F480990
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 791 | 315 | 782 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300033524|Ga0316592_1037898|Ga0316592_10378981 |
| Length | 339 |
| Sequence | MKSKLEYIWLDGTVPTQQLRSKTKIKEDFSGKLEDCPVWNFDGSSTNQSGGGKSDLLLKPVFICPDPDRKNAYLVMTEVLNADGTPHETNGRAHIEEEDDDFWFGFEQEYFIYDPQTRLPIGFPAGGFPLPQGPYYCGVGGSKAFGRQIVEEHLDMCLEAGLNVEGINAEVAAGQWEFQIFAKGAHSAGDQIWMARYLAERTAEKYGLDIEWHPKPLGKDLDWNGSGMHANFSNGLMRTCGDKKVFDTICEEFGKHIPEHIAVYGAYNDQRLTGKHETQSIDSFSYGAFDRGASIRIPVNTIEDGWKGRLEDRRPASNGDPYKIAAIIIKTTHKAVAKM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 3 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 4 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 5 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 6 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 7 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 8 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 9 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 10 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 14 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 207 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 212 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 213 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 219 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 220 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 227 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 228 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 229 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 282 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 285 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 286 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 287 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 289 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 290 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 291 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 297 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 298 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 299 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 300 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 301 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 302 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 303 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 304 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 307 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 309 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 311 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 312 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 313 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.58 |
| Metatranscriptomes | 3.29 |
| Isolates | 1.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.45 |
| Nodule | 0 |
| Rhizoplane | 0.38 |
| Rhizosphere | 88.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001094 | 3300001904 | Bacteria | 4957 |
| 2 | JGI24739J22299_10019733 | 3300001989 | Bacteria | 2410 |
| 3 | JGI24737J22298_10005842 | 3300001990 | Bacteria | 4238 |
| 4 | JGI24737J22298_10007501 | 3300001990 | Bacteria | 3679 |
| 5 | JGI24737J22298_10014505 | 3300001990 | Bacteria | 2558 |
| 6 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 7 | JGI25162J39368_1000017 | 3300002737 | Bacteria | 281385 |
| 8 | JGI25162J39368_1000774 | 3300002737 | Bacteria | 21551 |
| 9 | JGI25406J46586_10053471 | 3300003203 | Bacteria | 1340 |
| 10 | JGI25165J46597_1002106 | 3300003214 | Bacteria | 7255 |
| 11 | rootH1_10002295 | 3300003316 | Bacteria | 16572 |
| 12 | rootH1_10005314 | 3300003316 | Bacteria | 25578 |
| 13 | rootH2_10000120 | 3300003320 | Bacteria | 21848 |
| 14 | rootH2_10005887 | 3300003320 | Bacteria | 16531 |
| 15 | rootH2_10107502 | 3300003320 | Bacteria | 8852 |
| 16 | rootL2_10011707 | 3300003322 | Bacteria | 5424 |
| 17 | rootL2_10032383 | 3300003322 | Bacteria | 16765 |
| 18 | rootL2_10051135 | 3300003322 | Bacteria | 6633 |
| 19 | rootL2_10165298 | 3300003322 | Bacteria | 9047 |
| 20 | rootH1_10009528 | 3300003323 | Bacteria | 31356 |
| 21 | rootH1_10041936 | 3300003323 | Bacteria | 19801 |
| 22 | JGI25160J50197_1000860 | 3300003354 | Bacteria | 16129 |
| 23 | Ga0055531_10000026 | 3300003794 | Bacteria | 160364 |
| 24 | Ga0065165_1000266 | 3300005262 | Bacteria | 90228 |
| 25 | Ga0065712_10001062 | 3300005290 | Bacteria | 7585 |
| 26 | Ga0065712_10102171 | 3300005290 | Bacteria | 2016 |
| 27 | Ga0065712_10181277 | 3300005290 | Bacteria | 1191 |
| 28 | Ga0065715_10003311 | 3300005293 | Bacteria | 4961 |
| 29 | Ga0065707_10097749 | 3300005295 | Bacteria | 3146 |
| 30 | Ga0070658_10000011 | 3300005327 | Bacteria | 294396 |
| 31 | Ga0070676_10001127 | 3300005328 | Bacteria | 13348 |
| 32 | Ga0070676_10003209 | 3300005328 | Bacteria | 8475 |
| 33 | Ga0070676_10015757 | 3300005328 | Bacteria | 4170 |
| 34 | Ga0070683_100000228 | 3300005329 | Bacteria | 38265 |
| 35 | Ga0070683_100003644 | 3300005329 | Bacteria | 12546 |
| 36 | Ga0070683_100021481 | 3300005329 | Bacteria | 5762 |
| 37 | Ga0070683_100104041 | 3300005329 | Bacteria | 2676 |
| 38 | Ga0070683_100117797 | 3300005329 | Bacteria | 2508 |
| 39 | Ga0070690_100002371 | 3300005330 | Bacteria | 10127 |
| 40 | Ga0070690_100054029 | 3300005330 | Bacteria | 2571 |
| 41 | Ga0070670_100183606 | 3300005331 | Bacteria | 1816 |
| 42 | Ga0068869_100006749 | 3300005334 | Bacteria | 7292 |
| 43 | Ga0068869_100041953 | 3300005334 | Bacteria | 3278 |
| 44 | Ga0070666_10000051 | 3300005335 | Bacteria | 99740 |
| 45 | Ga0070682_100083044 | 3300005337 | Bacteria | 2078 |
| 46 | Ga0070682_100107202 | 3300005337 | Bacteria | 1855 |
| 47 | Ga0068868_100001454 | 3300005338 | Bacteria | 16337 |
| 48 | Ga0068868_100004292 | 3300005338 | Bacteria | 9981 |
| 49 | Ga0068868_100006589 | 3300005338 | Bacteria | 8232 |
| 50 | Ga0068868_100015633 | 3300005338 | Bacteria | 5620 |
| 51 | Ga0068868_100062232 | 3300005338 | Bacteria | 2958 |
| 52 | Ga0068868_100126373 | 3300005338 | Bacteria | 2089 |
| 53 | Ga0068868_100320609 | 3300005338 | Bacteria | 1320 |
| 54 | Ga0070660_100160916 | 3300005339 | Bacteria | 1809 |
| 55 | Ga0070689_100003291 | 3300005340 | Bacteria | 10730 |
| 56 | Ga0070689_100082898 | 3300005340 | Bacteria | 2519 |
| 57 | Ga0070687_100034448 | 3300005343 | Bacteria | 2507 |
| 58 | Ga0070661_100000443 | 3300005344 | Bacteria | 31823 |
| 59 | Ga0070661_100024402 | 3300005344 | Bacteria | 4337 |
| 60 | Ga0070668_100007989 | 3300005347 | Bacteria | 7859 |
| 61 | Ga0070668_100032172 | 3300005347 | Bacteria | 3992 |
| 62 | Ga0070668_100118733 | 3300005347 | Bacteria | 2111 |
| 63 | Ga0070669_100065404 | 3300005353 | Bacteria | 2679 |
| 64 | Ga0070669_100086702 | 3300005353 | Bacteria | 2340 |
| 65 | Ga0070675_100057529 | 3300005354 | Bacteria | 3206 |
| 66 | Ga0070675_100136268 | 3300005354 | Bacteria | 2095 |
| 67 | Ga0070675_100195735 | 3300005354 | Bacteria | 1753 |
| 68 | Ga0070671_100002364 | 3300005355 | Bacteria | 14559 |
| 69 | Ga0070671_100062848 | 3300005355 | Bacteria | 3091 |
| 70 | Ga0070674_100055922 | 3300005356 | Bacteria | 2735 |
| 71 | Ga0070674_100104360 | 3300005356 | Bacteria | 2071 |
| 72 | Ga0070673_100006709 | 3300005364 | Bacteria | 7506 |
| 73 | Ga0070673_100033594 | 3300005364 | Bacteria | 3876 |
| 74 | Ga0070673_100043498 | 3300005364 | Bacteria | 3471 |
| 75 | Ga0070673_100058801 | 3300005364 | Bacteria | 3041 |
| 76 | Ga0070673_100153403 | 3300005364 | Bacteria | 1952 |
| 77 | Ga0070673_100171994 | 3300005364 | Bacteria | 1849 |
| 78 | Ga0070673_100217106 | 3300005364 | Bacteria | 1653 |
| 79 | Ga0070688_100025601 | 3300005365 | Bacteria | 3494 |
| 80 | Ga0070688_100031289 | 3300005365 | Bacteria | 3201 |
| 81 | Ga0070688_100086197 | 3300005365 | Bacteria | 2043 |
| 82 | Ga0070659_100001530 | 3300005366 | Bacteria | 16680 |
| 83 | Ga0070659_100001700 | 3300005366 | Bacteria | 15810 |
| 84 | Ga0070659_100003474 | 3300005366 | Bacteria | 11211 |
| 85 | Ga0070659_100157601 | 3300005366 | Bacteria | 1855 |
| 86 | Ga0070667_100010216 | 3300005367 | Bacteria | 7755 |
| 87 | Ga0070667_100019342 | 3300005367 | Bacteria | 5650 |
| 88 | Ga0070667_100069235 | 3300005367 | Bacteria | 3003 |
| 89 | Ga0070667_100086982 | 3300005367 | Bacteria | 2682 |
| 90 | Ga0070667_100106847 | 3300005367 | Bacteria | 2423 |
| 91 | Ga0070667_100154764 | 3300005367 | Bacteria | 2016 |
| 92 | Ga0070678_100003359 | 3300005456 | Bacteria | 8917 |
| 93 | Ga0070678_100019268 | 3300005456 | Bacteria | 4444 |
| 94 | Ga0070678_100022137 | 3300005456 | Bacteria | 4204 |
| 95 | Ga0070662_100002245 | 3300005457 | Bacteria | 11849 |
| 96 | Ga0070662_100003667 | 3300005457 | Bacteria | 9595 |
| 97 | Ga0070662_100004108 | 3300005457 | Bacteria | 9146 |
| 98 | Ga0070662_100010394 | 3300005457 | Bacteria | 6104 |
| 99 | Ga0070681_10031571 | 3300005458 | Bacteria | 5318 |
| 100 | Ga0070681_10190722 | 3300005458 | Bacteria | 1969 |
| 101 | Ga0068867_100000844 | 3300005459 | Bacteria | 20625 |
| 102 | Ga0068867_100012531 | 3300005459 | Bacteria | 5999 |
| 103 | Ga0068867_100014377 | 3300005459 | Bacteria | 5608 |
| 104 | Ga0068867_100036578 | 3300005459 | Bacteria | 3565 |
| 105 | Ga0068867_100139400 | 3300005459 | Bacteria | 1894 |
| 106 | Ga0068867_100161935 | 3300005459 | Bacteria | 1765 |
| 107 | Ga0068867_100429299 | 3300005459 | Bacteria | 1121 |
| 108 | Ga0070685_10010336 | 3300005466 | Bacteria | 4847 |
| 109 | Ga0070685_10039884 | 3300005466 | Bacteria | 2670 |
| 110 | Ga0070685_10240157 | 3300005466 | Bacteria | 1195 |
| 111 | Ga0070698_100000297 | 3300005471 | Bacteria | 50707 |
| 112 | Ga0070698_100005528 | 3300005471 | Bacteria | 13808 |
| 113 | Ga0070679_100010044 | 3300005530 | Bacteria | 8966 |
| 114 | Ga0070679_100153790 | 3300005530 | Bacteria | 2276 |
| 115 | Ga0070684_100001378 | 3300005535 | Bacteria | 17456 |
| 116 | Ga0070684_100030200 | 3300005535 | Bacteria | 4602 |
| 117 | Ga0070684_100086450 | 3300005535 | Bacteria | 2783 |
| 118 | Ga0070684_100208045 | 3300005535 | Unclassified | 1783 |
| 119 | Ga0070684_100385862 | 3300005535 | Bacteria | 1290 |
| 120 | Ga0068853_100003147 | 3300005539 | Bacteria | 12610 |
| 121 | Ga0068853_100043624 | 3300005539 | Bacteria | 3837 |
| 122 | Ga0068853_100048142 | 3300005539 | Bacteria | 3660 |
| 123 | Ga0068853_100050373 | 3300005539 | Bacteria | 3583 |
| 124 | Ga0068853_100526471 | 3300005539 | Bacteria | 1118 |
| 125 | Ga0070672_100180848 | 3300005543 | Bacteria | 1757 |
| 126 | Ga0070686_100069084 | 3300005544 | Bacteria | 2306 |
| 127 | Ga0070686_100117277 | 3300005544 | Bacteria | 1823 |
| 128 | Ga0070686_100239448 | 3300005544 | Bacteria | 1320 |
| 129 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 130 | Ga0070665_100047316 | 3300005548 | Bacteria | 4318 |
| 131 | Ga0070665_100162423 | 3300005548 | Bacteria | 2236 |
| 132 | Ga0070704_100000001 | 3300005549 | Bacteria | 193214 |
| 133 | Ga0070704_100325264 | 3300005549 | Bacteria | 1290 |
| 134 | Ga0068855_100000035 | 3300005563 | Bacteria | 165487 |
| 135 | Ga0068855_100000506 | 3300005563 | Bacteria | 48223 |
| 136 | Ga0068855_100136419 | 3300005563 | Bacteria | 2799 |
| 137 | Ga0068855_100221351 | 3300005563 | Bacteria | 2122 |
| 138 | Ga0070664_100000126 | 3300005564 | Bacteria | 51280 |
| 139 | Ga0070664_100129068 | 3300005564 | Bacteria | 2220 |
| 140 | Ga0068857_100000388 | 3300005577 | Bacteria | 30820 |
| 141 | Ga0068857_100039665 | 3300005577 | Bacteria | 4172 |
| 142 | Ga0068857_100041652 | 3300005577 | Bacteria | 4072 |
| 143 | Ga0068857_100076485 | 3300005577 | Bacteria | 2985 |
| 144 | Ga0068857_100099773 | 3300005577 | Bacteria | 2605 |
| 145 | Ga0068857_100424757 | 3300005577 | Bacteria | 1240 |
| 146 | Ga0068854_100025486 | 3300005578 | Bacteria | 4058 |
| 147 | Ga0068854_100168955 | 3300005578 | Bacteria | 1700 |
| 148 | Ga0068856_100002273 | 3300005614 | Bacteria | 19820 |
| 149 | Ga0068856_100005752 | 3300005614 | Bacteria | 12217 |
| 150 | Ga0068856_100016539 | 3300005614 | Bacteria | 7140 |
| 151 | Ga0068856_100485027 | 3300005614 | Bacteria | 1257 |
| 152 | Ga0070702_100067102 | 3300005615 | Bacteria | 2106 |
| 153 | Ga0068852_100000321 | 3300005616 | Bacteria | 32639 |
| 154 | Ga0068852_100000590 | 3300005616 | Bacteria | 23897 |
| 155 | Ga0068852_100006413 | 3300005616 | Bacteria | 8501 |
| 156 | Ga0068859_100000023 | 3300005617 | Bacteria | 221914 |
| 157 | Ga0068859_100021815 | 3300005617 | Bacteria | 6422 |
| 158 | Ga0068859_100034932 | 3300005617 | Bacteria | 5043 |
| 159 | Ga0068859_100084110 | 3300005617 | Bacteria | 3226 |
| 160 | Ga0068859_100117101 | 3300005617 | Bacteria | 2729 |
| 161 | Ga0068859_100361898 | 3300005617 | Bacteria | 1546 |
| 162 | Ga0068864_100001566 | 3300005618 | Bacteria | 18828 |
| 163 | Ga0068864_100190720 | 3300005618 | Bacteria | 1879 |
| 164 | Ga0068864_100230798 | 3300005618 | Bacteria | 1711 |
| 165 | Ga0068864_100262894 | 3300005618 | Bacteria | 1606 |
| 166 | Ga0068866_10007841 | 3300005718 | Bacteria | 4480 |
| 167 | Ga0068861_100014197 | 3300005719 | Bacteria | 5587 |
| 168 | Ga0068861_100020452 | 3300005719 | Bacteria | 4741 |
| 169 | Ga0068861_100066705 | 3300005719 | Bacteria | 2775 |
| 170 | Ga0068861_100180276 | 3300005719 | Bacteria | 1758 |
| 171 | Ga0068851_10007740 | 3300005834 | Bacteria | 4942 |
| 172 | Ga0068851_10024439 | 3300005834 | Bacteria | 2958 |
| 173 | Ga0068851_10045210 | 3300005834 | Bacteria | 2225 |
| 174 | Ga0068851_10079958 | 3300005834 | Bacteria | 1706 |
| 175 | Ga0068870_10016650 | 3300005840 | Bacteria | 3518 |
| 176 | Ga0068863_100014563 | 3300005841 | Bacteria | 7570 |
| 177 | Ga0068863_100015773 | 3300005841 | Bacteria | 7254 |
| 178 | Ga0068863_100047731 | 3300005841 | Bacteria | 4061 |
| 179 | Ga0068863_100158227 | 3300005841 | Bacteria | 2169 |
| 180 | Ga0068863_100199838 | 3300005841 | Bacteria | 1923 |
| 181 | Ga0068863_100312499 | 3300005841 | Bacteria | 1525 |
| 182 | Ga0068858_100004690 | 3300005842 | Bacteria | 13396 |
| 183 | Ga0068858_100063280 | 3300005842 | Bacteria | 3423 |
| 184 | Ga0068858_100152685 | 3300005842 | Bacteria | 2172 |
| 185 | Ga0068858_100263952 | 3300005842 | Bacteria | 1637 |
| 186 | Ga0068860_100000053 | 3300005843 | Bacteria | 207331 |
| 187 | Ga0068860_100006137 | 3300005843 | Bacteria | 12089 |
| 188 | Ga0068860_100013396 | 3300005843 | Bacteria | 8040 |
| 189 | Ga0068860_100055899 | 3300005843 | Bacteria | 3752 |
| 190 | Ga0068862_100087658 | 3300005844 | Bacteria | 2707 |
| 191 | Ga0068862_100224322 | 3300005844 | Bacteria | 1702 |
| 192 | Ga0081539_10002032 | 3300005985 | Bacteria | 30481 |
| 193 | Ga0070716_100287332 | 3300006173 | Bacteria | 1138 |
| 194 | Ga0075366_10000123 | 3300006195 | Bacteria | 32043 |
| 195 | Ga0075366_10001829 | 3300006195 | Bacteria | 10726 |
| 196 | Ga0075366_10013142 | 3300006195 | Bacteria | 4708 |
| 197 | Ga0075366_10022193 | 3300006195 | Bacteria | 3692 |
| 198 | Ga0075366_10119045 | 3300006195 | Bacteria | 1591 |
| 199 | Ga0097621_100000020 | 3300006237 | Bacteria | 86226 |
| 200 | Ga0097621_100007241 | 3300006237 | Bacteria | 7922 |
| 201 | Ga0097621_100036478 | 3300006237 | Bacteria | 3933 |
| 202 | Ga0097621_100096526 | 3300006237 | Bacteria | 2480 |
| 203 | Ga0097621_100168801 | 3300006237 | Bacteria | 1885 |
| 204 | Ga0097621_100174063 | 3300006237 | Bacteria | 1857 |
| 205 | Ga0097621_100288034 | 3300006237 | Bacteria | 1447 |
| 206 | Ga0075370_10159129 | 3300006353 | Bacteria | 1325 |
| 207 | Ga0068871_100000130 | 3300006358 | Bacteria | 47875 |
| 208 | Ga0068871_100024457 | 3300006358 | Bacteria | 4685 |
| 209 | Ga0068871_100056594 | 3300006358 | Bacteria | 3188 |
| 210 | Ga0068871_100133594 | 3300006358 | Bacteria | 2106 |
| 211 | Ga0075428_100010125 | 3300006844 | Bacteria | 10475 |
| 212 | Ga0075428_100081134 | 3300006844 | Bacteria | 3540 |
| 213 | Ga0075428_100326104 | 3300006844 | Bacteria | 1649 |
| 214 | Ga0075430_100001450 | 3300006846 | Bacteria | 19258 |
| 215 | Ga0075431_100094982 | 3300006847 | Bacteria | 3077 |
| 216 | Ga0075429_100000803 | 3300006880 | Bacteria | 24685 |
| 217 | Ga0075429_100167363 | 3300006880 | Bacteria | 1925 |
| 218 | Ga0068865_100000050 | 3300006881 | Bacteria | 65632 |
| 219 | Ga0097620_100000023 | 3300006931 | Bacteria | 221914 |
| 220 | Ga0097620_100021815 | 3300006931 | Bacteria | 6422 |
| 221 | Ga0097620_100034933 | 3300006931 | Bacteria | 5043 |
| 222 | Ga0097620_100084104 | 3300006931 | Bacteria | 3226 |
| 223 | Ga0097620_100117099 | 3300006931 | Bacteria | 2729 |
| 224 | Ga0097620_100361877 | 3300006931 | Bacteria | 1546 |
| 225 | Ga0105240_10000008 | 3300009093 | Bacteria | 618862 |
| 226 | Ga0105240_10000670 | 3300009093 | Bacteria | 62864 |
| 227 | Ga0105240_10000728 | 3300009093 | Bacteria | 60140 |
| 228 | Ga0105240_10001190 | 3300009093 | Bacteria | 45471 |
| 229 | Ga0105240_10002005 | 3300009093 | Bacteria | 33578 |
| 230 | Ga0105240_10002522 | 3300009093 | Bacteria | 29394 |
| 231 | Ga0105240_10013576 | 3300009093 | Bacteria | 11179 |
| 232 | Ga0105240_10045988 | 3300009093 | Bacteria | 5534 |
| 233 | Ga0105240_10160821 | 3300009093 | Bacteria | 2667 |
| 234 | Ga0105240_10193265 | 3300009093 | Bacteria | 2391 |
| 235 | Ga0105240_10234492 | 3300009093 | Bacteria | 2130 |
| 236 | Ga0105240_10446939 | 3300009093 | Bacteria | 1447 |
| 237 | Ga0111539_10006028 | 3300009094 | Bacteria | 15661 |
| 238 | Ga0111539_10009852 | 3300009094 | Bacteria | 12056 |
| 239 | Ga0111539_10009875 | 3300009094 | Bacteria | 12044 |
| 240 | Ga0111539_10062072 | 3300009094 | Bacteria | 4425 |
| 241 | Ga0111539_10203098 | 3300009094 | Bacteria | 2311 |
| 242 | Ga0111539_10289450 | 3300009094 | Bacteria | 1906 |
| 243 | Ga0105247_10000662 | 3300009101 | Bacteria | 27269 |
| 244 | Ga0114129_10333002 | 3300009147 | Bacteria | 2015 |
| 245 | Ga0105241_10000281 | 3300009174 | Bacteria | 37919 |
| 246 | Ga0105241_10001608 | 3300009174 | Bacteria | 17237 |
| 247 | Ga0105241_10004819 | 3300009174 | Bacteria | 9942 |
| 248 | Ga0105241_10007868 | 3300009174 | Bacteria | 7836 |
| 249 | Ga0105241_10161598 | 3300009174 | Bacteria | 1842 |
| 250 | Ga0105242_10002097 | 3300009176 | Bacteria | 15701 |
| 251 | Ga0105242_10006335 | 3300009176 | Bacteria | 9114 |
| 252 | Ga0105242_10014086 | 3300009176 | Bacteria | 6189 |
| 253 | Ga0105242_10077691 | 3300009176 | Bacteria | 2769 |
| 254 | Ga0105242_10078993 | 3300009176 | Bacteria | 2747 |
| 255 | Ga0105242_10079545 | 3300009176 | Bacteria | 2738 |
| 256 | Ga0105237_10000622 | 3300009545 | Bacteria | 49566 |
| 257 | Ga0105237_10000902 | 3300009545 | Bacteria | 39969 |
| 258 | Ga0105237_10003737 | 3300009545 | Bacteria | 17929 |
| 259 | Ga0105237_10005252 | 3300009545 | Bacteria | 14657 |
| 260 | Ga0105237_10007095 | 3300009545 | Bacteria | 12317 |
| 261 | Ga0105237_10007800 | 3300009545 | Bacteria | 11668 |
| 262 | Ga0105237_10007917 | 3300009545 | Bacteria | 11581 |
| 263 | Ga0105237_10103018 | 3300009545 | Bacteria | 2846 |
| 264 | Ga0105237_10148166 | 3300009545 | Bacteria | 2342 |
| 265 | Ga0105238_10003022 | 3300009551 | Bacteria | 16794 |
| 266 | Ga0105238_10233223 | 3300009551 | Bacteria | 1817 |
| 267 | Ga0105249_10002624 | 3300009553 | Bacteria | 15564 |
| 268 | Ga0105249_10006638 | 3300009553 | Bacteria | 10070 |
| 269 | Ga0105249_10011834 | 3300009553 | Bacteria | 7669 |
| 270 | Ga0105249_10020024 | 3300009553 | Bacteria | 5975 |
| 271 | Ga0105249_10031174 | 3300009553 | Bacteria | 4821 |
| 272 | Ga0105249_10125761 | 3300009553 | Bacteria | 2441 |
| 273 | Ga0105249_10139668 | 3300009553 | Bacteria | 2322 |
| 274 | Ga0105249_10213918 | 3300009553 | Bacteria | 1893 |
| 275 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 276 | Ga0105239_10000012 | 3300010375 | Bacteria | 332279 |
| 277 | Ga0105239_10000079 | 3300010375 | Bacteria | 135513 |
| 278 | Ga0105239_10000445 | 3300010375 | Bacteria | 60337 |
| 279 | Ga0105239_10000959 | 3300010375 | Bacteria | 40551 |
| 280 | Ga0105239_10001148 | 3300010375 | Bacteria | 36457 |
| 281 | Ga0105239_10003843 | 3300010375 | Bacteria | 18238 |
| 282 | Ga0105239_10012429 | 3300010375 | Bacteria | 9481 |
| 283 | Ga0105239_10021418 | 3300010375 | Bacteria | 7127 |
| 284 | Ga0105239_10022611 | 3300010375 | Bacteria | 6931 |
| 285 | Ga0105239_10024144 | 3300010375 | Bacteria | 6697 |
| 286 | Ga0105239_10032754 | 3300010375 | Bacteria | 5711 |
| 287 | Ga0105239_10056002 | 3300010375 | Bacteria | 4326 |
| 288 | Ga0105246_10006795 | 3300011119 | Bacteria | 6992 |
| 289 | Ga0105246_10292802 | 3300011119 | Bacteria | 1311 |
| 290 | Ga0157373_10001101 | 3300013100 | Bacteria | 20720 |
| 291 | Ga0157373_10007899 | 3300013100 | Bacteria | 7916 |
| 292 | Ga0157373_10065903 | 3300013100 | Bacteria | 2563 |
| 293 | Ga0157371_10003814 | 3300013102 | Bacteria | 13473 |
| 294 | Ga0157371_10008724 | 3300013102 | Bacteria | 8047 |
| 295 | Ga0157371_10018949 | 3300013102 | Bacteria | 5081 |
| 296 | Ga0157371_10030864 | 3300013102 | Bacteria | 3863 |
| 297 | Ga0157371_10101189 | 3300013102 | Bacteria | 2044 |
| 298 | Ga0157371_10109621 | 3300013102 | Bacteria | 1959 |
| 299 | Ga0157371_10147338 | 3300013102 | Bacteria | 1678 |
| 300 | Ga0157371_10179720 | 3300013102 | Bacteria | 1513 |
| 301 | Ga0157370_10006833 | 3300013104 | Bacteria | 12505 |
| 302 | Ga0157370_10082950 | 3300013104 | Bacteria | 3014 |
| 303 | Ga0157370_10407795 | 3300013104 | Bacteria | 1250 |
| 304 | Ga0157369_10011074 | 3300013105 | Bacteria | 10260 |
| 305 | Ga0157369_10148384 | 3300013105 | Bacteria | 2479 |
| 306 | Ga0157369_10163483 | 3300013105 | Bacteria | 2348 |
| 307 | Ga0157369_10194401 | 3300013105 | Bacteria | 2131 |
| 308 | Ga0157374_10000004 | 3300013296 | Bacteria | 759774 |
| 309 | Ga0157374_10003759 | 3300013296 | Bacteria | 12757 |
| 310 | Ga0157374_10006271 | 3300013296 | Bacteria | 10083 |
| 311 | Ga0157374_10009183 | 3300013296 | Bacteria | 8478 |
| 312 | Ga0157374_10021520 | 3300013296 | Bacteria | 5741 |
| 313 | Ga0157374_10072972 | 3300013296 | Bacteria | 3239 |
| 314 | Ga0157374_10079054 | 3300013296 | Bacteria | 3116 |
| 315 | Ga0157374_10112153 | 3300013296 | Bacteria | 2624 |
| 316 | Ga0157374_10193328 | 3300013296 | Bacteria | 1990 |
| 317 | Ga0157374_10195979 | 3300013296 | Bacteria | 1977 |
| 318 | Ga0157378_10072604 | 3300013297 | Bacteria | 3092 |
| 319 | Ga0157378_10105500 | 3300013297 | Bacteria | 2577 |
| 320 | Ga0157378_10107676 | 3300013297 | Bacteria | 2551 |
| 321 | Ga0157378_10121035 | 3300013297 | Bacteria | 2413 |
| 322 | Ga0157378_10161247 | 3300013297 | Bacteria | 2097 |
| 323 | Ga0163162_10000031 | 3300013306 | Bacteria | 157666 |
| 324 | Ga0163162_10000161 | 3300013306 | Bacteria | 62198 |
| 325 | Ga0163162_10000223 | 3300013306 | Bacteria | 51991 |
| 326 | Ga0163162_10008282 | 3300013306 | Bacteria | 10146 |
| 327 | Ga0163162_10013375 | 3300013306 | Bacteria | 8015 |
| 328 | Ga0163162_10049354 | 3300013306 | Bacteria | 4218 |
| 329 | Ga0163162_10065460 | 3300013306 | Bacteria | 3682 |
| 330 | Ga0163162_10076770 | 3300013306 | Bacteria | 3403 |
| 331 | Ga0163162_10100926 | 3300013306 | Bacteria | 2977 |
| 332 | Ga0163162_10110129 | 3300013306 | Bacteria | 2851 |
| 333 | Ga0163162_10147547 | 3300013306 | Bacteria | 2469 |
| 334 | Ga0163162_10192129 | 3300013306 | Bacteria | 2169 |
| 335 | Ga0163162_10638904 | 3300013306 | Bacteria | 1189 |
| 336 | Ga0157372_10000077 | 3300013307 | Bacteria | 102192 |
| 337 | Ga0157372_10000252 | 3300013307 | Bacteria | 59348 |
| 338 | Ga0157372_10000988 | 3300013307 | Bacteria | 31100 |
| 339 | Ga0157372_10002075 | 3300013307 | Bacteria | 21762 |
| 340 | Ga0157372_10003847 | 3300013307 | Bacteria | 16131 |
| 341 | Ga0157372_10028973 | 3300013307 | Bacteria | 6041 |
| 342 | Ga0157372_10052458 | 3300013307 | Bacteria | 4541 |
| 343 | Ga0157372_10059053 | 3300013307 | Bacteria | 4289 |
| 344 | Ga0157372_10099621 | 3300013307 | Bacteria | 3315 |
| 345 | Ga0157372_10105046 | 3300013307 | Bacteria | 3230 |
| 346 | Ga0157372_10247922 | 3300013307 | Bacteria | 2067 |
| 347 | Ga0157375_10002968 | 3300013308 | Bacteria | 14733 |
| 348 | Ga0157375_10041638 | 3300013308 | Bacteria | 4437 |
| 349 | Ga0157375_10058934 | 3300013308 | Bacteria | 3801 |
| 350 | Ga0157375_10149321 | 3300013308 | Bacteria | 2471 |
| 351 | Ga0157375_10182536 | 3300013308 | Bacteria | 2250 |
| 352 | Ga0157375_10198465 | 3300013308 | Bacteria | 2162 |
| 353 | Ga0157375_10347464 | 3300013308 | Bacteria | 1649 |
| 354 | Ga0157375_10583039 | 3300013308 | Bacteria | 1278 |
| 355 | Ga0163163_10000176 | 3300014325 | Bacteria | 66751 |
| 356 | Ga0163163_10041106 | 3300014325 | Bacteria | 4520 |
| 357 | Ga0157380_10000789 | 3300014326 | Bacteria | 19895 |
| 358 | Ga0157380_10009405 | 3300014326 | Bacteria | 7001 |
| 359 | Ga0157380_10156305 | 3300014326 | Bacteria | 1977 |
| 360 | Ga0157377_10009077 | 3300014745 | Bacteria | 4871 |
| 361 | Ga0157377_10035212 | 3300014745 | Bacteria | 2745 |
| 362 | Ga0157377_10041286 | 3300014745 | Bacteria | 2559 |
| 363 | Ga0157377_10049547 | 3300014745 | Bacteria | 2361 |
| 364 | Ga0157379_10106312 | 3300014968 | Bacteria | 2519 |
| 365 | Ga0157379_10125359 | 3300014968 | Bacteria | 2311 |
| 366 | Ga0157376_10011492 | 3300014969 | Bacteria | 6529 |
| 367 | Ga0157376_10031069 | 3300014969 | Bacteria | 4272 |
| 368 | Ga0157376_10038823 | 3300014969 | Bacteria | 3877 |
| 369 | Ga0157376_10040394 | 3300014969 | Bacteria | 3813 |
| 370 | Ga0157376_10048359 | 3300014969 | Bacteria | 3516 |
| 371 | Ga0157376_10091728 | 3300014969 | Bacteria | 2632 |
| 372 | Ga0157376_10120043 | 3300014969 | Bacteria | 2328 |
| 373 | Ga0163161_10000120 | 3300017792 | Bacteria | 73632 |
| 374 | Ga0163161_10001827 | 3300017792 | Bacteria | 15547 |
| 375 | Ga0163161_10089666 | 3300017792 | Bacteria | 2274 |
| 376 | Ga0163161_10141300 | 3300017792 | Bacteria | 1823 |
| 377 | Ga0206356_10918650 | 3300020070 | Bacteria | 1085 |
| 378 | Ga0206351_10778228 | 3300020077 | Bacteria | 1090 |
| 379 | Ga0154015_1194800 | 3300020610 | Bacteria | 1101 |
| 380 | Ga0213872_10011644 | 3300021361 | Bacteria | 4159 |
| 381 | Ga0224712_10124343 | 3300022467 | Bacteria | 1120 |
| 382 | Ga0207427_100171 | 3300025231 | Bacteria | 71988 |
| 383 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 384 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 385 | Ga0209026_1002264 | 3300025250 | Bacteria | 7374 |
| 386 | Ga0209026_1009270 | 3300025250 | Bacteria | 1950 |
| 387 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 388 | Ga0209233_1002449 | 3300025261 | Bacteria | 6840 |
| 389 | Ga0209676_1002043 | 3300025292 | Bacteria | 15783 |
| 390 | Ga0209050_1001548 | 3300025298 | Bacteria | 24081 |
| 391 | Ga0209050_1026084 | 3300025298 | Bacteria | 1966 |
| 392 | Ga0207426_1000009 | 3300025302 | Bacteria | 797229 |
| 393 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 394 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 395 | Ga0207697_10065113 | 3300025315 | Bacteria | 1521 |
| 396 | Ga0207697_10093814 | 3300025315 | Bacteria | 1274 |
| 397 | Ga0207656_10010375 | 3300025321 | Bacteria | 3489 |
| 398 | Ga0207656_10015168 | 3300025321 | Bacteria | 2980 |
| 399 | Ga0207656_10032229 | 3300025321 | Bacteria | 2176 |
| 400 | Ga0207656_10073677 | 3300025321 | Bacteria | 1522 |
| 401 | Ga0207682_10046956 | 3300025893 | Bacteria | 1776 |
| 402 | Ga0207642_10033726 | 3300025899 | Bacteria | 2169 |
| 403 | Ga0207710_10005592 | 3300025900 | Bacteria | 5407 |
| 404 | Ga0207680_10000053 | 3300025903 | Bacteria | 55149 |
| 405 | Ga0207680_10026500 | 3300025903 | Bacteria | 3214 |
| 406 | Ga0207680_10065172 | 3300025903 | Bacteria | 2235 |
| 407 | Ga0207647_10000463 | 3300025904 | Bacteria | 32923 |
| 408 | Ga0207647_10002289 | 3300025904 | Bacteria | 14588 |
| 409 | Ga0207647_10041668 | 3300025904 | Bacteria | 2885 |
| 410 | Ga0207647_10064384 | 3300025904 | Bacteria | 2228 |
| 411 | Ga0207647_10217406 | 3300025904 | Bacteria | 1102 |
| 412 | Ga0207685_10133979 | 3300025905 | Bacteria | 1103 |
| 413 | Ga0207645_10000082 | 3300025907 | Bacteria | 68372 |
| 414 | Ga0207645_10009123 | 3300025907 | Bacteria | 6879 |
| 415 | Ga0207645_10013009 | 3300025907 | Bacteria | 5623 |
| 416 | Ga0207645_10025040 | 3300025907 | Bacteria | 3863 |
| 417 | Ga0207645_10056839 | 3300025907 | Bacteria | 2498 |
| 418 | Ga0207643_10014774 | 3300025908 | Bacteria | 4246 |
| 419 | Ga0207705_10000015 | 3300025909 | Bacteria | 382901 |
| 420 | Ga0207705_10059570 | 3300025909 | Bacteria | 2756 |
| 421 | Ga0207705_10321369 | 3300025909 | Bacteria | 1189 |
| 422 | Ga0207654_10000422 | 3300025911 | Bacteria | 24231 |
| 423 | Ga0207654_10001451 | 3300025911 | Bacteria | 12574 |
| 424 | Ga0207654_10002361 | 3300025911 | Bacteria | 9675 |
| 425 | Ga0207654_10022023 | 3300025911 | Bacteria | 3395 |
| 426 | Ga0207654_10069331 | 3300025911 | Bacteria | 2089 |
| 427 | Ga0207654_10178182 | 3300025911 | Bacteria | 1385 |
| 428 | Ga0207707_10106716 | 3300025912 | Bacteria | 2448 |
| 429 | Ga0207695_10000021 | 3300025913 | Bacteria | 679399 |
| 430 | Ga0207695_10000039 | 3300025913 | Bacteria | 454801 |
| 431 | Ga0207695_10000189 | 3300025913 | Bacteria | 177142 |
| 432 | Ga0207695_10000993 | 3300025913 | Bacteria | 50217 |
| 433 | Ga0207695_10003570 | 3300025913 | Bacteria | 21781 |
| 434 | Ga0207695_10005021 | 3300025913 | Bacteria | 17768 |
| 435 | Ga0207695_10016238 | 3300025913 | Bacteria | 8725 |
| 436 | Ga0207695_10036935 | 3300025913 | Bacteria | 5275 |
| 437 | Ga0207695_10198971 | 3300025913 | Bacteria | 1919 |
| 438 | Ga0207695_10202362 | 3300025913 | Bacteria | 1899 |
| 439 | Ga0207695_10202672 | 3300025913 | Bacteria | 1898 |
| 440 | Ga0207671_10000909 | 3300025914 | Bacteria | 37375 |
| 441 | Ga0207671_10001801 | 3300025914 | Bacteria | 23958 |
| 442 | Ga0207671_10002125 | 3300025914 | Bacteria | 21631 |
| 443 | Ga0207671_10002229 | 3300025914 | Bacteria | 21016 |
| 444 | Ga0207671_10002851 | 3300025914 | Bacteria | 17936 |
| 445 | Ga0207671_10009608 | 3300025914 | Bacteria | 8063 |
| 446 | Ga0207671_10016783 | 3300025914 | Bacteria | 5676 |
| 447 | Ga0207671_10054773 | 3300025914 | Bacteria | 2955 |
| 448 | Ga0207671_10133261 | 3300025914 | Bacteria | 1909 |
| 449 | Ga0207671_10268726 | 3300025914 | Bacteria | 1343 |
| 450 | Ga0207660_10014210 | 3300025917 | Bacteria | 5229 |
| 451 | Ga0207662_10018257 | 3300025918 | Bacteria | 3976 |
| 452 | Ga0207662_10079565 | 3300025918 | Bacteria | 1997 |
| 453 | Ga0207657_10173467 | 3300025919 | Bacteria | 1746 |
| 454 | Ga0207649_10002117 | 3300025920 | Bacteria | 11248 |
| 455 | Ga0207649_10108806 | 3300025920 | Bacteria | 1848 |
| 456 | Ga0207652_10145801 | 3300025921 | Bacteria | 2119 |
| 457 | Ga0207652_10187409 | 3300025921 | Bacteria | 1860 |
| 458 | Ga0207681_10012383 | 3300025923 | Bacteria | 5264 |
| 459 | Ga0207681_10048713 | 3300025923 | Bacteria | 2861 |
| 460 | Ga0207650_10002543 | 3300025925 | Bacteria | 12643 |
| 461 | Ga0207650_10014352 | 3300025925 | Bacteria | 5507 |
| 462 | Ga0207650_10149598 | 3300025925 | Bacteria | 1841 |
| 463 | Ga0207650_10150728 | 3300025925 | Bacteria | 1835 |
| 464 | Ga0207650_10171388 | 3300025925 | Bacteria | 1725 |
| 465 | Ga0207659_10005103 | 3300025926 | Bacteria | 7957 |
| 466 | Ga0207659_10013848 | 3300025926 | Bacteria | 5183 |
| 467 | Ga0207659_10021136 | 3300025926 | Bacteria | 4315 |
| 468 | Ga0207659_10041778 | 3300025926 | Bacteria | 3212 |
| 469 | Ga0207659_10113522 | 3300025926 | Bacteria | 2064 |
| 470 | Ga0207644_10124474 | 3300025931 | Bacteria | 1966 |
| 471 | Ga0207644_10197064 | 3300025931 | Bacteria | 1587 |
| 472 | Ga0207690_10003612 | 3300025932 | Bacteria | 9206 |
| 473 | Ga0207690_10006302 | 3300025932 | Bacteria | 7029 |
| 474 | Ga0207690_10008351 | 3300025932 | Bacteria | 6146 |
| 475 | Ga0207690_10123396 | 3300025932 | Bacteria | 1885 |
| 476 | Ga0207706_10001363 | 3300025933 | Bacteria | 24429 |
| 477 | Ga0207706_10004385 | 3300025933 | Bacteria | 13262 |
| 478 | Ga0207706_10110110 | 3300025933 | Bacteria | 2423 |
| 479 | Ga0207686_10000630 | 3300025934 | Bacteria | 21868 |
| 480 | Ga0207686_10010003 | 3300025934 | Bacteria | 5157 |
| 481 | Ga0207686_10016556 | 3300025934 | Bacteria | 4138 |
| 482 | Ga0207686_10073118 | 3300025934 | Bacteria | 2211 |
| 483 | Ga0207670_10005924 | 3300025936 | Bacteria | 6748 |
| 484 | Ga0207670_10010335 | 3300025936 | Bacteria | 5370 |
| 485 | Ga0207670_10014227 | 3300025936 | Bacteria | 4717 |
| 486 | Ga0207669_10018626 | 3300025937 | Bacteria | 3595 |
| 487 | Ga0207669_10040159 | 3300025937 | Bacteria | 2712 |
| 488 | Ga0207704_10000078 | 3300025938 | Bacteria | 59491 |
| 489 | Ga0207704_10198340 | 3300025938 | Bacteria | 1466 |
| 490 | Ga0207704_10290987 | 3300025938 | Bacteria | 1246 |
| 491 | Ga0207691_10023429 | 3300025940 | Bacteria | 5811 |
| 492 | Ga0207691_10034574 | 3300025940 | Bacteria | 4698 |
| 493 | Ga0207691_10077511 | 3300025940 | Bacteria | 2994 |
| 494 | Ga0207689_10005094 | 3300025942 | Bacteria | 11823 |
| 495 | Ga0207689_10005194 | 3300025942 | Bacteria | 11686 |
| 496 | Ga0207689_10011041 | 3300025942 | Bacteria | 7764 |
| 497 | Ga0207689_10012402 | 3300025942 | Bacteria | 7288 |
| 498 | Ga0207689_10016035 | 3300025942 | Bacteria | 6342 |
| 499 | Ga0207689_10017262 | 3300025942 | Bacteria | 6109 |
| 500 | Ga0207689_10041387 | 3300025942 | Bacteria | 3812 |
| 501 | Ga0207689_10044330 | 3300025942 | Bacteria | 3677 |
| 502 | Ga0207661_10000338 | 3300025944 | Bacteria | 29898 |
| 503 | Ga0207661_10164114 | 3300025944 | Bacteria | 1929 |
| 504 | Ga0207661_10440201 | 3300025944 | Unclassified | 1186 |
| 505 | Ga0207679_10000251 | 3300025945 | Bacteria | 40884 |
| 506 | Ga0207679_10034418 | 3300025945 | Bacteria | 3574 |
| 507 | Ga0207667_10000022 | 3300025949 | Bacteria | 369570 |
| 508 | Ga0207667_10002632 | 3300025949 | Bacteria | 22201 |
| 509 | Ga0207667_10125813 | 3300025949 | Bacteria | 2640 |
| 510 | Ga0207667_10199661 | 3300025949 | Bacteria | 2052 |
| 511 | Ga0207651_10276098 | 3300025960 | Bacteria | 1386 |
| 512 | Ga0207651_10292363 | 3300025960 | Bacteria | 1351 |
| 513 | Ga0207712_10002527 | 3300025961 | Bacteria | 11765 |
| 514 | Ga0207712_10009920 | 3300025961 | Bacteria | 6036 |
| 515 | Ga0207712_10012118 | 3300025961 | Bacteria | 5507 |
| 516 | Ga0207712_10052268 | 3300025961 | Bacteria | 2861 |
| 517 | Ga0207712_10219886 | 3300025961 | Bacteria | 1518 |
| 518 | Ga0207668_10057828 | 3300025972 | Bacteria | 2707 |
| 519 | Ga0207640_10090812 | 3300025981 | Bacteria | 2114 |
| 520 | Ga0207658_10045021 | 3300025986 | Bacteria | 3215 |
| 521 | Ga0207658_10052666 | 3300025986 | Bacteria | 3004 |
| 522 | Ga0207658_10077032 | 3300025986 | Bacteria | 2543 |
| 523 | Ga0207658_10194235 | 3300025986 | Bacteria | 1690 |
| 524 | Ga0207658_10310703 | 3300025986 | Bacteria | 1361 |
| 525 | Ga0207677_10001889 | 3300026023 | Bacteria | 11061 |
| 526 | Ga0207677_10020742 | 3300026023 | Bacteria | 3998 |
| 527 | Ga0207677_10033981 | 3300026023 | Bacteria | 3297 |
| 528 | Ga0207677_10111587 | 3300026023 | Bacteria | 2038 |
| 529 | Ga0207677_10137019 | 3300026023 | Bacteria | 1868 |
| 530 | Ga0207703_10003760 | 3300026035 | Bacteria | 12625 |
| 531 | Ga0207703_10116577 | 3300026035 | Bacteria | 2287 |
| 532 | Ga0207703_10426033 | 3300026035 | Bacteria | 1235 |
| 533 | Ga0207639_10005745 | 3300026041 | Bacteria | 8401 |
| 534 | Ga0207678_10038306 | 3300026067 | Bacteria | 4166 |
| 535 | Ga0207708_10143798 | 3300026075 | Bacteria | 1873 |
| 536 | Ga0207708_10192131 | 3300026075 | Bacteria | 1625 |
| 537 | Ga0207702_10001984 | 3300026078 | Bacteria | 19874 |
| 538 | Ga0207702_10010619 | 3300026078 | Bacteria | 7696 |
| 539 | Ga0207702_10018669 | 3300026078 | Bacteria | 5736 |
| 540 | Ga0207641_10000202 | 3300026088 | Bacteria | 79668 |
| 541 | Ga0207641_10002390 | 3300026088 | Bacteria | 17318 |
| 542 | Ga0207648_10000472 | 3300026089 | Bacteria | 44933 |
| 543 | Ga0207648_10003850 | 3300026089 | Bacteria | 15679 |
| 544 | Ga0207648_10011089 | 3300026089 | Bacteria | 8505 |
| 545 | Ga0207648_10020425 | 3300026089 | Bacteria | 5963 |
| 546 | Ga0207648_10092732 | 3300026089 | Bacteria | 2641 |
| 547 | Ga0207648_10109691 | 3300026089 | Bacteria | 2422 |
| 548 | Ga0207648_10140691 | 3300026089 | Bacteria | 2126 |
| 549 | Ga0207648_10146042 | 3300026089 | Bacteria | 2086 |
| 550 | Ga0207648_10254388 | 3300026089 | Bacteria | 1566 |
| 551 | Ga0207676_10039175 | 3300026095 | Bacteria | 3623 |
| 552 | Ga0207676_10042377 | 3300026095 | Bacteria | 3501 |
| 553 | Ga0207674_10000624 | 3300026116 | Bacteria | 46352 |
| 554 | Ga0207674_10009101 | 3300026116 | Bacteria | 11396 |
| 555 | Ga0207674_10011799 | 3300026116 | Bacteria | 9804 |
| 556 | Ga0207674_10043117 | 3300026116 | Bacteria | 4654 |
| 557 | Ga0207674_10047276 | 3300026116 | Bacteria | 4413 |
| 558 | Ga0207674_10085564 | 3300026116 | Bacteria | 3148 |
| 559 | Ga0207674_10157566 | 3300026116 | Bacteria | 2226 |
| 560 | Ga0207674_10216554 | 3300026116 | Bacteria | 1863 |
| 561 | Ga0207674_10295900 | 3300026116 | Bacteria | 1567 |
| 562 | Ga0207675_100002674 | 3300026118 | Bacteria | 17586 |
| 563 | Ga0207675_100012863 | 3300026118 | Bacteria | 7817 |
| 564 | Ga0207675_100040537 | 3300026118 | Bacteria | 4349 |
| 565 | Ga0207675_100059014 | 3300026118 | Bacteria | 3581 |
| 566 | Ga0207675_100064221 | 3300026118 | Bacteria | 3431 |
| 567 | Ga0207675_100185553 | 3300026118 | Bacteria | 1993 |
| 568 | Ga0207675_100232551 | 3300026118 | Bacteria | 1779 |
| 569 | Ga0207683_10010049 | 3300026121 | Bacteria | 8076 |
| 570 | Ga0207683_10019276 | 3300026121 | Bacteria | 5823 |
| 571 | Ga0207683_10242793 | 3300026121 | Bacteria | 1643 |
| 572 | Ga0207683_10462717 | 3300026121 | Bacteria | 1170 |
| 573 | Ga0207698_10015237 | 3300026142 | Bacteria | 5145 |
| 574 | Ga0207698_10015561 | 3300026142 | Bacteria | 5097 |
| 575 | Ga0207698_10048691 | 3300026142 | Bacteria | 3219 |
| 576 | Ga0207698_10169916 | 3300026142 | Bacteria | 1918 |
| 577 | Ga0209995_1019358 | 3300027471 | Bacteria | 1124 |
| 578 | Ga0207428_10015643 | 3300027907 | Bacteria | 6555 |
| 579 | Ga0207428_10041009 | 3300027907 | Bacteria | 3750 |
| 580 | Ga0207428_10199147 | 3300027907 | Bacteria | 1507 |
| 581 | Ga0268266_10000052 | 3300028379 | Bacteria | 296230 |
| 582 | Ga0268266_10000057 | 3300028379 | Bacteria | 284777 |
| 583 | Ga0268266_10017280 | 3300028379 | Bacteria | 6158 |
| 584 | Ga0268266_10081042 | 3300028379 | Bacteria | 2829 |
| 585 | Ga0268265_10034260 | 3300028380 | Bacteria | 3699 |
| 586 | Ga0268265_10037951 | 3300028380 | Bacteria | 3540 |
| 587 | Ga0268264_10000098 | 3300028381 | Bacteria | 229055 |
| 588 | Ga0268264_10002491 | 3300028381 | Bacteria | 16192 |
| 589 | Ga0268264_10027377 | 3300028381 | Bacteria | 4657 |
| 590 | Ga0307517_10001280 | 3300028786 | Bacteria | 42200 |
| 591 | Ga0307517_10002277 | 3300028786 | Bacteria | 30968 |
| 592 | Ga0307515_10000007 | 3300028794 | Bacteria | 719669 |
| 593 | Ga0307515_10000076 | 3300028794 | Bacteria | 228736 |
| 594 | Ga0307515_10000235 | 3300028794 | Bacteria | 136714 |
| 595 | Ga0307515_10000280 | 3300028794 | Bacteria | 125330 |
| 596 | Ga0307515_10139202 | 3300028794 | Bacteria | 2615 |
| 597 | Ga0307515_10170256 | 3300028794 | Unclassified | 2175 |
| 598 | Ga0265338_10016034 | 3300028800 | Bacteria | 8185 |
| 599 | Ga0265338_10105407 | 3300028800 | Bacteria | 2285 |
| 600 | Ga0307511_10000580 | 3300030521 | Bacteria | 39130 |
| 601 | Ga0265327_10000101 | 3300031251 | Bacteria | 188671 |
| 602 | Ga0307509_10062159 | 3300031507 | Bacteria | 3939 |
| 603 | Ga0307509_10239788 | 3300031507 | Bacteria | 1607 |
| 604 | Ga0307408_100000652 | 3300031548 | Bacteria | 29132 |
| 605 | Ga0307408_100007740 | 3300031548 | Bacteria | 7106 |
| 606 | Ga0307508_10002190 | 3300031616 | Bacteria | 20884 |
| 607 | Ga0307514_10042682 | 3300031649 | Bacteria | 3565 |
| 608 | Ga0316576_10036361 | 3300031727 | Bacteria | 3520 |
| 609 | Ga0307516_10000232 | 3300031730 | Bacteria | 71483 |
| 610 | Ga0307516_10041064 | 3300031730 | Bacteria | 4601 |
| 611 | Ga0307405_10020557 | 3300031731 | Bacteria | 3691 |
| 612 | Ga0307405_10094127 | 3300031731 | Bacteria | 1992 |
| 613 | Ga0307407_10036101 | 3300031903 | Bacteria | 2721 |
| 614 | Ga0307407_10287271 | 3300031903 | Bacteria | 1142 |
| 615 | Ga0307412_10009687 | 3300031911 | Bacteria | 5532 |
| 616 | Ga0307409_100038251 | 3300031995 | Bacteria | 3547 |
| 617 | Ga0307416_100006444 | 3300032002 | Bacteria | 7354 |
| 618 | Ga0307414_10051471 | 3300032004 | Bacteria | 2859 |
| 619 | Ga0307415_100004572 | 3300032126 | Bacteria | 7211 |
| 620 | Ga0307507_10000217 | 3300033179 | Bacteria | 109884 |
| 621 | Ga0316592_1037898 | 3300033524 | Bacteria | 1062 |
| 622 | Ga0316588_1043791 | 3300033528 | Bacteria | 1075 |
| 623 | Ga0316588_1044428 | 3300033528 | Bacteria | 1068 |
| 624 | Ga0316596_1039269 | 3300033541 | Bacteria | 1242 |
| 625 | Ga0316596_1043315 | 3300033541 | Bacteria | 1185 |
| 626 | Ga0316596_1046531 | 3300033541 | Bacteria | 1146 |
| 627 | Ga0316596_1055210 | 3300033541 | Bacteria | 1054 |
| 628 | Ga0373933_0158769 | 3300035724 | Bacteria | 1435 |
| 629 | Ga0316582_0064032 | 3300036647 | Bacteria | 2364 |
| 630 | Ga0316584_0059444 | 3300036712 | Bacteria | 2862 |
| 631 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 632 | Ga0395899_0000257 | 3300037312 | Bacteria | 69779 |
| 633 | Ga0395899_0000312 | 3300037312 | Bacteria | 62304 |
| 634 | Ga0395899_0191567 | 3300037312 | Bacteria | 1431 |
| 635 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 636 | Ga0395900_0000128 | 3300037418 | Bacteria | 127446 |
| 637 | Ga0395900_0004584 | 3300037418 | Bacteria | 14585 |
| 638 | Ga0395900_0032708 | 3300037418 | Bacteria | 5349 |
| 639 | Ga0395898_0040271 | 3300037466 | Bacteria | 4621 |
| 640 | Ga0395905_0000037 | 3300037471 | Bacteria | 261808 |
| 641 | Ga0395905_0001831 | 3300037471 | Bacteria | 24563 |
| 642 | Ga0395905_0007096 | 3300037471 | Bacteria | 11198 |
| 643 | Ga0395901_0000166 | 3300038443 | Bacteria | 86352 |
| 644 | Ga0395901_0046840 | 3300038443 | Bacteria | 4492 |
| 645 | Ga0400483_011190 | 3300039062 | Bacteria | 182340 |
| 646 | Ga0400483_103871 | 3300039062 | Bacteria | 25736 |
| 647 | Ga0400483_215675 | 3300039062 | Bacteria | 181282 |
| 648 | Ga0400483_267913 | 3300039062 | Bacteria | 7742 |
| 649 | Ga0400489_43658 | 3300039093 | Bacteria | 3782 |
| 650 | Ga0400487_65977 | 3300039110 | Bacteria | 5294 |
| 651 | Ga0436361_0602515 | 3300039447 | Bacteria | 4188 |
| 652 | Ga0451807_0005345 | 3300041486 | Bacteria | 2340 |
| 653 | Ga0439445_0042614 | 3300042004 | Bacteria | 1209 |
| 654 | Ga0439448_0008853 | 3300042005 | Bacteria | 2954 |
| 655 | Ga0439449_0023575 | 3300042007 | Bacteria | 2301 |
| 656 | Ga0439457_012416 | 3300042014 | Bacteria | 1920 |
| 657 | Ga0439457_023734 | 3300042014 | Bacteria | 1357 |
| 658 | Ga0450897_000713 | 3300042128 | Bacteria | 1977 |
| 659 | Ga0450898_001336 | 3300042134 | Bacteria | 3223 |
| 660 | Ga0439434_0012567 | 3300042435 | Bacteria | 2506 |
| 661 | Ga0451577_0079806 | 3300042876 | Bacteria | 2917 |
| 662 | Ga0466969_0053386 | 3300044656 | Bacteria | 1983 |
| 663 | Ga0466972_0015909 | 3300044658 | Bacteria | 3761 |
| 664 | Ga0466965_0182567 | 3300044683 | Bacteria | 1107 |
| 665 | Ga0466961_0045211 | 3300044693 | Bacteria | 2817 |
| 666 | Ga0453684_0000841 | 3300044712 | Bacteria | 103501 |
| 667 | Ga0453684_0082744 | 3300044712 | Bacteria | 3997 |
| 668 | Ga0453684_0726946 | 3300044712 | Bacteria | 1076 |
| 669 | Ga0466957_0126395 | 3300044842 | Bacteria | 1634 |
| 670 | Ga0466959_0025420 | 3300045049 | Bacteria | 4389 |
| 671 | Ga0466959_0121211 | 3300045049 | Bacteria | 1859 |
| 672 | Ga0466959_0137085 | 3300045049 | Bacteria | 1732 |
| 673 | Ga0451576_0006366 | 3300045051 | Bacteria | 14496 |
| 674 | Ga0451576_0013410 | 3300045051 | Bacteria | 9170 |
| 675 | Ga0451576_0026843 | 3300045051 | Bacteria | 6188 |
| 676 | Ga0451576_0092878 | 3300045051 | Bacteria | 3138 |
| 677 | Ga0451576_0108543 | 3300045051 | Bacteria | 2888 |
| 678 | Ga0495638_0000005 | 3300046460 | Bacteria | 680627 |
| 679 | Ga0495638_0018717 | 3300046460 | Bacteria | 4595 |
| 680 | Ga0495651_0130495 | 3300046462 | Bacteria | 1835 |
| 681 | Ga0495650_0000087 | 3300046471 | Bacteria | 234870 |
| 682 | Ga0495585_0000167 | 3300046492 | Bacteria | 70874 |
| 683 | Ga0495585_0004197 | 3300046492 | Bacteria | 9409 |
| 684 | Ga0495607_0013492 | 3300046501 | Bacteria | 5353 |
| 685 | Ga0495606_0000052 | 3300046507 | Bacteria | 201529 |
| 686 | Ga0495606_0034414 | 3300046507 | Bacteria | 3479 |
| 687 | Ga0495616_0001285 | 3300046513 | Bacteria | 17645 |
| 688 | Ga0495616_0005065 | 3300046513 | Bacteria | 8195 |
| 689 | Ga0495618_0208969 | 3300046514 | Bacteria | 1234 |
| 690 | Ga0495628_0019958 | 3300046516 | Bacteria | 5536 |
| 691 | Ga0495630_0005239 | 3300046517 | Bacteria | 9140 |
| 692 | Ga0495632_0070137 | 3300046519 | Bacteria | 1686 |
| 693 | Ga0495648_0002287 | 3300046524 | Bacteria | 17883 |
| 694 | Ga0495648_0012616 | 3300046524 | Bacteria | 6291 |
| 695 | Ga0495654_0030030 | 3300046530 | Bacteria | 2768 |
| 696 | Ga0495587_0021739 | 3300046536 | Bacteria | 3959 |
| 697 | Ga0495645_0212432 | 3300046543 | Bacteria | 1306 |
| 698 | Ga0495633_0000029 | 3300046558 | Bacteria | 200381 |
| 699 | Ga0495611_0037935 | 3300046648 | Bacteria | 2142 |
| 700 | Ga0495625_0000008 | 3300046660 | Bacteria | 536165 |
| 701 | Ga0495625_0076677 | 3300046660 | Bacteria | 2337 |
| 702 | Ga0495661_0000511 | 3300046665 | Bacteria | 40405 |
| 703 | Ga0495599_0156618 | 3300046678 | Bacteria | 1409 |
| 704 | Ga0495658_0065180 | 3300046683 | Bacteria | 2101 |
| 705 | Ga0495671_0020496 | 3300046692 | Bacteria | 3483 |
| 706 | Ga0495671_0027394 | 3300046692 | Bacteria | 2944 |
| 707 | Ga0495649_0000018 | 3300046694 | Bacteria | 220586 |
| 708 | Ga0495660_0009229 | 3300046810 | Bacteria | 5765 |
| 709 | Ga0495672_0013741 | 3300047320 | Bacteria | 5571 |
| 710 | Ga0495672_0099743 | 3300047320 | Bacteria | 1578 |
| 711 | Ga0495687_000006 | 3300047443 | Bacteria | 571936 |
| 712 | Ga0495687_000527 | 3300047443 | Bacteria | 45682 |
| 713 | Ga0495687_000972 | 3300047443 | Bacteria | 29181 |
| 714 | Ga0495686_0000052 | 3300047472 | Bacteria | 262622 |
| 715 | Ga0495686_0011200 | 3300047472 | Bacteria | 6328 |
| 716 | Ga0495686_0055857 | 3300047472 | Bacteria | 2468 |
| 717 | Ga0495686_0194552 | 3300047472 | Bacteria | 1167 |
| 718 | Ga0495614_0007516 | 3300048089 | Bacteria | 4852 |
| 719 | Ga0496101_0249408 | 3300048904 | Bacteria | 1383 |
| 720 | Ga0496126_0028444 | 3300048929 | Bacteria | 5327 |
| 721 | Ga0501306_013260 | 3300049127 | Bacteria | 1073 |
| 722 | Ga0501308_005279 | 3300049128 | Bacteria | 1280 |
| 723 | Ga0501309_000827 | 3300049129 | Bacteria | 2744 |
| 724 | Ga0501310_000823 | 3300049130 | Bacteria | 2759 |
| 725 | Ga0501304_000510 | 3300049160 | Bacteria | 2060 |
| 726 | Ga0501305_004876 | 3300049161 | Bacteria | 1599 |
| 727 | Ga0501305_015207 | 3300049161 | Bacteria | 1085 |
| 728 | Ga0501307_011201 | 3300049162 | Bacteria | 1050 |
| 729 | Ga0495678_003683 | 3300049459 | Bacteria | 9280 |
| 730 | Ga0501315_012093 | 3300049531 | Bacteria | 1062 |
| 731 | Ga0501315_012764 | 3300049531 | Bacteria | 1044 |
| 732 | Ga0501317_012120 | 3300049533 | Bacteria | 1060 |
| 733 | Ga0501320_000742 | 3300049536 | Bacteria | 2065 |
| 734 | Ga0501072_0345636 | 3300049588 | Bacteria | 1181 |
| 735 | Ga0501206_003576 | 3300049653 | Bacteria | 1976 |
| 736 | Ga0501223_002757 | 3300049663 | Bacteria | 3855 |
| 737 | Ga0501235_005105 | 3300049669 | Bacteria | 2852 |
| 738 | Ga0501257_000838 | 3300049686 | Bacteria | 6153 |
| 739 | Ga0501259_002994 | 3300049688 | Bacteria | 2704 |
| 740 | Ga0501259_005521 | 3300049688 | Bacteria | 2003 |
| 741 | Ga0501221_003139 | 3300049704 | Bacteria | 2716 |
| 742 | Ga0501225_0008563 | 3300049705 | Bacteria | 2931 |
| 743 | Ga0501241_000710 | 3300049758 | Bacteria | 7167 |
| 744 | Ga0501264_000594 | 3300049761 | Bacteria | 5151 |
| 745 | nmdc:mga0k408_171_c1 | 3300050493 | Bacteria | 34186 |
| 746 | nmdc:mga0k408_3472_c1 | 3300050493 | Bacteria | 8343 |
| 747 | nmdc:mga0k408_563_c2 | 3300050493 | Bacteria | 17614 |
| 748 | nmdc:mga07m45_169687_c1 | 3300050496 | Bacteria | 1268 |
| 749 | nmdc:mga09592_102763_c1 | 3300050508 | Bacteria | 2449 |
| 750 | nmdc:mga09592_5680_c1 | 3300050508 | Bacteria | 10174 |
| 751 | nmdc:mga06r32_30314_c1 | 3300050510 | Bacteria | 5075 |
| 752 | nmdc:mga08y16_161644_c1 | 3300050511 | Bacteria | 2327 |
| 753 | nmdc:mga08y16_29769_c1 | 3300050511 | Bacteria | 5749 |
| 754 | nmdc:mga08y16_4421_c1 | 3300050511 | Bacteria | 14687 |
| 755 | nmdc:mga0n895_137434_c1 | 3300050512 | Bacteria | 2471 |
| 756 | Ga0500635_0000305 | 3300053080 | Bacteria | 17216 |
| 757 | Ga0500646_0007785 | 3300053090 | Bacteria | 2738 |
| 758 | Ga0500583_0001564 | 3300053092 | Bacteria | 6621 |
| 759 | Ga0500641_0040415 | 3300053096 | Bacteria | 1883 |
| 760 | Ga0500556_0026068 | 3300053104 | Bacteria | 1938 |
| 761 | Ga0500557_001744 | 3300053105 | Bacteria | 3711 |
| 762 | Ga0500562_008228 | 3300053108 | Bacteria | 2633 |
| 763 | Ga0500608_002485 | 3300053122 | Bacteria | 6714 |
| 764 | Ga0500618_000037 | 3300053125 | Bacteria | 117320 |
| 765 | Ga0500642_0033245 | 3300053130 | Bacteria | 2171 |
| 766 | Ga0500642_0037713 | 3300053130 | Bacteria | 2067 |
| 767 | Ga0500655_009797 | 3300053133 | Bacteria | 1730 |
| 768 | Ga0500564_062773 | 3300053138 | Bacteria | 1683 |
| 769 | Ga0500568_0000346 | 3300053139 | Bacteria | 36068 |
| 770 | Ga0500568_0004443 | 3300053139 | Bacteria | 7493 |
| 771 | Ga0500616_0000003 | 3300053153 | Bacteria | 1220687 |
| 772 | Ga0500616_0018065 | 3300053153 | Bacteria | 3991 |
| 773 | Ga0500616_0027972 | 3300053153 | Bacteria | 3110 |
| 774 | Ga0500622_0000034 | 3300053156 | Bacteria | 187647 |
| 775 | Ga0500622_0000235 | 3300053156 | Bacteria | 57565 |
| 776 | Ga0500622_0000639 | 3300053156 | Bacteria | 31329 |
| 777 | Ga0500622_0082737 | 3300053156 | Bacteria | 1605 |
| 778 | Ga0500624_000554 | 3300053157 | Bacteria | 10469 |
| 779 | Ga0500611_000026 | 3300053727 | Bacteria | 96342 |
| 780 | Ga0587083_0030930 | 3300059505 | Bacteria | 1065 |
| 781 | Ga0587098_005387 | 3300059604 | Bacteria | 1253 |
| 782 | Ga0587109_026989 | 3300059624 | Bacteria | 1065 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049588 | Ga0501072_0345636 | Ga0501072_0345636_172_1158 | 320 |
| 2 | 3300049705 | Ga0501225_0008563 | Ga0501225_0008563_1893_2909 | 320 |
| 3 | 3300033541 | Ga0316596_1055210 | Ga0316596_10552101 | 325 |
| 4 | 3300033541 | Ga0316596_1039269 | Ga0316596_10392692 | 327 |
| 5 | 3300036647 | Ga0316582_0064032 | Ga0316582_0064032_1013_2023 | 327 |
| 6 | 3300036712 | Ga0316584_0059444 | Ga0316584_0059444_677_1687 | 327 |
| 7 | 3300046543 | Ga0495645_0212432 | Ga0495645_0212432_127_1188 | 327 |
| 8 | 3300005843 | Ga0068860_100000053 | Ga0068860_100000053114 | 329 |
| 9 | 3300009553 | Ga0105249_10125761 | Ga0105249_101257611 | 329 |
| 10 | 3300013306 | Ga0163162_10000223 | Ga0163162_1000022341 | 329 |
| 11 | 3300025961 | Ga0207712_10052268 | Ga0207712_100522684 | 329 |
| 12 | 3300028381 | Ga0268264_10000098 | Ga0268264_10000098112 | 329 |
| 13 | 3300047443 | Ga0495687_000006 | Ga0495687_000006_401602_402636 | 329 |
| 14 | iso_pu_bacteria | 2599185184 | 2599478257 | 331 |
| 15 | iso_pu_bacteria | 2852623160 | 2852623783 | 331 |
| 16 | iso_pu_bacteria | 2884933994 | 2884937311 | 331 |
| 17 | iso_pu_bacteria | 2919437846 | 2919438947 | 331 |
| 18 | iso_pu_bacteria | 2928078545 | 2928080693 | 331 |
| 19 | iso_pu_bacteria | 2928147474 | 2928150918 | 331 |
| 20 | iso_pu_bacteria | 2932082852 | 2932082923 | 331 |
| 21 | iso_pu_bacteria | 2977232053 | 2977235874 | 331 |
| 22 | 3300005356 | Ga0070674_100055922 | Ga0070674_1000559223 | 332 |
| 23 | 3300005459 | Ga0068867_100014377 | Ga0068867_1000143772 | 332 |
| 24 | 3300005617 | Ga0068859_100361898 | Ga0068859_1003618981 | 332 |
| 25 | 3300005844 | Ga0068862_100087658 | Ga0068862_1000876582 | 332 |
| 26 | 3300006931 | Ga0097620_100361877 | Ga0097620_1003618771 | 332 |
| 27 | 3300009176 | Ga0105242_10079545 | Ga0105242_100795452 | 332 |
| 28 | 3300025907 | Ga0207645_10056839 | Ga0207645_100568391 | 332 |
| 29 | 3300025937 | Ga0207669_10018626 | Ga0207669_100186262 | 332 |
| 30 | 3300025942 | Ga0207689_10044330 | Ga0207689_100443302 | 332 |
| 31 | 3300026089 | Ga0207648_10003850 | Ga0207648_100038504 | 332 |
| 32 | 3300026118 | Ga0207675_100064221 | Ga0207675_1000642212 | 332 |
| 33 | 3300028380 | Ga0268265_10037951 | Ga0268265_100379512 | 332 |
| 34 | iso_pu_bacteria | 2522125168 | 2522551501 | 332 |
| 35 | 3300003322 | rootL2_10011707 | rootL2_100117074 | 333 |
| 36 | 3300003794 | Ga0055531_10000026 | Ga0055531_10000026136 | 333 |
| 37 | 3300005539 | Ga0068853_100526471 | Ga0068853_1005264711 | 333 |
| 38 | 3300006195 | Ga0075366_10001829 | Ga0075366_100018292 | 333 |
| 39 | 3300013100 | Ga0157373_10007899 | Ga0157373_100078993 | 333 |
| 40 | 3300013306 | Ga0163162_10065460 | Ga0163162_100654605 | 333 |
| 41 | 3300013308 | Ga0157375_10347464 | Ga0157375_103474642 | 333 |
| 42 | 3300017792 | Ga0163161_10000120 | Ga0163161_1000012058 | 333 |
| 43 | 3300025304 | Ga0209257_1000004 | Ga0209257_1000004872 | 333 |
| 44 | 3300025940 | Ga0207691_10077511 | Ga0207691_100775113 | 333 |
| 45 | 3300031507 | Ga0307509_10239788 | Ga0307509_102397882 | 333 |
| 46 | 3300037418 | Ga0395900_0000128 | Ga0395900_0000128_81157_82161 | 333 |
| 47 | 3300046501 | Ga0495607_0013492 | Ga0495607_0013492_3874_4884 | 333 |
| 48 | 3300047320 | Ga0495672_0099743 | Ga0495672_0099743_396_1454 | 333 |
| 49 | 3300048904 | Ga0496101_0249408 | Ga0496101_0249408_139_1143 | 333 |
| 50 | 3300048929 | Ga0496126_0028444 | Ga0496126_0028444_1026_2030 | 333 |
| 51 | 3300049758 | Ga0501241_000710 | Ga0501241_000710_5192_6199 | 333 |
| 52 | 3300050493 | nmdc:mga0k408_563_c2 | nmdc:mga0k408_563_c2_4081_5088 | 333 |
| 53 | 3300053139 | Ga0500568_0000346 | Ga0500568_0000346_31128_32168 | 333 |
| 54 | 3300053156 | Ga0500622_0000639 | Ga0500622_0000639_30202_31209 | 333 |
| 55 | 3300001904 | JGI24736J21556_1001094 | JGI24736J21556_10010945 | 334 |
| 56 | 3300001989 | JGI24739J22299_10019733 | JGI24739J22299_100197332 | 334 |
| 57 | 3300001990 | JGI24737J22298_10005842 | JGI24737J22298_100058423 | 334 |
| 58 | 3300001990 | JGI24737J22298_10007501 | JGI24737J22298_100075013 | 334 |
| 59 | 3300001990 | JGI24737J22298_10014505 | JGI24737J22298_100145052 | 334 |
| 60 | 3300002067 | JGI24735J21928_10000004 | JGI24735J21928_10000004181 | 334 |
| 61 | 3300002737 | JGI25162J39368_1000017 | JGI25162J39368_100001796 | 334 |
| 62 | 3300002737 | JGI25162J39368_1000774 | JGI25162J39368_100077412 | 334 |
| 63 | 3300003203 | JGI25406J46586_10053471 | JGI25406J46586_100534711 | 334 |
| 64 | 3300003214 | JGI25165J46597_1002106 | JGI25165J46597_10021065 | 334 |
| 65 | 3300003316 | rootH1_10002295 | rootH1_100022958 | 334 |
| 66 | 3300003316 | rootH1_10005314 | rootH1_1000531427 | 334 |
| 67 | 3300003320 | rootH2_10000120 | rootH2_100001201 | 334 |
| 68 | 3300003320 | rootH2_10005887 | rootH2_100058879 | 334 |
| 69 | 3300003320 | rootH2_10107502 | rootH2_101075024 | 334 |
| 70 | 3300003322 | rootL2_10032383 | rootL2_1003238314 | 334 |
| 71 | 3300003322 | rootL2_10051135 | rootL2_100511354 | 334 |
| 72 | 3300003322 | rootL2_10165298 | rootL2_101652987 | 334 |
| 73 | 3300003323 | rootH1_10009528 | rootH1_100095286 | 334 |
| 74 | 3300003323 | rootH1_10041936 | rootH1_1004193617 | 334 |
| 75 | 3300003354 | JGI25160J50197_1000860 | JGI25160J50197_10008606 | 334 |
| 76 | 3300005262 | Ga0065165_1000266 | Ga0065165_100026647 | 334 |
| 77 | 3300005290 | Ga0065712_10001062 | Ga0065712_100010625 | 334 |
| 78 | 3300005290 | Ga0065712_10102171 | Ga0065712_101021712 | 334 |
| 79 | 3300005290 | Ga0065712_10181277 | Ga0065712_101812771 | 334 |
| 80 | 3300005293 | Ga0065715_10003311 | Ga0065715_100033113 | 334 |
| 81 | 3300005295 | Ga0065707_10097749 | Ga0065707_100977492 | 334 |
| 82 | 3300005327 | Ga0070658_10000011 | Ga0070658_10000011114 | 334 |
| 83 | 3300005328 | Ga0070676_10001127 | Ga0070676_100011277 | 334 |
| 84 | 3300005328 | Ga0070676_10003209 | Ga0070676_100032092 | 334 |
| 85 | 3300005328 | Ga0070676_10015757 | Ga0070676_100157572 | 334 |
| 86 | 3300005329 | Ga0070683_100000228 | Ga0070683_10000022814 | 334 |
| 87 | 3300005329 | Ga0070683_100003644 | Ga0070683_1000036448 | 334 |
| 88 | 3300005329 | Ga0070683_100021481 | Ga0070683_1000214812 | 334 |
| 89 | 3300005329 | Ga0070683_100104041 | Ga0070683_1001040411 | 334 |
| 90 | 3300005329 | Ga0070683_100117797 | Ga0070683_1001177971 | 334 |
| 91 | 3300005330 | Ga0070690_100002371 | Ga0070690_1000023715 | 334 |
| 92 | 3300005330 | Ga0070690_100054029 | Ga0070690_1000540291 | 334 |
| 93 | 3300005331 | Ga0070670_100183606 | Ga0070670_1001836062 | 334 |
| 94 | 3300005334 | Ga0068869_100006749 | Ga0068869_1000067493 | 334 |
| 95 | 3300005334 | Ga0068869_100041953 | Ga0068869_1000419532 | 334 |
| 96 | 3300005335 | Ga0070666_10000051 | Ga0070666_1000005184 | 334 |
| 97 | 3300005337 | Ga0070682_100083044 | Ga0070682_1000830441 | 334 |
| 98 | 3300005337 | Ga0070682_100107202 | Ga0070682_1001072021 | 334 |
| 99 | 3300005338 | Ga0068868_100001454 | Ga0068868_10000145411 | 334 |
| 100 | 3300005338 | Ga0068868_100004292 | Ga0068868_1000042922 | 334 |
| 101 | 3300005338 | Ga0068868_100006589 | Ga0068868_1000065894 | 334 |
| 102 | 3300005338 | Ga0068868_100015633 | Ga0068868_1000156332 | 334 |
| 103 | 3300005338 | Ga0068868_100062232 | Ga0068868_1000622321 | 334 |
| 104 | 3300005338 | Ga0068868_100126373 | Ga0068868_1001263732 | 334 |
| 105 | 3300005338 | Ga0068868_100320609 | Ga0068868_1003206091 | 334 |
| 106 | 3300005339 | Ga0070660_100160916 | Ga0070660_1001609162 | 334 |
| 107 | 3300005340 | Ga0070689_100003291 | Ga0070689_1000032916 | 334 |
| 108 | 3300005340 | Ga0070689_100082898 | Ga0070689_1000828982 | 334 |
| 109 | 3300005343 | Ga0070687_100034448 | Ga0070687_1000344481 | 334 |
| 110 | 3300005344 | Ga0070661_100000443 | Ga0070661_1000004434 | 334 |
| 111 | 3300005344 | Ga0070661_100024402 | Ga0070661_1000244023 | 334 |
| 112 | 3300005347 | Ga0070668_100007989 | Ga0070668_1000079892 | 334 |
| 113 | 3300005347 | Ga0070668_100032172 | Ga0070668_1000321722 | 334 |
| 114 | 3300005347 | Ga0070668_100118733 | Ga0070668_1001187332 | 334 |
| 115 | 3300005353 | Ga0070669_100065404 | Ga0070669_1000654042 | 334 |
| 116 | 3300005353 | Ga0070669_100086702 | Ga0070669_1000867021 | 334 |
| 117 | 3300005354 | Ga0070675_100057529 | Ga0070675_1000575292 | 334 |
| 118 | 3300005354 | Ga0070675_100136268 | Ga0070675_1001362682 | 334 |
| 119 | 3300005354 | Ga0070675_100195735 | Ga0070675_1001957352 | 334 |
| 120 | 3300005355 | Ga0070671_100002364 | Ga0070671_10000236411 | 334 |
| 121 | 3300005355 | Ga0070671_100062848 | Ga0070671_1000628482 | 334 |
| 122 | 3300005356 | Ga0070674_100104360 | Ga0070674_1001043602 | 334 |
| 123 | 3300005364 | Ga0070673_100006709 | Ga0070673_1000067091 | 334 |
| 124 | 3300005364 | Ga0070673_100033594 | Ga0070673_1000335941 | 334 |
| 125 | 3300005364 | Ga0070673_100043498 | Ga0070673_1000434983 | 334 |
| 126 | 3300005364 | Ga0070673_100058801 | Ga0070673_1000588012 | 334 |
| 127 | 3300005364 | Ga0070673_100153403 | Ga0070673_1001534031 | 334 |
| 128 | 3300005364 | Ga0070673_100171994 | Ga0070673_1001719941 | 334 |
| 129 | 3300005364 | Ga0070673_100217106 | Ga0070673_1002171062 | 334 |
| 130 | 3300005365 | Ga0070688_100025601 | Ga0070688_1000256012 | 334 |
| 131 | 3300005365 | Ga0070688_100031289 | Ga0070688_1000312892 | 334 |
| 132 | 3300005365 | Ga0070688_100086197 | Ga0070688_1000861972 | 334 |
| 133 | 3300005366 | Ga0070659_100001530 | Ga0070659_1000015305 | 334 |
| 134 | 3300005366 | Ga0070659_100001700 | Ga0070659_10000170010 | 334 |
| 135 | 3300005366 | Ga0070659_100003474 | Ga0070659_1000034742 | 334 |
| 136 | 3300005366 | Ga0070659_100157601 | Ga0070659_1001576012 | 334 |
| 137 | 3300005367 | Ga0070667_100010216 | Ga0070667_1000102165 | 334 |
| 138 | 3300005367 | Ga0070667_100019342 | Ga0070667_1000193422 | 334 |
| 139 | 3300005367 | Ga0070667_100069235 | Ga0070667_1000692352 | 334 |
| 140 | 3300005367 | Ga0070667_100086982 | Ga0070667_1000869822 | 334 |
| 141 | 3300005367 | Ga0070667_100106847 | Ga0070667_1001068472 | 334 |
| 142 | 3300005367 | Ga0070667_100154764 | Ga0070667_1001547642 | 334 |
| 143 | 3300005456 | Ga0070678_100003359 | Ga0070678_1000033593 | 334 |
| 144 | 3300005456 | Ga0070678_100019268 | Ga0070678_1000192681 | 334 |
| 145 | 3300005456 | Ga0070678_100022137 | Ga0070678_1000221375 | 334 |
| 146 | 3300005457 | Ga0070662_100002245 | Ga0070662_10000224512 | 334 |
| 147 | 3300005457 | Ga0070662_100003667 | Ga0070662_1000036678 | 334 |
| 148 | 3300005457 | Ga0070662_100004108 | Ga0070662_1000041082 | 334 |
| 149 | 3300005457 | Ga0070662_100010394 | Ga0070662_1000103943 | 334 |
| 150 | 3300005458 | Ga0070681_10031571 | Ga0070681_100315713 | 334 |
| 151 | 3300005458 | Ga0070681_10190722 | Ga0070681_101907221 | 334 |
| 152 | 3300005459 | Ga0068867_100000844 | Ga0068867_10000084410 | 334 |
| 153 | 3300005459 | Ga0068867_100012531 | Ga0068867_1000125313 | 334 |
| 154 | 3300005459 | Ga0068867_100036578 | Ga0068867_1000365782 | 334 |
| 155 | 3300005459 | Ga0068867_100139400 | Ga0068867_1001394002 | 334 |
| 156 | 3300005459 | Ga0068867_100161935 | Ga0068867_1001619351 | 334 |
| 157 | 3300005459 | Ga0068867_100429299 | Ga0068867_1004292991 | 334 |
| 158 | 3300005466 | Ga0070685_10010336 | Ga0070685_100103364 | 334 |
| 159 | 3300005466 | Ga0070685_10039884 | Ga0070685_100398842 | 334 |
| 160 | 3300005466 | Ga0070685_10240157 | Ga0070685_102401571 | 334 |
| 161 | 3300005471 | Ga0070698_100000297 | Ga0070698_10000029715 | 334 |
| 162 | 3300005471 | Ga0070698_100005528 | Ga0070698_1000055283 | 334 |
| 163 | 3300005530 | Ga0070679_100010044 | Ga0070679_1000100446 | 334 |
| 164 | 3300005530 | Ga0070679_100153790 | Ga0070679_1001537902 | 334 |
| 165 | 3300005535 | Ga0070684_100001378 | Ga0070684_10000137811 | 334 |
| 166 | 3300005535 | Ga0070684_100030200 | Ga0070684_1000302002 | 334 |
| 167 | 3300005535 | Ga0070684_100086450 | Ga0070684_1000864502 | 334 |
| 168 | 3300005535 | Ga0070684_100208045 | Ga0070684_1002080452 | 334 |
| 169 | 3300005535 | Ga0070684_100385862 | Ga0070684_1003858621 | 334 |
| 170 | 3300005539 | Ga0068853_100003147 | Ga0068853_10000314710 | 334 |
| 171 | 3300005539 | Ga0068853_100043624 | Ga0068853_1000436244 | 334 |
| 172 | 3300005539 | Ga0068853_100048142 | Ga0068853_1000481423 | 334 |
| 173 | 3300005539 | Ga0068853_100050373 | Ga0068853_1000503732 | 334 |
| 174 | 3300005543 | Ga0070672_100180848 | Ga0070672_1001808481 | 334 |
| 175 | 3300005544 | Ga0070686_100069084 | Ga0070686_1000690841 | 334 |
| 176 | 3300005544 | Ga0070686_100117277 | Ga0070686_1001172772 | 334 |
| 177 | 3300005544 | Ga0070686_100239448 | Ga0070686_1002394481 | 334 |
| 178 | 3300005548 | Ga0070665_100000003 | Ga0070665_100000003599 | 334 |
| 179 | 3300005548 | Ga0070665_100047316 | Ga0070665_1000473164 | 334 |
| 180 | 3300005548 | Ga0070665_100162423 | Ga0070665_1001624232 | 334 |
| 181 | 3300005549 | Ga0070704_100000001 | Ga0070704_100000001176 | 334 |
| 182 | 3300005549 | Ga0070704_100325264 | Ga0070704_1003252641 | 334 |
| 183 | 3300005563 | Ga0068855_100000035 | Ga0068855_100000035127 | 334 |
| 184 | 3300005563 | Ga0068855_100000506 | Ga0068855_10000050646 | 334 |
| 185 | 3300005563 | Ga0068855_100136419 | Ga0068855_1001364193 | 334 |
| 186 | 3300005563 | Ga0068855_100221351 | Ga0068855_1002213513 | 334 |
| 187 | 3300005564 | Ga0070664_100000126 | Ga0070664_10000012617 | 334 |
| 188 | 3300005564 | Ga0070664_100129068 | Ga0070664_1001290681 | 334 |
| 189 | 3300005577 | Ga0068857_100000388 | Ga0068857_1000003888 | 334 |
| 190 | 3300005577 | Ga0068857_100039665 | Ga0068857_1000396653 | 334 |
| 191 | 3300005577 | Ga0068857_100041652 | Ga0068857_1000416523 | 334 |
| 192 | 3300005577 | Ga0068857_100076485 | Ga0068857_1000764851 | 334 |
| 193 | 3300005577 | Ga0068857_100099773 | Ga0068857_1000997733 | 334 |
| 194 | 3300005577 | Ga0068857_100424757 | Ga0068857_1004247571 | 334 |
| 195 | 3300005578 | Ga0068854_100025486 | Ga0068854_1000254862 | 334 |
| 196 | 3300005578 | Ga0068854_100168955 | Ga0068854_1001689551 | 334 |
| 197 | 3300005614 | Ga0068856_100002273 | Ga0068856_1000022734 | 334 |
| 198 | 3300005614 | Ga0068856_100005752 | Ga0068856_1000057528 | 334 |
| 199 | 3300005614 | Ga0068856_100016539 | Ga0068856_1000165394 | 334 |
| 200 | 3300005614 | Ga0068856_100485027 | Ga0068856_1004850271 | 334 |
| 201 | 3300005615 | Ga0070702_100067102 | Ga0070702_1000671022 | 334 |
| 202 | 3300005616 | Ga0068852_100000321 | Ga0068852_10000032113 | 334 |
| 203 | 3300005616 | Ga0068852_100000590 | Ga0068852_10000059014 | 334 |
| 204 | 3300005616 | Ga0068852_100006413 | Ga0068852_1000064132 | 334 |
| 205 | 3300005617 | Ga0068859_100000023 | Ga0068859_100000023162 | 334 |
| 206 | 3300005617 | Ga0068859_100021815 | Ga0068859_1000218152 | 334 |
| 207 | 3300005617 | Ga0068859_100034932 | Ga0068859_1000349323 | 334 |
| 208 | 3300005617 | Ga0068859_100084110 | Ga0068859_1000841102 | 334 |
| 209 | 3300005617 | Ga0068859_100117101 | Ga0068859_1001171014 | 334 |
| 210 | 3300005618 | Ga0068864_100001566 | Ga0068864_1000015666 | 334 |
| 211 | 3300005618 | Ga0068864_100190720 | Ga0068864_1001907202 | 334 |
| 212 | 3300005618 | Ga0068864_100230798 | Ga0068864_1002307981 | 334 |
| 213 | 3300005618 | Ga0068864_100262894 | Ga0068864_1002628942 | 334 |
| 214 | 3300005718 | Ga0068866_10007841 | Ga0068866_100078413 | 334 |
| 215 | 3300005719 | Ga0068861_100014197 | Ga0068861_1000141973 | 334 |
| 216 | 3300005719 | Ga0068861_100020452 | Ga0068861_1000204522 | 334 |
| 217 | 3300005719 | Ga0068861_100066705 | Ga0068861_1000667052 | 334 |
| 218 | 3300005719 | Ga0068861_100180276 | Ga0068861_1001802762 | 334 |
| 219 | 3300005834 | Ga0068851_10007740 | Ga0068851_100077402 | 334 |
| 220 | 3300005834 | Ga0068851_10024439 | Ga0068851_100244391 | 334 |
| 221 | 3300005834 | Ga0068851_10045210 | Ga0068851_100452102 | 334 |
| 222 | 3300005834 | Ga0068851_10079958 | Ga0068851_100799583 | 334 |
| 223 | 3300005840 | Ga0068870_10016650 | Ga0068870_100166504 | 334 |
| 224 | 3300005841 | Ga0068863_100014563 | Ga0068863_1000145636 | 334 |
| 225 | 3300005841 | Ga0068863_100015773 | Ga0068863_1000157732 | 334 |
| 226 | 3300005841 | Ga0068863_100047731 | Ga0068863_1000477312 | 334 |
| 227 | 3300005841 | Ga0068863_100158227 | Ga0068863_1001582271 | 334 |
| 228 | 3300005841 | Ga0068863_100199838 | Ga0068863_1001998382 | 334 |
| 229 | 3300005841 | Ga0068863_100312499 | Ga0068863_1003124991 | 334 |
| 230 | 3300005842 | Ga0068858_100004690 | Ga0068858_1000046907 | 334 |
| 231 | 3300005842 | Ga0068858_100063280 | Ga0068858_1000632803 | 334 |
| 232 | 3300005842 | Ga0068858_100152685 | Ga0068858_1001526852 | 334 |
| 233 | 3300005842 | Ga0068858_100263952 | Ga0068858_1002639522 | 334 |
| 234 | 3300005843 | Ga0068860_100006137 | Ga0068860_1000061379 | 334 |
| 235 | 3300005843 | Ga0068860_100013396 | Ga0068860_1000133962 | 334 |
| 236 | 3300005843 | Ga0068860_100055899 | Ga0068860_1000558992 | 334 |
| 237 | 3300005844 | Ga0068862_100224322 | Ga0068862_1002243222 | 334 |
| 238 | 3300005985 | Ga0081539_10002032 | Ga0081539_1000203224 | 334 |
| 239 | 3300006173 | Ga0070716_100287332 | Ga0070716_1002873321 | 334 |
| 240 | 3300006195 | Ga0075366_10000123 | Ga0075366_1000012322 | 334 |
| 241 | 3300006195 | Ga0075366_10013142 | Ga0075366_100131424 | 334 |
| 242 | 3300006195 | Ga0075366_10022193 | Ga0075366_100221932 | 334 |
| 243 | 3300006195 | Ga0075366_10119045 | Ga0075366_101190452 | 334 |
| 244 | 3300006237 | Ga0097621_100000020 | Ga0097621_10000002064 | 334 |
| 245 | 3300006237 | Ga0097621_100007241 | Ga0097621_1000072414 | 334 |
| 246 | 3300006237 | Ga0097621_100036478 | Ga0097621_1000364783 | 334 |
| 247 | 3300006237 | Ga0097621_100096526 | Ga0097621_1000965262 | 334 |
| 248 | 3300006237 | Ga0097621_100168801 | Ga0097621_1001688012 | 334 |
| 249 | 3300006237 | Ga0097621_100174063 | Ga0097621_1001740633 | 334 |
| 250 | 3300006237 | Ga0097621_100288034 | Ga0097621_1002880342 | 334 |
| 251 | 3300006353 | Ga0075370_10159129 | Ga0075370_101591291 | 334 |
| 252 | 3300006358 | Ga0068871_100000130 | Ga0068871_10000013010 | 334 |
| 253 | 3300006358 | Ga0068871_100024457 | Ga0068871_1000244573 | 334 |
| 254 | 3300006358 | Ga0068871_100056594 | Ga0068871_1000565942 | 334 |
| 255 | 3300006358 | Ga0068871_100133594 | Ga0068871_1001335942 | 334 |
| 256 | 3300006844 | Ga0075428_100010125 | Ga0075428_1000101258 | 334 |
| 257 | 3300006844 | Ga0075428_100081134 | Ga0075428_1000811342 | 334 |
| 258 | 3300006844 | Ga0075428_100326104 | Ga0075428_1003261042 | 334 |
| 259 | 3300006846 | Ga0075430_100001450 | Ga0075430_1000014502 | 334 |
| 260 | 3300006847 | Ga0075431_100094982 | Ga0075431_1000949822 | 334 |
| 261 | 3300006880 | Ga0075429_100000803 | Ga0075429_1000008032 | 334 |
| 262 | 3300006880 | Ga0075429_100167363 | Ga0075429_1001673632 | 334 |
| 263 | 3300006881 | Ga0068865_100000050 | Ga0068865_10000005041 | 334 |
| 264 | 3300006931 | Ga0097620_100000023 | Ga0097620_100000023162 | 334 |
| 265 | 3300006931 | Ga0097620_100021815 | Ga0097620_1000218152 | 334 |
| 266 | 3300006931 | Ga0097620_100034933 | Ga0097620_1000349333 | 334 |
| 267 | 3300006931 | Ga0097620_100084104 | Ga0097620_1000841042 | 334 |
| 268 | 3300006931 | Ga0097620_100117099 | Ga0097620_1001170994 | 334 |
| 269 | 3300009093 | Ga0105240_10000008 | Ga0105240_10000008339 | 334 |
| 270 | 3300009093 | Ga0105240_10000670 | Ga0105240_1000067023 | 334 |
| 271 | 3300009093 | Ga0105240_10000728 | Ga0105240_1000072823 | 334 |
| 272 | 3300009093 | Ga0105240_10001190 | Ga0105240_1000119035 | 334 |
| 273 | 3300009093 | Ga0105240_10002005 | Ga0105240_1000200529 | 334 |
| 274 | 3300009093 | Ga0105240_10002522 | Ga0105240_100025228 | 334 |
| 275 | 3300009093 | Ga0105240_10013576 | Ga0105240_100135762 | 334 |
| 276 | 3300009093 | Ga0105240_10045988 | Ga0105240_100459886 | 334 |
| 277 | 3300009093 | Ga0105240_10160821 | Ga0105240_101608213 | 334 |
| 278 | 3300009093 | Ga0105240_10193265 | Ga0105240_101932652 | 334 |
| 279 | 3300009093 | Ga0105240_10234492 | Ga0105240_102344922 | 334 |
| 280 | 3300009093 | Ga0105240_10446939 | Ga0105240_104469391 | 334 |
| 281 | 3300009094 | Ga0111539_10006028 | Ga0111539_100060285 | 334 |
| 282 | 3300009094 | Ga0111539_10009852 | Ga0111539_100098529 | 334 |
| 283 | 3300009094 | Ga0111539_10009875 | Ga0111539_100098752 | 334 |
| 284 | 3300009094 | Ga0111539_10062072 | Ga0111539_100620722 | 334 |
| 285 | 3300009094 | Ga0111539_10203098 | Ga0111539_102030981 | 334 |
| 286 | 3300009094 | Ga0111539_10289450 | Ga0111539_102894502 | 334 |
| 287 | 3300009101 | Ga0105247_10000662 | Ga0105247_100006626 | 334 |
| 288 | 3300009147 | Ga0114129_10333002 | Ga0114129_103330022 | 334 |
| 289 | 3300009174 | Ga0105241_10000281 | Ga0105241_1000028119 | 334 |
| 290 | 3300009174 | Ga0105241_10001608 | Ga0105241_100016088 | 334 |
| 291 | 3300009174 | Ga0105241_10004819 | Ga0105241_100048193 | 334 |
| 292 | 3300009174 | Ga0105241_10007868 | Ga0105241_100078686 | 334 |
| 293 | 3300009174 | Ga0105241_10161598 | Ga0105241_101615982 | 334 |
| 294 | 3300009176 | Ga0105242_10002097 | Ga0105242_100020973 | 334 |
| 295 | 3300009176 | Ga0105242_10006335 | Ga0105242_100063354 | 334 |
| 296 | 3300009176 | Ga0105242_10014086 | Ga0105242_100140861 | 334 |
| 297 | 3300009176 | Ga0105242_10077691 | Ga0105242_100776912 | 334 |
| 298 | 3300009176 | Ga0105242_10078993 | Ga0105242_100789932 | 334 |
| 299 | 3300009545 | Ga0105237_10000622 | Ga0105237_1000062233 | 334 |
| 300 | 3300009545 | Ga0105237_10000902 | Ga0105237_1000090222 | 334 |
| 301 | 3300009545 | Ga0105237_10003737 | Ga0105237_100037375 | 334 |
| 302 | 3300009545 | Ga0105237_10005252 | Ga0105237_100052522 | 334 |
| 303 | 3300009545 | Ga0105237_10007095 | Ga0105237_1000709511 | 334 |
| 304 | 3300009545 | Ga0105237_10007800 | Ga0105237_100078008 | 334 |
| 305 | 3300009545 | Ga0105237_10007917 | Ga0105237_100079179 | 334 |
| 306 | 3300009545 | Ga0105237_10103018 | Ga0105237_101030181 | 334 |
| 307 | 3300009545 | Ga0105237_10148166 | Ga0105237_101481661 | 334 |
| 308 | 3300009551 | Ga0105238_10003022 | Ga0105238_100030221 | 334 |
| 309 | 3300009551 | Ga0105238_10233223 | Ga0105238_102332231 | 334 |
| 310 | 3300009553 | Ga0105249_10002624 | Ga0105249_1000262410 | 334 |
| 311 | 3300009553 | Ga0105249_10006638 | Ga0105249_100066383 | 334 |
| 312 | 3300009553 | Ga0105249_10011834 | Ga0105249_100118347 | 334 |
| 313 | 3300009553 | Ga0105249_10020024 | Ga0105249_100200243 | 334 |
| 314 | 3300009553 | Ga0105249_10031174 | Ga0105249_100311744 | 334 |
| 315 | 3300009553 | Ga0105249_10139668 | Ga0105249_101396681 | 334 |
| 316 | 3300009553 | Ga0105249_10213918 | Ga0105249_102139183 | 334 |
| 317 | 3300010375 | Ga0105239_10000002 | Ga0105239_10000002257 | 334 |
| 318 | 3300010375 | Ga0105239_10000012 | Ga0105239_10000012175 | 334 |
| 319 | 3300010375 | Ga0105239_10000079 | Ga0105239_1000007978 | 334 |
| 320 | 3300010375 | Ga0105239_10000445 | Ga0105239_1000044544 | 334 |
| 321 | 3300010375 | Ga0105239_10000959 | Ga0105239_100009596 | 334 |
| 322 | 3300010375 | Ga0105239_10001148 | Ga0105239_1000114811 | 334 |
| 323 | 3300010375 | Ga0105239_10003843 | Ga0105239_100038435 | 334 |
| 324 | 3300010375 | Ga0105239_10012429 | Ga0105239_100124295 | 334 |
| 325 | 3300010375 | Ga0105239_10021418 | Ga0105239_100214185 | 334 |
| 326 | 3300010375 | Ga0105239_10022611 | Ga0105239_100226112 | 334 |
| 327 | 3300010375 | Ga0105239_10024144 | Ga0105239_100241445 | 334 |
| 328 | 3300010375 | Ga0105239_10032754 | Ga0105239_100327543 | 334 |
| 329 | 3300010375 | Ga0105239_10056002 | Ga0105239_100560025 | 334 |
| 330 | 3300011119 | Ga0105246_10006795 | Ga0105246_100067956 | 334 |
| 331 | 3300011119 | Ga0105246_10292802 | Ga0105246_102928021 | 334 |
| 332 | 3300013100 | Ga0157373_10001101 | Ga0157373_1000110111 | 334 |
| 333 | 3300013100 | Ga0157373_10065903 | Ga0157373_100659033 | 334 |
| 334 | 3300013102 | Ga0157371_10003814 | Ga0157371_1000381411 | 334 |
| 335 | 3300013102 | Ga0157371_10008724 | Ga0157371_100087246 | 334 |
| 336 | 3300013102 | Ga0157371_10018949 | Ga0157371_100189492 | 334 |
| 337 | 3300013102 | Ga0157371_10030864 | Ga0157371_100308641 | 334 |
| 338 | 3300013102 | Ga0157371_10101189 | Ga0157371_101011892 | 334 |
| 339 | 3300013102 | Ga0157371_10109621 | Ga0157371_101096212 | 334 |
| 340 | 3300013102 | Ga0157371_10147338 | Ga0157371_101473381 | 334 |
| 341 | 3300013102 | Ga0157371_10179720 | Ga0157371_101797202 | 334 |
| 342 | 3300013104 | Ga0157370_10006833 | Ga0157370_100068339 | 334 |
| 343 | 3300013104 | Ga0157370_10082950 | Ga0157370_100829502 | 334 |
| 344 | 3300013104 | Ga0157370_10407795 | Ga0157370_104077951 | 334 |
| 345 | 3300013105 | Ga0157369_10011074 | Ga0157369_100110747 | 334 |
| 346 | 3300013105 | Ga0157369_10148384 | Ga0157369_101483842 | 334 |
| 347 | 3300013105 | Ga0157369_10163483 | Ga0157369_101634832 | 334 |
| 348 | 3300013105 | Ga0157369_10194401 | Ga0157369_101944012 | 334 |
| 349 | 3300013296 | Ga0157374_10000004 | Ga0157374_1000000499 | 334 |
| 350 | 3300013296 | Ga0157374_10003759 | Ga0157374_1000375911 | 334 |
| 351 | 3300013296 | Ga0157374_10006271 | Ga0157374_100062717 | 334 |
| 352 | 3300013296 | Ga0157374_10009183 | Ga0157374_100091838 | 334 |
| 353 | 3300013296 | Ga0157374_10021520 | Ga0157374_100215203 | 334 |
| 354 | 3300013296 | Ga0157374_10072972 | Ga0157374_100729723 | 334 |
| 355 | 3300013296 | Ga0157374_10079054 | Ga0157374_100790542 | 334 |
| 356 | 3300013296 | Ga0157374_10112153 | Ga0157374_101121532 | 334 |
| 357 | 3300013296 | Ga0157374_10193328 | Ga0157374_101933282 | 334 |
| 358 | 3300013296 | Ga0157374_10195979 | Ga0157374_101959792 | 334 |
| 359 | 3300013297 | Ga0157378_10072604 | Ga0157378_100726042 | 334 |
| 360 | 3300013297 | Ga0157378_10105500 | Ga0157378_101055002 | 334 |
| 361 | 3300013297 | Ga0157378_10107676 | Ga0157378_101076762 | 334 |
| 362 | 3300013297 | Ga0157378_10121035 | Ga0157378_101210352 | 334 |
| 363 | 3300013297 | Ga0157378_10161247 | Ga0157378_101612472 | 334 |
| 364 | 3300013306 | Ga0163162_10000031 | Ga0163162_1000003110 | 334 |
| 365 | 3300013306 | Ga0163162_10000161 | Ga0163162_1000016137 | 334 |
| 366 | 3300013306 | Ga0163162_10008282 | Ga0163162_100082828 | 334 |
| 367 | 3300013306 | Ga0163162_10013375 | Ga0163162_100133756 | 334 |
| 368 | 3300013306 | Ga0163162_10049354 | Ga0163162_100493542 | 334 |
| 369 | 3300013306 | Ga0163162_10076770 | Ga0163162_100767703 | 334 |
| 370 | 3300013306 | Ga0163162_10100926 | Ga0163162_101009262 | 334 |
| 371 | 3300013306 | Ga0163162_10110129 | Ga0163162_101101293 | 334 |
| 372 | 3300013306 | Ga0163162_10147547 | Ga0163162_101475472 | 334 |
| 373 | 3300013306 | Ga0163162_10192129 | Ga0163162_101921292 | 334 |
| 374 | 3300013306 | Ga0163162_10638904 | Ga0163162_106389041 | 334 |
| 375 | 3300013307 | Ga0157372_10000077 | Ga0157372_100000778 | 334 |
| 376 | 3300013307 | Ga0157372_10000252 | Ga0157372_1000025244 | 334 |
| 377 | 3300013307 | Ga0157372_10000988 | Ga0157372_100009885 | 334 |
| 378 | 3300013307 | Ga0157372_10002075 | Ga0157372_100020757 | 334 |
| 379 | 3300013307 | Ga0157372_10003847 | Ga0157372_100038479 | 334 |
| 380 | 3300013307 | Ga0157372_10028973 | Ga0157372_100289735 | 334 |
| 381 | 3300013307 | Ga0157372_10052458 | Ga0157372_100524582 | 334 |
| 382 | 3300013307 | Ga0157372_10059053 | Ga0157372_100590534 | 334 |
| 383 | 3300013307 | Ga0157372_10099621 | Ga0157372_100996212 | 334 |
| 384 | 3300013307 | Ga0157372_10105046 | Ga0157372_101050461 | 334 |
| 385 | 3300013307 | Ga0157372_10247922 | Ga0157372_102479222 | 334 |
| 386 | 3300013308 | Ga0157375_10002968 | Ga0157375_100029682 | 334 |
| 387 | 3300013308 | Ga0157375_10041638 | Ga0157375_100416383 | 334 |
| 388 | 3300013308 | Ga0157375_10058934 | Ga0157375_100589341 | 334 |
| 389 | 3300013308 | Ga0157375_10149321 | Ga0157375_101493212 | 334 |
| 390 | 3300013308 | Ga0157375_10182536 | Ga0157375_101825362 | 334 |
| 391 | 3300013308 | Ga0157375_10198465 | Ga0157375_101984652 | 334 |
| 392 | 3300013308 | Ga0157375_10583039 | Ga0157375_105830391 | 334 |
| 393 | 3300014325 | Ga0163163_10000176 | Ga0163163_1000017658 | 334 |
| 394 | 3300014325 | Ga0163163_10041106 | Ga0163163_100411062 | 334 |
| 395 | 3300014326 | Ga0157380_10000789 | Ga0157380_100007892 | 334 |
| 396 | 3300014326 | Ga0157380_10009405 | Ga0157380_100094056 | 334 |
| 397 | 3300014326 | Ga0157380_10156305 | Ga0157380_101563052 | 334 |
| 398 | 3300014745 | Ga0157377_10009077 | Ga0157377_100090772 | 334 |
| 399 | 3300014745 | Ga0157377_10035212 | Ga0157377_100352122 | 334 |
| 400 | 3300014745 | Ga0157377_10041286 | Ga0157377_100412862 | 334 |
| 401 | 3300014745 | Ga0157377_10049547 | Ga0157377_100495472 | 334 |
| 402 | 3300014968 | Ga0157379_10106312 | Ga0157379_101063121 | 334 |
| 403 | 3300014968 | Ga0157379_10125359 | Ga0157379_101253592 | 334 |
| 404 | 3300014969 | Ga0157376_10011492 | Ga0157376_100114925 | 334 |
| 405 | 3300014969 | Ga0157376_10031069 | Ga0157376_100310692 | 334 |
| 406 | 3300014969 | Ga0157376_10038823 | Ga0157376_100388231 | 334 |
| 407 | 3300014969 | Ga0157376_10040394 | Ga0157376_100403942 | 334 |
| 408 | 3300014969 | Ga0157376_10048359 | Ga0157376_100483593 | 334 |
| 409 | 3300014969 | Ga0157376_10091728 | Ga0157376_100917282 | 334 |
| 410 | 3300014969 | Ga0157376_10120043 | Ga0157376_101200432 | 334 |
| 411 | 3300017792 | Ga0163161_10001827 | Ga0163161_1000182713 | 334 |
| 412 | 3300017792 | Ga0163161_10089666 | Ga0163161_100896662 | 334 |
| 413 | 3300017792 | Ga0163161_10141300 | Ga0163161_101413002 | 334 |
| 414 | 3300020070 | Ga0206356_10918650 | Ga0206356_109186501 | 334 |
| 415 | 3300020077 | Ga0206351_10778228 | Ga0206351_107782281 | 334 |
| 416 | 3300020610 | Ga0154015_1194800 | Ga0154015_11948001 | 334 |
| 417 | 3300021361 | Ga0213872_10011644 | Ga0213872_100116444 | 334 |
| 418 | 3300022467 | Ga0224712_10124343 | Ga0224712_101243431 | 334 |
| 419 | 3300025231 | Ga0207427_100171 | Ga0207427_1001713 | 334 |
| 420 | 3300025233 | Ga0209437_100024 | Ga0209437_100024218 | 334 |
| 421 | 3300025233 | Ga0209437_100052 | Ga0209437_100052102 | 334 |
| 422 | 3300025250 | Ga0209026_1002264 | Ga0209026_10022649 | 334 |
| 423 | 3300025250 | Ga0209026_1009270 | Ga0209026_10092702 | 334 |
| 424 | 3300025261 | Ga0209233_1000067 | Ga0209233_1000067102 | 334 |
| 425 | 3300025261 | Ga0209233_1002449 | Ga0209233_10024496 | 334 |
| 426 | 3300025292 | Ga0209676_1002043 | Ga0209676_10020434 | 334 |
| 427 | 3300025298 | Ga0209050_1001548 | Ga0209050_100154818 | 334 |
| 428 | 3300025298 | Ga0209050_1026084 | Ga0209050_10260841 | 334 |
| 429 | 3300025302 | Ga0207426_1000009 | Ga0207426_1000009229 | 334 |
| 430 | 3300025304 | Ga0209257_1000007 | Ga0209257_10000071407 | 334 |
| 431 | 3300025315 | Ga0207697_10065113 | Ga0207697_100651131 | 334 |
| 432 | 3300025315 | Ga0207697_10093814 | Ga0207697_100938141 | 334 |
| 433 | 3300025321 | Ga0207656_10010375 | Ga0207656_100103752 | 334 |
| 434 | 3300025321 | Ga0207656_10015168 | Ga0207656_100151682 | 334 |
| 435 | 3300025321 | Ga0207656_10032229 | Ga0207656_100322292 | 334 |
| 436 | 3300025321 | Ga0207656_10073677 | Ga0207656_100736772 | 334 |
| 437 | 3300025893 | Ga0207682_10046956 | Ga0207682_100469561 | 334 |
| 438 | 3300025899 | Ga0207642_10033726 | Ga0207642_100337261 | 334 |
| 439 | 3300025900 | Ga0207710_10005592 | Ga0207710_100055924 | 334 |
| 440 | 3300025903 | Ga0207680_10000053 | Ga0207680_1000005346 | 334 |
| 441 | 3300025903 | Ga0207680_10026500 | Ga0207680_100265002 | 334 |
| 442 | 3300025903 | Ga0207680_10065172 | Ga0207680_100651722 | 334 |
| 443 | 3300025904 | Ga0207647_10000463 | Ga0207647_100004635 | 334 |
| 444 | 3300025904 | Ga0207647_10002289 | Ga0207647_100022899 | 334 |
| 445 | 3300025904 | Ga0207647_10041668 | Ga0207647_100416682 | 334 |
| 446 | 3300025904 | Ga0207647_10064384 | Ga0207647_100643842 | 334 |
| 447 | 3300025904 | Ga0207647_10217406 | Ga0207647_102174061 | 334 |
| 448 | 3300025905 | Ga0207685_10133979 | Ga0207685_101339791 | 334 |
| 449 | 3300025907 | Ga0207645_10000082 | Ga0207645_1000008260 | 334 |
| 450 | 3300025907 | Ga0207645_10009123 | Ga0207645_100091233 | 334 |
| 451 | 3300025907 | Ga0207645_10013009 | Ga0207645_100130091 | 334 |
| 452 | 3300025907 | Ga0207645_10025040 | Ga0207645_100250401 | 334 |
| 453 | 3300025908 | Ga0207643_10014774 | Ga0207643_100147743 | 334 |
| 454 | 3300025909 | Ga0207705_10000015 | Ga0207705_10000015114 | 334 |
| 455 | 3300025909 | Ga0207705_10059570 | Ga0207705_100595702 | 334 |
| 456 | 3300025909 | Ga0207705_10321369 | Ga0207705_103213691 | 334 |
| 457 | 3300025911 | Ga0207654_10000422 | Ga0207654_1000042213 | 334 |
| 458 | 3300025911 | Ga0207654_10001451 | Ga0207654_1000145114 | 334 |
| 459 | 3300025911 | Ga0207654_10002361 | Ga0207654_100023616 | 334 |
| 460 | 3300025911 | Ga0207654_10022023 | Ga0207654_100220232 | 334 |
| 461 | 3300025911 | Ga0207654_10069331 | Ga0207654_100693313 | 334 |
| 462 | 3300025911 | Ga0207654_10178182 | Ga0207654_101781821 | 334 |
| 463 | 3300025912 | Ga0207707_10106716 | Ga0207707_101067163 | 334 |
| 464 | 3300025913 | Ga0207695_10000021 | Ga0207695_1000002161 | 334 |
| 465 | 3300025913 | Ga0207695_10000039 | Ga0207695_10000039179 | 334 |
| 466 | 3300025913 | Ga0207695_10000189 | Ga0207695_10000189142 | 334 |
| 467 | 3300025913 | Ga0207695_10000993 | Ga0207695_1000099316 | 334 |
| 468 | 3300025913 | Ga0207695_10003570 | Ga0207695_1000357012 | 334 |
| 469 | 3300025913 | Ga0207695_10005021 | Ga0207695_1000502110 | 334 |
| 470 | 3300025913 | Ga0207695_10016238 | Ga0207695_100162386 | 334 |
| 471 | 3300025913 | Ga0207695_10036935 | Ga0207695_100369354 | 334 |
| 472 | 3300025913 | Ga0207695_10198971 | Ga0207695_101989712 | 334 |
| 473 | 3300025913 | Ga0207695_10202362 | Ga0207695_102023623 | 334 |
| 474 | 3300025913 | Ga0207695_10202672 | Ga0207695_102026722 | 334 |
| 475 | 3300025914 | Ga0207671_10000909 | Ga0207671_1000090928 | 334 |
| 476 | 3300025914 | Ga0207671_10001801 | Ga0207671_100018014 | 334 |
| 477 | 3300025914 | Ga0207671_10002125 | Ga0207671_1000212512 | 334 |
| 478 | 3300025914 | Ga0207671_10002229 | Ga0207671_1000222910 | 334 |
| 479 | 3300025914 | Ga0207671_10002851 | Ga0207671_100028517 | 334 |
| 480 | 3300025914 | Ga0207671_10009608 | Ga0207671_100096084 | 334 |
| 481 | 3300025914 | Ga0207671_10016783 | Ga0207671_100167833 | 334 |
| 482 | 3300025914 | Ga0207671_10054773 | Ga0207671_100547731 | 334 |
| 483 | 3300025914 | Ga0207671_10133261 | Ga0207671_101332612 | 334 |
| 484 | 3300025914 | Ga0207671_10268726 | Ga0207671_102687261 | 334 |
| 485 | 3300025917 | Ga0207660_10014210 | Ga0207660_100142106 | 334 |
| 486 | 3300025918 | Ga0207662_10018257 | Ga0207662_100182572 | 334 |
| 487 | 3300025918 | Ga0207662_10079565 | Ga0207662_100795652 | 334 |
| 488 | 3300025919 | Ga0207657_10173467 | Ga0207657_101734672 | 334 |
| 489 | 3300025920 | Ga0207649_10002117 | Ga0207649_100021174 | 334 |
| 490 | 3300025920 | Ga0207649_10108806 | Ga0207649_101088062 | 334 |
| 491 | 3300025921 | Ga0207652_10145801 | Ga0207652_101458012 | 334 |
| 492 | 3300025921 | Ga0207652_10187409 | Ga0207652_101874092 | 334 |
| 493 | 3300025923 | Ga0207681_10012383 | Ga0207681_100123834 | 334 |
| 494 | 3300025923 | Ga0207681_10048713 | Ga0207681_100487133 | 334 |
| 495 | 3300025925 | Ga0207650_10002543 | Ga0207650_100025433 | 334 |
| 496 | 3300025925 | Ga0207650_10014352 | Ga0207650_100143524 | 334 |
| 497 | 3300025925 | Ga0207650_10149598 | Ga0207650_101495982 | 334 |
| 498 | 3300025925 | Ga0207650_10150728 | Ga0207650_101507282 | 334 |
| 499 | 3300025925 | Ga0207650_10171388 | Ga0207650_101713882 | 334 |
| 500 | 3300025926 | Ga0207659_10005103 | Ga0207659_100051034 | 334 |
| 501 | 3300025926 | Ga0207659_10013848 | Ga0207659_100138483 | 334 |
| 502 | 3300025926 | Ga0207659_10021136 | Ga0207659_100211362 | 334 |
| 503 | 3300025926 | Ga0207659_10041778 | Ga0207659_100417782 | 334 |
| 504 | 3300025926 | Ga0207659_10113522 | Ga0207659_101135222 | 334 |
| 505 | 3300025931 | Ga0207644_10124474 | Ga0207644_101244742 | 334 |
| 506 | 3300025931 | Ga0207644_10197064 | Ga0207644_101970641 | 334 |
| 507 | 3300025932 | Ga0207690_10003612 | Ga0207690_100036125 | 334 |
| 508 | 3300025932 | Ga0207690_10006302 | Ga0207690_100063022 | 334 |
| 509 | 3300025932 | Ga0207690_10008351 | Ga0207690_100083518 | 334 |
| 510 | 3300025932 | Ga0207690_10123396 | Ga0207690_101233962 | 334 |
| 511 | 3300025933 | Ga0207706_10001363 | Ga0207706_100013633 | 334 |
| 512 | 3300025933 | Ga0207706_10004385 | Ga0207706_100043856 | 334 |
| 513 | 3300025933 | Ga0207706_10110110 | Ga0207706_101101102 | 334 |
| 514 | 3300025934 | Ga0207686_10000630 | Ga0207686_1000063010 | 334 |
| 515 | 3300025934 | Ga0207686_10010003 | Ga0207686_100100034 | 334 |
| 516 | 3300025934 | Ga0207686_10016556 | Ga0207686_100165563 | 334 |
| 517 | 3300025934 | Ga0207686_10073118 | Ga0207686_100731182 | 334 |
| 518 | 3300025936 | Ga0207670_10005924 | Ga0207670_100059244 | 334 |
| 519 | 3300025936 | Ga0207670_10010335 | Ga0207670_100103353 | 334 |
| 520 | 3300025936 | Ga0207670_10014227 | Ga0207670_100142273 | 334 |
| 521 | 3300025937 | Ga0207669_10040159 | Ga0207669_100401593 | 334 |
| 522 | 3300025938 | Ga0207704_10000078 | Ga0207704_1000007819 | 334 |
| 523 | 3300025938 | Ga0207704_10198340 | Ga0207704_101983401 | 334 |
| 524 | 3300025938 | Ga0207704_10290987 | Ga0207704_102909871 | 334 |
| 525 | 3300025940 | Ga0207691_10023429 | Ga0207691_100234292 | 334 |
| 526 | 3300025940 | Ga0207691_10034574 | Ga0207691_100345743 | 334 |
| 527 | 3300025942 | Ga0207689_10005094 | Ga0207689_100050948 | 334 |
| 528 | 3300025942 | Ga0207689_10005194 | Ga0207689_100051945 | 334 |
| 529 | 3300025942 | Ga0207689_10011041 | Ga0207689_100110412 | 334 |
| 530 | 3300025942 | Ga0207689_10012402 | Ga0207689_100124022 | 334 |
| 531 | 3300025942 | Ga0207689_10016035 | Ga0207689_100160353 | 334 |
| 532 | 3300025942 | Ga0207689_10017262 | Ga0207689_100172623 | 334 |
| 533 | 3300025942 | Ga0207689_10041387 | Ga0207689_100413872 | 334 |
| 534 | 3300025944 | Ga0207661_10000338 | Ga0207661_1000033821 | 334 |
| 535 | 3300025944 | Ga0207661_10164114 | Ga0207661_101641142 | 334 |
| 536 | 3300025944 | Ga0207661_10440201 | Ga0207661_104402011 | 334 |
| 537 | 3300025945 | Ga0207679_10000251 | Ga0207679_1000025127 | 334 |
| 538 | 3300025945 | Ga0207679_10034418 | Ga0207679_100344182 | 334 |
| 539 | 3300025949 | Ga0207667_10000022 | Ga0207667_10000022294 | 334 |
| 540 | 3300025949 | Ga0207667_10002632 | Ga0207667_1000263216 | 334 |
| 541 | 3300025949 | Ga0207667_10125813 | Ga0207667_101258133 | 334 |
| 542 | 3300025949 | Ga0207667_10199661 | Ga0207667_101996613 | 334 |
| 543 | 3300025960 | Ga0207651_10276098 | Ga0207651_102760981 | 334 |
| 544 | 3300025960 | Ga0207651_10292363 | Ga0207651_102923631 | 334 |
| 545 | 3300025961 | Ga0207712_10002527 | Ga0207712_1000252710 | 334 |
| 546 | 3300025961 | Ga0207712_10009920 | Ga0207712_100099203 | 334 |
| 547 | 3300025961 | Ga0207712_10012118 | Ga0207712_100121184 | 334 |
| 548 | 3300025961 | Ga0207712_10219886 | Ga0207712_102198861 | 334 |
| 549 | 3300025972 | Ga0207668_10057828 | Ga0207668_100578282 | 334 |
| 550 | 3300025981 | Ga0207640_10090812 | Ga0207640_100908122 | 334 |
| 551 | 3300025986 | Ga0207658_10045021 | Ga0207658_100450212 | 334 |
| 552 | 3300025986 | Ga0207658_10052666 | Ga0207658_100526662 | 334 |
| 553 | 3300025986 | Ga0207658_10077032 | Ga0207658_100770323 | 334 |
| 554 | 3300025986 | Ga0207658_10194235 | Ga0207658_101942352 | 334 |
| 555 | 3300025986 | Ga0207658_10310703 | Ga0207658_103107031 | 334 |
| 556 | 3300026023 | Ga0207677_10001889 | Ga0207677_100018899 | 334 |
| 557 | 3300026023 | Ga0207677_10020742 | Ga0207677_100207422 | 334 |
| 558 | 3300026023 | Ga0207677_10033981 | Ga0207677_100339812 | 334 |
| 559 | 3300026023 | Ga0207677_10111587 | Ga0207677_101115872 | 334 |
| 560 | 3300026023 | Ga0207677_10137019 | Ga0207677_101370192 | 334 |
| 561 | 3300026035 | Ga0207703_10003760 | Ga0207703_100037606 | 334 |
| 562 | 3300026035 | Ga0207703_10116577 | Ga0207703_101165773 | 334 |
| 563 | 3300026035 | Ga0207703_10426033 | Ga0207703_104260331 | 334 |
| 564 | 3300026041 | Ga0207639_10005745 | Ga0207639_100057453 | 334 |
| 565 | 3300026067 | Ga0207678_10038306 | Ga0207678_100383062 | 334 |
| 566 | 3300026075 | Ga0207708_10143798 | Ga0207708_101437981 | 334 |
| 567 | 3300026075 | Ga0207708_10192131 | Ga0207708_101921312 | 334 |
| 568 | 3300026078 | Ga0207702_10001984 | Ga0207702_100019844 | 334 |
| 569 | 3300026078 | Ga0207702_10010619 | Ga0207702_100106198 | 334 |
| 570 | 3300026078 | Ga0207702_10018669 | Ga0207702_100186694 | 334 |
| 571 | 3300026088 | Ga0207641_10000202 | Ga0207641_1000020236 | 334 |
| 572 | 3300026088 | Ga0207641_10002390 | Ga0207641_100023902 | 334 |
| 573 | 3300026089 | Ga0207648_10000472 | Ga0207648_1000047211 | 334 |
| 574 | 3300026089 | Ga0207648_10011089 | Ga0207648_100110898 | 334 |
| 575 | 3300026089 | Ga0207648_10020425 | Ga0207648_100204253 | 334 |
| 576 | 3300026089 | Ga0207648_10092732 | Ga0207648_100927322 | 334 |
| 577 | 3300026089 | Ga0207648_10109691 | Ga0207648_101096912 | 334 |
| 578 | 3300026089 | Ga0207648_10140691 | Ga0207648_101406912 | 334 |
| 579 | 3300026089 | Ga0207648_10146042 | Ga0207648_101460422 | 334 |
| 580 | 3300026089 | Ga0207648_10254388 | Ga0207648_102543882 | 334 |
| 581 | 3300026095 | Ga0207676_10039175 | Ga0207676_100391753 | 334 |
| 582 | 3300026095 | Ga0207676_10042377 | Ga0207676_100423771 | 334 |
| 583 | 3300026116 | Ga0207674_10000624 | Ga0207674_1000062420 | 334 |
| 584 | 3300026116 | Ga0207674_10009101 | Ga0207674_1000910111 | 334 |
| 585 | 3300026116 | Ga0207674_10011799 | Ga0207674_100117997 | 334 |
| 586 | 3300026116 | Ga0207674_10043117 | Ga0207674_100431172 | 334 |
| 587 | 3300026116 | Ga0207674_10047276 | Ga0207674_100472763 | 334 |
| 588 | 3300026116 | Ga0207674_10085564 | Ga0207674_100855643 | 334 |
| 589 | 3300026116 | Ga0207674_10157566 | Ga0207674_101575662 | 334 |
| 590 | 3300026116 | Ga0207674_10216554 | Ga0207674_102165541 | 334 |
| 591 | 3300026116 | Ga0207674_10295900 | Ga0207674_102959001 | 334 |
| 592 | 3300026118 | Ga0207675_100002674 | Ga0207675_1000026748 | 334 |
| 593 | 3300026118 | Ga0207675_100012863 | Ga0207675_1000128635 | 334 |
| 594 | 3300026118 | Ga0207675_100040537 | Ga0207675_1000405372 | 334 |
| 595 | 3300026118 | Ga0207675_100059014 | Ga0207675_1000590142 | 334 |
| 596 | 3300026118 | Ga0207675_100185553 | Ga0207675_1001855532 | 334 |
| 597 | 3300026118 | Ga0207675_100232551 | Ga0207675_1002325511 | 334 |
| 598 | 3300026121 | Ga0207683_10010049 | Ga0207683_100100493 | 334 |
| 599 | 3300026121 | Ga0207683_10019276 | Ga0207683_100192764 | 334 |
| 600 | 3300026121 | Ga0207683_10242793 | Ga0207683_102427932 | 334 |
| 601 | 3300026121 | Ga0207683_10462717 | Ga0207683_104627171 | 334 |
| 602 | 3300026142 | Ga0207698_10015237 | Ga0207698_100152371 | 334 |
| 603 | 3300026142 | Ga0207698_10015561 | Ga0207698_100155612 | 334 |
| 604 | 3300026142 | Ga0207698_10048691 | Ga0207698_100486913 | 334 |
| 605 | 3300026142 | Ga0207698_10169916 | Ga0207698_101699161 | 334 |
| 606 | 3300027471 | Ga0209995_1019358 | Ga0209995_10193581 | 334 |
| 607 | 3300027907 | Ga0207428_10015643 | Ga0207428_100156434 | 334 |
| 608 | 3300027907 | Ga0207428_10041009 | Ga0207428_100410094 | 334 |
| 609 | 3300027907 | Ga0207428_10199147 | Ga0207428_101991471 | 334 |
| 610 | 3300028379 | Ga0268266_10000052 | Ga0268266_10000052191 | 334 |
| 611 | 3300028379 | Ga0268266_10000057 | Ga0268266_10000057207 | 334 |
| 612 | 3300028379 | Ga0268266_10017280 | Ga0268266_100172802 | 334 |
| 613 | 3300028379 | Ga0268266_10081042 | Ga0268266_100810422 | 334 |
| 614 | 3300028380 | Ga0268265_10034260 | Ga0268265_100342602 | 334 |
| 615 | 3300028381 | Ga0268264_10002491 | Ga0268264_100024916 | 334 |
| 616 | 3300028381 | Ga0268264_10027377 | Ga0268264_100273774 | 334 |
| 617 | 3300028786 | Ga0307517_10001280 | Ga0307517_100012807 | 334 |
| 618 | 3300028786 | Ga0307517_10002277 | Ga0307517_1000227714 | 334 |
| 619 | 3300028794 | Ga0307515_10000007 | Ga0307515_10000007309 | 334 |
| 620 | 3300028794 | Ga0307515_10000076 | Ga0307515_10000076172 | 334 |
| 621 | 3300028794 | Ga0307515_10000235 | Ga0307515_1000023516 | 334 |
| 622 | 3300028794 | Ga0307515_10000280 | Ga0307515_1000028024 | 334 |
| 623 | 3300028794 | Ga0307515_10139202 | Ga0307515_101392023 | 334 |
| 624 | 3300028794 | Ga0307515_10170256 | Ga0307515_101702562 | 334 |
| 625 | 3300028800 | Ga0265338_10016034 | Ga0265338_100160342 | 334 |
| 626 | 3300028800 | Ga0265338_10105407 | Ga0265338_101054071 | 334 |
| 627 | 3300030521 | Ga0307511_10000580 | Ga0307511_1000058010 | 334 |
| 628 | 3300031251 | Ga0265327_10000101 | Ga0265327_10000101129 | 334 |
| 629 | 3300031507 | Ga0307509_10062159 | Ga0307509_100621594 | 334 |
| 630 | 3300031548 | Ga0307408_100000652 | Ga0307408_10000065226 | 334 |
| 631 | 3300031548 | Ga0307408_100007740 | Ga0307408_1000077408 | 334 |
| 632 | 3300031616 | Ga0307508_10002190 | Ga0307508_100021908 | 334 |
| 633 | 3300031649 | Ga0307514_10042682 | Ga0307514_100426822 | 334 |
| 634 | 3300031727 | Ga0316576_10036361 | Ga0316576_100363612 | 334 |
| 635 | 3300031730 | Ga0307516_10000232 | Ga0307516_1000023211 | 334 |
| 636 | 3300031730 | Ga0307516_10041064 | Ga0307516_100410643 | 334 |
| 637 | 3300031731 | Ga0307405_10020557 | Ga0307405_100205573 | 334 |
| 638 | 3300031731 | Ga0307405_10094127 | Ga0307405_100941271 | 334 |
| 639 | 3300031903 | Ga0307407_10036101 | Ga0307407_100361012 | 334 |
| 640 | 3300031903 | Ga0307407_10287271 | Ga0307407_102872711 | 334 |
| 641 | 3300031911 | Ga0307412_10009687 | Ga0307412_100096871 | 334 |
| 642 | 3300031995 | Ga0307409_100038251 | Ga0307409_1000382512 | 334 |
| 643 | 3300032002 | Ga0307416_100006444 | Ga0307416_1000064443 | 334 |
| 644 | 3300032004 | Ga0307414_10051471 | Ga0307414_100514714 | 334 |
| 645 | 3300032126 | Ga0307415_100004572 | Ga0307415_1000045724 | 334 |
| 646 | 3300033179 | Ga0307507_10000217 | Ga0307507_1000021746 | 334 |
| 647 | 3300033524 | Ga0316592_1037898 | Ga0316592_10378981 | 334 |
| 648 | 3300033528 | Ga0316588_1043791 | Ga0316588_10437911 | 334 |
| 649 | 3300033528 | Ga0316588_1044428 | Ga0316588_10444281 | 334 |
| 650 | 3300033541 | Ga0316596_1043315 | Ga0316596_10433151 | 334 |
| 651 | 3300033541 | Ga0316596_1046531 | Ga0316596_10465311 | 334 |
| 652 | 3300035724 | Ga0373933_0158769 | Ga0373933_0158769_190_1239 | 334 |
| 653 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_1296728_1297738 | 334 |
| 654 | 3300037312 | Ga0395899_0000257 | Ga0395899_0000257_60661_61668 | 334 |
| 655 | 3300037312 | Ga0395899_0000312 | Ga0395899_0000312_17300_18304 | 334 |
| 656 | 3300037312 | Ga0395899_0191567 | Ga0395899_0191567_147_1190 | 334 |
| 657 | 3300037418 | Ga0395900_0000014 | Ga0395900_0000014_34661_35665 | 334 |
| 658 | 3300037418 | Ga0395900_0004584 | Ga0395900_0004584_10746_11753 | 334 |
| 659 | 3300037418 | Ga0395900_0032708 | Ga0395900_0032708_3487_4524 | 334 |
| 660 | 3300037466 | Ga0395898_0040271 | Ga0395898_0040271_352_1359 | 334 |
| 661 | 3300037471 | Ga0395905_0000037 | Ga0395905_0000037_34651_35655 | 334 |
| 662 | 3300037471 | Ga0395905_0001831 | Ga0395905_0001831_786_1829 | 334 |
| 663 | 3300037471 | Ga0395905_0007096 | Ga0395905_0007096_5430_6437 | 334 |
| 664 | 3300038443 | Ga0395901_0000166 | Ga0395901_0000166_34515_35519 | 334 |
| 665 | 3300038443 | Ga0395901_0046840 | Ga0395901_0046840_3266_4276 | 334 |
| 666 | 3300039062 | Ga0400483_011190 | Ga0400483_011190_87051_88067 | 334 |
| 667 | 3300039062 | Ga0400483_103871 | Ga0400483_103871_5139_6299 | 334 |
| 668 | 3300039062 | Ga0400483_215675 | Ga0400483_215675_86713_87729 | 334 |
| 669 | 3300039062 | Ga0400483_267913 | Ga0400483_267913_70_1230 | 334 |
| 670 | 3300039093 | Ga0400489_43658 | Ga0400489_43658_1098_2258 | 334 |
| 671 | 3300039110 | Ga0400487_65977 | Ga0400487_65977_2777_3787 | 334 |
| 672 | 3300039447 | Ga0436361_0602515 | Ga0436361_0602515_2881_3885 | 334 |
| 673 | 3300041486 | Ga0451807_0005345 | Ga0451807_0005345_776_1816 | 334 |
| 674 | 3300042004 | Ga0439445_0042614 | Ga0439445_0042614_28_1038 | 334 |
| 675 | 3300042005 | Ga0439448_0008853 | Ga0439448_0008853_1094_2098 | 334 |
| 676 | 3300042007 | Ga0439449_0023575 | Ga0439449_0023575_1096_2106 | 334 |
| 677 | 3300042014 | Ga0439457_012416 | Ga0439457_012416_760_1770 | 334 |
| 678 | 3300042014 | Ga0439457_023734 | Ga0439457_023734_288_1331 | 334 |
| 679 | 3300042128 | Ga0450897_000713 | Ga0450897_000713_518_1528 | 334 |
| 680 | 3300042134 | Ga0450898_001336 | Ga0450898_001336_597_1607 | 334 |
| 681 | 3300042435 | Ga0439434_0012567 | Ga0439434_0012567_699_1709 | 334 |
| 682 | 3300042876 | Ga0451577_0079806 | Ga0451577_0079806_203_1216 | 334 |
| 683 | 3300044656 | Ga0466969_0053386 | Ga0466969_0053386_845_1852 | 334 |
| 684 | 3300044658 | Ga0466972_0015909 | Ga0466972_0015909_2180_3211 | 334 |
| 685 | 3300044683 | Ga0466965_0182567 | Ga0466965_0182567_25_1071 | 334 |
| 686 | 3300044693 | Ga0466961_0045211 | Ga0466961_0045211_1585_2592 | 334 |
| 687 | 3300044712 | Ga0453684_0000841 | Ga0453684_0000841_65492_66544 | 334 |
| 688 | 3300044712 | Ga0453684_0082744 | Ga0453684_0082744_2496_3509 | 334 |
| 689 | 3300044712 | Ga0453684_0726946 | Ga0453684_0726946_44_1057 | 334 |
| 690 | 3300044842 | Ga0466957_0126395 | Ga0466957_0126395_143_1174 | 334 |
| 691 | 3300045049 | Ga0466959_0025420 | Ga0466959_0025420_996_2003 | 334 |
| 692 | 3300045049 | Ga0466959_0121211 | Ga0466959_0121211_500_1561 | 334 |
| 693 | 3300045049 | Ga0466959_0137085 | Ga0466959_0137085_168_1172 | 334 |
| 694 | 3300045051 | Ga0451576_0006366 | Ga0451576_0006366_4957_6009 | 334 |
| 695 | 3300045051 | Ga0451576_0013410 | Ga0451576_0013410_5959_6972 | 334 |
| 696 | 3300045051 | Ga0451576_0026843 | Ga0451576_0026843_2548_3561 | 334 |
| 697 | 3300045051 | Ga0451576_0092878 | Ga0451576_0092878_591_1643 | 334 |
| 698 | 3300045051 | Ga0451576_0108543 | Ga0451576_0108543_749_1762 | 334 |
| 699 | 3300046460 | Ga0495638_0000005 | Ga0495638_0000005_371657_372691 | 334 |
| 700 | 3300046460 | Ga0495638_0018717 | Ga0495638_0018717_1717_2754 | 334 |
| 701 | 3300046462 | Ga0495651_0130495 | Ga0495651_0130495_633_1643 | 334 |
| 702 | 3300046471 | Ga0495650_0000087 | Ga0495650_0000087_97389_98399 | 334 |
| 703 | 3300046492 | Ga0495585_0000167 | Ga0495585_0000167_41441_42451 | 334 |
| 704 | 3300046492 | Ga0495585_0004197 | Ga0495585_0004197_3852_4862 | 334 |
| 705 | 3300046507 | Ga0495606_0000052 | Ga0495606_0000052_96303_97313 | 334 |
| 706 | 3300046507 | Ga0495606_0034414 | Ga0495606_0034414_2443_3453 | 334 |
| 707 | 3300046513 | Ga0495616_0001285 | Ga0495616_0001285_16111_17121 | 334 |
| 708 | 3300046513 | Ga0495616_0005065 | Ga0495616_0005065_4495_5505 | 334 |
| 709 | 3300046514 | Ga0495618_0208969 | Ga0495618_0208969_147_1196 | 334 |
| 710 | 3300046516 | Ga0495628_0019958 | Ga0495628_0019958_4391_5440 | 334 |
| 711 | 3300046517 | Ga0495630_0005239 | Ga0495630_0005239_1524_2573 | 334 |
| 712 | 3300046519 | Ga0495632_0070137 | Ga0495632_0070137_142_1146 | 334 |
| 713 | 3300046524 | Ga0495648_0002287 | Ga0495648_0002287_8227_9237 | 334 |
| 714 | 3300046524 | Ga0495648_0012616 | Ga0495648_0012616_2356_3390 | 334 |
| 715 | 3300046530 | Ga0495654_0030030 | Ga0495654_0030030_1093_2103 | 334 |
| 716 | 3300046536 | Ga0495587_0021739 | Ga0495587_0021739_2116_3165 | 334 |
| 717 | 3300046558 | Ga0495633_0000029 | Ga0495633_0000029_136230_137240 | 334 |
| 718 | 3300046648 | Ga0495611_0037935 | Ga0495611_0037935_206_1240 | 334 |
| 719 | 3300046660 | Ga0495625_0000008 | Ga0495625_0000008_462324_463334 | 334 |
| 720 | 3300046660 | Ga0495625_0076677 | Ga0495625_0076677_222_1226 | 334 |
| 721 | 3300046665 | Ga0495661_0000511 | Ga0495661_0000511_16480_17490 | 334 |
| 722 | 3300046678 | Ga0495599_0156618 | Ga0495599_0156618_290_1339 | 334 |
| 723 | 3300046683 | Ga0495658_0065180 | Ga0495658_0065180_329_1339 | 334 |
| 724 | 3300046692 | Ga0495671_0020496 | Ga0495671_0020496_138_1148 | 334 |
| 725 | 3300046692 | Ga0495671_0027394 | Ga0495671_0027394_1515_2525 | 334 |
| 726 | 3300046694 | Ga0495649_0000018 | Ga0495649_0000018_72831_73841 | 334 |
| 727 | 3300046810 | Ga0495660_0009229 | Ga0495660_0009229_2681_3691 | 334 |
| 728 | 3300047320 | Ga0495672_0013741 | Ga0495672_0013741_1752_2801 | 334 |
| 729 | 3300047443 | Ga0495687_000527 | Ga0495687_000527_43139_44272 | 334 |
| 730 | 3300047443 | Ga0495687_000972 | Ga0495687_000972_11593_12603 | 334 |
| 731 | 3300047472 | Ga0495686_0000052 | Ga0495686_0000052_181324_182334 | 334 |
| 732 | 3300047472 | Ga0495686_0011200 | Ga0495686_0011200_528_1538 | 334 |
| 733 | 3300047472 | Ga0495686_0055857 | Ga0495686_0055857_924_1934 | 334 |
| 734 | 3300047472 | Ga0495686_0194552 | Ga0495686_0194552_102_1112 | 334 |
| 735 | 3300048089 | Ga0495614_0007516 | Ga0495614_0007516_1897_2907 | 334 |
| 736 | 3300049127 | Ga0501306_013260 | Ga0501306_013260_22_1053 | 334 |
| 737 | 3300049128 | Ga0501308_005279 | Ga0501308_005279_230_1261 | 334 |
| 738 | 3300049129 | Ga0501309_000827 | Ga0501309_000827_10_1038 | 334 |
| 739 | 3300049130 | Ga0501310_000823 | Ga0501310_000823_16_1044 | 334 |
| 740 | 3300049160 | Ga0501304_000510 | Ga0501304_000510_1021_2049 | 334 |
| 741 | 3300049161 | Ga0501305_004876 | Ga0501305_004876_10_1038 | 334 |
| 742 | 3300049161 | Ga0501305_015207 | Ga0501305_015207_24_1055 | 334 |
| 743 | 3300049162 | Ga0501307_011201 | Ga0501307_011201_10_1038 | 334 |
| 744 | 3300049459 | Ga0495678_003683 | Ga0495678_003683_2727_3737 | 334 |
| 745 | 3300049531 | Ga0501315_012093 | Ga0501315_012093_17_1051 | 334 |
| 746 | 3300049531 | Ga0501315_012764 | Ga0501315_012764_19_1029 | 334 |
| 747 | 3300049533 | Ga0501317_012120 | Ga0501317_012120_19_1029 | 334 |
| 748 | 3300049536 | Ga0501320_000742 | Ga0501320_000742_10_1038 | 334 |
| 749 | 3300049653 | Ga0501206_003576 | Ga0501206_003576_511_1575 | 334 |
| 750 | 3300049663 | Ga0501223_002757 | Ga0501223_002757_1904_2911 | 334 |
| 751 | 3300049669 | Ga0501235_005105 | Ga0501235_005105_1521_2585 | 334 |
| 752 | 3300049686 | Ga0501257_000838 | Ga0501257_000838_2393_3421 | 334 |
| 753 | 3300049688 | Ga0501259_002994 | Ga0501259_002994_129_1193 | 334 |
| 754 | 3300049688 | Ga0501259_005521 | Ga0501259_005521_270_1298 | 334 |
| 755 | 3300049704 | Ga0501221_003139 | Ga0501221_003139_1531_2595 | 334 |
| 756 | 3300049761 | Ga0501264_000594 | Ga0501264_000594_3986_5020 | 334 |
| 757 | 3300050493 | nmdc:mga0k408_171_c1 | nmdc:mga0k408_171_c1_19194_20204 | 334 |
| 758 | 3300050493 | nmdc:mga0k408_3472_c1 | nmdc:mga0k408_3472_c1_4041_5051 | 334 |
| 759 | 3300050496 | nmdc:mga07m45_169687_c1 | nmdc:mga07m45_169687_c1_116_1126 | 334 |
| 760 | 3300050508 | nmdc:mga09592_102763_c1 | nmdc:mga09592_102763_c1_219_1262 | 334 |
| 761 | 3300050508 | nmdc:mga09592_5680_c1 | nmdc:mga09592_5680_c1_2370_3413 | 334 |
| 762 | 3300050510 | nmdc:mga06r32_30314_c1 | nmdc:mga06r32_30314_c1_950_1993 | 334 |
| 763 | 3300050511 | nmdc:mga08y16_161644_c1 | nmdc:mga08y16_161644_c1_426_1469 | 334 |
| 764 | 3300050511 | nmdc:mga08y16_29769_c1 | nmdc:mga08y16_29769_c1_2874_3884 | 334 |
| 765 | 3300050511 | nmdc:mga08y16_4421_c1 | nmdc:mga08y16_4421_c1_12158_13192 | 334 |
| 766 | 3300050512 | nmdc:mga0n895_137434_c1 | nmdc:mga0n895_137434_c1_723_1769 | 334 |
| 767 | 3300053080 | Ga0500635_0000305 | Ga0500635_0000305_13607_14617 | 334 |
| 768 | 3300053090 | Ga0500646_0007785 | Ga0500646_0007785_177_1211 | 334 |
| 769 | 3300053092 | Ga0500583_0001564 | Ga0500583_0001564_4209_5243 | 334 |
| 770 | 3300053096 | Ga0500641_0040415 | Ga0500641_0040415_713_1756 | 334 |
| 771 | 3300053104 | Ga0500556_0026068 | Ga0500556_0026068_883_1917 | 334 |
| 772 | 3300053105 | Ga0500557_001744 | Ga0500557_001744_1208_2242 | 334 |
| 773 | 3300053108 | Ga0500562_008228 | Ga0500562_008228_615_1649 | 334 |
| 774 | 3300053122 | Ga0500608_002485 | Ga0500608_002485_2045_3049 | 334 |
| 775 | 3300053125 | Ga0500618_000037 | Ga0500618_000037_108135_109145 | 334 |
| 776 | 3300053130 | Ga0500642_0033245 | Ga0500642_0033245_595_1602 | 334 |
| 777 | 3300053130 | Ga0500642_0037713 | Ga0500642_0037713_81_1115 | 334 |
| 778 | 3300053133 | Ga0500655_009797 | Ga0500655_009797_588_1625 | 334 |
| 779 | 3300053138 | Ga0500564_062773 | Ga0500564_062773_145_1155 | 334 |
| 780 | 3300053139 | Ga0500568_0004443 | Ga0500568_0004443_4685_5719 | 334 |
| 781 | 3300053153 | Ga0500616_0000003 | Ga0500616_0000003_919546_920580 | 334 |
| 782 | 3300053153 | Ga0500616_0018065 | Ga0500616_0018065_2160_3173 | 334 |
| 783 | 3300053153 | Ga0500616_0027972 | Ga0500616_0027972_1189_2223 | 334 |
| 784 | 3300053156 | Ga0500622_0000034 | Ga0500622_0000034_28792_29826 | 334 |
| 785 | 3300053156 | Ga0500622_0000235 | Ga0500622_0000235_15127_16161 | 334 |
| 786 | 3300053156 | Ga0500622_0082737 | Ga0500622_0082737_175_1185 | 334 |
| 787 | 3300053157 | Ga0500624_000554 | Ga0500624_000554_3824_4834 | 334 |
| 788 | 3300053727 | Ga0500611_000026 | Ga0500611_000026_47590_48639 | 334 |
| 789 | 3300059505 | Ga0587083_0030930 | Ga0587083_0030930_37_1044 | 334 |
| 790 | 3300059604 | Ga0587098_005387 | Ga0587098_005387_179_1237 | 334 |
| 791 | 3300059624 | Ga0587109_026989 | Ga0587109_026989_21_1037 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d3a-assembly1.cif.gz_A | crystal structure of the maize glutamine synthetase complexed with adp and methionine sulfoximine phosphate | 0.918 | 2 | 330 |
| 4bax-assembly1.cif.gz_E | crystal structure of glutamine synthetase from streptomyces coelicolor | 0.9128 | 2 | 333 |
| 7evt-assembly1.cif.gz_H | crystal structure of the n-terminal degron-truncated human glutamine synthetase | 0.909 | 2 | 330 |
| 8ecy-assembly1.cif.gz_A | cryoem structure of bovine bestrophin-2 and glutamine synthetase complex | 0.9071 | 2 | 330 |
| 7evt-assembly1.cif.gz_I | crystal structure of the n-terminal degron-truncated human glutamine synthetase | 0.9049 | 1 | 330 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2uu7A02 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain | 0.9186 | 101 | 330 | 3.30.590.10 |
| 4baxC01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain | 0.9163 | 2 | 86 | 3.10.20.70 |
| af_Q08CT3_116_307_3.30.590.10 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain | 0.9085 | 101 | 272 | 3.30.590.10 |
| 4is4B01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain | 0.9048 | 2 | 86 | 3.10.20.70 |
| af_A0A0R0LAY4_104_248_3.30.590.10 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain | 0.8898 | 106 | 215 | 3.30.590.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D1ZQP8-F1-model_v4 | glutamine synthetase (EC 6.3.1.2) (Glutamine synthetase II) | 0.9766 | 150 | 333 |
GO:0004356
GO:0005524 GO:0005737 GO:0006542 |
| AF-A0A350CFH7-F1-model_v4 | glutamine synthetase (EC 6.3.1.2) (Glutamine synthetase II) | 0.9743 | 164 | 332 |
GO:0004356
GO:0005524 GO:0005737 GO:0006542 |
| AF-A0A2E0C5M4-F1-model_v4 | glutamine synthetase (EC 6.3.1.2) (Glutamine synthetase II) | 0.9728 | 189 | 333 |
GO:0004356
GO:0005524 GO:0005737 GO:0006542 |
| AF-A0A519DG88-F1-model_v4 | Glutamine synthetase (EC 6.3.1.2) | 0.9701 | 2 | 333 |
GO:0004356
GO:0005524 GO:0005737 GO:0006542 |
| AF-A0A2N6G3C2-F1-model_v4 | Glutamine synthetase (EC 6.3.1.2) | 0.9698 | 2 | 333 |
GO:0004356
GO:0005524 GO:0005737 GO:0006542 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar