539_38_1780 | 564 |
| 579 | 3300049579 | Ga0501043_0035129 | Ga0501043_0035129_1564_3306 | 564 |
| 580 | 3300049581 | Ga0501047_0001651 | Ga0501047_0001651_8191_9933 | 564 |
| 581 | 3300049582 | Ga0501048_0084968 | Ga0501048_0084968_115_1857 | 564 |
| 582 | 3300050512 | nmdc:mga0n895_17840_c1 | nmdc:mga0n895_17840_c1_2453_4186 | 564 |
| 583 | 3300050514 | nmdc:mga08x19_23544_c1 | nmdc:mga08x19_23544_c1_2077_3810 | 564 |
| 584 | 3300050514 | nmdc:mga08x19_31771_c2 | nmdc:mga08x19_31771_c2_94_1827 | 564 |
| 585 | 3300050514 | nmdc:mga08x19_41_c1 | nmdc:mga08x19_41_c1_41039_42772 | 564 |
| 586 | 3300005841 | Ga0068863_100067148 | Ga0068863_1000671482 | 565 |
| 587 | 3300005843 | Ga0068860_100000257 | Ga0068860_10000025746 | 565 |
| 588 | 3300025908 | Ga0207643_10050478 | Ga0207643_100504782 | 565 |
| 589 | 3300025914 | Ga0207671_10027264 | Ga0207671_100272642 | 565 |
| 590 | 3300028381 | Ga0268264_10000049 | Ga0268264_10000049238 | 565 |
| 591 | 3300031240 | Ga0265320_10000594 | Ga0265320_100005942 | 565 |
| 592 | 3300031507 | Ga0307509_10048794 | Ga0307509_100487944 | 565 |
| 593 | 3300031730 | Ga0307516_10015603 | Ga0307516_100156035 | 565 |
| 594 | 3300033179 | Ga0307507_10020473 | Ga0307507_100204732 | 565 |
| 595 | 3300048909 | Ga0496106_0001870 | Ga0496106_0001870_5840_7579 | 565 |
| 596 | 3300048920 | Ga0496117_0004399 | Ga0496117_0004399_11852_13591 | 565 |
| 597 | 3300048921 | Ga0496118_0005557 | Ga0496118_0005557_8978_10717 | 565 |
| 598 | 3300048924 | Ga0496121_0000716 | Ga0496121_0000716_43346_45085 | 565 |
| 599 | 3300048927 | Ga0496124_0001529 | Ga0496124_0001529_16250_17989 | 565 |
| 600 | 3300048928 | Ga0496125_0042313 | Ga0496125_0042313_463_2202 | 565 |
| 601 | 3300048929 | Ga0496126_0016855 | Ga0496126_0016855_2470_4209 | 565 |
| 602 | 3300005435 | Ga0070714_100013699 | Ga0070714_1000136992 | 566 |
| 603 | 3300006038 | Ga0075365_10002405 | Ga0075365_100024057 | 566 |
| 604 | 3300006048 | Ga0075363_100036631 | Ga0075363_1000366311 | 566 |
| 605 | 3300006178 | Ga0075367_10005576 | Ga0075367_100055766 | 566 |
| 606 | 3300013105 | Ga0157369_10016112 | Ga0157369_100161122 | 566 |
| 607 | 3300022467 | Ga0224712_10008506 | Ga0224712_100085061 | 566 |
| 608 | 3300025929 | Ga0207664_10006879 | Ga0207664_100068795 | 566 |
| 609 | 3300037418 | Ga0395900_0003234 | Ga0395900_0003234_6316_8055 | 566 |
| 610 | 3300037466 | Ga0395898_0003112 | Ga0395898_0003112_2259_3998 | 566 |
| 611 | 3300039437 | Ga0436365_1132543 | Ga0436365_1132543_3165_4904 | 566 |
| 612 | 3300039437 | Ga0436365_1417024 | Ga0436365_1417024_844_2583 | 566 |
| 613 | 3300048929 | Ga0496126_0046200 | Ga0496126_0046200_252_1997 | 566 |
| 614 | 3300050490 | nmdc:mga03n38_2102_c1 | nmdc:mga03n38_2102_c1_3965_5701 | 566 |
| 615 | 3300050494 | nmdc:mga06z11_2594_c1 | nmdc:mga06z11_2594_c1_1068_2804 | 566 |
| 616 | 3300003203 | JGI25406J46586_10000009 | JGI25406J46586_1000000973 | 567 |
| 617 | 3300003203 | JGI25406J46586_10001070 | JGI25406J46586_1000107011 | 567 |
| 618 | 3300003659 | JGI25404J52841_10001198 | JGI25404J52841_100011983 | 567 |
| 619 | 3300005329 | Ga0070683_100011699 | Ga0070683_1000116995 | 567 |
| 620 | 3300005338 | Ga0068868_100031113 | Ga0068868_1000311132 | 567 |
| 621 | 3300005365 | Ga0070688_100049792 | Ga0070688_1000497921 | 567 |
| 622 | 3300005436 | Ga0070713_100007516 | Ga0070713_1000075164 | 567 |
| 623 | 3300005455 | Ga0070663_100005865 | Ga0070663_1000058653 | 567 |
| 624 | 3300005458 | Ga0070681_10013363 | Ga0070681_100133635 | 567 |
| 625 | 3300005459 | Ga0068867_100092449 | Ga0068867_1000924491 | 567 |
| 626 | 3300005530 | Ga0070679_100028402 | Ga0070679_1000284022 | 567 |
| 627 | 3300005535 | Ga0070684_100054727 | Ga0070684_1000547272 | 567 |
| 628 | 3300005548 | Ga0070665_100035980 | Ga0070665_1000359803 | 567 |
| 629 | 3300005563 | Ga0068855_100013741 | Ga0068855_1000137419 | 567 |
| 630 | 3300005563 | Ga0068855_100029724 | Ga0068855_1000297245 | 567 |
| 631 | 3300005577 | Ga0068857_100031281 | Ga0068857_1000312812 | 567 |
| 632 | 3300005614 | Ga0068856_100191346 | Ga0068856_1001913462 | 567 |
| 633 | 3300005719 | Ga0068861_100102745 | Ga0068861_1001027452 | 567 |
| 634 | 3300005937 | Ga0081455_10010356 | Ga0081455_100103564 | 567 |
| 635 | 3300005937 | Ga0081455_10015530 | Ga0081455_100155302 | 567 |
| 636 | 3300005937 | Ga0081455_10018973 | Ga0081455_100189735 | 567 |
| 637 | 3300005983 | Ga0081540_1002606 | Ga0081540_10026064 | 567 |
| 638 | 3300005983 | Ga0081540_1002760 | Ga0081540_100276012 | 567 |
| 639 | 3300005983 | Ga0081540_1006050 | Ga0081540_10060507 | 567 |
| 640 | 3300005983 | Ga0081540_1017407 | Ga0081540_10174074 | 567 |
| 641 | 3300005985 | Ga0081539_10000048 | Ga0081539_1000004873 | 567 |
| 642 | 3300005985 | Ga0081539_10000530 | Ga0081539_1000053029 | 567 |
| 643 | 3300006038 | Ga0075365_10027068 | Ga0075365_100270683 | 567 |
| 644 | 3300009093 | Ga0105240_10011824 | Ga0105240_100118248 | 567 |
| 645 | 3300009551 | Ga0105238_10033741 | Ga0105238_100337414 | 567 |
| 646 | 3300010159 | Ga0099796_10017188 | Ga0099796_100171882 | 567 |
| 647 | 3300013104 | Ga0157370_10007832 | Ga0157370_100078323 | 567 |
| 648 | 3300025904 | Ga0207647_10036497 | Ga0207647_100364972 | 567 |
| 649 | 3300025906 | Ga0207699_10009117 | Ga0207699_100091172 | 567 |
| 650 | 3300025912 | Ga0207707_10002611 | Ga0207707_100026119 | 567 |
| 651 | 3300025912 | Ga0207707_10014215 | Ga0207707_100142153 | 567 |
| 652 | 3300025913 | Ga0207695_10046036 | Ga0207695_100460362 | 567 |
| 653 | 3300025915 | Ga0207693_10007348 | Ga0207693_100073485 | 567 |
| 654 | 3300025916 | Ga0207663_10108814 | Ga0207663_101088141 | 567 |
| 655 | 3300025921 | Ga0207652_10024973 | Ga0207652_100249734 | 567 |
| 656 | 3300025924 | Ga0207694_10018576 | Ga0207694_100185764 | 567 |
| 657 | 3300025924 | Ga0207694_10070539 | Ga0207694_100705392 | 567 |
| 658 | 3300025933 | Ga0207706_10061276 | Ga0207706_100612762 | 567 |
| 659 | 3300025944 | Ga0207661_10000678 | Ga0207661_1000067823 | 567 |
| 660 | 3300025949 | Ga0207667_10043643 | Ga0207667_100436434 | 567 |
| 661 | 3300026067 | Ga0207678_10005720 | Ga0207678_100057204 | 567 |
| 662 | 3300026075 | Ga0207708_10073069 | Ga0207708_100730692 | 567 |
| 663 | 3300026116 | Ga0207674_10041082 | Ga0207674_100410823 | 567 |
| 664 | 3300026116 | Ga0207674_10044321 | Ga0207674_100443212 | 567 |
| 665 | 3300026121 | Ga0207683_10005111 | Ga0207683_100051112 | 567 |
| 666 | 3300028379 | Ga0268266_10007460 | Ga0268266_100074607 | 567 |
| 667 | 3300028379 | Ga0268266_10007480 | Ga0268266_100074802 | 567 |
| 668 | 3300028573 | Ga0265334_10025471 | Ga0265334_100254712 | 567 |
| 669 | 3300031235 | Ga0265330_10007390 | Ga0265330_100073907 | 567 |
| 670 | 3300031241 | Ga0265325_10002005 | Ga0265325_100020054 | 567 |
| 671 | 3300031247 | Ga0265340_10002628 | Ga0265340_100026282 | 567 |
| 672 | 3300031507 | Ga0307509_10096831 | Ga0307509_100968312 | 567 |
| 673 | 3300033180 | Ga0307510_10018815 | Ga0307510_100188151 | 567 |
| 674 | 3300035692 | Ga0373935_0000229 | Ga0373935_0000229_5603_7345 | 567 |
| 675 | 3300035695 | Ga0373927_0000071 | Ga0373927_0000071_28402_30144 | 567 |
| 676 | 3300035724 | Ga0373933_0000114 | Ga0373933_0000114_8453_10258 | 567 |
| 677 | 3300035725 | Ga0373947_0006904 | Ga0373947_0006904_4484_6226 | 567 |
| 678 | 3300036401 | Ga0373937_0026032 | Ga0373937_0026032_2627_4369 | 567 |
| 679 | 3300046455 | Ga0495603_0000035 | Ga0495603_0000035_24764_26506 | 567 |
| 680 | 3300046455 | Ga0495603_0006447 | Ga0495603_0006447_185_1927 | 567 |
| 681 | 3300046459 | Ga0495629_0000081 | Ga0495629_0000081_54588_56330 | 567 |
| 682 | 3300046461 | Ga0495641_0003571 | Ga0495641_0003571_8663_10405 | 567 |
| 683 | 3300046473 | Ga0495582_0000235 | Ga0495582_0000235_9831_11573 | 567 |
| 684 | 3300046475 | Ga0495639_0000010 | Ga0495639_0000010_20658_22400 | 567 |
| 685 | 3300046476 | Ga0495662_0000034 | Ga0495662_0000034_1020_2762 | 567 |
| 686 | 3300046477 | Ga0495664_0003381 | Ga0495664_0003381_3470_5212 | 567 |
| 687 | 3300046499 | Ga0495594_0004984 | Ga0495594_0004984_2282_4024 | 567 |
| 688 | 3300046507 | Ga0495606_0000265 | Ga0495606_0000265_60850_62592 | 567 |
| 689 | 3300046516 | Ga0495628_0027454 | Ga0495628_0027454_1107_2849 | 567 |
| 690 | 3300046531 | Ga0495665_0000005 | Ga0495665_0000005_7785_9527 | 567 |
| 691 | 3300046533 | Ga0495640_0010386 | Ga0495640_0010386_5313_7055 | 567 |
| 692 | 3300046642 | Ga0495634_0000261 | Ga0495634_0000261_24140_25882 | 567 |
| 693 | 3300046660 | Ga0495625_0022319 | Ga0495625_0022319_1725_3476 | 567 |
| 694 | 3300046680 | Ga0495646_0009132 | Ga0495646_0009132_4068_5810 | 567 |
| 695 | 3300046681 | Ga0495647_0000500 | Ga0495647_0000500_2931_4673 | 567 |
| 696 | 3300046683 | Ga0495658_0041467 | Ga0495658_0041467_448_2190 | 567 |
| 697 | 3300046684 | Ga0495669_0028465 | Ga0495669_0028465_411_2153 | 567 |
| 698 | 3300046689 | Ga0495613_0008391 | Ga0495613_0008391_5605_7347 | 567 |
| 699 | 3300046690 | Ga0495624_0001342 | Ga0495624_0001342_4619_6361 | 567 |
| 700 | 3300047315 | Ga0495581_0000018 | Ga0495581_0000018_23042_24784 | 567 |
| 701 | 3300047319 | Ga0495674_0000134 | Ga0495674_0000134_9420_11162 | 567 |
| 702 | 3300047673 | Ga0495593_0000072 | Ga0495593_0000072_27582_29324 | 567 |
| 703 | 3300048089 | Ga0495614_0014011 | Ga0495614_0014011_297_2039 | 567 |
| 704 | 3300048903 | Ga0496100_0047806 | Ga0496100_0047806_336_2078 | 567 |
| 705 | 3300048905 | Ga0496102_0093512 | Ga0496102_0093512_509_2251 | 567 |
| 706 | 3300048907 | Ga0496104_0101667 | Ga0496104_0101667_271_2013 | 567 |
| 707 | 3300048909 | Ga0496106_0024272 | Ga0496106_0024272_2442_4184 | 567 |
| 708 | 3300048913 | Ga0496110_0032951 | Ga0496110_0032951_2407_4149 | 567 |
| 709 | 3300048915 | Ga0496112_0000019 | Ga0496112_0000019_130842_132593 | 567 |
| 710 | 3300048917 | Ga0496114_0003712 | Ga0496114_0003712_5134_6876 | 567 |
| 711 | 3300048917 | Ga0496114_0003910 | Ga0496114_0003910_3485_5227 | 567 |
| 712 | 3300048918 | Ga0496115_0001711 | Ga0496115_0001711_6074_7816 | 567 |
| 713 | 3300048929 | Ga0496126_0043595 | Ga0496126_0043595_1242_3020 | 567 |
| 714 | 3300048929 | Ga0496126_0047952 | Ga0496126_0047952_1215_2966 | 567 |
| 715 | 3300049583 | Ga0501067_0017156 | Ga0501067_0017156_1356_3116 | 567 |
| 716 | 3300050496 | nmdc:mga07m45_10790_c1 | nmdc:mga07m45_10790_c1_797_2548 | 567 |
| 717 | 3300053077 | Ga0495601_0044676 | Ga0495601_0044676_658_2400 | 567 |
| 718 | 3300053080 | Ga0500635_0014926 | Ga0500635_0014926_391_2133 | 567 |
| 719 | 3300053119 | Ga0500595_007200 | Ga0500595_007200_2795_4546 | 567 |
| 720 | 3300053150 | Ga0500603_000165 | Ga0500603_000165_14685_16427 | 567 |
| 721 | 3300053178 | Ga0500637_0018015 | Ga0500637_0018015_150_1892 | 567 |
| 722 | 3300005435 | Ga0070714_100039232 | Ga0070714_1000392323 | 568 |
| 723 | 3300005563 | Ga0068855_100086805 | Ga0068855_1000868053 | 568 |
| 724 | 3300005614 | Ga0068856_100073128 | Ga0068856_1000731282 | 568 |
| 725 | 3300025929 | Ga0207664_10025212 | Ga0207664_100252123 | 568 |
| 726 | 3300026041 | Ga0207639_10084776 | Ga0207639_100847762 | 568 |
| 727 | 3300006353 | Ga0075370_10017249 | Ga0075370_100172492 | 569 |
| 728 | 3300030521 | Ga0307511_10028194 | Ga0307511_100281945 | 569 |
| 729 | 3300049823 | Ga0501044_0010517 | Ga0501044_0010517_3475_5226 | 569 |
| 730 | 3300005434 | Ga0070709_10055666 | Ga0070709_100556662 | 570 |
| 731 | 3300025906 | Ga0207699_10055717 | Ga0207699_100557172 | 570 |
| 732 | 3300025929 | Ga0207664_10014340 | Ga0207664_100143402 | 570 |
| 733 | 3300005347 | Ga0070668_100003177 | Ga0070668_1000031779 | 576 |
| 734 | 3300005367 | Ga0070667_100014374 | Ga0070667_1000143743 | 576 |
| 735 | 3300005548 | Ga0070665_100000300 | Ga0070665_10000030038 | 576 |
| 736 | 3300005844 | Ga0068862_100023319 | Ga0068862_1000233192 | 576 |
| 737 | 3300009177 | Ga0105248_10101093 | Ga0105248_101010933 | 576 |
| 738 | 3300025941 | Ga0207711_10060400 | Ga0207711_100604001 | 576 |
| 739 | 3300025972 | Ga0207668_10000206 | Ga0207668_1000020635 | 576 |
| 740 | 3300025986 | Ga0207658_10002058 | Ga0207658_1000205811 | 576 |
| 741 | 3300028379 | Ga0268266_10001512 | Ga0268266_1000151225 | 576 |
| 742 | 3300028380 | Ga0268265_10023588 | Ga0268265_100235883 | 576 |
| 743 | 3300001904 | JGI24736J21556_1000255 | JGI24736J21556_10002554 | 580 |
| 744 | 3300001904 | JGI24736J21556_1001954 | JGI24736J21556_10019543 | 580 |
| 745 | 3300001915 | JGI24741J21665_1000319 | JGI24741J21665_10003192 | 580 |
| 746 | 3300001979 | JGI24740J21852_10002383 | JGI24740J21852_100023836 | 580 |
| 747 | 3300001989 | JGI24739J22299_10000140 | JGI24739J22299_100001404 | 580 |
| 748 | 3300001989 | JGI24739J22299_10015400 | JGI24739J22299_100154002 | 580 |
| 749 | 3300002067 | JGI24735J21928_10000421 | JGI24735J21928_100004217 | 580 |
| 750 | 3300002075 | JGI24738J21930_10000172 | JGI24738J21930_1000017216 | 580 |
| 751 | 3300002075 | JGI24738J21930_10004142 | JGI24738J21930_100041422 | 580 |
| 752 | 3300005337 | Ga0070682_100057594 | Ga0070682_1000575942 | 580 |
| 753 | 3300005339 | Ga0070660_100057258 | Ga0070660_1000572581 | 580 |
| 754 | 3300005344 | Ga0070661_100052486 | Ga0070661_1000524862 | 580 |
| 755 | 3300005457 | Ga0070662_100061223 | Ga0070662_1000612233 | 580 |
| 756 | 3300005564 | Ga0070664_100040931 | Ga0070664_1000409313 | 580 |
| 757 | 3300005577 | Ga0068857_100018795 | Ga0068857_1000187955 | 580 |
| 758 | 3300009174 | Ga0105241_10003385 | Ga0105241_100033852 | 580 |
| 759 | 3300013104 | Ga0157370_10010501 | Ga0157370_100105016 | 580 |
| 760 | 3300013307 | Ga0157372_10098716 | Ga0157372_100987162 | 580 |
| 761 | 3300025321 | Ga0207656_10008793 | Ga0207656_100087932 | 580 |
| 762 | 3300025904 | Ga0207647_10001008 | Ga0207647_1000100810 | 580 |
| 763 | 3300025909 | Ga0207705_10062433 | Ga0207705_100624332 | 580 |
| 764 | 3300025911 | Ga0207654_10001821 | Ga0207654_100018212 | 580 |
| 765 | 3300025913 | Ga0207695_10017517 | Ga0207695_100175171 | 580 |
| 766 | 3300025913 | Ga0207695_10184871 | Ga0207695_101848712 | 580 |
| 767 | 3300025914 | Ga0207671_10002722 | Ga0207671_100027229 | 580 |
| 768 | 3300025919 | Ga0207657_10043683 | Ga0207657_100436833 | 580 |
| 769 | 3300025924 | Ga0207694_10006266 | Ga0207694_100062662 | 580 |
| 770 | 3300025924 | Ga0207694_10121213 | Ga0207694_101212132 | 580 |
| 771 | 3300025933 | Ga0207706_10005065 | Ga0207706_1000506510 | 580 |
| 772 | 3300025933 | Ga0207706_10069306 | Ga0207706_100693062 | 580 |
| 773 | 3300025981 | Ga0207640_10046274 | Ga0207640_100462742 | 580 |
| 774 | 3300026041 | Ga0207639_10000716 | Ga0207639_1000071616 | 580 |
| 775 | 3300026041 | Ga0207639_10010687 | Ga0207639_100106876 | 580 |
| 776 | 3300026078 | Ga0207702_10003834 | Ga0207702_100038344 | 580 |
| 777 | 3300026078 | Ga0207702_10004629 | Ga0207702_1000462911 | 580 |
| 778 | 3300026116 | Ga0207674_10053198 | Ga0207674_100531984 | 580 |
| 779 | 3300031548 | Ga0307408_100001451 | Ga0307408_1000014518 | 580 |
| 780 | 3300031731 | Ga0307405_10020376 | Ga0307405_100203762 | 580 |
| 781 | 3300031731 | Ga0307405_10046204 | Ga0307405_100462042 | 580 |
| 782 | 3300031852 | Ga0307410_10012623 | Ga0307410_100126231 | 580 |
| 783 | 3300032002 | Ga0307416_100101138 | Ga0307416_1001011382 | 580 |
| 784 | 3300032004 | Ga0307414_10000290 | Ga0307414_1000029018 | 580 |
| 785 | 3300049663 | Ga0501223_000074 | Ga0501223_000074_5473_7215 | 580 |
| 786 | 3300049664 | Ga0501224_000017 | Ga0501224_000017_23045_24787 | 580 |
| 787 | 3300049668 | Ga0501233_000110 | Ga0501233_000110_2626_4368 | 580 |
| 788 | 3300049669 | Ga0501235_000012 | Ga0501235_000012_26419_28161 | 580 |
| 789 | 3300049705 | Ga0501225_0000007 | Ga0501225_0000007_23051_24793 | 580 |
| 790 | 3300049707 | Ga0501234_000212 | Ga0501234_000212_2622_4364 | 580 |
| 791 | 3300049853 | Ga0501226_000040 | Ga0501226_000040_2622_4364 | 580 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gip-assembly2.cif.gz_B | crystal structure of n-acyl-d-glutamate deacylase from bordetella bronchiseptica complexed with zinc, acetate and formate ions. | 0.7713 | 5 | 563 |
| 3gip-assembly2.cif.gz_B | crystal structure of n-acyl-d-glutamate deacylase from bordetella bronchiseptica complexed with zinc, acetate and formate ions. | 0.7652 | 5 | 563 |
| 1v4y-assembly1.cif.gz_A | the functional role of the binuclear metal center in d-aminoacylase. one-metal activation and second-metal attenuation | 0.7388 | 5 | 563 |
| 1rk6-assembly1.cif.gz_A | the enzyme in complex with 50mm cdcl2 | 0.7362 | 5 | 563 |
| 1rk5-assembly1.cif.gz_A | the d-aminoacylase mutant d366a in complex with 100mm cucl2 | 0.7361 | 5 | 563 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rjrA01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9335 | 5 | 55 | 2.30.40.10 |
| af_P77671_2_52_2.30.40.10 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9222 | 4 | 54 | 2.30.40.10 |
| 1nfgD01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9137 | 6 | 57 | 2.30.40.10 |
| 3e74D01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.91 | 4 | 56 | 2.30.40.10 |
| 1nfgB01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9059 | 6 | 54 | 2.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I0KHE5-F1-model_v4 | deleted | 0.9896 | 57 | 206 |
|
| AF-X7XNI6-F1-model_v4 | Amidohydrolase family protein | 0.9855 | 57 | 180 |
GO:0016787
|
| AF-A0A4Q3CNI2-F1-model_v4 | D-aminoacylase | 0.9845 | 5 | 218 |
GO:0005829
GO:0016812 |
| AF-A0A349J4A3-F1-model_v4 | Amidohydrolase | 0.9833 | 3 | 264 |
GO:0005829
GO:0016812 |
| AF-A0A3D1GG47-F1-model_v4 | deleted | 0.9833 | 3 | 225 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar