F480990

General Info

Members Datasets Scaffolds Average Seq Length
791 315 782 343

Family's Representative Sequence

Representative Sequence 3300033524|Ga0316592_1037898|Ga0316592_10378981
Length 339
Sequence MKSKLEYIWLDGTVPTQQLRSKTKIKEDFSGKLEDCPVWNFDGSSTNQSGGGKSDLLLKPVFICPDPDRKNAYLVMTEVLNADGTPHETNGRAHIEEEDDDFWFGFEQEYFIYDPQTRLPIGFPAGGFPLPQGPYYCGVGGSKAFGRQIVEEHLDMCLEAGLNVEGINAEVAAGQWEFQIFAKGAHSAGDQIWMARYLAERTAEKYGLDIEWHPKPLGKDLDWNGSGMHANFSNGLMRTCGDKKVFDTICEEFGKHIPEHIAVYGAYNDQRLTGKHETQSIDSFSYGAFDRGASIRIPVNTIEDGWKGRLEDRRPASNGDPYKIAAIIIKTTHKAVAKM

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
6 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
7 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
8 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
9 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
207 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
212 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
219 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
220 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
228 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
277 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
282 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
283 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
284 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
285 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
286 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
287 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
288 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
289 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
297 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
298 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
301 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
302 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
307 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
312 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
313 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 3.29
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.45
Nodule 0
Rhizoplane 0.38
Rhizosphere 88.24
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001094 3300001904 Bacteria 4957
2 JGI24739J22299_10019733 3300001989 Bacteria 2410
3 JGI24737J22298_10005842 3300001990 Bacteria 4238
4 JGI24737J22298_10007501 3300001990 Bacteria 3679
5 JGI24737J22298_10014505 3300001990 Bacteria 2558
6 JGI24735J21928_10000004 3300002067 Bacteria 381713
7 JGI25162J39368_1000017 3300002737 Bacteria 281385
8 JGI25162J39368_1000774 3300002737 Bacteria 21551
9 JGI25406J46586_10053471 3300003203 Bacteria 1340
10 JGI25165J46597_1002106 3300003214 Bacteria 7255
11 rootH1_10002295 3300003316 Bacteria 16572
12 rootH1_10005314 3300003316 Bacteria 25578
13 rootH2_10000120 3300003320 Bacteria 21848
14 rootH2_10005887 3300003320 Bacteria 16531
15 rootH2_10107502 3300003320 Bacteria 8852
16 rootL2_10011707 3300003322 Bacteria 5424
17 rootL2_10032383 3300003322 Bacteria 16765
18 rootL2_10051135 3300003322 Bacteria 6633
19 rootL2_10165298 3300003322 Bacteria 9047
20 rootH1_10009528 3300003323 Bacteria 31356
21 rootH1_10041936 3300003323 Bacteria 19801
22 JGI25160J50197_1000860 3300003354 Bacteria 16129
23 Ga0055531_10000026 3300003794 Bacteria 160364
24 Ga0065165_1000266 3300005262 Bacteria 90228
25 Ga0065712_10001062 3300005290 Bacteria 7585
26 Ga0065712_10102171 3300005290 Bacteria 2016
27 Ga0065712_10181277 3300005290 Bacteria 1191
28 Ga0065715_10003311 3300005293 Bacteria 4961
29 Ga0065707_10097749 3300005295 Bacteria 3146
30 Ga0070658_10000011 3300005327 Bacteria 294396
31 Ga0070676_10001127 3300005328 Bacteria 13348
32 Ga0070676_10003209 3300005328 Bacteria 8475
33 Ga0070676_10015757 3300005328 Bacteria 4170
34 Ga0070683_100000228 3300005329 Bacteria 38265
35 Ga0070683_100003644 3300005329 Bacteria 12546
36 Ga0070683_100021481 3300005329 Bacteria 5762
37 Ga0070683_100104041 3300005329 Bacteria 2676
38 Ga0070683_100117797 3300005329 Bacteria 2508
39 Ga0070690_100002371 3300005330 Bacteria 10127
40 Ga0070690_100054029 3300005330 Bacteria 2571
41 Ga0070670_100183606 3300005331 Bacteria 1816
42 Ga0068869_100006749 3300005334 Bacteria 7292
43 Ga0068869_100041953 3300005334 Bacteria 3278
44 Ga0070666_10000051 3300005335 Bacteria 99740
45 Ga0070682_100083044 3300005337 Bacteria 2078
46 Ga0070682_100107202 3300005337 Bacteria 1855
47 Ga0068868_100001454 3300005338 Bacteria 16337
48 Ga0068868_100004292 3300005338 Bacteria 9981
49 Ga0068868_100006589 3300005338 Bacteria 8232
50 Ga0068868_100015633 3300005338 Bacteria 5620
51 Ga0068868_100062232 3300005338 Bacteria 2958
52 Ga0068868_100126373 3300005338 Bacteria 2089
53 Ga0068868_100320609 3300005338 Bacteria 1320
54 Ga0070660_100160916 3300005339 Bacteria 1809
55 Ga0070689_100003291 3300005340 Bacteria 10730
56 Ga0070689_100082898 3300005340 Bacteria 2519
57 Ga0070687_100034448 3300005343 Bacteria 2507
58 Ga0070661_100000443 3300005344 Bacteria 31823
59 Ga0070661_100024402 3300005344 Bacteria 4337
60 Ga0070668_100007989 3300005347 Bacteria 7859
61 Ga0070668_100032172 3300005347 Bacteria 3992
62 Ga0070668_100118733 3300005347 Bacteria 2111
63 Ga0070669_100065404 3300005353 Bacteria 2679
64 Ga0070669_100086702 3300005353 Bacteria 2340
65 Ga0070675_100057529 3300005354 Bacteria 3206
66 Ga0070675_100136268 3300005354 Bacteria 2095
67 Ga0070675_100195735 3300005354 Bacteria 1753
68 Ga0070671_100002364 3300005355 Bacteria 14559
69 Ga0070671_100062848 3300005355 Bacteria 3091
70 Ga0070674_100055922 3300005356 Bacteria 2735
71 Ga0070674_100104360 3300005356 Bacteria 2071
72 Ga0070673_100006709 3300005364 Bacteria 7506
73 Ga0070673_100033594 3300005364 Bacteria 3876
74 Ga0070673_100043498 3300005364 Bacteria 3471
75 Ga0070673_100058801 3300005364 Bacteria 3041
76 Ga0070673_100153403 3300005364 Bacteria 1952
77 Ga0070673_100171994 3300005364 Bacteria 1849
78 Ga0070673_100217106 3300005364 Bacteria 1653
79 Ga0070688_100025601 3300005365 Bacteria 3494
80 Ga0070688_100031289 3300005365 Bacteria 3201
81 Ga0070688_100086197 3300005365 Bacteria 2043
82 Ga0070659_100001530 3300005366 Bacteria 16680
83 Ga0070659_100001700 3300005366 Bacteria 15810
84 Ga0070659_100003474 3300005366 Bacteria 11211
85 Ga0070659_100157601 3300005366 Bacteria 1855
86 Ga0070667_100010216 3300005367 Bacteria 7755
87 Ga0070667_100019342 3300005367 Bacteria 5650
88 Ga0070667_100069235 3300005367 Bacteria 3003
89 Ga0070667_100086982 3300005367 Bacteria 2682
90 Ga0070667_100106847 3300005367 Bacteria 2423
91 Ga0070667_100154764 3300005367 Bacteria 2016
92 Ga0070678_100003359 3300005456 Bacteria 8917
93 Ga0070678_100019268 3300005456 Bacteria 4444
94 Ga0070678_100022137 3300005456 Bacteria 4204
95 Ga0070662_100002245 3300005457 Bacteria 11849
96 Ga0070662_100003667 3300005457 Bacteria 9595
97 Ga0070662_100004108 3300005457 Bacteria 9146
98 Ga0070662_100010394 3300005457 Bacteria 6104
99 Ga0070681_10031571 3300005458 Bacteria 5318
100 Ga0070681_10190722 3300005458 Bacteria 1969
101 Ga0068867_100000844 3300005459 Bacteria 20625
102 Ga0068867_100012531 3300005459 Bacteria 5999
103 Ga0068867_100014377 3300005459 Bacteria 5608
104 Ga0068867_100036578 3300005459 Bacteria 3565
105 Ga0068867_100139400 3300005459 Bacteria 1894
106 Ga0068867_100161935 3300005459 Bacteria 1765
107 Ga0068867_100429299 3300005459 Bacteria 1121
108 Ga0070685_10010336 3300005466 Bacteria 4847
109 Ga0070685_10039884 3300005466 Bacteria 2670
110 Ga0070685_10240157 3300005466 Bacteria 1195
111 Ga0070698_100000297 3300005471 Bacteria 50707
112 Ga0070698_100005528 3300005471 Bacteria 13808
113 Ga0070679_100010044 3300005530 Bacteria 8966
114 Ga0070679_100153790 3300005530 Bacteria 2276
115 Ga0070684_100001378 3300005535 Bacteria 17456
116 Ga0070684_100030200 3300005535 Bacteria 4602
117 Ga0070684_100086450 3300005535 Bacteria 2783
118 Ga0070684_100208045 3300005535 Unclassified 1783
119 Ga0070684_100385862 3300005535 Bacteria 1290
120 Ga0068853_100003147 3300005539 Bacteria 12610
121 Ga0068853_100043624 3300005539 Bacteria 3837
122 Ga0068853_100048142 3300005539 Bacteria 3660
123 Ga0068853_100050373 3300005539 Bacteria 3583
124 Ga0068853_100526471 3300005539 Bacteria 1118
125 Ga0070672_100180848 3300005543 Bacteria 1757
126 Ga0070686_100069084 3300005544 Bacteria 2306
127 Ga0070686_100117277 3300005544 Bacteria 1823
128 Ga0070686_100239448 3300005544 Bacteria 1320
129 Ga0070665_100000003 3300005548 Bacteria 811857
130 Ga0070665_100047316 3300005548 Bacteria 4318
131 Ga0070665_100162423 3300005548 Bacteria 2236
132 Ga0070704_100000001 3300005549 Bacteria 193214
133 Ga0070704_100325264 3300005549 Bacteria 1290
134 Ga0068855_100000035 3300005563 Bacteria 165487
135 Ga0068855_100000506 3300005563 Bacteria 48223
136 Ga0068855_100136419 3300005563 Bacteria 2799
137 Ga0068855_100221351 3300005563 Bacteria 2122
138 Ga0070664_100000126 3300005564 Bacteria 51280
139 Ga0070664_100129068 3300005564 Bacteria 2220
140 Ga0068857_100000388 3300005577 Bacteria 30820
141 Ga0068857_100039665 3300005577 Bacteria 4172
142 Ga0068857_100041652 3300005577 Bacteria 4072
143 Ga0068857_100076485 3300005577 Bacteria 2985
144 Ga0068857_100099773 3300005577 Bacteria 2605
145 Ga0068857_100424757 3300005577 Bacteria 1240
146 Ga0068854_100025486 3300005578 Bacteria 4058
147 Ga0068854_100168955 3300005578 Bacteria 1700
148 Ga0068856_100002273 3300005614 Bacteria 19820
149 Ga0068856_100005752 3300005614 Bacteria 12217
150 Ga0068856_100016539 3300005614 Bacteria 7140
151 Ga0068856_100485027 3300005614 Bacteria 1257
152 Ga0070702_100067102 3300005615 Bacteria 2106
153 Ga0068852_100000321 3300005616 Bacteria 32639
154 Ga0068852_100000590 3300005616 Bacteria 23897
155 Ga0068852_100006413 3300005616 Bacteria 8501
156 Ga0068859_100000023 3300005617 Bacteria 221914
157 Ga0068859_100021815 3300005617 Bacteria 6422
158 Ga0068859_100034932 3300005617 Bacteria 5043
159 Ga0068859_100084110 3300005617 Bacteria 3226
160 Ga0068859_100117101 3300005617 Bacteria 2729
161 Ga0068859_100361898 3300005617 Bacteria 1546
162 Ga0068864_100001566 3300005618 Bacteria 18828
163 Ga0068864_100190720 3300005618 Bacteria 1879
164 Ga0068864_100230798 3300005618 Bacteria 1711
165 Ga0068864_100262894 3300005618 Bacteria 1606
166 Ga0068866_10007841 3300005718 Bacteria 4480
167 Ga0068861_100014197 3300005719 Bacteria 5587
168 Ga0068861_100020452 3300005719 Bacteria 4741
169 Ga0068861_100066705 3300005719 Bacteria 2775
170 Ga0068861_100180276 3300005719 Bacteria 1758
171 Ga0068851_10007740 3300005834 Bacteria 4942
172 Ga0068851_10024439 3300005834 Bacteria 2958
173 Ga0068851_10045210 3300005834 Bacteria 2225
174 Ga0068851_10079958 3300005834 Bacteria 1706
175 Ga0068870_10016650 3300005840 Bacteria 3518
176 Ga0068863_100014563 3300005841 Bacteria 7570
177 Ga0068863_100015773 3300005841 Bacteria 7254
178 Ga0068863_100047731 3300005841 Bacteria 4061
179 Ga0068863_100158227 3300005841 Bacteria 2169
180 Ga0068863_100199838 3300005841 Bacteria 1923
181 Ga0068863_100312499 3300005841 Bacteria 1525
182 Ga0068858_100004690 3300005842 Bacteria 13396
183 Ga0068858_100063280 3300005842 Bacteria 3423
184 Ga0068858_100152685 3300005842 Bacteria 2172
185 Ga0068858_100263952 3300005842 Bacteria 1637
186 Ga0068860_100000053 3300005843 Bacteria 207331
187 Ga0068860_100006137 3300005843 Bacteria 12089
188 Ga0068860_100013396 3300005843 Bacteria 8040
189 Ga0068860_100055899 3300005843 Bacteria 3752
190 Ga0068862_100087658 3300005844 Bacteria 2707
191 Ga0068862_100224322 3300005844 Bacteria 1702
192 Ga0081539_10002032 3300005985 Bacteria 30481
193 Ga0070716_100287332 3300006173 Bacteria 1138
194 Ga0075366_10000123 3300006195 Bacteria 32043
195 Ga0075366_10001829 3300006195 Bacteria 10726
196 Ga0075366_10013142 3300006195 Bacteria 4708
197 Ga0075366_10022193 3300006195 Bacteria 3692
198 Ga0075366_10119045 3300006195 Bacteria 1591
199 Ga0097621_100000020 3300006237 Bacteria 86226
200 Ga0097621_100007241 3300006237 Bacteria 7922
201 Ga0097621_100036478 3300006237 Bacteria 3933
202 Ga0097621_100096526 3300006237 Bacteria 2480
203 Ga0097621_100168801 3300006237 Bacteria 1885
204 Ga0097621_100174063 3300006237 Bacteria 1857
205 Ga0097621_100288034 3300006237 Bacteria 1447
206 Ga0075370_10159129 3300006353 Bacteria 1325
207 Ga0068871_100000130 3300006358 Bacteria 47875
208 Ga0068871_100024457 3300006358 Bacteria 4685
209 Ga0068871_100056594 3300006358 Bacteria 3188
210 Ga0068871_100133594 3300006358 Bacteria 2106
211 Ga0075428_100010125 3300006844 Bacteria 10475
212 Ga0075428_100081134 3300006844 Bacteria 3540
213 Ga0075428_100326104 3300006844 Bacteria 1649
214 Ga0075430_100001450 3300006846 Bacteria 19258
215 Ga0075431_100094982 3300006847 Bacteria 3077
216 Ga0075429_100000803 3300006880 Bacteria 24685
217 Ga0075429_100167363 3300006880 Bacteria 1925
218 Ga0068865_100000050 3300006881 Bacteria 65632
219 Ga0097620_100000023 3300006931 Bacteria 221914
220 Ga0097620_100021815 3300006931 Bacteria 6422
221 Ga0097620_100034933 3300006931 Bacteria 5043
222 Ga0097620_100084104 3300006931 Bacteria 3226
223 Ga0097620_100117099 3300006931 Bacteria 2729
224 Ga0097620_100361877 3300006931 Bacteria 1546
225 Ga0105240_10000008 3300009093 Bacteria 618862
226 Ga0105240_10000670 3300009093 Bacteria 62864
227 Ga0105240_10000728 3300009093 Bacteria 60140
228 Ga0105240_10001190 3300009093 Bacteria 45471
229 Ga0105240_10002005 3300009093 Bacteria 33578
230 Ga0105240_10002522 3300009093 Bacteria 29394
231 Ga0105240_10013576 3300009093 Bacteria 11179
232 Ga0105240_10045988 3300009093 Bacteria 5534
233 Ga0105240_10160821 3300009093 Bacteria 2667
234 Ga0105240_10193265 3300009093 Bacteria 2391
235 Ga0105240_10234492 3300009093 Bacteria 2130
236 Ga0105240_10446939 3300009093 Bacteria 1447
237 Ga0111539_10006028 3300009094 Bacteria 15661
238 Ga0111539_10009852 3300009094 Bacteria 12056
239 Ga0111539_10009875 3300009094 Bacteria 12044
240 Ga0111539_10062072 3300009094 Bacteria 4425
241 Ga0111539_10203098 3300009094 Bacteria 2311
242 Ga0111539_10289450 3300009094 Bacteria 1906
243 Ga0105247_10000662 3300009101 Bacteria 27269
244 Ga0114129_10333002 3300009147 Bacteria 2015
245 Ga0105241_10000281 3300009174 Bacteria 37919
246 Ga0105241_10001608 3300009174 Bacteria 17237
247 Ga0105241_10004819 3300009174 Bacteria 9942
248 Ga0105241_10007868 3300009174 Bacteria 7836
249 Ga0105241_10161598 3300009174 Bacteria 1842
250 Ga0105242_10002097 3300009176 Bacteria 15701
251 Ga0105242_10006335 3300009176 Bacteria 9114
252 Ga0105242_10014086 3300009176 Bacteria 6189
253 Ga0105242_10077691 3300009176 Bacteria 2769
254 Ga0105242_10078993 3300009176 Bacteria 2747
255 Ga0105242_10079545 3300009176 Bacteria 2738
256 Ga0105237_10000622 3300009545 Bacteria 49566
257 Ga0105237_10000902 3300009545 Bacteria 39969
258 Ga0105237_10003737 3300009545 Bacteria 17929
259 Ga0105237_10005252 3300009545 Bacteria 14657
260 Ga0105237_10007095 3300009545 Bacteria 12317
261 Ga0105237_10007800 3300009545 Bacteria 11668
262 Ga0105237_10007917 3300009545 Bacteria 11581
263 Ga0105237_10103018 3300009545 Bacteria 2846
264 Ga0105237_10148166 3300009545 Bacteria 2342
265 Ga0105238_10003022 3300009551 Bacteria 16794
266 Ga0105238_10233223 3300009551 Bacteria 1817
267 Ga0105249_10002624 3300009553 Bacteria 15564
268 Ga0105249_10006638 3300009553 Bacteria 10070
269 Ga0105249_10011834 3300009553 Bacteria 7669
270 Ga0105249_10020024 3300009553 Bacteria 5975
271 Ga0105249_10031174 3300009553 Bacteria 4821
272 Ga0105249_10125761 3300009553 Bacteria 2441
273 Ga0105249_10139668 3300009553 Bacteria 2322
274 Ga0105249_10213918 3300009553 Bacteria 1893
275 Ga0105239_10000002 3300010375 Bacteria 610298
276 Ga0105239_10000012 3300010375 Bacteria 332279
277 Ga0105239_10000079 3300010375 Bacteria 135513
278 Ga0105239_10000445 3300010375 Bacteria 60337
279 Ga0105239_10000959 3300010375 Bacteria 40551
280 Ga0105239_10001148 3300010375 Bacteria 36457
281 Ga0105239_10003843 3300010375 Bacteria 18238
282 Ga0105239_10012429 3300010375 Bacteria 9481
283 Ga0105239_10021418 3300010375 Bacteria 7127
284 Ga0105239_10022611 3300010375 Bacteria 6931
285 Ga0105239_10024144 3300010375 Bacteria 6697
286 Ga0105239_10032754 3300010375 Bacteria 5711
287 Ga0105239_10056002 3300010375 Bacteria 4326
288 Ga0105246_10006795 3300011119 Bacteria 6992
289 Ga0105246_10292802 3300011119 Bacteria 1311
290 Ga0157373_10001101 3300013100 Bacteria 20720
291 Ga0157373_10007899 3300013100 Bacteria 7916
292 Ga0157373_10065903 3300013100 Bacteria 2563
293 Ga0157371_10003814 3300013102 Bacteria 13473
294 Ga0157371_10008724 3300013102 Bacteria 8047
295 Ga0157371_10018949 3300013102 Bacteria 5081
296 Ga0157371_10030864 3300013102 Bacteria 3863
297 Ga0157371_10101189 3300013102 Bacteria 2044
298 Ga0157371_10109621 3300013102 Bacteria 1959
299 Ga0157371_10147338 3300013102 Bacteria 1678
300 Ga0157371_10179720 3300013102 Bacteria 1513
301 Ga0157370_10006833 3300013104 Bacteria 12505
302 Ga0157370_10082950 3300013104 Bacteria 3014
303 Ga0157370_10407795 3300013104 Bacteria 1250
304 Ga0157369_10011074 3300013105 Bacteria 10260
305 Ga0157369_10148384 3300013105 Bacteria 2479
306 Ga0157369_10163483 3300013105 Bacteria 2348
307 Ga0157369_10194401 3300013105 Bacteria 2131
308 Ga0157374_10000004 3300013296 Bacteria 759774
309 Ga0157374_10003759 3300013296 Bacteria 12757
310 Ga0157374_10006271 3300013296 Bacteria 10083
311 Ga0157374_10009183 3300013296 Bacteria 8478
312 Ga0157374_10021520 3300013296 Bacteria 5741
313 Ga0157374_10072972 3300013296 Bacteria 3239
314 Ga0157374_10079054 3300013296 Bacteria 3116
315 Ga0157374_10112153 3300013296 Bacteria 2624
316 Ga0157374_10193328 3300013296 Bacteria 1990
317 Ga0157374_10195979 3300013296 Bacteria 1977
318 Ga0157378_10072604 3300013297 Bacteria 3092
319 Ga0157378_10105500 3300013297 Bacteria 2577
320 Ga0157378_10107676 3300013297 Bacteria 2551
321 Ga0157378_10121035 3300013297 Bacteria 2413
322 Ga0157378_10161247 3300013297 Bacteria 2097
323 Ga0163162_10000031 3300013306 Bacteria 157666
324 Ga0163162_10000161 3300013306 Bacteria 62198
325 Ga0163162_10000223 3300013306 Bacteria 51991
326 Ga0163162_10008282 3300013306 Bacteria 10146
327 Ga0163162_10013375 3300013306 Bacteria 8015
328 Ga0163162_10049354 3300013306 Bacteria 4218
329 Ga0163162_10065460 3300013306 Bacteria 3682
330 Ga0163162_10076770 3300013306 Bacteria 3403
331 Ga0163162_10100926 3300013306 Bacteria 2977
332 Ga0163162_10110129 3300013306 Bacteria 2851
333 Ga0163162_10147547 3300013306 Bacteria 2469
334 Ga0163162_10192129 3300013306 Bacteria 2169
335 Ga0163162_10638904 3300013306 Bacteria 1189
336 Ga0157372_10000077 3300013307 Bacteria 102192
337 Ga0157372_10000252 3300013307 Bacteria 59348
338 Ga0157372_10000988 3300013307 Bacteria 31100
339 Ga0157372_10002075 3300013307 Bacteria 21762
340 Ga0157372_10003847 3300013307 Bacteria 16131
341 Ga0157372_10028973 3300013307 Bacteria 6041
342 Ga0157372_10052458 3300013307 Bacteria 4541
343 Ga0157372_10059053 3300013307 Bacteria 4289
344 Ga0157372_10099621 3300013307 Bacteria 3315
345 Ga0157372_10105046 3300013307 Bacteria 3230
346 Ga0157372_10247922 3300013307 Bacteria 2067
347 Ga0157375_10002968 3300013308 Bacteria 14733
348 Ga0157375_10041638 3300013308 Bacteria 4437
349 Ga0157375_10058934 3300013308 Bacteria 3801
350 Ga0157375_10149321 3300013308 Bacteria 2471
351 Ga0157375_10182536 3300013308 Bacteria 2250
352 Ga0157375_10198465 3300013308 Bacteria 2162
353 Ga0157375_10347464 3300013308 Bacteria 1649
354 Ga0157375_10583039 3300013308 Bacteria 1278
355 Ga0163163_10000176 3300014325 Bacteria 66751
356 Ga0163163_10041106 3300014325 Bacteria 4520
357 Ga0157380_10000789 3300014326 Bacteria 19895
358 Ga0157380_10009405 3300014326 Bacteria 7001
359 Ga0157380_10156305 3300014326 Bacteria 1977
360 Ga0157377_10009077 3300014745 Bacteria 4871
361 Ga0157377_10035212 3300014745 Bacteria 2745
362 Ga0157377_10041286 3300014745 Bacteria 2559
363 Ga0157377_10049547 3300014745 Bacteria 2361
364 Ga0157379_10106312 3300014968 Bacteria 2519
365 Ga0157379_10125359 3300014968 Bacteria 2311
366 Ga0157376_10011492 3300014969 Bacteria 6529
367 Ga0157376_10031069 3300014969 Bacteria 4272
368 Ga0157376_10038823 3300014969 Bacteria 3877
369 Ga0157376_10040394 3300014969 Bacteria 3813
370 Ga0157376_10048359 3300014969 Bacteria 3516
371 Ga0157376_10091728 3300014969 Bacteria 2632
372 Ga0157376_10120043 3300014969 Bacteria 2328
373 Ga0163161_10000120 3300017792 Bacteria 73632
374 Ga0163161_10001827 3300017792 Bacteria 15547
375 Ga0163161_10089666 3300017792 Bacteria 2274
376 Ga0163161_10141300 3300017792 Bacteria 1823
377 Ga0206356_10918650 3300020070 Bacteria 1085
378 Ga0206351_10778228 3300020077 Bacteria 1090
379 Ga0154015_1194800 3300020610 Bacteria 1101
380 Ga0213872_10011644 3300021361 Bacteria 4159
381 Ga0224712_10124343 3300022467 Bacteria 1120
382 Ga0207427_100171 3300025231 Bacteria 71988
383 Ga0209437_100024 3300025233 Bacteria 592878
384 Ga0209437_100052 3300025233 Bacteria 380548
385 Ga0209026_1002264 3300025250 Bacteria 7374
386 Ga0209026_1009270 3300025250 Bacteria 1950
387 Ga0209233_1000067 3300025261 Bacteria 380554
388 Ga0209233_1002449 3300025261 Bacteria 6840
389 Ga0209676_1002043 3300025292 Bacteria 15783
390 Ga0209050_1001548 3300025298 Bacteria 24081
391 Ga0209050_1026084 3300025298 Bacteria 1966
392 Ga0207426_1000009 3300025302 Bacteria 797229
393 Ga0209257_1000004 3300025304 Bacteria 1678347
394 Ga0209257_1000007 3300025304 Bacteria 1564415
395 Ga0207697_10065113 3300025315 Bacteria 1521
396 Ga0207697_10093814 3300025315 Bacteria 1274
397 Ga0207656_10010375 3300025321 Bacteria 3489
398 Ga0207656_10015168 3300025321 Bacteria 2980
399 Ga0207656_10032229 3300025321 Bacteria 2176
400 Ga0207656_10073677 3300025321 Bacteria 1522
401 Ga0207682_10046956 3300025893 Bacteria 1776
402 Ga0207642_10033726 3300025899 Bacteria 2169
403 Ga0207710_10005592 3300025900 Bacteria 5407
404 Ga0207680_10000053 3300025903 Bacteria 55149
405 Ga0207680_10026500 3300025903 Bacteria 3214
406 Ga0207680_10065172 3300025903 Bacteria 2235
407 Ga0207647_10000463 3300025904 Bacteria 32923
408 Ga0207647_10002289 3300025904 Bacteria 14588
409 Ga0207647_10041668 3300025904 Bacteria 2885
410 Ga0207647_10064384 3300025904 Bacteria 2228
411 Ga0207647_10217406 3300025904 Bacteria 1102
412 Ga0207685_10133979 3300025905 Bacteria 1103
413 Ga0207645_10000082 3300025907 Bacteria 68372
414 Ga0207645_10009123 3300025907 Bacteria 6879
415 Ga0207645_10013009 3300025907 Bacteria 5623
416 Ga0207645_10025040 3300025907 Bacteria 3863
417 Ga0207645_10056839 3300025907 Bacteria 2498
418 Ga0207643_10014774 3300025908 Bacteria 4246
419 Ga0207705_10000015 3300025909 Bacteria 382901
420 Ga0207705_10059570 3300025909 Bacteria 2756
421 Ga0207705_10321369 3300025909 Bacteria 1189
422 Ga0207654_10000422 3300025911 Bacteria 24231
423 Ga0207654_10001451 3300025911 Bacteria 12574
424 Ga0207654_10002361 3300025911 Bacteria 9675
425 Ga0207654_10022023 3300025911 Bacteria 3395
426 Ga0207654_10069331 3300025911 Bacteria 2089
427 Ga0207654_10178182 3300025911 Bacteria 1385
428 Ga0207707_10106716 3300025912 Bacteria 2448
429 Ga0207695_10000021 3300025913 Bacteria 679399
430 Ga0207695_10000039 3300025913 Bacteria 454801
431 Ga0207695_10000189 3300025913 Bacteria 177142
432 Ga0207695_10000993 3300025913 Bacteria 50217
433 Ga0207695_10003570 3300025913 Bacteria 21781
434 Ga0207695_10005021 3300025913 Bacteria 17768
435 Ga0207695_10016238 3300025913 Bacteria 8725
436 Ga0207695_10036935 3300025913 Bacteria 5275
437 Ga0207695_10198971 3300025913 Bacteria 1919
438 Ga0207695_10202362 3300025913 Bacteria 1899
439 Ga0207695_10202672 3300025913 Bacteria 1898
440 Ga0207671_10000909 3300025914 Bacteria 37375
441 Ga0207671_10001801 3300025914 Bacteria 23958
442 Ga0207671_10002125 3300025914 Bacteria 21631
443 Ga0207671_10002229 3300025914 Bacteria 21016
444 Ga0207671_10002851 3300025914 Bacteria 17936
445 Ga0207671_10009608 3300025914 Bacteria 8063
446 Ga0207671_10016783 3300025914 Bacteria 5676
447 Ga0207671_10054773 3300025914 Bacteria 2955
448 Ga0207671_10133261 3300025914 Bacteria 1909
449 Ga0207671_10268726 3300025914 Bacteria 1343
450 Ga0207660_10014210 3300025917 Bacteria 5229
451 Ga0207662_10018257 3300025918 Bacteria 3976
452 Ga0207662_10079565 3300025918 Bacteria 1997
453 Ga0207657_10173467 3300025919 Bacteria 1746
454 Ga0207649_10002117 3300025920 Bacteria 11248
455 Ga0207649_10108806 3300025920 Bacteria 1848
456 Ga0207652_10145801 3300025921 Bacteria 2119
457 Ga0207652_10187409 3300025921 Bacteria 1860
458 Ga0207681_10012383 3300025923 Bacteria 5264
459 Ga0207681_10048713 3300025923 Bacteria 2861
460 Ga0207650_10002543 3300025925 Bacteria 12643
461 Ga0207650_10014352 3300025925 Bacteria 5507
462 Ga0207650_10149598 3300025925 Bacteria 1841
463 Ga0207650_10150728 3300025925 Bacteria 1835
464 Ga0207650_10171388 3300025925 Bacteria 1725
465 Ga0207659_10005103 3300025926 Bacteria 7957
466 Ga0207659_10013848 3300025926 Bacteria 5183
467 Ga0207659_10021136 3300025926 Bacteria 4315
468 Ga0207659_10041778 3300025926 Bacteria 3212
469 Ga0207659_10113522 3300025926 Bacteria 2064
470 Ga0207644_10124474 3300025931 Bacteria 1966
471 Ga0207644_10197064 3300025931 Bacteria 1587
472 Ga0207690_10003612 3300025932 Bacteria 9206
473 Ga0207690_10006302 3300025932 Bacteria 7029
474 Ga0207690_10008351 3300025932 Bacteria 6146
475 Ga0207690_10123396 3300025932 Bacteria 1885
476 Ga0207706_10001363 3300025933 Bacteria 24429
477 Ga0207706_10004385 3300025933 Bacteria 13262
478 Ga0207706_10110110 3300025933 Bacteria 2423
479 Ga0207686_10000630 3300025934 Bacteria 21868
480 Ga0207686_10010003 3300025934 Bacteria 5157
481 Ga0207686_10016556 3300025934 Bacteria 4138
482 Ga0207686_10073118 3300025934 Bacteria 2211
483 Ga0207670_10005924 3300025936 Bacteria 6748
484 Ga0207670_10010335 3300025936 Bacteria 5370
485 Ga0207670_10014227 3300025936 Bacteria 4717
486 Ga0207669_10018626 3300025937 Bacteria 3595
487 Ga0207669_10040159 3300025937 Bacteria 2712
488 Ga0207704_10000078 3300025938 Bacteria 59491
489 Ga0207704_10198340 3300025938 Bacteria 1466
490 Ga0207704_10290987 3300025938 Bacteria 1246
491 Ga0207691_10023429 3300025940 Bacteria 5811
492 Ga0207691_10034574 3300025940 Bacteria 4698
493 Ga0207691_10077511 3300025940 Bacteria 2994
494 Ga0207689_10005094 3300025942 Bacteria 11823
495 Ga0207689_10005194 3300025942 Bacteria 11686
496 Ga0207689_10011041 3300025942 Bacteria 7764
497 Ga0207689_10012402 3300025942 Bacteria 7288
498 Ga0207689_10016035 3300025942 Bacteria 6342
499 Ga0207689_10017262 3300025942 Bacteria 6109
500 Ga0207689_10041387 3300025942 Bacteria 3812
501 Ga0207689_10044330 3300025942 Bacteria 3677
502 Ga0207661_10000338 3300025944 Bacteria 29898
503 Ga0207661_10164114 3300025944 Bacteria 1929
504 Ga0207661_10440201 3300025944 Unclassified 1186
505 Ga0207679_10000251 3300025945 Bacteria 40884
506 Ga0207679_10034418 3300025945 Bacteria 3574
507 Ga0207667_10000022 3300025949 Bacteria 369570
508 Ga0207667_10002632 3300025949 Bacteria 22201
509 Ga0207667_10125813 3300025949 Bacteria 2640
510 Ga0207667_10199661 3300025949 Bacteria 2052
511 Ga0207651_10276098 3300025960 Bacteria 1386
512 Ga0207651_10292363 3300025960 Bacteria 1351
513 Ga0207712_10002527 3300025961 Bacteria 11765
514 Ga0207712_10009920 3300025961 Bacteria 6036
515 Ga0207712_10012118 3300025961 Bacteria 5507
516 Ga0207712_10052268 3300025961 Bacteria 2861
517 Ga0207712_10219886 3300025961 Bacteria 1518
518 Ga0207668_10057828 3300025972 Bacteria 2707
519 Ga0207640_10090812 3300025981 Bacteria 2114
520 Ga0207658_10045021 3300025986 Bacteria 3215
521 Ga0207658_10052666 3300025986 Bacteria 3004
522 Ga0207658_10077032 3300025986 Bacteria 2543
523 Ga0207658_10194235 3300025986 Bacteria 1690
524 Ga0207658_10310703 3300025986 Bacteria 1361
525 Ga0207677_10001889 3300026023 Bacteria 11061
526 Ga0207677_10020742 3300026023 Bacteria 3998
527 Ga0207677_10033981 3300026023 Bacteria 3297
528 Ga0207677_10111587 3300026023 Bacteria 2038
529 Ga0207677_10137019 3300026023 Bacteria 1868
530 Ga0207703_10003760 3300026035 Bacteria 12625
531 Ga0207703_10116577 3300026035 Bacteria 2287
532 Ga0207703_10426033 3300026035 Bacteria 1235
533 Ga0207639_10005745 3300026041 Bacteria 8401
534 Ga0207678_10038306 3300026067 Bacteria 4166
535 Ga0207708_10143798 3300026075 Bacteria 1873
536 Ga0207708_10192131 3300026075 Bacteria 1625
537 Ga0207702_10001984 3300026078 Bacteria 19874
538 Ga0207702_10010619 3300026078 Bacteria 7696
539 Ga0207702_10018669 3300026078 Bacteria 5736
540 Ga0207641_10000202 3300026088 Bacteria 79668
541 Ga0207641_10002390 3300026088 Bacteria 17318
542 Ga0207648_10000472 3300026089 Bacteria 44933
543 Ga0207648_10003850 3300026089 Bacteria 15679
544 Ga0207648_10011089 3300026089 Bacteria 8505
545 Ga0207648_10020425 3300026089 Bacteria 5963
546 Ga0207648_10092732 3300026089 Bacteria 2641
547 Ga0207648_10109691 3300026089 Bacteria 2422
548 Ga0207648_10140691 3300026089 Bacteria 2126
549 Ga0207648_10146042 3300026089 Bacteria 2086
550 Ga0207648_10254388 3300026089 Bacteria 1566
551 Ga0207676_10039175 3300026095 Bacteria 3623
552 Ga0207676_10042377 3300026095 Bacteria 3501
553 Ga0207674_10000624 3300026116 Bacteria 46352
554 Ga0207674_10009101 3300026116 Bacteria 11396
555 Ga0207674_10011799 3300026116 Bacteria 9804
556 Ga0207674_10043117 3300026116 Bacteria 4654
557 Ga0207674_10047276 3300026116 Bacteria 4413
558 Ga0207674_10085564 3300026116 Bacteria 3148
559 Ga0207674_10157566 3300026116 Bacteria 2226
560 Ga0207674_10216554 3300026116 Bacteria 1863
561 Ga0207674_10295900 3300026116 Bacteria 1567
562 Ga0207675_100002674 3300026118 Bacteria 17586
563 Ga0207675_100012863 3300026118 Bacteria 7817
564 Ga0207675_100040537 3300026118 Bacteria 4349
565 Ga0207675_100059014 3300026118 Bacteria 3581
566 Ga0207675_100064221 3300026118 Bacteria 3431
567 Ga0207675_100185553 3300026118 Bacteria 1993
568 Ga0207675_100232551 3300026118 Bacteria 1779
569 Ga0207683_10010049 3300026121 Bacteria 8076
570 Ga0207683_10019276 3300026121 Bacteria 5823
571 Ga0207683_10242793 3300026121 Bacteria 1643
572 Ga0207683_10462717 3300026121 Bacteria 1170
573 Ga0207698_10015237 3300026142 Bacteria 5145
574 Ga0207698_10015561 3300026142 Bacteria 5097
575 Ga0207698_10048691 3300026142 Bacteria 3219
576 Ga0207698_10169916 3300026142 Bacteria 1918
577 Ga0209995_1019358 3300027471 Bacteria 1124
578 Ga0207428_10015643 3300027907 Bacteria 6555
579 Ga0207428_10041009 3300027907 Bacteria 3750
580 Ga0207428_10199147 3300027907 Bacteria 1507
581 Ga0268266_10000052 3300028379 Bacteria 296230
582 Ga0268266_10000057 3300028379 Bacteria 284777
583 Ga0268266_10017280 3300028379 Bacteria 6158
584 Ga0268266_10081042 3300028379 Bacteria 2829
585 Ga0268265_10034260 3300028380 Bacteria 3699
586 Ga0268265_10037951 3300028380 Bacteria 3540
587 Ga0268264_10000098 3300028381 Bacteria 229055
588 Ga0268264_10002491 3300028381 Bacteria 16192
589 Ga0268264_10027377 3300028381 Bacteria 4657
590 Ga0307517_10001280 3300028786 Bacteria 42200
591 Ga0307517_10002277 3300028786 Bacteria 30968
592 Ga0307515_10000007 3300028794 Bacteria 719669
593 Ga0307515_10000076 3300028794 Bacteria 228736
594 Ga0307515_10000235 3300028794 Bacteria 136714
595 Ga0307515_10000280 3300028794 Bacteria 125330
596 Ga0307515_10139202 3300028794 Bacteria 2615
597 Ga0307515_10170256 3300028794 Unclassified 2175
598 Ga0265338_10016034 3300028800 Bacteria 8185
599 Ga0265338_10105407 3300028800 Bacteria 2285
600 Ga0307511_10000580 3300030521 Bacteria 39130
601 Ga0265327_10000101 3300031251 Bacteria 188671
602 Ga0307509_10062159 3300031507 Bacteria 3939
603 Ga0307509_10239788 3300031507 Bacteria 1607
604 Ga0307408_100000652 3300031548 Bacteria 29132
605 Ga0307408_100007740 3300031548 Bacteria 7106
606 Ga0307508_10002190 3300031616 Bacteria 20884
607 Ga0307514_10042682 3300031649 Bacteria 3565
608 Ga0316576_10036361 3300031727 Bacteria 3520
609 Ga0307516_10000232 3300031730 Bacteria 71483
610 Ga0307516_10041064 3300031730 Bacteria 4601
611 Ga0307405_10020557 3300031731 Bacteria 3691
612 Ga0307405_10094127 3300031731 Bacteria 1992
613 Ga0307407_10036101 3300031903 Bacteria 2721
614 Ga0307407_10287271 3300031903 Bacteria 1142
615 Ga0307412_10009687 3300031911 Bacteria 5532
616 Ga0307409_100038251 3300031995 Bacteria 3547
617 Ga0307416_100006444 3300032002 Bacteria 7354
618 Ga0307414_10051471 3300032004 Bacteria 2859
619 Ga0307415_100004572 3300032126 Bacteria 7211
620 Ga0307507_10000217 3300033179 Bacteria 109884
621 Ga0316592_1037898 3300033524 Bacteria 1062
622 Ga0316588_1043791 3300033528 Bacteria 1075
623 Ga0316588_1044428 3300033528 Bacteria 1068
624 Ga0316596_1039269 3300033541 Bacteria 1242
625 Ga0316596_1043315 3300033541 Bacteria 1185
626 Ga0316596_1046531 3300033541 Bacteria 1146
627 Ga0316596_1055210 3300033541 Bacteria 1054
628 Ga0373933_0158769 3300035724 Bacteria 1435
629 Ga0316582_0064032 3300036647 Bacteria 2364
630 Ga0316584_0059444 3300036712 Bacteria 2862
631 Ga0395899_0000002 3300037312 Bacteria 1324310
632 Ga0395899_0000257 3300037312 Bacteria 69779
633 Ga0395899_0000312 3300037312 Bacteria 62304
634 Ga0395899_0191567 3300037312 Bacteria 1431
635 Ga0395900_0000014 3300037418 Bacteria 386513
636 Ga0395900_0000128 3300037418 Bacteria 127446
637 Ga0395900_0004584 3300037418 Bacteria 14585
638 Ga0395900_0032708 3300037418 Bacteria 5349
639 Ga0395898_0040271 3300037466 Bacteria 4621
640 Ga0395905_0000037 3300037471 Bacteria 261808
641 Ga0395905_0001831 3300037471 Bacteria 24563
642 Ga0395905_0007096 3300037471 Bacteria 11198
643 Ga0395901_0000166 3300038443 Bacteria 86352
644 Ga0395901_0046840 3300038443 Bacteria 4492
645 Ga0400483_011190 3300039062 Bacteria 182340
646 Ga0400483_103871 3300039062 Bacteria 25736
647 Ga0400483_215675 3300039062 Bacteria 181282
648 Ga0400483_267913 3300039062 Bacteria 7742
649 Ga0400489_43658 3300039093 Bacteria 3782
650 Ga0400487_65977 3300039110 Bacteria 5294
651 Ga0436361_0602515 3300039447 Bacteria 4188
652 Ga0451807_0005345 3300041486 Bacteria 2340
653 Ga0439445_0042614 3300042004 Bacteria 1209
654 Ga0439448_0008853 3300042005 Bacteria 2954
655 Ga0439449_0023575 3300042007 Bacteria 2301
656 Ga0439457_012416 3300042014 Bacteria 1920
657 Ga0439457_023734 3300042014 Bacteria 1357
658 Ga0450897_000713 3300042128 Bacteria 1977
659 Ga0450898_001336 3300042134 Bacteria 3223
660 Ga0439434_0012567 3300042435 Bacteria 2506
661 Ga0451577_0079806 3300042876 Bacteria 2917
662 Ga0466969_0053386 3300044656 Bacteria 1983
663 Ga0466972_0015909 3300044658 Bacteria 3761
664 Ga0466965_0182567 3300044683 Bacteria 1107
665 Ga0466961_0045211 3300044693 Bacteria 2817
666 Ga0453684_0000841 3300044712 Bacteria 103501
667 Ga0453684_0082744 3300044712 Bacteria 3997
668 Ga0453684_0726946 3300044712 Bacteria 1076
669 Ga0466957_0126395 3300044842 Bacteria 1634
670 Ga0466959_0025420 3300045049 Bacteria 4389
671 Ga0466959_0121211 3300045049 Bacteria 1859
672 Ga0466959_0137085 3300045049 Bacteria 1732
673 Ga0451576_0006366 3300045051 Bacteria 14496
674 Ga0451576_0013410 3300045051 Bacteria 9170
675 Ga0451576_0026843 3300045051 Bacteria 6188
676 Ga0451576_0092878 3300045051 Bacteria 3138
677 Ga0451576_0108543 3300045051 Bacteria 2888
678 Ga0495638_0000005 3300046460 Bacteria 680627
679 Ga0495638_0018717 3300046460 Bacteria 4595
680 Ga0495651_0130495 3300046462 Bacteria 1835
681 Ga0495650_0000087 3300046471 Bacteria 234870
682 Ga0495585_0000167 3300046492 Bacteria 70874
683 Ga0495585_0004197 3300046492 Bacteria 9409
684 Ga0495607_0013492 3300046501 Bacteria 5353
685 Ga0495606_0000052 3300046507 Bacteria 201529
686 Ga0495606_0034414 3300046507 Bacteria 3479
687 Ga0495616_0001285 3300046513 Bacteria 17645
688 Ga0495616_0005065 3300046513 Bacteria 8195
689 Ga0495618_0208969 3300046514 Bacteria 1234
690 Ga0495628_0019958 3300046516 Bacteria 5536
691 Ga0495630_0005239 3300046517 Bacteria 9140
692 Ga0495632_0070137 3300046519 Bacteria 1686
693 Ga0495648_0002287 3300046524 Bacteria 17883
694 Ga0495648_0012616 3300046524 Bacteria 6291
695 Ga0495654_0030030 3300046530 Bacteria 2768
696 Ga0495587_0021739 3300046536 Bacteria 3959
697 Ga0495645_0212432 3300046543 Bacteria 1306
698 Ga0495633_0000029 3300046558 Bacteria 200381
699 Ga0495611_0037935 3300046648 Bacteria 2142
700 Ga0495625_0000008 3300046660 Bacteria 536165
701 Ga0495625_0076677 3300046660 Bacteria 2337
702 Ga0495661_0000511 3300046665 Bacteria 40405
703 Ga0495599_0156618 3300046678 Bacteria 1409
704 Ga0495658_0065180 3300046683 Bacteria 2101
705 Ga0495671_0020496 3300046692 Bacteria 3483
706 Ga0495671_0027394 3300046692 Bacteria 2944
707 Ga0495649_0000018 3300046694 Bacteria 220586
708 Ga0495660_0009229 3300046810 Bacteria 5765
709 Ga0495672_0013741 3300047320 Bacteria 5571
710 Ga0495672_0099743 3300047320 Bacteria 1578
711 Ga0495687_000006 3300047443 Bacteria 571936
712 Ga0495687_000527 3300047443 Bacteria 45682
713 Ga0495687_000972 3300047443 Bacteria 29181
714 Ga0495686_0000052 3300047472 Bacteria 262622
715 Ga0495686_0011200 3300047472 Bacteria 6328
716 Ga0495686_0055857 3300047472 Bacteria 2468
717 Ga0495686_0194552 3300047472 Bacteria 1167
718 Ga0495614_0007516 3300048089 Bacteria 4852
719 Ga0496101_0249408 3300048904 Bacteria 1383
720 Ga0496126_0028444 3300048929 Bacteria 5327
721 Ga0501306_013260 3300049127 Bacteria 1073
722 Ga0501308_005279 3300049128 Bacteria 1280
723 Ga0501309_000827 3300049129 Bacteria 2744
724 Ga0501310_000823 3300049130 Bacteria 2759
725 Ga0501304_000510 3300049160 Bacteria 2060
726 Ga0501305_004876 3300049161 Bacteria 1599
727 Ga0501305_015207 3300049161 Bacteria 1085
728 Ga0501307_011201 3300049162 Bacteria 1050
729 Ga0495678_003683 3300049459 Bacteria 9280
730 Ga0501315_012093 3300049531 Bacteria 1062
731 Ga0501315_012764 3300049531 Bacteria 1044
732 Ga0501317_012120 3300049533 Bacteria 1060
733 Ga0501320_000742 3300049536 Bacteria 2065
734 Ga0501072_0345636 3300049588 Bacteria 1181
735 Ga0501206_003576 3300049653 Bacteria 1976
736 Ga0501223_002757 3300049663 Bacteria 3855
737 Ga0501235_005105 3300049669 Bacteria 2852
738 Ga0501257_000838 3300049686 Bacteria 6153
739 Ga0501259_002994 3300049688 Bacteria 2704
740 Ga0501259_005521 3300049688 Bacteria 2003
741 Ga0501221_003139 3300049704 Bacteria 2716
742 Ga0501225_0008563 3300049705 Bacteria 2931
743 Ga0501241_000710 3300049758 Bacteria 7167
744 Ga0501264_000594 3300049761 Bacteria 5151
745 nmdc:mga0k408_171_c1 3300050493 Bacteria 34186
746 nmdc:mga0k408_3472_c1 3300050493 Bacteria 8343
747 nmdc:mga0k408_563_c2 3300050493 Bacteria 17614
748 nmdc:mga07m45_169687_c1 3300050496 Bacteria 1268
749 nmdc:mga09592_102763_c1 3300050508 Bacteria 2449
750 nmdc:mga09592_5680_c1 3300050508 Bacteria 10174
751 nmdc:mga06r32_30314_c1 3300050510 Bacteria 5075
752 nmdc:mga08y16_161644_c1 3300050511 Bacteria 2327
753 nmdc:mga08y16_29769_c1 3300050511 Bacteria 5749
754 nmdc:mga08y16_4421_c1 3300050511 Bacteria 14687
755 nmdc:mga0n895_137434_c1 3300050512 Bacteria 2471
756 Ga0500635_0000305 3300053080 Bacteria 17216
757 Ga0500646_0007785 3300053090 Bacteria 2738
758 Ga0500583_0001564 3300053092 Bacteria 6621
759 Ga0500641_0040415 3300053096 Bacteria 1883
760 Ga0500556_0026068 3300053104 Bacteria 1938
761 Ga0500557_001744 3300053105 Bacteria 3711
762 Ga0500562_008228 3300053108 Bacteria 2633
763 Ga0500608_002485 3300053122 Bacteria 6714
764 Ga0500618_000037 3300053125 Bacteria 117320
765 Ga0500642_0033245 3300053130 Bacteria 2171
766 Ga0500642_0037713 3300053130 Bacteria 2067
767 Ga0500655_009797 3300053133 Bacteria 1730
768 Ga0500564_062773 3300053138 Bacteria 1683
769 Ga0500568_0000346 3300053139 Bacteria 36068
770 Ga0500568_0004443 3300053139 Bacteria 7493
771 Ga0500616_0000003 3300053153 Bacteria 1220687
772 Ga0500616_0018065 3300053153 Bacteria 3991
773 Ga0500616_0027972 3300053153 Bacteria 3110
774 Ga0500622_0000034 3300053156 Bacteria 187647
775 Ga0500622_0000235 3300053156 Bacteria 57565
776 Ga0500622_0000639 3300053156 Bacteria 31329
777 Ga0500622_0082737 3300053156 Bacteria 1605
778 Ga0500624_000554 3300053157 Bacteria 10469
779 Ga0500611_000026 3300053727 Bacteria 96342
780 Ga0587083_0030930 3300059505 Bacteria 1065
781 Ga0587098_005387 3300059604 Bacteria 1253
782 Ga0587109_026989 3300059624 Bacteria 1065

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0345636 Ga0501072_0345636_172_1158 320
2 3300049705 Ga0501225_0008563 Ga0501225_0008563_1893_2909 320
3 3300033541 Ga0316596_1055210 Ga0316596_10552101 325
4 3300033541 Ga0316596_1039269 Ga0316596_10392692 327
5 3300036647 Ga0316582_0064032 Ga0316582_0064032_1013_2023 327
6 3300036712 Ga0316584_0059444 Ga0316584_0059444_677_1687 327
7 3300046543 Ga0495645_0212432 Ga0495645_0212432_127_1188 327
8 3300005843 Ga0068860_100000053 Ga0068860_100000053114 329
9 3300009553 Ga0105249_10125761 Ga0105249_101257611 329
10 3300013306 Ga0163162_10000223 Ga0163162_1000022341 329
11 3300025961 Ga0207712_10052268 Ga0207712_100522684 329
12 3300028381 Ga0268264_10000098 Ga0268264_10000098112 329
13 3300047443 Ga0495687_000006 Ga0495687_000006_401602_402636 329
14 iso_pu_bacteria 2599185184 2599478257 331
15 iso_pu_bacteria 2852623160 2852623783 331
16 iso_pu_bacteria 2884933994 2884937311 331
17 iso_pu_bacteria 2919437846 2919438947 331
18 iso_pu_bacteria 2928078545 2928080693 331
19 iso_pu_bacteria 2928147474 2928150918 331
20 iso_pu_bacteria 2932082852 2932082923 331
21 iso_pu_bacteria 2977232053 2977235874 331
22 3300005356 Ga0070674_100055922 Ga0070674_1000559223 332
23 3300005459 Ga0068867_100014377 Ga0068867_1000143772 332
24 3300005617 Ga0068859_100361898 Ga0068859_1003618981 332
25 3300005844 Ga0068862_100087658 Ga0068862_1000876582 332
26 3300006931 Ga0097620_100361877 Ga0097620_1003618771 332
27 3300009176 Ga0105242_10079545 Ga0105242_100795452 332
28 3300025907 Ga0207645_10056839 Ga0207645_100568391 332
29 3300025937 Ga0207669_10018626 Ga0207669_100186262 332
30 3300025942 Ga0207689_10044330 Ga0207689_100443302 332
31 3300026089 Ga0207648_10003850 Ga0207648_100038504 332
32 3300026118 Ga0207675_100064221 Ga0207675_1000642212 332
33 3300028380 Ga0268265_10037951 Ga0268265_100379512 332
34 iso_pu_bacteria 2522125168 2522551501 332
35 3300003322 rootL2_10011707 rootL2_100117074 333
36 3300003794 Ga0055531_10000026 Ga0055531_10000026136 333
37 3300005539 Ga0068853_100526471 Ga0068853_1005264711 333
38 3300006195 Ga0075366_10001829 Ga0075366_100018292 333
39 3300013100 Ga0157373_10007899 Ga0157373_100078993 333
40 3300013306 Ga0163162_10065460 Ga0163162_100654605 333
41 3300013308 Ga0157375_10347464 Ga0157375_103474642 333
42 3300017792 Ga0163161_10000120 Ga0163161_1000012058 333
43 3300025304 Ga0209257_1000004 Ga0209257_1000004872 333
44 3300025940 Ga0207691_10077511 Ga0207691_100775113 333
45 3300031507 Ga0307509_10239788 Ga0307509_102397882 333
46 3300037418 Ga0395900_0000128 Ga0395900_0000128_81157_82161 333
47 3300046501 Ga0495607_0013492 Ga0495607_0013492_3874_4884 333
48 3300047320 Ga0495672_0099743 Ga0495672_0099743_396_1454 333
49 3300048904 Ga0496101_0249408 Ga0496101_0249408_139_1143 333
50 3300048929 Ga0496126_0028444 Ga0496126_0028444_1026_2030 333
51 3300049758 Ga0501241_000710 Ga0501241_000710_5192_6199 333
52 3300050493 nmdc:mga0k408_563_c2 nmdc:mga0k408_563_c2_4081_5088 333
53 3300053139 Ga0500568_0000346 Ga0500568_0000346_31128_32168 333
54 3300053156 Ga0500622_0000639 Ga0500622_0000639_30202_31209 333
55 3300001904 JGI24736J21556_1001094 JGI24736J21556_10010945 334
56 3300001989 JGI24739J22299_10019733 JGI24739J22299_100197332 334
57 3300001990 JGI24737J22298_10005842 JGI24737J22298_100058423 334
58 3300001990 JGI24737J22298_10007501 JGI24737J22298_100075013 334
59 3300001990 JGI24737J22298_10014505 JGI24737J22298_100145052 334
60 3300002067 JGI24735J21928_10000004 JGI24735J21928_10000004181 334
61 3300002737 JGI25162J39368_1000017 JGI25162J39368_100001796 334
62 3300002737 JGI25162J39368_1000774 JGI25162J39368_100077412 334
63 3300003203 JGI25406J46586_10053471 JGI25406J46586_100534711 334
64 3300003214 JGI25165J46597_1002106 JGI25165J46597_10021065 334
65 3300003316 rootH1_10002295 rootH1_100022958 334
66 3300003316 rootH1_10005314 rootH1_1000531427 334
67 3300003320 rootH2_10000120 rootH2_100001201 334
68 3300003320 rootH2_10005887 rootH2_100058879 334
69 3300003320 rootH2_10107502 rootH2_101075024 334
70 3300003322 rootL2_10032383 rootL2_1003238314 334
71 3300003322 rootL2_10051135 rootL2_100511354 334
72 3300003322 rootL2_10165298 rootL2_101652987 334
73 3300003323 rootH1_10009528 rootH1_100095286 334
74 3300003323 rootH1_10041936 rootH1_1004193617 334
75 3300003354 JGI25160J50197_1000860 JGI25160J50197_10008606 334
76 3300005262 Ga0065165_1000266 Ga0065165_100026647 334
77 3300005290 Ga0065712_10001062 Ga0065712_100010625 334
78 3300005290 Ga0065712_10102171 Ga0065712_101021712 334
79 3300005290 Ga0065712_10181277 Ga0065712_101812771 334
80 3300005293 Ga0065715_10003311 Ga0065715_100033113 334
81 3300005295 Ga0065707_10097749 Ga0065707_100977492 334
82 3300005327 Ga0070658_10000011 Ga0070658_10000011114 334
83 3300005328 Ga0070676_10001127 Ga0070676_100011277 334
84 3300005328 Ga0070676_10003209 Ga0070676_100032092 334
85 3300005328 Ga0070676_10015757 Ga0070676_100157572 334
86 3300005329 Ga0070683_100000228 Ga0070683_10000022814 334
87 3300005329 Ga0070683_100003644 Ga0070683_1000036448 334
88 3300005329 Ga0070683_100021481 Ga0070683_1000214812 334
89 3300005329 Ga0070683_100104041 Ga0070683_1001040411 334
90 3300005329 Ga0070683_100117797 Ga0070683_1001177971 334
91 3300005330 Ga0070690_100002371 Ga0070690_1000023715 334
92 3300005330 Ga0070690_100054029 Ga0070690_1000540291 334
93 3300005331 Ga0070670_100183606 Ga0070670_1001836062 334
94 3300005334 Ga0068869_100006749 Ga0068869_1000067493 334
95 3300005334 Ga0068869_100041953 Ga0068869_1000419532 334
96 3300005335 Ga0070666_10000051 Ga0070666_1000005184 334
97 3300005337 Ga0070682_100083044 Ga0070682_1000830441 334
98 3300005337 Ga0070682_100107202 Ga0070682_1001072021 334
99 3300005338 Ga0068868_100001454 Ga0068868_10000145411 334
100 3300005338 Ga0068868_100004292 Ga0068868_1000042922 334
101 3300005338 Ga0068868_100006589 Ga0068868_1000065894 334
102 3300005338 Ga0068868_100015633 Ga0068868_1000156332 334
103 3300005338 Ga0068868_100062232 Ga0068868_1000622321 334
104 3300005338 Ga0068868_100126373 Ga0068868_1001263732 334
105 3300005338 Ga0068868_100320609 Ga0068868_1003206091 334
106 3300005339 Ga0070660_100160916 Ga0070660_1001609162 334
107 3300005340 Ga0070689_100003291 Ga0070689_1000032916 334
108 3300005340 Ga0070689_100082898 Ga0070689_1000828982 334
109 3300005343 Ga0070687_100034448 Ga0070687_1000344481 334
110 3300005344 Ga0070661_100000443 Ga0070661_1000004434 334
111 3300005344 Ga0070661_100024402 Ga0070661_1000244023 334
112 3300005347 Ga0070668_100007989 Ga0070668_1000079892 334
113 3300005347 Ga0070668_100032172 Ga0070668_1000321722 334
114 3300005347 Ga0070668_100118733 Ga0070668_1001187332 334
115 3300005353 Ga0070669_100065404 Ga0070669_1000654042 334
116 3300005353 Ga0070669_100086702 Ga0070669_1000867021 334
117 3300005354 Ga0070675_100057529 Ga0070675_1000575292 334
118 3300005354 Ga0070675_100136268 Ga0070675_1001362682 334
119 3300005354 Ga0070675_100195735 Ga0070675_1001957352 334
120 3300005355 Ga0070671_100002364 Ga0070671_10000236411 334
121 3300005355 Ga0070671_100062848 Ga0070671_1000628482 334
122 3300005356 Ga0070674_100104360 Ga0070674_1001043602 334
123 3300005364 Ga0070673_100006709 Ga0070673_1000067091 334
124 3300005364 Ga0070673_100033594 Ga0070673_1000335941 334
125 3300005364 Ga0070673_100043498 Ga0070673_1000434983 334
126 3300005364 Ga0070673_100058801 Ga0070673_1000588012 334
127 3300005364 Ga0070673_100153403 Ga0070673_1001534031 334
128 3300005364 Ga0070673_100171994 Ga0070673_1001719941 334
129 3300005364 Ga0070673_100217106 Ga0070673_1002171062 334
130 3300005365 Ga0070688_100025601 Ga0070688_1000256012 334
131 3300005365 Ga0070688_100031289 Ga0070688_1000312892 334
132 3300005365 Ga0070688_100086197 Ga0070688_1000861972 334
133 3300005366 Ga0070659_100001530 Ga0070659_1000015305 334
134 3300005366 Ga0070659_100001700 Ga0070659_10000170010 334
135 3300005366 Ga0070659_100003474 Ga0070659_1000034742 334
136 3300005366 Ga0070659_100157601 Ga0070659_1001576012 334
137 3300005367 Ga0070667_100010216 Ga0070667_1000102165 334
138 3300005367 Ga0070667_100019342 Ga0070667_1000193422 334
139 3300005367 Ga0070667_100069235 Ga0070667_1000692352 334
140 3300005367 Ga0070667_100086982 Ga0070667_1000869822 334
141 3300005367 Ga0070667_100106847 Ga0070667_1001068472 334
142 3300005367 Ga0070667_100154764 Ga0070667_1001547642 334
143 3300005456 Ga0070678_100003359 Ga0070678_1000033593 334
144 3300005456 Ga0070678_100019268 Ga0070678_1000192681 334
145 3300005456 Ga0070678_100022137 Ga0070678_1000221375 334
146 3300005457 Ga0070662_100002245 Ga0070662_10000224512 334
147 3300005457 Ga0070662_100003667 Ga0070662_1000036678 334
148 3300005457 Ga0070662_100004108 Ga0070662_1000041082 334
149 3300005457 Ga0070662_100010394 Ga0070662_1000103943 334
150 3300005458 Ga0070681_10031571 Ga0070681_100315713 334
151 3300005458 Ga0070681_10190722 Ga0070681_101907221 334
152 3300005459 Ga0068867_100000844 Ga0068867_10000084410 334
153 3300005459 Ga0068867_100012531 Ga0068867_1000125313 334
154 3300005459 Ga0068867_100036578 Ga0068867_1000365782 334
155 3300005459 Ga0068867_100139400 Ga0068867_1001394002 334
156 3300005459 Ga0068867_100161935 Ga0068867_1001619351 334
157 3300005459 Ga0068867_100429299 Ga0068867_1004292991 334
158 3300005466 Ga0070685_10010336 Ga0070685_100103364 334
159 3300005466 Ga0070685_10039884 Ga0070685_100398842 334
160 3300005466 Ga0070685_10240157 Ga0070685_102401571 334
161 3300005471 Ga0070698_100000297 Ga0070698_10000029715 334
162 3300005471 Ga0070698_100005528 Ga0070698_1000055283 334
163 3300005530 Ga0070679_100010044 Ga0070679_1000100446 334
164 3300005530 Ga0070679_100153790 Ga0070679_1001537902 334
165 3300005535 Ga0070684_100001378 Ga0070684_10000137811 334
166 3300005535 Ga0070684_100030200 Ga0070684_1000302002 334
167 3300005535 Ga0070684_100086450 Ga0070684_1000864502 334
168 3300005535 Ga0070684_100208045 Ga0070684_1002080452 334
169 3300005535 Ga0070684_100385862 Ga0070684_1003858621 334
170 3300005539 Ga0068853_100003147 Ga0068853_10000314710 334
171 3300005539 Ga0068853_100043624 Ga0068853_1000436244 334
172 3300005539 Ga0068853_100048142 Ga0068853_1000481423 334
173 3300005539 Ga0068853_100050373 Ga0068853_1000503732 334
174 3300005543 Ga0070672_100180848 Ga0070672_1001808481 334
175 3300005544 Ga0070686_100069084 Ga0070686_1000690841 334
176 3300005544 Ga0070686_100117277 Ga0070686_1001172772 334
177 3300005544 Ga0070686_100239448 Ga0070686_1002394481 334
178 3300005548 Ga0070665_100000003 Ga0070665_100000003599 334
179 3300005548 Ga0070665_100047316 Ga0070665_1000473164 334
180 3300005548 Ga0070665_100162423 Ga0070665_1001624232 334
181 3300005549 Ga0070704_100000001 Ga0070704_100000001176 334
182 3300005549 Ga0070704_100325264 Ga0070704_1003252641 334
183 3300005563 Ga0068855_100000035 Ga0068855_100000035127 334
184 3300005563 Ga0068855_100000506 Ga0068855_10000050646 334
185 3300005563 Ga0068855_100136419 Ga0068855_1001364193 334
186 3300005563 Ga0068855_100221351 Ga0068855_1002213513 334
187 3300005564 Ga0070664_100000126 Ga0070664_10000012617 334
188 3300005564 Ga0070664_100129068 Ga0070664_1001290681 334
189 3300005577 Ga0068857_100000388 Ga0068857_1000003888 334
190 3300005577 Ga0068857_100039665 Ga0068857_1000396653 334
191 3300005577 Ga0068857_100041652 Ga0068857_1000416523 334
192 3300005577 Ga0068857_100076485 Ga0068857_1000764851 334
193 3300005577 Ga0068857_100099773 Ga0068857_1000997733 334
194 3300005577 Ga0068857_100424757 Ga0068857_1004247571 334
195 3300005578 Ga0068854_100025486 Ga0068854_1000254862 334
196 3300005578 Ga0068854_100168955 Ga0068854_1001689551 334
197 3300005614 Ga0068856_100002273 Ga0068856_1000022734 334
198 3300005614 Ga0068856_100005752 Ga0068856_1000057528 334
199 3300005614 Ga0068856_100016539 Ga0068856_1000165394 334
200 3300005614 Ga0068856_100485027 Ga0068856_1004850271 334
201 3300005615 Ga0070702_100067102 Ga0070702_1000671022 334
202 3300005616 Ga0068852_100000321 Ga0068852_10000032113 334
203 3300005616 Ga0068852_100000590 Ga0068852_10000059014 334
204 3300005616 Ga0068852_100006413 Ga0068852_1000064132 334
205 3300005617 Ga0068859_100000023 Ga0068859_100000023162 334
206 3300005617 Ga0068859_100021815 Ga0068859_1000218152 334
207 3300005617 Ga0068859_100034932 Ga0068859_1000349323 334
208 3300005617 Ga0068859_100084110 Ga0068859_1000841102 334
209 3300005617 Ga0068859_100117101 Ga0068859_1001171014 334
210 3300005618 Ga0068864_100001566 Ga0068864_1000015666 334
211 3300005618 Ga0068864_100190720 Ga0068864_1001907202 334
212 3300005618 Ga0068864_100230798 Ga0068864_1002307981 334
213 3300005618 Ga0068864_100262894 Ga0068864_1002628942 334
214 3300005718 Ga0068866_10007841 Ga0068866_100078413 334
215 3300005719 Ga0068861_100014197 Ga0068861_1000141973 334
216 3300005719 Ga0068861_100020452 Ga0068861_1000204522 334
217 3300005719 Ga0068861_100066705 Ga0068861_1000667052 334
218 3300005719 Ga0068861_100180276 Ga0068861_1001802762 334
219 3300005834 Ga0068851_10007740 Ga0068851_100077402 334
220 3300005834 Ga0068851_10024439 Ga0068851_100244391 334
221 3300005834 Ga0068851_10045210 Ga0068851_100452102 334
222 3300005834 Ga0068851_10079958 Ga0068851_100799583 334
223 3300005840 Ga0068870_10016650 Ga0068870_100166504 334
224 3300005841 Ga0068863_100014563 Ga0068863_1000145636 334
225 3300005841 Ga0068863_100015773 Ga0068863_1000157732 334
226 3300005841 Ga0068863_100047731 Ga0068863_1000477312 334
227 3300005841 Ga0068863_100158227 Ga0068863_1001582271 334
228 3300005841 Ga0068863_100199838 Ga0068863_1001998382 334
229 3300005841 Ga0068863_100312499 Ga0068863_1003124991 334
230 3300005842 Ga0068858_100004690 Ga0068858_1000046907 334
231 3300005842 Ga0068858_100063280 Ga0068858_1000632803 334
232 3300005842 Ga0068858_100152685 Ga0068858_1001526852 334
233 3300005842 Ga0068858_100263952 Ga0068858_1002639522 334
234 3300005843 Ga0068860_100006137 Ga0068860_1000061379 334
235 3300005843 Ga0068860_100013396 Ga0068860_1000133962 334
236 3300005843 Ga0068860_100055899 Ga0068860_1000558992 334
237 3300005844 Ga0068862_100224322 Ga0068862_1002243222 334
238 3300005985 Ga0081539_10002032 Ga0081539_1000203224 334
239 3300006173 Ga0070716_100287332 Ga0070716_1002873321 334
240 3300006195 Ga0075366_10000123 Ga0075366_1000012322 334
241 3300006195 Ga0075366_10013142 Ga0075366_100131424 334
242 3300006195 Ga0075366_10022193 Ga0075366_100221932 334
243 3300006195 Ga0075366_10119045 Ga0075366_101190452 334
244 3300006237 Ga0097621_100000020 Ga0097621_10000002064 334
245 3300006237 Ga0097621_100007241 Ga0097621_1000072414 334
246 3300006237 Ga0097621_100036478 Ga0097621_1000364783 334
247 3300006237 Ga0097621_100096526 Ga0097621_1000965262 334
248 3300006237 Ga0097621_100168801 Ga0097621_1001688012 334
249 3300006237 Ga0097621_100174063 Ga0097621_1001740633 334
250 3300006237 Ga0097621_100288034 Ga0097621_1002880342 334
251 3300006353 Ga0075370_10159129 Ga0075370_101591291 334
252 3300006358 Ga0068871_100000130 Ga0068871_10000013010 334
253 3300006358 Ga0068871_100024457 Ga0068871_1000244573 334
254 3300006358 Ga0068871_100056594 Ga0068871_1000565942 334
255 3300006358 Ga0068871_100133594 Ga0068871_1001335942 334
256 3300006844 Ga0075428_100010125 Ga0075428_1000101258 334
257 3300006844 Ga0075428_100081134 Ga0075428_1000811342 334
258 3300006844 Ga0075428_100326104 Ga0075428_1003261042 334
259 3300006846 Ga0075430_100001450 Ga0075430_1000014502 334
260 3300006847 Ga0075431_100094982 Ga0075431_1000949822 334
261 3300006880 Ga0075429_100000803 Ga0075429_1000008032 334
262 3300006880 Ga0075429_100167363 Ga0075429_1001673632 334
263 3300006881 Ga0068865_100000050 Ga0068865_10000005041 334
264 3300006931 Ga0097620_100000023 Ga0097620_100000023162 334
265 3300006931 Ga0097620_100021815 Ga0097620_1000218152 334
266 3300006931 Ga0097620_100034933 Ga0097620_1000349333 334
267 3300006931 Ga0097620_100084104 Ga0097620_1000841042 334
268 3300006931 Ga0097620_100117099 Ga0097620_1001170994 334
269 3300009093 Ga0105240_10000008 Ga0105240_10000008339 334
270 3300009093 Ga0105240_10000670 Ga0105240_1000067023 334
271 3300009093 Ga0105240_10000728 Ga0105240_1000072823 334
272 3300009093 Ga0105240_10001190 Ga0105240_1000119035 334
273 3300009093 Ga0105240_10002005 Ga0105240_1000200529 334
274 3300009093 Ga0105240_10002522 Ga0105240_100025228 334
275 3300009093 Ga0105240_10013576 Ga0105240_100135762 334
276 3300009093 Ga0105240_10045988 Ga0105240_100459886 334
277 3300009093 Ga0105240_10160821 Ga0105240_101608213 334
278 3300009093 Ga0105240_10193265 Ga0105240_101932652 334
279 3300009093 Ga0105240_10234492 Ga0105240_102344922 334
280 3300009093 Ga0105240_10446939 Ga0105240_104469391 334
281 3300009094 Ga0111539_10006028 Ga0111539_100060285 334
282 3300009094 Ga0111539_10009852 Ga0111539_100098529 334
283 3300009094 Ga0111539_10009875 Ga0111539_100098752 334
284 3300009094 Ga0111539_10062072 Ga0111539_100620722 334
285 3300009094 Ga0111539_10203098 Ga0111539_102030981 334
286 3300009094 Ga0111539_10289450 Ga0111539_102894502 334
287 3300009101 Ga0105247_10000662 Ga0105247_100006626 334
288 3300009147 Ga0114129_10333002 Ga0114129_103330022 334
289 3300009174 Ga0105241_10000281 Ga0105241_1000028119 334
290 3300009174 Ga0105241_10001608 Ga0105241_100016088 334
291 3300009174 Ga0105241_10004819 Ga0105241_100048193 334
292 3300009174 Ga0105241_10007868 Ga0105241_100078686 334
293 3300009174 Ga0105241_10161598 Ga0105241_101615982 334
294 3300009176 Ga0105242_10002097 Ga0105242_100020973 334
295 3300009176 Ga0105242_10006335 Ga0105242_100063354 334
296 3300009176 Ga0105242_10014086 Ga0105242_100140861 334
297 3300009176 Ga0105242_10077691 Ga0105242_100776912 334
298 3300009176 Ga0105242_10078993 Ga0105242_100789932 334
299 3300009545 Ga0105237_10000622 Ga0105237_1000062233 334
300 3300009545 Ga0105237_10000902 Ga0105237_1000090222 334
301 3300009545 Ga0105237_10003737 Ga0105237_100037375 334
302 3300009545 Ga0105237_10005252 Ga0105237_100052522 334
303 3300009545 Ga0105237_10007095 Ga0105237_1000709511 334
304 3300009545 Ga0105237_10007800 Ga0105237_100078008 334
305 3300009545 Ga0105237_10007917 Ga0105237_100079179 334
306 3300009545 Ga0105237_10103018 Ga0105237_101030181 334
307 3300009545 Ga0105237_10148166 Ga0105237_101481661 334
308 3300009551 Ga0105238_10003022 Ga0105238_100030221 334
309 3300009551 Ga0105238_10233223 Ga0105238_102332231 334
310 3300009553 Ga0105249_10002624 Ga0105249_1000262410 334
311 3300009553 Ga0105249_10006638 Ga0105249_100066383 334
312 3300009553 Ga0105249_10011834 Ga0105249_100118347 334
313 3300009553 Ga0105249_10020024 Ga0105249_100200243 334
314 3300009553 Ga0105249_10031174 Ga0105249_100311744 334
315 3300009553 Ga0105249_10139668 Ga0105249_101396681 334
316 3300009553 Ga0105249_10213918 Ga0105249_102139183 334
317 3300010375 Ga0105239_10000002 Ga0105239_10000002257 334
318 3300010375 Ga0105239_10000012 Ga0105239_10000012175 334
319 3300010375 Ga0105239_10000079 Ga0105239_1000007978 334
320 3300010375 Ga0105239_10000445 Ga0105239_1000044544 334
321 3300010375 Ga0105239_10000959 Ga0105239_100009596 334
322 3300010375 Ga0105239_10001148 Ga0105239_1000114811 334
323 3300010375 Ga0105239_10003843 Ga0105239_100038435 334
324 3300010375 Ga0105239_10012429 Ga0105239_100124295 334
325 3300010375 Ga0105239_10021418 Ga0105239_100214185 334
326 3300010375 Ga0105239_10022611 Ga0105239_100226112 334
327 3300010375 Ga0105239_10024144 Ga0105239_100241445 334
328 3300010375 Ga0105239_10032754 Ga0105239_100327543 334
329 3300010375 Ga0105239_10056002 Ga0105239_100560025 334
330 3300011119 Ga0105246_10006795 Ga0105246_100067956 334
331 3300011119 Ga0105246_10292802 Ga0105246_102928021 334
332 3300013100 Ga0157373_10001101 Ga0157373_1000110111 334
333 3300013100 Ga0157373_10065903 Ga0157373_100659033 334
334 3300013102 Ga0157371_10003814 Ga0157371_1000381411 334
335 3300013102 Ga0157371_10008724 Ga0157371_100087246 334
336 3300013102 Ga0157371_10018949 Ga0157371_100189492 334
337 3300013102 Ga0157371_10030864 Ga0157371_100308641 334
338 3300013102 Ga0157371_10101189 Ga0157371_101011892 334
339 3300013102 Ga0157371_10109621 Ga0157371_101096212 334
340 3300013102 Ga0157371_10147338 Ga0157371_101473381 334
341 3300013102 Ga0157371_10179720 Ga0157371_101797202 334
342 3300013104 Ga0157370_10006833 Ga0157370_100068339 334
343 3300013104 Ga0157370_10082950 Ga0157370_100829502 334
344 3300013104 Ga0157370_10407795 Ga0157370_104077951 334
345 3300013105 Ga0157369_10011074 Ga0157369_100110747 334
346 3300013105 Ga0157369_10148384 Ga0157369_101483842 334
347 3300013105 Ga0157369_10163483 Ga0157369_101634832 334
348 3300013105 Ga0157369_10194401 Ga0157369_101944012 334
349 3300013296 Ga0157374_10000004 Ga0157374_1000000499 334
350 3300013296 Ga0157374_10003759 Ga0157374_1000375911 334
351 3300013296 Ga0157374_10006271 Ga0157374_100062717 334
352 3300013296 Ga0157374_10009183 Ga0157374_100091838 334
353 3300013296 Ga0157374_10021520 Ga0157374_100215203 334
354 3300013296 Ga0157374_10072972 Ga0157374_100729723 334
355 3300013296 Ga0157374_10079054 Ga0157374_100790542 334
356 3300013296 Ga0157374_10112153 Ga0157374_101121532 334
357 3300013296 Ga0157374_10193328 Ga0157374_101933282 334
358 3300013296 Ga0157374_10195979 Ga0157374_101959792 334
359 3300013297 Ga0157378_10072604 Ga0157378_100726042 334
360 3300013297 Ga0157378_10105500 Ga0157378_101055002 334
361 3300013297 Ga0157378_10107676 Ga0157378_101076762 334
362 3300013297 Ga0157378_10121035 Ga0157378_101210352 334
363 3300013297 Ga0157378_10161247 Ga0157378_101612472 334
364 3300013306 Ga0163162_10000031 Ga0163162_1000003110 334
365 3300013306 Ga0163162_10000161 Ga0163162_1000016137 334
366 3300013306 Ga0163162_10008282 Ga0163162_100082828 334
367 3300013306 Ga0163162_10013375 Ga0163162_100133756 334
368 3300013306 Ga0163162_10049354 Ga0163162_100493542 334
369 3300013306 Ga0163162_10076770 Ga0163162_100767703 334
370 3300013306 Ga0163162_10100926 Ga0163162_101009262 334
371 3300013306 Ga0163162_10110129 Ga0163162_101101293 334
372 3300013306 Ga0163162_10147547 Ga0163162_101475472 334
373 3300013306 Ga0163162_10192129 Ga0163162_101921292 334
374 3300013306 Ga0163162_10638904 Ga0163162_106389041 334
375 3300013307 Ga0157372_10000077 Ga0157372_100000778 334
376 3300013307 Ga0157372_10000252 Ga0157372_1000025244 334
377 3300013307 Ga0157372_10000988 Ga0157372_100009885 334
378 3300013307 Ga0157372_10002075 Ga0157372_100020757 334
379 3300013307 Ga0157372_10003847 Ga0157372_100038479 334
380 3300013307 Ga0157372_10028973 Ga0157372_100289735 334
381 3300013307 Ga0157372_10052458 Ga0157372_100524582 334
382 3300013307 Ga0157372_10059053 Ga0157372_100590534 334
383 3300013307 Ga0157372_10099621 Ga0157372_100996212 334
384 3300013307 Ga0157372_10105046 Ga0157372_101050461 334
385 3300013307 Ga0157372_10247922 Ga0157372_102479222 334
386 3300013308 Ga0157375_10002968 Ga0157375_100029682 334
387 3300013308 Ga0157375_10041638 Ga0157375_100416383 334
388 3300013308 Ga0157375_10058934 Ga0157375_100589341 334
389 3300013308 Ga0157375_10149321 Ga0157375_101493212 334
390 3300013308 Ga0157375_10182536 Ga0157375_101825362 334
391 3300013308 Ga0157375_10198465 Ga0157375_101984652 334
392 3300013308 Ga0157375_10583039 Ga0157375_105830391 334
393 3300014325 Ga0163163_10000176 Ga0163163_1000017658 334
394 3300014325 Ga0163163_10041106 Ga0163163_100411062 334
395 3300014326 Ga0157380_10000789 Ga0157380_100007892 334
396 3300014326 Ga0157380_10009405 Ga0157380_100094056 334
397 3300014326 Ga0157380_10156305 Ga0157380_101563052 334
398 3300014745 Ga0157377_10009077 Ga0157377_100090772 334
399 3300014745 Ga0157377_10035212 Ga0157377_100352122 334
400 3300014745 Ga0157377_10041286 Ga0157377_100412862 334
401 3300014745 Ga0157377_10049547 Ga0157377_100495472 334
402 3300014968 Ga0157379_10106312 Ga0157379_101063121 334
403 3300014968 Ga0157379_10125359 Ga0157379_101253592 334
404 3300014969 Ga0157376_10011492 Ga0157376_100114925 334
405 3300014969 Ga0157376_10031069 Ga0157376_100310692 334
406 3300014969 Ga0157376_10038823 Ga0157376_100388231 334
407 3300014969 Ga0157376_10040394 Ga0157376_100403942 334
408 3300014969 Ga0157376_10048359 Ga0157376_100483593 334
409 3300014969 Ga0157376_10091728 Ga0157376_100917282 334
410 3300014969 Ga0157376_10120043 Ga0157376_101200432 334
411 3300017792 Ga0163161_10001827 Ga0163161_1000182713 334
412 3300017792 Ga0163161_10089666 Ga0163161_100896662 334
413 3300017792 Ga0163161_10141300 Ga0163161_101413002 334
414 3300020070 Ga0206356_10918650 Ga0206356_109186501 334
415 3300020077 Ga0206351_10778228 Ga0206351_107782281 334
416 3300020610 Ga0154015_1194800 Ga0154015_11948001 334
417 3300021361 Ga0213872_10011644 Ga0213872_100116444 334
418 3300022467 Ga0224712_10124343 Ga0224712_101243431 334
419 3300025231 Ga0207427_100171 Ga0207427_1001713 334
420 3300025233 Ga0209437_100024 Ga0209437_100024218 334
421 3300025233 Ga0209437_100052 Ga0209437_100052102 334
422 3300025250 Ga0209026_1002264 Ga0209026_10022649 334
423 3300025250 Ga0209026_1009270 Ga0209026_10092702 334
424 3300025261 Ga0209233_1000067 Ga0209233_1000067102 334
425 3300025261 Ga0209233_1002449 Ga0209233_10024496 334
426 3300025292 Ga0209676_1002043 Ga0209676_10020434 334
427 3300025298 Ga0209050_1001548 Ga0209050_100154818 334
428 3300025298 Ga0209050_1026084 Ga0209050_10260841 334
429 3300025302 Ga0207426_1000009 Ga0207426_1000009229 334
430 3300025304 Ga0209257_1000007 Ga0209257_10000071407 334
431 3300025315 Ga0207697_10065113 Ga0207697_100651131 334
432 3300025315 Ga0207697_10093814 Ga0207697_100938141 334
433 3300025321 Ga0207656_10010375 Ga0207656_100103752 334
434 3300025321 Ga0207656_10015168 Ga0207656_100151682 334
435 3300025321 Ga0207656_10032229 Ga0207656_100322292 334
436 3300025321 Ga0207656_10073677 Ga0207656_100736772 334
437 3300025893 Ga0207682_10046956 Ga0207682_100469561 334
438 3300025899 Ga0207642_10033726 Ga0207642_100337261 334
439 3300025900 Ga0207710_10005592 Ga0207710_100055924 334
440 3300025903 Ga0207680_10000053 Ga0207680_1000005346 334
441 3300025903 Ga0207680_10026500 Ga0207680_100265002 334
442 3300025903 Ga0207680_10065172 Ga0207680_100651722 334
443 3300025904 Ga0207647_10000463 Ga0207647_100004635 334
444 3300025904 Ga0207647_10002289 Ga0207647_100022899 334
445 3300025904 Ga0207647_10041668 Ga0207647_100416682 334
446 3300025904 Ga0207647_10064384 Ga0207647_100643842 334
447 3300025904 Ga0207647_10217406 Ga0207647_102174061 334
448 3300025905 Ga0207685_10133979 Ga0207685_101339791 334
449 3300025907 Ga0207645_10000082 Ga0207645_1000008260 334
450 3300025907 Ga0207645_10009123 Ga0207645_100091233 334
451 3300025907 Ga0207645_10013009 Ga0207645_100130091 334
452 3300025907 Ga0207645_10025040 Ga0207645_100250401 334
453 3300025908 Ga0207643_10014774 Ga0207643_100147743 334
454 3300025909 Ga0207705_10000015 Ga0207705_10000015114 334
455 3300025909 Ga0207705_10059570 Ga0207705_100595702 334
456 3300025909 Ga0207705_10321369 Ga0207705_103213691 334
457 3300025911 Ga0207654_10000422 Ga0207654_1000042213 334
458 3300025911 Ga0207654_10001451 Ga0207654_1000145114 334
459 3300025911 Ga0207654_10002361 Ga0207654_100023616 334
460 3300025911 Ga0207654_10022023 Ga0207654_100220232 334
461 3300025911 Ga0207654_10069331 Ga0207654_100693313 334
462 3300025911 Ga0207654_10178182 Ga0207654_101781821 334
463 3300025912 Ga0207707_10106716 Ga0207707_101067163 334
464 3300025913 Ga0207695_10000021 Ga0207695_1000002161 334
465 3300025913 Ga0207695_10000039 Ga0207695_10000039179 334
466 3300025913 Ga0207695_10000189 Ga0207695_10000189142 334
467 3300025913 Ga0207695_10000993 Ga0207695_1000099316 334
468 3300025913 Ga0207695_10003570 Ga0207695_1000357012 334
469 3300025913 Ga0207695_10005021 Ga0207695_1000502110 334
470 3300025913 Ga0207695_10016238 Ga0207695_100162386 334
471 3300025913 Ga0207695_10036935 Ga0207695_100369354 334
472 3300025913 Ga0207695_10198971 Ga0207695_101989712 334
473 3300025913 Ga0207695_10202362 Ga0207695_102023623 334
474 3300025913 Ga0207695_10202672 Ga0207695_102026722 334
475 3300025914 Ga0207671_10000909 Ga0207671_1000090928 334
476 3300025914 Ga0207671_10001801 Ga0207671_100018014 334
477 3300025914 Ga0207671_10002125 Ga0207671_1000212512 334
478 3300025914 Ga0207671_10002229 Ga0207671_1000222910 334
479 3300025914 Ga0207671_10002851 Ga0207671_100028517 334
480 3300025914 Ga0207671_10009608 Ga0207671_100096084 334
481 3300025914 Ga0207671_10016783 Ga0207671_100167833 334
482 3300025914 Ga0207671_10054773 Ga0207671_100547731 334
483 3300025914 Ga0207671_10133261 Ga0207671_101332612 334
484 3300025914 Ga0207671_10268726 Ga0207671_102687261 334
485 3300025917 Ga0207660_10014210 Ga0207660_100142106 334
486 3300025918 Ga0207662_10018257 Ga0207662_100182572 334
487 3300025918 Ga0207662_10079565 Ga0207662_100795652 334
488 3300025919 Ga0207657_10173467 Ga0207657_101734672 334
489 3300025920 Ga0207649_10002117 Ga0207649_100021174 334
490 3300025920 Ga0207649_10108806 Ga0207649_101088062 334
491 3300025921 Ga0207652_10145801 Ga0207652_101458012 334
492 3300025921 Ga0207652_10187409 Ga0207652_101874092 334
493 3300025923 Ga0207681_10012383 Ga0207681_100123834 334
494 3300025923 Ga0207681_10048713 Ga0207681_100487133 334
495 3300025925 Ga0207650_10002543 Ga0207650_100025433 334
496 3300025925 Ga0207650_10014352 Ga0207650_100143524 334
497 3300025925 Ga0207650_10149598 Ga0207650_101495982 334
498 3300025925 Ga0207650_10150728 Ga0207650_101507282 334
499 3300025925 Ga0207650_10171388 Ga0207650_101713882 334
500 3300025926 Ga0207659_10005103 Ga0207659_100051034 334
501 3300025926 Ga0207659_10013848 Ga0207659_100138483 334
502 3300025926 Ga0207659_10021136 Ga0207659_100211362 334
503 3300025926 Ga0207659_10041778 Ga0207659_100417782 334
504 3300025926 Ga0207659_10113522 Ga0207659_101135222 334
505 3300025931 Ga0207644_10124474 Ga0207644_101244742 334
506 3300025931 Ga0207644_10197064 Ga0207644_101970641 334
507 3300025932 Ga0207690_10003612 Ga0207690_100036125 334
508 3300025932 Ga0207690_10006302 Ga0207690_100063022 334
509 3300025932 Ga0207690_10008351 Ga0207690_100083518 334
510 3300025932 Ga0207690_10123396 Ga0207690_101233962 334
511 3300025933 Ga0207706_10001363 Ga0207706_100013633 334
512 3300025933 Ga0207706_10004385 Ga0207706_100043856 334
513 3300025933 Ga0207706_10110110 Ga0207706_101101102 334
514 3300025934 Ga0207686_10000630 Ga0207686_1000063010 334
515 3300025934 Ga0207686_10010003 Ga0207686_100100034 334
516 3300025934 Ga0207686_10016556 Ga0207686_100165563 334
517 3300025934 Ga0207686_10073118 Ga0207686_100731182 334
518 3300025936 Ga0207670_10005924 Ga0207670_100059244 334
519 3300025936 Ga0207670_10010335 Ga0207670_100103353 334
520 3300025936 Ga0207670_10014227 Ga0207670_100142273 334
521 3300025937 Ga0207669_10040159 Ga0207669_100401593 334
522 3300025938 Ga0207704_10000078 Ga0207704_1000007819 334
523 3300025938 Ga0207704_10198340 Ga0207704_101983401 334
524 3300025938 Ga0207704_10290987 Ga0207704_102909871 334
525 3300025940 Ga0207691_10023429 Ga0207691_100234292 334
526 3300025940 Ga0207691_10034574 Ga0207691_100345743 334
527 3300025942 Ga0207689_10005094 Ga0207689_100050948 334
528 3300025942 Ga0207689_10005194 Ga0207689_100051945 334
529 3300025942 Ga0207689_10011041 Ga0207689_100110412 334
530 3300025942 Ga0207689_10012402 Ga0207689_100124022 334
531 3300025942 Ga0207689_10016035 Ga0207689_100160353 334
532 3300025942 Ga0207689_10017262 Ga0207689_100172623 334
533 3300025942 Ga0207689_10041387 Ga0207689_100413872 334
534 3300025944 Ga0207661_10000338 Ga0207661_1000033821 334
535 3300025944 Ga0207661_10164114 Ga0207661_101641142 334
536 3300025944 Ga0207661_10440201 Ga0207661_104402011 334
537 3300025945 Ga0207679_10000251 Ga0207679_1000025127 334
538 3300025945 Ga0207679_10034418 Ga0207679_100344182 334
539 3300025949 Ga0207667_10000022 Ga0207667_10000022294 334
540 3300025949 Ga0207667_10002632 Ga0207667_1000263216 334
541 3300025949 Ga0207667_10125813 Ga0207667_101258133 334
542 3300025949 Ga0207667_10199661 Ga0207667_101996613 334
543 3300025960 Ga0207651_10276098 Ga0207651_102760981 334
544 3300025960 Ga0207651_10292363 Ga0207651_102923631 334
545 3300025961 Ga0207712_10002527 Ga0207712_1000252710 334
546 3300025961 Ga0207712_10009920 Ga0207712_100099203 334
547 3300025961 Ga0207712_10012118 Ga0207712_100121184 334
548 3300025961 Ga0207712_10219886 Ga0207712_102198861 334
549 3300025972 Ga0207668_10057828 Ga0207668_100578282 334
550 3300025981 Ga0207640_10090812 Ga0207640_100908122 334
551 3300025986 Ga0207658_10045021 Ga0207658_100450212 334
552 3300025986 Ga0207658_10052666 Ga0207658_100526662 334
553 3300025986 Ga0207658_10077032 Ga0207658_100770323 334
554 3300025986 Ga0207658_10194235 Ga0207658_101942352 334
555 3300025986 Ga0207658_10310703 Ga0207658_103107031 334
556 3300026023 Ga0207677_10001889 Ga0207677_100018899 334
557 3300026023 Ga0207677_10020742 Ga0207677_100207422 334
558 3300026023 Ga0207677_10033981 Ga0207677_100339812 334
559 3300026023 Ga0207677_10111587 Ga0207677_101115872 334
560 3300026023 Ga0207677_10137019 Ga0207677_101370192 334
561 3300026035 Ga0207703_10003760 Ga0207703_100037606 334
562 3300026035 Ga0207703_10116577 Ga0207703_101165773 334
563 3300026035 Ga0207703_10426033 Ga0207703_104260331 334
564 3300026041 Ga0207639_10005745 Ga0207639_100057453 334
565 3300026067 Ga0207678_10038306 Ga0207678_100383062 334
566 3300026075 Ga0207708_10143798 Ga0207708_101437981 334
567 3300026075 Ga0207708_10192131 Ga0207708_101921312 334
568 3300026078 Ga0207702_10001984 Ga0207702_100019844 334
569 3300026078 Ga0207702_10010619 Ga0207702_100106198 334
570 3300026078 Ga0207702_10018669 Ga0207702_100186694 334
571 3300026088 Ga0207641_10000202 Ga0207641_1000020236 334
572 3300026088 Ga0207641_10002390 Ga0207641_100023902 334
573 3300026089 Ga0207648_10000472 Ga0207648_1000047211 334
574 3300026089 Ga0207648_10011089 Ga0207648_100110898 334
575 3300026089 Ga0207648_10020425 Ga0207648_100204253 334
576 3300026089 Ga0207648_10092732 Ga0207648_100927322 334
577 3300026089 Ga0207648_10109691 Ga0207648_101096912 334
578 3300026089 Ga0207648_10140691 Ga0207648_101406912 334
579 3300026089 Ga0207648_10146042 Ga0207648_101460422 334
580 3300026089 Ga0207648_10254388 Ga0207648_102543882 334
581 3300026095 Ga0207676_10039175 Ga0207676_100391753 334
582 3300026095 Ga0207676_10042377 Ga0207676_100423771 334
583 3300026116 Ga0207674_10000624 Ga0207674_1000062420 334
584 3300026116 Ga0207674_10009101 Ga0207674_1000910111 334
585 3300026116 Ga0207674_10011799 Ga0207674_100117997 334
586 3300026116 Ga0207674_10043117 Ga0207674_100431172 334
587 3300026116 Ga0207674_10047276 Ga0207674_100472763 334
588 3300026116 Ga0207674_10085564 Ga0207674_100855643 334
589 3300026116 Ga0207674_10157566 Ga0207674_101575662 334
590 3300026116 Ga0207674_10216554 Ga0207674_102165541 334
591 3300026116 Ga0207674_10295900 Ga0207674_102959001 334
592 3300026118 Ga0207675_100002674 Ga0207675_1000026748 334
593 3300026118 Ga0207675_100012863 Ga0207675_1000128635 334
594 3300026118 Ga0207675_100040537 Ga0207675_1000405372 334
595 3300026118 Ga0207675_100059014 Ga0207675_1000590142 334
596 3300026118 Ga0207675_100185553 Ga0207675_1001855532 334
597 3300026118 Ga0207675_100232551 Ga0207675_1002325511 334
598 3300026121 Ga0207683_10010049 Ga0207683_100100493 334
599 3300026121 Ga0207683_10019276 Ga0207683_100192764 334
600 3300026121 Ga0207683_10242793 Ga0207683_102427932 334
601 3300026121 Ga0207683_10462717 Ga0207683_104627171 334
602 3300026142 Ga0207698_10015237 Ga0207698_100152371 334
603 3300026142 Ga0207698_10015561 Ga0207698_100155612 334
604 3300026142 Ga0207698_10048691 Ga0207698_100486913 334
605 3300026142 Ga0207698_10169916 Ga0207698_101699161 334
606 3300027471 Ga0209995_1019358 Ga0209995_10193581 334
607 3300027907 Ga0207428_10015643 Ga0207428_100156434 334
608 3300027907 Ga0207428_10041009 Ga0207428_100410094 334
609 3300027907 Ga0207428_10199147 Ga0207428_101991471 334
610 3300028379 Ga0268266_10000052 Ga0268266_10000052191 334
611 3300028379 Ga0268266_10000057 Ga0268266_10000057207 334
612 3300028379 Ga0268266_10017280 Ga0268266_100172802 334
613 3300028379 Ga0268266_10081042 Ga0268266_100810422 334
614 3300028380 Ga0268265_10034260 Ga0268265_100342602 334
615 3300028381 Ga0268264_10002491 Ga0268264_100024916 334
616 3300028381 Ga0268264_10027377 Ga0268264_100273774 334
617 3300028786 Ga0307517_10001280 Ga0307517_100012807 334
618 3300028786 Ga0307517_10002277 Ga0307517_1000227714 334
619 3300028794 Ga0307515_10000007 Ga0307515_10000007309 334
620 3300028794 Ga0307515_10000076 Ga0307515_10000076172 334
621 3300028794 Ga0307515_10000235 Ga0307515_1000023516 334
622 3300028794 Ga0307515_10000280 Ga0307515_1000028024 334
623 3300028794 Ga0307515_10139202 Ga0307515_101392023 334
624 3300028794 Ga0307515_10170256 Ga0307515_101702562 334
625 3300028800 Ga0265338_10016034 Ga0265338_100160342 334
626 3300028800 Ga0265338_10105407 Ga0265338_101054071 334
627 3300030521 Ga0307511_10000580 Ga0307511_1000058010 334
628 3300031251 Ga0265327_10000101 Ga0265327_10000101129 334
629 3300031507 Ga0307509_10062159 Ga0307509_100621594 334
630 3300031548 Ga0307408_100000652 Ga0307408_10000065226 334
631 3300031548 Ga0307408_100007740 Ga0307408_1000077408 334
632 3300031616 Ga0307508_10002190 Ga0307508_100021908 334
633 3300031649 Ga0307514_10042682 Ga0307514_100426822 334
634 3300031727 Ga0316576_10036361 Ga0316576_100363612 334
635 3300031730 Ga0307516_10000232 Ga0307516_1000023211 334
636 3300031730 Ga0307516_10041064 Ga0307516_100410643 334
637 3300031731 Ga0307405_10020557 Ga0307405_100205573 334
638 3300031731 Ga0307405_10094127 Ga0307405_100941271 334
639 3300031903 Ga0307407_10036101 Ga0307407_100361012 334
640 3300031903 Ga0307407_10287271 Ga0307407_102872711 334
641 3300031911 Ga0307412_10009687 Ga0307412_100096871 334
642 3300031995 Ga0307409_100038251 Ga0307409_1000382512 334
643 3300032002 Ga0307416_100006444 Ga0307416_1000064443 334
644 3300032004 Ga0307414_10051471 Ga0307414_100514714 334
645 3300032126 Ga0307415_100004572 Ga0307415_1000045724 334
646 3300033179 Ga0307507_10000217 Ga0307507_1000021746 334
647 3300033524 Ga0316592_1037898 Ga0316592_10378981 334
648 3300033528 Ga0316588_1043791 Ga0316588_10437911 334
649 3300033528 Ga0316588_1044428 Ga0316588_10444281 334
650 3300033541 Ga0316596_1043315 Ga0316596_10433151 334
651 3300033541 Ga0316596_1046531 Ga0316596_10465311 334
652 3300035724 Ga0373933_0158769 Ga0373933_0158769_190_1239 334
653 3300037312 Ga0395899_0000002 Ga0395899_0000002_1296728_1297738 334
654 3300037312 Ga0395899_0000257 Ga0395899_0000257_60661_61668 334
655 3300037312 Ga0395899_0000312 Ga0395899_0000312_17300_18304 334
656 3300037312 Ga0395899_0191567 Ga0395899_0191567_147_1190 334
657 3300037418 Ga0395900_0000014 Ga0395900_0000014_34661_35665 334
658 3300037418 Ga0395900_0004584 Ga0395900_0004584_10746_11753 334
659 3300037418 Ga0395900_0032708 Ga0395900_0032708_3487_4524 334
660 3300037466 Ga0395898_0040271 Ga0395898_0040271_352_1359 334
661 3300037471 Ga0395905_0000037 Ga0395905_0000037_34651_35655 334
662 3300037471 Ga0395905_0001831 Ga0395905_0001831_786_1829 334
663 3300037471 Ga0395905_0007096 Ga0395905_0007096_5430_6437 334
664 3300038443 Ga0395901_0000166 Ga0395901_0000166_34515_35519 334
665 3300038443 Ga0395901_0046840 Ga0395901_0046840_3266_4276 334
666 3300039062 Ga0400483_011190 Ga0400483_011190_87051_88067 334
667 3300039062 Ga0400483_103871 Ga0400483_103871_5139_6299 334
668 3300039062 Ga0400483_215675 Ga0400483_215675_86713_87729 334
669 3300039062 Ga0400483_267913 Ga0400483_267913_70_1230 334
670 3300039093 Ga0400489_43658 Ga0400489_43658_1098_2258 334
671 3300039110 Ga0400487_65977 Ga0400487_65977_2777_3787 334
672 3300039447 Ga0436361_0602515 Ga0436361_0602515_2881_3885 334
673 3300041486 Ga0451807_0005345 Ga0451807_0005345_776_1816 334
674 3300042004 Ga0439445_0042614 Ga0439445_0042614_28_1038 334
675 3300042005 Ga0439448_0008853 Ga0439448_0008853_1094_2098 334
676 3300042007 Ga0439449_0023575 Ga0439449_0023575_1096_2106 334
677 3300042014 Ga0439457_012416 Ga0439457_012416_760_1770 334
678 3300042014 Ga0439457_023734 Ga0439457_023734_288_1331 334
679 3300042128 Ga0450897_000713 Ga0450897_000713_518_1528 334
680 3300042134 Ga0450898_001336 Ga0450898_001336_597_1607 334
681 3300042435 Ga0439434_0012567 Ga0439434_0012567_699_1709 334
682 3300042876 Ga0451577_0079806 Ga0451577_0079806_203_1216 334
683 3300044656 Ga0466969_0053386 Ga0466969_0053386_845_1852 334
684 3300044658 Ga0466972_0015909 Ga0466972_0015909_2180_3211 334
685 3300044683 Ga0466965_0182567 Ga0466965_0182567_25_1071 334
686 3300044693 Ga0466961_0045211 Ga0466961_0045211_1585_2592 334
687 3300044712 Ga0453684_0000841 Ga0453684_0000841_65492_66544 334
688 3300044712 Ga0453684_0082744 Ga0453684_0082744_2496_3509 334
689 3300044712 Ga0453684_0726946 Ga0453684_0726946_44_1057 334
690 3300044842 Ga0466957_0126395 Ga0466957_0126395_143_1174 334
691 3300045049 Ga0466959_0025420 Ga0466959_0025420_996_2003 334
692 3300045049 Ga0466959_0121211 Ga0466959_0121211_500_1561 334
693 3300045049 Ga0466959_0137085 Ga0466959_0137085_168_1172 334
694 3300045051 Ga0451576_0006366 Ga0451576_0006366_4957_6009 334
695 3300045051 Ga0451576_0013410 Ga0451576_0013410_5959_6972 334
696 3300045051 Ga0451576_0026843 Ga0451576_0026843_2548_3561 334
697 3300045051 Ga0451576_0092878 Ga0451576_0092878_591_1643 334
698 3300045051 Ga0451576_0108543 Ga0451576_0108543_749_1762 334
699 3300046460 Ga0495638_0000005 Ga0495638_0000005_371657_372691 334
700 3300046460 Ga0495638_0018717 Ga0495638_0018717_1717_2754 334
701 3300046462 Ga0495651_0130495 Ga0495651_0130495_633_1643 334
702 3300046471 Ga0495650_0000087 Ga0495650_0000087_97389_98399 334
703 3300046492 Ga0495585_0000167 Ga0495585_0000167_41441_42451 334
704 3300046492 Ga0495585_0004197 Ga0495585_0004197_3852_4862 334
705 3300046507 Ga0495606_0000052 Ga0495606_0000052_96303_97313 334
706 3300046507 Ga0495606_0034414 Ga0495606_0034414_2443_3453 334
707 3300046513 Ga0495616_0001285 Ga0495616_0001285_16111_17121 334
708 3300046513 Ga0495616_0005065 Ga0495616_0005065_4495_5505 334
709 3300046514 Ga0495618_0208969 Ga0495618_0208969_147_1196 334
710 3300046516 Ga0495628_0019958 Ga0495628_0019958_4391_5440 334
711 3300046517 Ga0495630_0005239 Ga0495630_0005239_1524_2573 334
712 3300046519 Ga0495632_0070137 Ga0495632_0070137_142_1146 334
713 3300046524 Ga0495648_0002287 Ga0495648_0002287_8227_9237 334
714 3300046524 Ga0495648_0012616 Ga0495648_0012616_2356_3390 334
715 3300046530 Ga0495654_0030030 Ga0495654_0030030_1093_2103 334
716 3300046536 Ga0495587_0021739 Ga0495587_0021739_2116_3165 334
717 3300046558 Ga0495633_0000029 Ga0495633_0000029_136230_137240 334
718 3300046648 Ga0495611_0037935 Ga0495611_0037935_206_1240 334
719 3300046660 Ga0495625_0000008 Ga0495625_0000008_462324_463334 334
720 3300046660 Ga0495625_0076677 Ga0495625_0076677_222_1226 334
721 3300046665 Ga0495661_0000511 Ga0495661_0000511_16480_17490 334
722 3300046678 Ga0495599_0156618 Ga0495599_0156618_290_1339 334
723 3300046683 Ga0495658_0065180 Ga0495658_0065180_329_1339 334
724 3300046692 Ga0495671_0020496 Ga0495671_0020496_138_1148 334
725 3300046692 Ga0495671_0027394 Ga0495671_0027394_1515_2525 334
726 3300046694 Ga0495649_0000018 Ga0495649_0000018_72831_73841 334
727 3300046810 Ga0495660_0009229 Ga0495660_0009229_2681_3691 334
728 3300047320 Ga0495672_0013741 Ga0495672_0013741_1752_2801 334
729 3300047443 Ga0495687_000527 Ga0495687_000527_43139_44272 334
730 3300047443 Ga0495687_000972 Ga0495687_000972_11593_12603 334
731 3300047472 Ga0495686_0000052 Ga0495686_0000052_181324_182334 334
732 3300047472 Ga0495686_0011200 Ga0495686_0011200_528_1538 334
733 3300047472 Ga0495686_0055857 Ga0495686_0055857_924_1934 334
734 3300047472 Ga0495686_0194552 Ga0495686_0194552_102_1112 334
735 3300048089 Ga0495614_0007516 Ga0495614_0007516_1897_2907 334
736 3300049127 Ga0501306_013260 Ga0501306_013260_22_1053 334
737 3300049128 Ga0501308_005279 Ga0501308_005279_230_1261 334
738 3300049129 Ga0501309_000827 Ga0501309_000827_10_1038 334
739 3300049130 Ga0501310_000823 Ga0501310_000823_16_1044 334
740 3300049160 Ga0501304_000510 Ga0501304_000510_1021_2049 334
741 3300049161 Ga0501305_004876 Ga0501305_004876_10_1038 334
742 3300049161 Ga0501305_015207 Ga0501305_015207_24_1055 334
743 3300049162 Ga0501307_011201 Ga0501307_011201_10_1038 334
744 3300049459 Ga0495678_003683 Ga0495678_003683_2727_3737 334
745 3300049531 Ga0501315_012093 Ga0501315_012093_17_1051 334
746 3300049531 Ga0501315_012764 Ga0501315_012764_19_1029 334
747 3300049533 Ga0501317_012120 Ga0501317_012120_19_1029 334
748 3300049536 Ga0501320_000742 Ga0501320_000742_10_1038 334
749 3300049653 Ga0501206_003576 Ga0501206_003576_511_1575 334
750 3300049663 Ga0501223_002757 Ga0501223_002757_1904_2911 334
751 3300049669 Ga0501235_005105 Ga0501235_005105_1521_2585 334
752 3300049686 Ga0501257_000838 Ga0501257_000838_2393_3421 334
753 3300049688 Ga0501259_002994 Ga0501259_002994_129_1193 334
754 3300049688 Ga0501259_005521 Ga0501259_005521_270_1298 334
755 3300049704 Ga0501221_003139 Ga0501221_003139_1531_2595 334
756 3300049761 Ga0501264_000594 Ga0501264_000594_3986_5020 334
757 3300050493 nmdc:mga0k408_171_c1 nmdc:mga0k408_171_c1_19194_20204 334
758 3300050493 nmdc:mga0k408_3472_c1 nmdc:mga0k408_3472_c1_4041_5051 334
759 3300050496 nmdc:mga07m45_169687_c1 nmdc:mga07m45_169687_c1_116_1126 334
760 3300050508 nmdc:mga09592_102763_c1 nmdc:mga09592_102763_c1_219_1262 334
761 3300050508 nmdc:mga09592_5680_c1 nmdc:mga09592_5680_c1_2370_3413 334
762 3300050510 nmdc:mga06r32_30314_c1 nmdc:mga06r32_30314_c1_950_1993 334
763 3300050511 nmdc:mga08y16_161644_c1 nmdc:mga08y16_161644_c1_426_1469 334
764 3300050511 nmdc:mga08y16_29769_c1 nmdc:mga08y16_29769_c1_2874_3884 334
765 3300050511 nmdc:mga08y16_4421_c1 nmdc:mga08y16_4421_c1_12158_13192 334
766 3300050512 nmdc:mga0n895_137434_c1 nmdc:mga0n895_137434_c1_723_1769 334
767 3300053080 Ga0500635_0000305 Ga0500635_0000305_13607_14617 334
768 3300053090 Ga0500646_0007785 Ga0500646_0007785_177_1211 334
769 3300053092 Ga0500583_0001564 Ga0500583_0001564_4209_5243 334
770 3300053096 Ga0500641_0040415 Ga0500641_0040415_713_1756 334
771 3300053104 Ga0500556_0026068 Ga0500556_0026068_883_1917 334
772 3300053105 Ga0500557_001744 Ga0500557_001744_1208_2242 334
773 3300053108 Ga0500562_008228 Ga0500562_008228_615_1649 334
774 3300053122 Ga0500608_002485 Ga0500608_002485_2045_3049 334
775 3300053125 Ga0500618_000037 Ga0500618_000037_108135_109145 334
776 3300053130 Ga0500642_0033245 Ga0500642_0033245_595_1602 334
777 3300053130 Ga0500642_0037713 Ga0500642_0037713_81_1115 334
778 3300053133 Ga0500655_009797 Ga0500655_009797_588_1625 334
779 3300053138 Ga0500564_062773 Ga0500564_062773_145_1155 334
780 3300053139 Ga0500568_0004443 Ga0500568_0004443_4685_5719 334
781 3300053153 Ga0500616_0000003 Ga0500616_0000003_919546_920580 334
782 3300053153 Ga0500616_0018065 Ga0500616_0018065_2160_3173 334
783 3300053153 Ga0500616_0027972 Ga0500616_0027972_1189_2223 334
784 3300053156 Ga0500622_0000034 Ga0500622_0000034_28792_29826 334
785 3300053156 Ga0500622_0000235 Ga0500622_0000235_15127_16161 334
786 3300053156 Ga0500622_0082737 Ga0500622_0082737_175_1185 334
787 3300053157 Ga0500624_000554 Ga0500624_000554_3824_4834 334
788 3300053727 Ga0500611_000026 Ga0500611_000026_47590_48639 334
789 3300059505 Ga0587083_0030930 Ga0587083_0030930_37_1044 334
790 3300059604 Ga0587098_005387 Ga0587098_005387_179_1237 334
791 3300059624 Ga0587109_026989 Ga0587109_026989_21_1037 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03951

Gln-synt_N

Glutamine synthetase, beta-Grasp domain

1

82

0.82

PF00120

Gln-synt_C

Glutamine synthetase, catalytic domain

89

338

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d3a-assembly1.cif.gz_A crystal structure of the maize glutamine synthetase complexed with adp and methionine sulfoximine phosphate 0.918 2 330
4bax-assembly1.cif.gz_E crystal structure of glutamine synthetase from streptomyces coelicolor 0.9128 2 333
7evt-assembly1.cif.gz_H crystal structure of the n-terminal degron-truncated human glutamine synthetase 0.909 2 330
8ecy-assembly1.cif.gz_A cryoem structure of bovine bestrophin-2 and glutamine synthetase complex 0.9071 2 330
7evt-assembly1.cif.gz_I crystal structure of the n-terminal degron-truncated human glutamine synthetase 0.9049 1 330
ID Description Score Start End Superfamily
2uu7A02 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.9186 101 330 3.30.590.10
4baxC01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain 0.9163 2 86 3.10.20.70
af_Q08CT3_116_307_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.9085 101 272 3.30.590.10
4is4B01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain 0.9048 2 86 3.10.20.70
af_A0A0R0LAY4_104_248_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.8898 106 215 3.30.590.10
ID Description Score Start End GO Terms
AF-A0A3D1ZQP8-F1-model_v4 glutamine synthetase (EC 6.3.1.2) (Glutamine synthetase II) 0.9766 150 333 GO:0004356
GO:0005524
GO:0005737
GO:0006542
AF-A0A350CFH7-F1-model_v4 glutamine synthetase (EC 6.3.1.2) (Glutamine synthetase II) 0.9743 164 332 GO:0004356
GO:0005524
GO:0005737
GO:0006542
AF-A0A2E0C5M4-F1-model_v4 glutamine synthetase (EC 6.3.1.2) (Glutamine synthetase II) 0.9728 189 333 GO:0004356
GO:0005524
GO:0005737
GO:0006542
AF-A0A519DG88-F1-model_v4 Glutamine synthetase (EC 6.3.1.2) 0.9701 2 333 GO:0004356
GO:0005524
GO:0005737
GO:0006542
AF-A0A2N6G3C2-F1-model_v4 Glutamine synthetase (EC 6.3.1.2) 0.9698 2 333 GO:0004356
GO:0005524
GO:0005737
GO:0006542

Feature Viewer

pLDDT pTM Quality
89.68 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map