F480861

General Info

Members Datasets Scaffolds Average Seq Length
788 516 610 328

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10109974|Ga0070681_101099742
Length 365
Sequence MVRNCAPENLEIPGLVLPDHPGMTGEVIGKGMRITILFGGTNKERLVSVASAQALCEALPDADLWFWAADDSVHETQAKTLIGHSRPFEQEFTPGGRKVAAIIEQALDRAKADGRVLVLGLHGGRAENGELQAACELRDVPYTGSDSTSSHLAFDKVAAKRFAAIAGVKAPEGIPLQEIDAAFAEYGQLIAKPTYDGSSYGVIYVNARQDLVAVRNAAKTEHYLIEPRIAGVEATCGVLEKSNGELLALPPIEIVPGEGNFDYTAKYLLKSTQEICPGRFAADITAALMEKALLAHKALSCSGYSRSDFIVSDKGPVYLETNTLPGLTKASLYPKALKAKGIGFADFLKDQIVLAERRVRNTPGS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
20 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
21 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
22 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
23 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
24 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
25 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
26 2791355199
27 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
28 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
31 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
32 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
33 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
34 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
35 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
36 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
37 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
38 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
39 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
40 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
41 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
42 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
43 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
44 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
45 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
46 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
47 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
48 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
49 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
50 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
51 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
52 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
53 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
54 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
55 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
56 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
57 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
58 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
59 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
60 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
61 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
62 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
63 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
64 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
65 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
66 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
67 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
68 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
69 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
70 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
71 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
72 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
73 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
74 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
75 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
76 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
77 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
78 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
79 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
80 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
81 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
82 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
83 2904699407
84 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
85 2906610324
86 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
87 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
88 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
89 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
90 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
91 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
92 2922368715
93 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
94 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
95 2922425934
96 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
97 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
98 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
99 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
100 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
101 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
102 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
103 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
104 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
105 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
106 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
107 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
108 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
109 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
110 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
111 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
112 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
113 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
114 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
115 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
116 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
117 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
118 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
119 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
120 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
121 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
122 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
123 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
124 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
125 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
126 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
127 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
128 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
129 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
130 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
131 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
132 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
133 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
134 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
135 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
136 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
137 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
138 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
139 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
140 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
141 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
142 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
143 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
144 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
145 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
146 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
147 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
148 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
149 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
150 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
151 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
152 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
153 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
154 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
155 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
156 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
157 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
158 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
159 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
160 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
161 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
162 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
163 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
164 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
165 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
166 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
167 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
168 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
169 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
170 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
171 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
172 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
173 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
174 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
175 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
176 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
177 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
178 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
179 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
180 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
181 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
182 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
183 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
184 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
185 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
186 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
187 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
188 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
189 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
190 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
191 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
192 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
193 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
194 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
195 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
196 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
197 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
198 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
199 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
200 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
201 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
202 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
203 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
204 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
205 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
206 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
207 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
208 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
209 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
210 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
211 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
212 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
213 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
214 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
215 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
216 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
217 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
218 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
219 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
220 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
221 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
222 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
223 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
224 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
225 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
226 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
227 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
228 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
229 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
230 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
231 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
232 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
233 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
236 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
238 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
240 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
278 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
279 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
284 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
285 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
286 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
287 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
288 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
289 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
290 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
291 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
292 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
293 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
294 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
295 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
296 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
297 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
298 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
299 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
300 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
301 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
302 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
303 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
304 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
305 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
306 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
309 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
310 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
311 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
312 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
313 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
314 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
315 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
316 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
320 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
324 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
325 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
326 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
327 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
328 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
332 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
333 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
334 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
335 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
336 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
337 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
338 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
339 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
340 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
341 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
342 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
343 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
344 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
345 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
346 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
347 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
348 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
349 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
350 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
351 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
352 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
353 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
354 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
357 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
358 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
359 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
360 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
361 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
362 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
363 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
364 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
365 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
366 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
367 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
368 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
369 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
370 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
373 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
374 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
375 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
376 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
377 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
378 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
384 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
385 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
386 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
387 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
388 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
389 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
390 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
391 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
392 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
393 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
394 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
395 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
396 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
397 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
398 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
399 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
400 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
401 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
402 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
403 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
404 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
405 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
406 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
407 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
420 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
421 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
422 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
423 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
424 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
425 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
426 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
427 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
430 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
431 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
434 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
437 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
438 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
439 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
440 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
441 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
442 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
443 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
444 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
445 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
446 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
447 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
448 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
449 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
450 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
451 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
452 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
453 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
454 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
455 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
456 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
457 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
458 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
459 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
460 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
461 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
462 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
463 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
464 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
465 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
466 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
467 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
468 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
469 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
470 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
471 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
472 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
473 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
474 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
475 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
476 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
477 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
478 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
479 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
480 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
481 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
482 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
483 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
484 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
485 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
486 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
487 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
488 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
489 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
490 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
491 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
492 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
493 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
494 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
495 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
496 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
497 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
498 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
499 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
500 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
501 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
502 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
503 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
504 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
505 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
506 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
507 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
508 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
509 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
510 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
511 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
512 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
513 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
514 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
515 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
516 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.91
Metatranscriptomes 0
Isolates 22.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.29
Nodule 16.88
Rhizoplane 4.7
Rhizosphere 55.96
Stem 0
Stem Tuber 0
Unclassified 11.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002709 3300001979 Bacteria 7951
2 JGI24737J22298_10019055 3300001990 Bacteria 2195
3 JGI25153J46596_10004246 3300003215 Bacteria 7754
4 JGI25153J46596_10009718 3300003215 Bacteria 4427
5 JGI25153J46596_10028250 3300003215 Bacteria 1949
6 JGI25160J50197_1001885 3300003354 Bacteria 10064
7 Ga0055542_1008536 3300003762 Bacteria 2000
8 Ga0055531_10005281 3300003794 Bacteria 7578
9 Ga0065165_1004931 3300005262 Bacteria 7867
10 Ga0065165_1009824 3300005262 Bacteria 4226
11 Ga0065165_1015966 3300005262 Bacteria 2836
12 Ga0070683_100005294 3300005329 Bacteria 10748
13 Ga0070683_100005592 3300005329 Bacteria 10498
14 Ga0070670_100121633 3300005331 Bacteria 2252
15 Ga0068869_100038866 3300005334 Bacteria 3394
16 Ga0068869_100088815 3300005334 Bacteria 2320
17 Ga0070680_100016152 3300005336 Bacteria 5869
18 Ga0070680_100035140 3300005336 Bacteria 4045
19 Ga0070682_100096754 3300005337 Bacteria 1941
20 Ga0070660_100029630 3300005339 Bacteria 4104
21 Ga0070691_10105503 3300005341 Bacteria 1404
22 Ga0070661_100075427 3300005344 Bacteria 2485
23 Ga0070671_100077140 3300005355 Bacteria 2784
24 Ga0070671_100127629 3300005355 Bacteria 2142
25 Ga0070671_100161101 3300005355 Bacteria 1896
26 Ga0070674_100220894 3300005356 Bacteria 1474
27 Ga0070673_100054667 3300005364 Bacteria 3141
28 Ga0070709_10001417 3300005434 Bacteria 12994
29 Ga0070709_10007249 3300005434 Bacteria 6077
30 Ga0070709_10049645 3300005434 Bacteria 2625
31 Ga0070709_10225001 3300005434 Bacteria 1340
32 Ga0070709_10265907 3300005434 Bacteria 1241
33 Ga0070714_100018262 3300005435 Bacteria 5694
34 Ga0070714_100088352 3300005435 Bacteria 2712
35 Ga0070713_100022889 3300005436 Bacteria 4837
36 Ga0070713_100033799 3300005436 Bacteria 4101
37 Ga0070713_100128657 3300005436 Bacteria 2231
38 Ga0070710_10000633 3300005437 Bacteria 16752
39 Ga0070710_10008834 3300005437 Bacteria 4914
40 Ga0070710_10042841 3300005437 Bacteria 2504
41 Ga0070711_100001478 3300005439 Bacteria 12909
42 Ga0070711_100002216 3300005439 Bacteria 11029
43 Ga0070711_100011186 3300005439 Bacteria 5564
44 Ga0070663_100047179 3300005455 Bacteria 3051
45 Ga0070663_100120978 3300005455 Bacteria 1977
46 Ga0070663_100159892 3300005455 Bacteria 1733
47 Ga0070678_100127777 3300005456 Bacteria 2015
48 Ga0070678_100194575 3300005456 Bacteria 1669
49 Ga0070662_100096892 3300005457 Bacteria 2226
50 Ga0070662_100133874 3300005457 Bacteria 1914
51 Ga0070681_10040433 3300005458 Bacteria 4672
52 Ga0070681_10101517 3300005458 Bacteria 2822
53 Ga0070681_10109974 3300005458 Bacteria 2696
54 Ga0070681_10153891 3300005458 Bacteria 2225
55 Ga0070706_100258990 3300005467 Bacteria 1624
56 Ga0070698_100019627 3300005471 Bacteria 7091
57 Ga0070699_100054802 3300005518 Bacteria 3452
58 Ga0070679_100024858 3300005530 Bacteria 5870
59 Ga0070679_100136505 3300005530 Bacteria 2433
60 Ga0070679_100143535 3300005530 Bacteria 2366
61 Ga0070684_100005206 3300005535 Bacteria 9945
62 Ga0070684_100209620 3300005535 Bacteria 1776
63 Ga0068853_100038556 3300005539 Bacteria 4071
64 Ga0068853_100057494 3300005539 Bacteria 3356
65 Ga0068853_100099309 3300005539 Bacteria 2572
66 Ga0068853_100118906 3300005539 Bacteria 2355
67 Ga0068853_100213997 3300005539 Bacteria 1758
68 Ga0070693_100075808 3300005547 Bacteria 1992
69 Ga0070665_100206548 3300005548 Bacteria 1965
70 Ga0070665_100546352 3300005548 Bacteria 1171
71 Ga0068855_100049698 3300005563 Bacteria 4944
72 Ga0068855_100079756 3300005563 Bacteria 3796
73 Ga0068855_100210097 3300005563 Bacteria 2187
74 Ga0068855_100397248 3300005563 Bacteria 1511
75 Ga0068855_100398324 3300005563 Bacteria 1509
76 Ga0068857_100072650 3300005577 Bacteria 3066
77 Ga0068857_100114359 3300005577 Bacteria 2427
78 Ga0068854_100098644 3300005578 Bacteria 2187
79 Ga0068856_100187170 3300005614 Bacteria 2084
80 Ga0068856_100503048 3300005614 Bacteria 1233
81 Ga0068852_100032693 3300005616 Bacteria 4310
82 Ga0068859_100069977 3300005617 Bacteria 3544
83 Ga0068864_100047790 3300005618 Bacteria 3677
84 Ga0068861_100032076 3300005719 Bacteria 3865
85 Ga0068863_100157256 3300005841 Bacteria 2176
86 Ga0068863_100342243 3300005841 Bacteria 1455
87 Ga0068860_100051464 3300005843 Bacteria 3919
88 Ga0081455_10006756 3300005937 Bacteria 12243
89 Ga0081540_1023138 3300005983 Bacteria 3646
90 Ga0081540_1027848 3300005983 Bacteria 3191
91 Ga0081540_1070485 3300005983 Bacteria 1618
92 Ga0070717_10005443 3300006028 Bacteria 9293
93 Ga0070717_10121422 3300006028 Bacteria 2238
94 Ga0075365_10071742 3300006038 Bacteria 2331
95 Ga0075365_10100654 3300006038 Bacteria 1978
96 Ga0075363_100047166 3300006048 Bacteria 2287
97 Ga0075364_10109173 3300006051 Bacteria 1845
98 Ga0070715_10152801 3300006163 Bacteria 1133
99 Ga0070716_100026542 3300006173 Bacteria 3103
100 Ga0070716_100097370 3300006173 Bacteria 1795
101 Ga0070716_100126542 3300006173 Bacteria 1608
102 Ga0070712_100011086 3300006175 Bacteria 5706
103 Ga0070712_100035217 3300006175 Bacteria 3398
104 Ga0070712_100160308 3300006175 Bacteria 1737
105 Ga0075362_10032986 3300006177 Bacteria 2250
106 Ga0075367_10039628 3300006178 Bacteria 2748
107 Ga0075367_10044973 3300006178 Bacteria 2590
108 Ga0075367_10090256 3300006178 Bacteria 1863
109 Ga0075366_10031599 3300006195 Bacteria 3116
110 Ga0075366_10090918 3300006195 Bacteria 1828
111 Ga0097621_100060854 3300006237 Bacteria 3096
112 Ga0075370_10017964 3300006353 Bacteria 3829
113 Ga0075370_10039171 3300006353 Bacteria 2670
114 Ga0075428_100320575 3300006844 Bacteria 1665
115 Ga0075429_100295759 3300006880 Bacteria 1417
116 Ga0097620_100069979 3300006931 Bacteria 3544
117 Ga0099822_1000022 3300006943 Bacteria 64942
118 Ga0075435_100106565 3300007076 Bacteria 2327
119 Ga0099794_10060117 3300007265 Bacteria 1845
120 Ga0099795_10024142 3300007788 Bacteria 2024
121 Ga0105240_10015270 3300009093 Bacteria 10450
122 Ga0105240_10204385 3300009093 Bacteria 2313
123 Ga0105240_10249530 3300009093 Bacteria 2053
124 Ga0105240_10482159 3300009093 Bacteria 1382
125 Ga0111539_10563759 3300009094 Bacteria 1326
126 Ga0105245_10086340 3300009098 Bacteria 2877
127 Ga0105245_10144896 3300009098 Bacteria 2240
128 Ga0105247_10052860 3300009101 Bacteria 2505
129 Ga0114129_10151279 3300009147 Bacteria 3176
130 Ga0105241_10071350 3300009174 Bacteria 2696
131 Ga0105241_10151253 3300009174 Bacteria 1899
132 Ga0105241_10265661 3300009174 Bacteria 1460
133 Ga0105248_10306356 3300009177 Bacteria 1789
134 Ga0105248_10605922 3300009177 Bacteria 1236
135 Ga0105237_10015378 3300009545 Bacteria 7967
136 Ga0105237_10062087 3300009545 Bacteria 3735
137 Ga0105237_10074463 3300009545 Bacteria 3387
138 Ga0105237_10153473 3300009545 Bacteria 2299
139 Ga0105238_10035119 3300009551 Bacteria 5099
140 Ga0105238_10039569 3300009551 Bacteria 4781
141 Ga0105238_10059830 3300009551 Bacteria 3815
142 Ga0105238_10341775 3300009551 Bacteria 1485
143 Ga0105249_10323730 3300009553 Bacteria 1553
144 Ga0105249_10410469 3300009553 Bacteria 1386
145 Ga0105239_10044175 3300010375 Bacteria 4885
146 Ga0105239_10090525 3300010375 Bacteria 3375
147 Ga0105239_10111939 3300010375 Bacteria 3026
148 Ga0105239_10118056 3300010375 Bacteria 2944
149 Ga0105246_10056010 3300011119 Bacteria 2723
150 Ga0105246_10106980 3300011119 Bacteria 2047
151 Ga0157370_10044147 3300013104 Bacteria 4286
152 Ga0157370_10210557 3300013104 Bacteria 1802
153 Ga0157369_10012925 3300013105 Bacteria 9461
154 Ga0157369_10043079 3300013105 Bacteria 4921
155 Ga0157369_10065240 3300013105 Bacteria 3919
156 Ga0157369_10211345 3300013105 Bacteria 2033
157 Ga0157369_10549082 3300013105 Bacteria 1194
158 Ga0157374_10032938 3300013296 Bacteria 4723
159 Ga0157374_10138837 3300013296 Bacteria 2358
160 Ga0157372_10171321 3300013307 Bacteria 2511
161 Ga0157372_10296379 3300013307 Bacteria 1881
162 Ga0163163_10098820 3300014325 Bacteria 2940
163 Ga0163163_10193757 3300014325 Bacteria 2080
164 Ga0157380_10196934 3300014326 Bacteria 1784
165 Ga0182008_10049174 3300014497 Bacteria 2093
166 Ga0157376_10319272 3300014969 Bacteria 1476
167 Ga0214545_1000003 3300021324 Bacteria 720274
168 Ga0214543_1000002 3300021327 Bacteria 712733
169 Ga0213876_10010096 3300021384 Bacteria 5073
170 Ga0213876_10110693 3300021384 Bacteria 1458
171 Ga0209677_101595 3300025253 Bacteria 9567
172 Ga0209677_103126 3300025253 Bacteria 5624
173 Ga0209148_1000424 3300025254 Bacteria 47087
174 Ga0209233_1001581 3300025261 Bacteria 8917
175 Ga0209233_1002935 3300025261 Bacteria 6096
176 Ga0209455_1002609 3300025272 Bacteria 6856
177 Ga0209455_1003259 3300025272 Bacteria 5843
178 Ga0209758_1000141 3300025297 Bacteria 172481
179 Ga0209758_1005684 3300025297 Bacteria 9427
180 Ga0209758_1015210 3300025297 Bacteria 4008
181 Ga0209256_1006007 3300025299 Bacteria 6649
182 Ga0209256_1018545 3300025299 Bacteria 2254
183 Ga0207426_1003443 3300025302 Bacteria 8598
184 Ga0207426_1004449 3300025302 Bacteria 6833
185 Ga0207426_1035836 3300025302 Bacteria 1581
186 Ga0209257_1000426 3300025304 Bacteria 81095
187 Ga0207692_10001428 3300025898 Bacteria 8939
188 Ga0207692_10009587 3300025898 Bacteria 4051
189 Ga0207647_10044552 3300025904 Bacteria 2771
190 Ga0207647_10090069 3300025904 Bacteria 1831
191 Ga0207699_10000390 3300025906 Bacteria 22928
192 Ga0207699_10041162 3300025906 Bacteria 2667
193 Ga0207699_10314054 3300025906 Bacteria 1097
194 Ga0207645_10103780 3300025907 Bacteria 1836
195 Ga0207643_10037027 3300025908 Bacteria 2737
196 Ga0207684_10239989 3300025910 Bacteria 1564
197 Ga0207654_10073979 3300025911 Bacteria 2032
198 Ga0207707_10000178 3300025912 Bacteria 66057
199 Ga0207707_10051598 3300025912 Bacteria 3582
200 Ga0207707_10279084 3300025912 Bacteria 1447
201 Ga0207707_10281805 3300025912 Bacteria 1439
202 Ga0207695_10000062 3300025913 Bacteria 351979
203 Ga0207695_10094476 3300025913 Bacteria 2997
204 Ga0207695_10142177 3300025913 Bacteria 2347
205 Ga0207695_10147543 3300025913 Bacteria 2294
206 Ga0207671_10004982 3300025914 Bacteria 12436
207 Ga0207671_10014027 3300025914 Bacteria 6355
208 Ga0207671_10041566 3300025914 Bacteria 3403
209 Ga0207671_10058580 3300025914 Bacteria 2856
210 Ga0207671_10317253 3300025914 Bacteria 1233
211 Ga0207693_10010089 3300025915 Bacteria 7672
212 Ga0207693_10018488 3300025915 Bacteria 5551
213 Ga0207693_10030018 3300025915 Bacteria 4292
214 Ga0207663_10006434 3300025916 Bacteria 6008
215 Ga0207663_10014546 3300025916 Bacteria 4312
216 Ga0207663_10021194 3300025916 Bacteria 3696
217 Ga0207660_10025918 3300025917 Bacteria 3987
218 Ga0207660_10085211 3300025917 Bacteria 2330
219 Ga0207660_10098702 3300025917 Bacteria 2179
220 Ga0207649_10045452 3300025920 Bacteria 2693
221 Ga0207649_10058057 3300025920 Bacteria 2422
222 Ga0207649_10091445 3300025920 Bacteria 1993
223 Ga0207652_10019378 3300025921 Bacteria 5594
224 Ga0207652_10080871 3300025921 Bacteria 2841
225 Ga0207694_10082859 3300025924 Bacteria 2521
226 Ga0207694_10108854 3300025924 Bacteria 2202
227 Ga0207694_10296308 3300025924 Bacteria 1331
228 Ga0207650_10120108 3300025925 Bacteria 2045
229 Ga0207687_10109490 3300025927 Bacteria 2047
230 Ga0207687_10255925 3300025927 Bacteria 1394
231 Ga0207700_10028238 3300025928 Bacteria 3941
232 Ga0207700_10242324 3300025928 Bacteria 1537
233 Ga0207664_10155134 3300025929 Bacteria 1949
234 Ga0207664_10189006 3300025929 Bacteria 1772
235 Ga0207644_10034683 3300025931 Bacteria 3532
236 Ga0207706_10136540 3300025933 Bacteria 2157
237 Ga0207706_10221238 3300025933 Bacteria 1658
238 Ga0207665_10208097 3300025939 Bacteria 1428
239 Ga0207665_10208894 3300025939 Bacteria 1425
240 Ga0207711_10071760 3300025941 Bacteria 3005
241 Ga0207711_10275787 3300025941 Bacteria 1548
242 Ga0207661_10004270 3300025944 Bacteria 10004
243 Ga0207661_10019900 3300025944 Bacteria 5009
244 Ga0207679_10229934 3300025945 Bacteria 1565
245 Ga0207667_10051910 3300025949 Bacteria 4321
246 Ga0207667_10141704 3300025949 Bacteria 2475
247 Ga0207667_10206222 3300025949 Bacteria 2015
248 Ga0207667_10236332 3300025949 Bacteria 1871
249 Ga0207651_10037284 3300025960 Bacteria 3184
250 Ga0207651_10255195 3300025960 Bacteria 1437
251 Ga0207639_10010472 3300026041 Bacteria 6423
252 Ga0207639_10037559 3300026041 Bacteria 3598
253 Ga0207639_10143918 3300026041 Bacteria 1990
254 Ga0207639_10262309 3300026041 Bacteria 1512
255 Ga0207678_10039941 3300026067 Bacteria 4070
256 Ga0207678_10042373 3300026067 Bacteria 3943
257 Ga0207678_10130864 3300026067 Bacteria 2140
258 Ga0207678_10252210 3300026067 Bacteria 1511
259 Ga0207708_10060504 3300026075 Bacteria 2891
260 Ga0207702_10428523 3300026078 Bacteria 1280
261 Ga0207702_10442352 3300026078 Bacteria 1260
262 Ga0207674_10057562 3300026116 Bacteria 3940
263 Ga0207674_10082897 3300026116 Bacteria 3207
264 Ga0207674_10117039 3300026116 Bacteria 2636
265 Ga0207675_100033143 3300026118 Bacteria 4813
266 Ga0207683_10088917 3300026121 Bacteria 2749
267 Ga0207698_10141215 3300026142 Bacteria 2075
268 Ga0207698_10468616 3300026142 Bacteria 1219
269 Ga0209389_1000023 3300027296 Bacteria 150730
270 Ga0209589_1000010 3300027357 Bacteria 237657
271 Ga0209489_100011 3300027361 Bacteria 244710
272 Ga0268266_10006027 3300028379 Bacteria 11179
273 Ga0268266_10064115 3300028379 Bacteria 3173
274 Ga0268266_10162581 3300028379 Bacteria 2021
275 Ga0268265_10010132 3300028380 Bacteria 6365
276 Ga0268265_10369527 3300028380 Bacteria 1316
277 Ga0268264_10141202 3300028381 Bacteria 2148
278 Ga0307517_10000085 3300028786 Bacteria 131200
279 Ga0307515_10039862 3300028794 Bacteria 7450
280 Ga0265339_10009066 3300031249 Bacteria 6285
281 Ga0265331_10021647 3300031250 Bacteria 3288
282 Ga0265314_10081846 3300031711 Bacteria 2125
283 Ga0265342_10006824 3300031712 Bacteria 8440
284 Ga0307516_10045593 3300031730 Bacteria 4329
285 Ga0307516_10049467 3300031730 Bacteria 4131
286 Ga0307516_10153314 3300031730 Bacteria 2062
287 Ga0307406_10104987 3300031901 Bacteria 1932
288 Ga0307416_100092339 3300032002 Bacteria 2603
289 Ga0307415_100407808 3300032126 Bacteria 1162
290 Ga0307510_10036621 3300033180 Bacteria 5458
291 Ga0307510_10130239 3300033180 Bacteria 2192
292 Ga0315911_1000010 3300033442 Bacteria 322197
293 Ga0373926_0010149 3300035083 Bacteria 3152
294 Ga0373926_0011513 3300035083 Bacteria 2977
295 Ga0373944_0010032 3300035089 Bacteria 2576
296 Ga0373953_0010516 3300035117 Bacteria 3223
297 Ga0373956_0057759 3300035119 Bacteria 1754
298 Ga0373943_0006580 3300035170 Bacteria 5212
299 Ga0373943_0076550 3300035170 Bacteria 1707
300 Ga0373946_0051217 3300035171 Bacteria 1727
301 Ga0373924_0012841 3300035410 Bacteria 3136
302 Ga0373935_0000259 3300035692 Bacteria 26229
303 Ga0373927_0000339 3300035695 Bacteria 36731
304 Ga0373927_0002379 3300035695 Bacteria 13707
305 Ga0373927_0012044 3300035695 Bacteria 5753
306 Ga0373927_0016655 3300035695 Bacteria 4849
307 Ga0373927_0088787 3300035695 Bacteria 2007
308 Ga0373933_0003061 3300035724 Bacteria 9333
309 Ga0373947_0000217 3300035725 Bacteria 32254
310 Ga0373947_0011904 3300035725 Bacteria 4984
311 Ga0373947_0048091 3300035725 Bacteria 2558
312 Ga0373937_0022213 3300036401 Bacteria 5702
313 Ga0373937_0070599 3300036401 Bacteria 3222
314 Ga0373937_0469908 3300036401 Bacteria 1194
315 Ga0373925_0004501 3300037068 Bacteria 10530
316 Ga0373925_0173209 3300037068 Bacteria 1704
317 Ga0373925_0179546 3300037068 Bacteria 1675
318 Ga0395905_0019046 3300037471 Bacteria 6510
319 Ga0436364_1334513 3300037853 Bacteria 1377
320 Ga0395901_0057616 3300038443 Bacteria 4041
321 Ga0395901_0064581 3300038443 Bacteria 3811
322 Ga0436365_0023590 3300039437 Bacteria 4181
323 Ga0436365_0938537 3300039437 Bacteria 1885
324 Ga0436365_1446014 3300039437 Bacteria 2887
325 Ga0436365_1446425 3300039437 Bacteria 5355
326 Ga0436365_1673545 3300039437 Bacteria 1541
327 Ga0436361_0081107 3300039447 Bacteria 1539
328 Ga0436361_1114449 3300039447 Bacteria 1717
329 Ga0436363_0742244 3300039450 Bacteria 1531
330 Ga0436362_0646134 3300039453 Bacteria 7178
331 Ga0466969_0044014 3300044656 Bacteria 2223
332 Ga0466969_0085228 3300044656 Bacteria 1502
333 Ga0466972_0000520 3300044658 Bacteria 19029
334 Ga0466972_0004454 3300044658 Bacteria 7005
335 Ga0466966_0059000 3300044684 Bacteria 2424
336 Ga0466966_0066368 3300044684 Bacteria 2268
337 Ga0466961_0000149 3300044693 Bacteria 47561
338 Ga0466960_0003292 3300044901 Bacteria 6199
339 Ga0466959_0004087 3300045049 Bacteria 9713
340 Ga0466958_0107640 3300045836 Bacteria 1739
341 Ga0466967_0206070 3300045976 Bacteria 1864
342 Ga0466967_0412996 3300045976 Bacteria 1314
343 Ga0495592_0045306 3300046454 Bacteria 3283
344 Ga0495603_0000352 3300046455 Bacteria 24722
345 Ga0495603_0013852 3300046455 Bacteria 4881
346 Ga0495603_0168157 3300046455 Bacteria 1270
347 Ga0495629_0003719 3300046459 Bacteria 11498
348 Ga0495629_0042670 3300046459 Bacteria 3186
349 Ga0495629_0077072 3300046459 Bacteria 2327
350 Ga0495629_0118718 3300046459 Bacteria 1843
351 Ga0495638_0002610 3300046460 Bacteria 14544
352 Ga0495638_0150487 3300046460 Bacteria 1350
353 Ga0495638_0173691 3300046460 Bacteria 1234
354 Ga0495641_0018952 3300046461 Bacteria 3536
355 Ga0495641_0026296 3300046461 Bacteria 2841
356 Ga0495580_0047201 3300046472 Bacteria 3053
357 Ga0495580_0062999 3300046472 Bacteria 2601
358 Ga0495639_0001973 3300046475 Bacteria 9084
359 Ga0495639_0002472 3300046475 Bacteria 8065
360 Ga0495662_0000872 3300046476 Bacteria 14723
361 Ga0495664_0013868 3300046477 Bacteria 4570
362 Ga0495664_0032321 3300046477 Bacteria 3070
363 Ga0495664_0154024 3300046477 Bacteria 1394
364 Ga0495585_0047515 3300046492 Bacteria 2390
365 Ga0495594_0001257 3300046499 Bacteria 13294
366 Ga0495594_0019990 3300046499 Bacteria 3564
367 Ga0495596_0041048 3300046500 Bacteria 1825
368 Ga0495606_0021592 3300046507 Bacteria 4713
369 Ga0495606_0050798 3300046507 Bacteria 2709
370 Ga0495608_0144634 3300046511 Bacteria 1517
371 Ga0495608_0154648 3300046511 Bacteria 1460
372 Ga0495618_0098788 3300046514 Bacteria 1868
373 Ga0495628_0059443 3300046516 Bacteria 3001
374 Ga0495628_0076574 3300046516 Bacteria 2603
375 Ga0495628_0192352 3300046516 Bacteria 1540
376 Ga0495632_0067308 3300046519 Bacteria 1727
377 Ga0495644_0048274 3300046523 Bacteria 1599
378 Ga0495666_0041105 3300046526 Bacteria 2240
379 Ga0495652_0033678 3300046529 Bacteria 4470
380 Ga0495652_0136093 3300046529 Bacteria 1938
381 Ga0495665_0000361 3300046531 Bacteria 22971
382 Ga0495665_0082956 3300046531 Bacteria 1685
383 Ga0495640_0003002 3300046533 Bacteria 13580
384 Ga0495640_0036139 3300046533 Bacteria 3491
385 Ga0495640_0036471 3300046533 Bacteria 3473
386 Ga0495609_0082180 3300046538 Bacteria 1408
387 Ga0495597_0034517 3300046542 Bacteria 2286
388 Ga0495645_0020761 3300046543 Bacteria 4744
389 Ga0495645_0113386 3300046543 Bacteria 1916
390 Ga0495645_0120232 3300046543 Bacteria 1850
391 Ga0495622_0079669 3300046557 Bacteria 1507
392 Ga0495633_0123606 3300046558 Bacteria 1198
393 Ga0495667_0038334 3300046559 Bacteria 3191
394 Ga0495656_0018728 3300046615 Bacteria 2665
395 Ga0495656_0138565 3300046615 Bacteria 1164
396 Ga0495668_0016367 3300046616 Bacteria 4310
397 Ga0495634_0000249 3300046642 Bacteria 50835
398 Ga0495634_0034343 3300046642 Bacteria 3481
399 Ga0495625_0153889 3300046660 Bacteria 1544
400 Ga0495635_0000239 3300046663 Bacteria 34889
401 Ga0495635_0011527 3300046663 Bacteria 6197
402 Ga0495635_0106089 3300046663 Bacteria 1919
403 Ga0495659_0038199 3300046664 Bacteria 1704
404 Ga0495588_0003787 3300046674 Bacteria 6628
405 Ga0495588_0014080 3300046674 Bacteria 3823
406 Ga0495657_0003492 3300046675 Bacteria 12822
407 Ga0495599_0022511 3300046678 Bacteria 3935
408 Ga0495623_0002296 3300046679 Bacteria 12741
409 Ga0495623_0047010 3300046679 Bacteria 2739
410 Ga0495646_0005453 3300046680 Bacteria 8043
411 Ga0495647_0001674 3300046681 Bacteria 6865
412 Ga0495647_0019253 3300046681 Bacteria 2439
413 Ga0495658_0001058 3300046683 Bacteria 14532
414 Ga0495658_0071454 3300046683 Bacteria 2016
415 Ga0495613_0000929 3300046689 Bacteria 22466
416 Ga0495613_0208176 3300046689 Bacteria 1376
417 Ga0495624_0099539 3300046690 Bacteria 1790
418 Ga0495624_0104140 3300046690 Bacteria 1746
419 Ga0495624_0204832 3300046690 Bacteria 1198
420 Ga0495600_0035084 3300046809 Bacteria 3257
421 Ga0495600_0077649 3300046809 Bacteria 2168
422 Ga0495660_0046424 3300046810 Bacteria 2382
423 Ga0495581_0016881 3300047315 Bacteria 4243
424 Ga0495581_0199072 3300047315 Bacteria 1172
425 Ga0495604_0005469 3300047317 Bacteria 10075
426 Ga0495604_0045025 3300047317 Bacteria 3445
427 Ga0495604_0066699 3300047317 Bacteria 2736
428 Ga0495674_0001854 3300047319 Bacteria 20818
429 Ga0495674_0087826 3300047319 Bacteria 2660
430 Ga0495674_0118713 3300047319 Bacteria 2236
431 Ga0495672_0027086 3300047320 Bacteria 3648
432 Ga0495676_0022316 3300047321 Bacteria 5509
433 Ga0495676_0029475 3300047321 Bacteria 4672
434 Ga0495676_0195425 3300047321 Bacteria 1409
435 Ga0495676_0290494 3300047321 Bacteria 1105
436 Ga0495680_0032224 3300047322 Bacteria 4257
437 Ga0495687_019183 3300047443 Bacteria 3362
438 Ga0495675_0002807 3300047444 Bacteria 10441
439 Ga0495677_0078335 3300047445 Bacteria 1237
440 Ga0495685_039846 3300047447 Bacteria 1608
441 Ga0495673_0033616 3300047469 Bacteria 2378
442 Ga0495684_0009436 3300047471 Bacteria 7533
443 Ga0495684_0043713 3300047471 Bacteria 3431
444 Ga0495686_0073671 3300047472 Bacteria 2097
445 Ga0495593_0000034 3300047673 Bacteria 57993
446 Ga0495593_0158705 3300047673 Bacteria 1142
447 Ga0495602_0049097 3300048088 Bacteria 3783
448 Ga0495615_0008880 3300048090 Bacteria 1957
449 Ga0496100_0094668 3300048903 Bacteria 2046
450 Ga0496101_0040575 3300048904 Bacteria 3315
451 Ga0496101_0143524 3300048904 Bacteria 1822
452 Ga0496103_0005710 3300048906 Bacteria 7435
453 Ga0496104_0015916 3300048907 Bacteria 6825
454 Ga0496104_0253556 3300048907 Bacteria 1672
455 Ga0496104_0356272 3300048907 Bacteria 1376
456 Ga0496104_0412918 3300048907 Bacteria 1262
457 Ga0496105_0034901 3300048908 Bacteria 4138
458 Ga0496105_0051425 3300048908 Bacteria 3404
459 Ga0496105_0168740 3300048908 Bacteria 1795
460 Ga0496106_0032306 3300048909 Bacteria 3902
461 Ga0496107_0051082 3300048910 Bacteria 2981
462 Ga0496107_0178459 3300048910 Bacteria 1577
463 Ga0496107_0184688 3300048910 Bacteria 1549
464 Ga0496107_0272553 3300048910 Bacteria 1260
465 Ga0496109_0054328 3300048912 Bacteria 3653
466 Ga0496109_0131145 3300048912 Bacteria 2339
467 Ga0496109_0206443 3300048912 Bacteria 1847
468 Ga0496110_0013275 3300048913 Bacteria 6803
469 Ga0496110_0067610 3300048913 Bacteria 3162
470 Ga0496110_0099197 3300048913 Bacteria 2611
471 Ga0496110_0100133 3300048913 Bacteria 2598
472 Ga0496110_0248830 3300048913 Bacteria 1618
473 Ga0496112_0035334 3300048915 Bacteria 4868
474 Ga0496112_0035784 3300048915 Bacteria 4839
475 Ga0496112_0138008 3300048915 Bacteria 2408
476 Ga0496113_0083357 3300048916 Bacteria 2453
477 Ga0496113_0163077 3300048916 Bacteria 1763
478 Ga0496113_0317986 3300048916 Bacteria 1247
479 Ga0496114_0028100 3300048917 Bacteria 4613
480 Ga0496114_0071880 3300048917 Bacteria 2908
481 Ga0496114_0133540 3300048917 Bacteria 2145
482 Ga0496114_0370647 3300048917 Bacteria 1267
483 Ga0496115_0037983 3300048918 Bacteria 3819
484 Ga0496115_0121411 3300048918 Bacteria 2150
485 Ga0496116_0101606 3300048919 Bacteria 1716
486 Ga0496117_0047573 3300048920 Bacteria 3074
487 Ga0496118_0017089 3300048921 Bacteria 6622
488 Ga0496119_0058779 3300048922 Bacteria 2314
489 Ga0496119_0193247 3300048922 Bacteria 1059
490 Ga0496120_0021761 3300048923 Bacteria 4044
491 Ga0496121_0015642 3300048924 Bacteria 7916
492 Ga0496121_0050475 3300048924 Bacteria 3514
493 Ga0496121_0050757 3300048924 Bacteria 3501
494 Ga0496121_0077328 3300048924 Bacteria 2650
495 Ga0496121_0118993 3300048924 Bacteria 1998
496 Ga0496122_0080318 3300048925 Bacteria 2275
497 Ga0496124_0275469 3300048927 Bacteria 1230
498 Ga0496125_0028183 3300048928 Bacteria 5078
499 Ga0496125_0135448 3300048928 Bacteria 1724
500 Ga0496126_0009402 3300048929 Bacteria 10385
501 Ga0496126_0020832 3300048929 Bacteria 6418
502 Ga0496126_0030411 3300048929 Bacteria 5116
503 Ga0496126_0031723 3300048929 Bacteria 4986
504 Ga0496126_0111509 3300048929 Bacteria 2382
505 Ga0496126_0144421 3300048929 Bacteria 2045
506 Ga0496126_0235808 3300048929 Bacteria 1531
507 Ga0501032_0003534 3300049569 Bacteria 11926
508 Ga0501032_0076324 3300049569 Bacteria 2231
509 Ga0501033_0000249 3300049570 Bacteria 52045
510 Ga0501033_0000951 3300049570 Bacteria 26299
511 Ga0501034_0001938 3300049571 Bacteria 26206
512 Ga0501036_0004433 3300049572 Bacteria 11343
513 Ga0501036_0090479 3300049572 Bacteria 2585
514 Ga0501037_0000112 3300049573 Bacteria 75698
515 Ga0501037_0004019 3300049573 Bacteria 10664
516 Ga0501038_0000160 3300049574 Bacteria 57443
517 Ga0501038_0018478 3300049574 Bacteria 6294
518 Ga0501039_0011683 3300049575 Bacteria 6689
519 Ga0501039_0049318 3300049575 Bacteria 3254
520 Ga0501039_0168331 3300049575 Bacteria 1723
521 Ga0501042_0068679 3300049578 Bacteria 2534
522 Ga0501043_0000278 3300049579 Bacteria 46214
523 Ga0501043_0016672 3300049579 Bacteria 5756
524 Ga0501046_0000937 3300049580 Bacteria 28581
525 Ga0501046_0029168 3300049580 Bacteria 4487
526 Ga0501047_0000275 3300049581 Bacteria 59536
527 Ga0501048_0001248 3300049582 Bacteria 19253
528 Ga0501067_0000258 3300049583 Bacteria 28937
529 Ga0501067_0126237 3300049583 Bacteria 1424
530 Ga0501068_0004146 3300049584 Bacteria 7852
531 Ga0501069_0002032 3300049585 Bacteria 10137
532 Ga0501070_0002548 3300049586 Bacteria 15964
533 Ga0501070_0044688 3300049586 Bacteria 3684
534 Ga0501071_0038499 3300049587 Bacteria 3418
535 Ga0501071_0077213 3300049587 Bacteria 2433
536 Ga0501072_0006863 3300049588 Bacteria 8639
537 Ga0501073_0000103 3300049589 Bacteria 53962
538 Ga0501074_0025367 3300049590 Bacteria 4305
539 Ga0501079_0000451 3300049741 Bacteria 26871
540 Ga0501080_0002998 3300049742 Bacteria 14886
541 Ga0501080_0022860 3300049742 Bacteria 5796
542 Ga0501081_0333418 3300049743 Bacteria 1116
543 Ga0501083_0013394 3300049744 Bacteria 5732
544 Ga0501035_0000766 3300049822 Bacteria 34513
545 Ga0501044_0000418 3300049823 Bacteria 52554
546 Ga0501044_0071079 3300049823 Bacteria 3539
547 Ga0501044_0080760 3300049823 Bacteria 3293
548 Ga0501045_0012804 3300049824 Bacteria 5910
549 nmdc:mga03n38_77785_c1 3300050490 Bacteria 1551
550 nmdc:mga00v17_106119_c1 3300050491 Bacteria 1778
551 nmdc:mga00v17_156197_c1 3300050491 Bacteria 1467
552 nmdc:mga0yw44_1397_c1 3300050492 Bacteria 9573
553 nmdc:mga0yw44_20742_c1 3300050492 Bacteria 3653
554 nmdc:mga0yw44_57310_c1 3300050492 Bacteria 2376
555 nmdc:mga06z11_84251_c1 3300050494 Bacteria 1713
556 nmdc:mga06z11_86734_c1 3300050494 Bacteria 1691
557 nmdc:mga07m45_45292_c1 3300050496 Bacteria 2470
558 nmdc:mga07m45_48977_c1 3300050496 Bacteria 2377
559 nmdc:mga05p37_62404_c1 3300050507 Bacteria 4586
560 nmdc:mga09592_255513_c1 3300050508 Bacteria 1519
561 nmdc:mga08y16_302874_c1 3300050511 Bacteria 1647
562 nmdc:mga0n895_181060_c1 3300050512 Bacteria 2139
563 nmdc:mga0rr50_27857_c1 3300050513 Bacteria 3963
564 nmdc:mga0sz30_20733_c1 3300050516 Bacteria 2654
565 Ga0495601_0097002 3300053077 Bacteria 1902
566 Ga0495601_0103756 3300053077 Bacteria 1838
567 Ga0500610_0063990 3300053079 Bacteria 1919
568 Ga0500635_0016901 3300053080 Bacteria 2177
569 Ga0495619_0191674 3300053085 Bacteria 1415
570 Ga0500578_0045489 3300053086 Bacteria 2816
571 Ga0500643_000267 3300053087 Bacteria 46005
572 Ga0500643_041816 3300053087 Bacteria 1344
573 Ga0500651_0060147 3300053093 Bacteria 2374
574 Ga0500566_0000185 3300053094 Bacteria 32171
575 Ga0500566_0001146 3300053094 Bacteria 15389
576 Ga0500566_0001213 3300053094 Bacteria 15085
577 Ga0500640_040072 3300053095 Bacteria 2058
578 Ga0500555_026660 3300053103 Bacteria 1651
579 Ga0500562_001577 3300053108 Bacteria 5663
580 Ga0500572_000384 3300053111 Bacteria 15705
581 Ga0500572_008551 3300053111 Bacteria 2397
582 Ga0500594_0032137 3300053118 Bacteria 1389
583 Ga0500595_003818 3300053119 Bacteria 6928
584 Ga0500607_115620 3300053121 Bacteria 1307
585 Ga0500614_001219 3300053123 Bacteria 6263
586 Ga0500642_0066734 3300053130 Bacteria 1628
587 Ga0500652_041981 3300053131 Bacteria 1844
588 Ga0500658_0043983 3300053134 Bacteria 1800
589 Ga0500559_0000863 3300053136 Bacteria 19480
590 Ga0500559_0102704 3300053136 Bacteria 1318
591 Ga0500564_055337 3300053138 Bacteria 1809
592 Ga0500588_0009279 3300053146 Bacteria 2334
593 Ga0500590_133198 3300053148 Bacteria 1147
594 Ga0500603_002337 3300053150 Bacteria 4164
595 Ga0500603_031697 3300053150 Bacteria 1367
596 Ga0500616_0000166 3300053153 Bacteria 110141
597 Ga0500630_013860 3300053159 Bacteria 3968
598 Ga0500634_0052688 3300053161 Bacteria 2184
599 Ga0500638_001014 3300053162 Bacteria 8145
600 Ga0500639_000010 3300053163 Bacteria 136747
601 Ga0500636_0001916 3300053177 Bacteria 11425
602 Ga0500637_0000121 3300053178 Bacteria 28204
603 Ga0500637_0027260 3300053178 Bacteria 3153
604 Ga0500611_014364 3300053727 Bacteria 1380
605 Ga0500596_002495 3300053735 Bacteria 3628
606 Ga0500596_004734 3300053735 Bacteria 2469
607 Ga0500599_000459 3300053736 Bacteria 4213
608 Ga0501084_0003972 3300054114 Bacteria 12046
609 Ga0500661_000452 3300055283 Bacteria 7586
610 Ga0501082_0025989 3300060353 Bacteria 5046

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0067610 Ga0496110_0067610_2235_3146 299
2 3300044656 Ga0466969_0044014 Ga0466969_0044014_483_1478 308
3 3300005434 Ga0070709_10265907 Ga0070709_102659071 309
4 3300025929 Ga0207664_10189006 Ga0207664_101890062 309
5 3300035083 Ga0373926_0011513 Ga0373926_0011513_1704_2702 310
6 3300035089 Ga0373944_0010032 Ga0373944_0010032_102_1100 310
7 3300035117 Ga0373953_0010516 Ga0373953_0010516_1133_2131 310
8 3300035119 Ga0373956_0057759 Ga0373956_0057759_200_1201 310
9 3300035410 Ga0373924_0012841 Ga0373924_0012841_1175_2173 310
10 3300035695 Ga0373927_0012044 Ga0373927_0012044_3481_4479 310
11 3300035725 Ga0373947_0048091 Ga0373947_0048091_1336_2337 310
12 3300036401 Ga0373937_0469908 Ga0373937_0469908_136_1134 310
13 3300046459 Ga0495629_0077072 Ga0495629_0077072_1289_2290 310
14 3300046472 Ga0495580_0047201 Ga0495580_0047201_1961_2962 310
15 3300046475 Ga0495639_0002472 Ga0495639_0002472_4453_5454 310
16 3300046511 Ga0495608_0144634 Ga0495608_0144634_41_1042 310
17 3300046514 Ga0495618_0098788 Ga0495618_0098788_587_1588 310
18 3300046516 Ga0495628_0076574 Ga0495628_0076574_15_1016 310
19 3300046531 Ga0495665_0082956 Ga0495665_0082956_374_1372 310
20 3300046543 Ga0495645_0120232 Ga0495645_0120232_556_1557 310
21 3300046642 Ga0495634_0034343 Ga0495634_0034343_614_1615 310
22 3300046663 Ga0495635_0106089 Ga0495635_0106089_136_1137 310
23 3300046679 Ga0495623_0047010 Ga0495623_0047010_1454_2455 310
24 3300046681 Ga0495647_0019253 Ga0495647_0019253_930_1928 310
25 3300046683 Ga0495658_0071454 Ga0495658_0071454_964_1962 310
26 3300047315 Ga0495581_0016881 Ga0495581_0016881_76_1077 310
27 3300047317 Ga0495604_0045025 Ga0495604_0045025_221_1222 310
28 3300047319 Ga0495674_0087826 Ga0495674_0087826_112_1113 310
29 3300047321 Ga0495676_0195425 Ga0495676_0195425_142_1143 310
30 3300047471 Ga0495684_0009436 Ga0495684_0009436_1398_2396 310
31 3300053077 Ga0495601_0103756 Ga0495601_0103756_494_1495 310
32 3300037068 Ga0373925_0179546 Ga0373925_0179546_612_1559 313
33 3300048929 Ga0496126_0020832 Ga0496126_0020832_4540_5538 314
34 3300005467 Ga0070706_100258990 Ga0070706_1002589901 316
35 3300005471 Ga0070698_100019627 Ga0070698_1000196274 316
36 3300025253 Ga0209677_103126 Ga0209677_1031263 316
37 3300025910 Ga0207684_10239989 Ga0207684_102399891 316
38 3300005983 Ga0081540_1070485 Ga0081540_10704853 317
39 3300005539 Ga0068853_100099309 Ga0068853_1000993091 320
40 3300005548 Ga0070665_100206548 Ga0070665_1002065481 320
41 3300005563 Ga0068855_100049698 Ga0068855_1000496982 320
42 3300010375 Ga0105239_10118056 Ga0105239_101180562 320
43 3300025924 Ga0207694_10082859 Ga0207694_100828593 320
44 3300025949 Ga0207667_10206222 Ga0207667_102062221 320
45 3300026041 Ga0207639_10143918 Ga0207639_101439182 320
46 3300028379 Ga0268266_10162581 Ga0268266_101625811 320
47 3300048917 Ga0496114_0133540 Ga0496114_0133540_321_1352 320
48 3300009545 Ga0105237_10074463 Ga0105237_100744633 321
49 3300009551 Ga0105238_10035119 Ga0105238_100351193 321
50 3300013296 Ga0157374_10032938 Ga0157374_100329385 321
51 3300025914 Ga0207671_10014027 Ga0207671_100140275 321
52 3300046557 Ga0495622_0079669 Ga0495622_0079669_373_1347 322
53 iso_pu_bacteria 2507262055 2507511009 322
54 iso_pu_bacteria 2508501009 2508544830 322
55 iso_pu_bacteria 2508501042 2508696942 322
56 iso_pu_bacteria 2508501128 2509148872 322
57 iso_pu_bacteria 2513237092 2513623483 322
58 iso_pu_bacteria 2513237094 2513637471 322
59 iso_pu_bacteria 2513237096 2513655023 322
60 iso_pu_bacteria 2513237101 2513697429 322
61 iso_pu_bacteria 2513237104 2513716914 322
62 iso_pu_bacteria 2513237137 2513861038 322
63 iso_pu_bacteria 2513237139 2513874649 322
64 iso_pu_bacteria 2513237145 2513915954 322
65 iso_pu_bacteria 2515154112 2515625439 322
66 iso_pu_bacteria 2517572143 2517894740 322
67 iso_pu_bacteria 2524023228 2524534489 322
68 iso_pu_bacteria 2528768022 2528849823 322
69 iso_pu_bacteria 2667528175 2671119154 322
70 iso_pu_bacteria 2721755755 2723843079 322
71 iso_pu_bacteria 2791355196 2793064661 322
72 iso_pu_bacteria 2791355199 2793079514 322
73 iso_pu_bacteria 2802429603 2805916646 322
74 iso_pu_bacteria 2824600985 2824607727 322
75 iso_pu_bacteria 2824609381 2824617135 322
76 iso_pu_bacteria 2824617872 2824624257 322
77 iso_pu_bacteria 2824626560 2824633061 322
78 iso_pu_bacteria 2824635225 2824643384 322
79 iso_pu_bacteria 2824644064 2824648779 322
80 iso_pu_bacteria 2824653114 2824658708 322
81 iso_pu_bacteria 2824671348 2824676175 322
82 iso_pu_bacteria 2824687955 2824692367 322
83 iso_pu_bacteria 2824696289 2824704000 322
84 iso_pu_bacteria 2824704595 2824713584 322
85 iso_pu_bacteria 2824714736 2824722396 322
86 iso_pu_bacteria 2824723954 2824731665 322
87 iso_pu_bacteria 2824753945 2824761221 322
88 iso_pu_bacteria 2824763712 2824771854 322
89 iso_pu_bacteria 2838122688 2838127893 322
90 iso_pu_bacteria 2841941048 2841943186 322
91 iso_pu_bacteria 2841949485 2841954083 322
92 iso_pu_bacteria 2841957949 2841960222 322
93 iso_pu_bacteria 2841983080 2841987990 322
94 iso_pu_bacteria 2847939898 2847944240 322
95 iso_pu_bacteria 2849076700 2849081527 322
96 iso_pu_bacteria 2874590934 2874597746 322
97 iso_pu_bacteria 2874604998 2874612590 322
98 iso_pu_bacteria 2874612657 2874617700 322
99 iso_pu_bacteria 2874620515 2874623438 322
100 iso_pu_bacteria 2874645413 2874651275 322
101 iso_pu_bacteria 2876761206 2876762405 322
102 iso_pu_bacteria 2876771140 2876776346 322
103 iso_pu_bacteria 2876808645 2876812896 322
104 iso_pu_bacteria 2876818435 2876820914 322
105 iso_pu_bacteria 2879074833 2879081791 322
106 iso_pu_bacteria 2879099564 2879101352 322
107 iso_pu_bacteria 2879110137 2879118031 322
108 iso_pu_bacteria 2879127579 2879130506 322
109 iso_pu_bacteria 2879142872 2879146392 322
110 iso_pu_bacteria 2881364244 2881370677 322
111 iso_pu_bacteria 2881665667 2881672687 322
112 iso_pu_bacteria 2885374607 2885378763 322
113 iso_pu_bacteria 2885409591 2885413435 322
114 iso_pu_bacteria 2888378607 2888381527 322
115 iso_pu_bacteria 2888388044 2888389112 322
116 iso_pu_bacteria 2889033259 2889033619 322
117 iso_pu_bacteria 2903748898 2903751423 322
118 iso_pu_bacteria 2904666416 2904667331 322
119 iso_pu_bacteria 2904699407 2904705786 322
120 iso_pu_bacteria 2904711408 2904719225 322
121 iso_pu_bacteria 2906610324 2906611460 322
122 iso_pu_bacteria 2906626472 2906635176 322
123 iso_pu_bacteria 2906635258 2906641702 322
124 iso_pu_bacteria 2906660503 2906660804 322
125 iso_pu_bacteria 2908739725 2908745052 322
126 iso_pu_bacteria 2922361189 2922366988 322
127 iso_pu_bacteria 2922368715 2922371195 322
128 iso_pu_bacteria 2922386360 2922390231 322
129 iso_pu_bacteria 2922425934 2922427897 322
130 iso_pu_bacteria 2929615660 2929619579 322
131 iso_pu_bacteria 2929624759 2929627951 322
132 iso_pu_bacteria 2932784394 2932785909 322
133 iso_pu_bacteria 2932809354 2932817280 322
134 iso_pu_bacteria 2932818245 2932826877 322
135 iso_pu_bacteria 2932828146 2932830953 322
136 iso_pu_bacteria 2933577622 2933581499 322
137 iso_pu_bacteria 2935616580 2935621018 322
138 iso_pu_bacteria 2935630451 2935632175 322
139 iso_pu_bacteria 2935638405 2935640094 322
140 iso_pu_bacteria 2935665750 2935667067 322
141 iso_pu_bacteria 2935684952 2935690199 322
142 iso_pu_bacteria 2935703347 2935704823 322
143 iso_pu_bacteria 2935713505 2935718104 322
144 iso_pu_bacteria 2935722832 2935726746 322
145 iso_pu_bacteria 2935732158 2935735515 322
146 iso_pu_bacteria 2935741537 2935745214 322
147 iso_pu_bacteria 2935750917 2935755210 322
148 iso_pu_bacteria 2935760218 2935762273 322
149 iso_pu_bacteria 2935769743 2935773660 322
150 iso_pu_bacteria 2935777560 2935780215 322
151 iso_pu_bacteria 2935785616 2935788435 322
152 iso_pu_bacteria 2935793552 2935796591 322
153 iso_pu_bacteria 2935801545 2935803775 322
154 iso_pu_bacteria 2935810662 2935811691 322
155 iso_pu_bacteria 2935827899 2935829577 322
156 iso_pu_bacteria 2935837841 2935843089 322
157 iso_pu_bacteria 2935855204 2935858825 322
158 iso_pu_bacteria 2935864058 2935866777 322
159 iso_pu_bacteria 2935873716 2935876908 322
160 iso_pu_bacteria 2935959822 2935962047 322
161 iso_pu_bacteria 2935975950 2935976650 322
162 iso_pu_bacteria 2935984226 2935990726 322
163 iso_pu_bacteria 2935992306 2935993455 322
164 iso_pu_bacteria 2936002035 2936004350 322
165 iso_pu_bacteria 2936037263 2936038273 322
166 iso_pu_bacteria 2940556831 2940561509 322
167 iso_pu_bacteria 2941507105 2941508123 322
168 iso_pu_bacteria 2941515067 2941515372 322
169 iso_pu_bacteria 2941523033 2941524053 322
170 iso_pu_bacteria 2941538514 2941544313 322
171 iso_pu_bacteria 3005474847 3005477607 322
172 iso_pu_bacteria 3005483717 3005486186 322
173 iso_pu_bacteria 3005587118 3005588495 322
174 iso_pu_bacteria 3005710791 3005712619 322
175 iso_pu_bacteria 3005718088 3005719680 322
176 iso_pu_bacteria 8006926726 8006932251 322
177 iso_pu_bacteria 8006933436 8006933610 322
178 iso_pu_bacteria 8006964411 8006966524 322
179 iso_pu_bacteria 8006973647 8006983283 322
180 iso_pu_bacteria 8016511872 8016516432 322
181 iso_pu_bacteria 8016530956 8016537364 322
182 iso_pu_bacteria 8016539877 8016541633 322
183 iso_pu_bacteria 8016548790 8016551635 322
184 iso_pu_bacteria 8016557553 8016560021 322
185 iso_pu_bacteria 8016566248 8016567018 322
186 iso_pu_bacteria 8016595262 8016597946 322
187 iso_pu_bacteria 8016603502 8016604086 322
188 iso_pu_bacteria 8016613128 8016620668 322
189 iso_pu_bacteria 8016622563 8016629330 322
190 iso_pu_bacteria 8017057580 8017060105 322
191 iso_pu_bacteria 8019530166 8019537047 322
192 iso_pu_bacteria 8019538911 8019542493 322
193 iso_pu_bacteria 8019547302 8019548261 322
194 iso_pu_bacteria 8019555841 8019559547 322
195 iso_pu_bacteria 8019565922 8019569650 322
196 iso_pu_bacteria 8019576017 8019579615 322
197 iso_pu_bacteria 8019586578 8019587326 322
198 iso_pu_bacteria 8019597564 8019604015 322
199 iso_pu_bacteria 8019608314 8019614513 322
200 iso_pu_bacteria 8019619141 8019625140 322
201 iso_pu_bacteria 8019629233 8019637040 322
202 iso_pu_bacteria 8019638758 8019642563 322
203 iso_pu_bacteria 8019648815 8019650022 322
204 iso_pu_bacteria 8019659431 8019664882 322
205 iso_pu_bacteria 8019668869 8019674442 322
206 iso_pu_bacteria 8019678201 8019681661 322
207 iso_pu_bacteria 8055742211 8055749163 322
208 iso_pu_bacteria 8056673599 8056674868 322
209 iso_pu_bacteria 8056681323 8056682385 322
210 iso_pu_bacteria 8056967851 8056969724 322
211 iso_pu_bacteria 2513237141 2513892082 323
212 3300005436 Ga0070713_100033799 Ga0070713_1000337991 324
213 3300005436 Ga0070713_100128657 Ga0070713_1001286572 324
214 3300005535 Ga0070684_100209620 Ga0070684_1002096202 324
215 3300005539 Ga0068853_100118906 Ga0068853_1001189062 324
216 3300005563 Ga0068855_100079756 Ga0068855_1000797563 324
217 3300009093 Ga0105240_10482159 Ga0105240_104821592 324
218 3300009545 Ga0105237_10153473 Ga0105237_101534732 324
219 3300013104 Ga0157370_10044147 Ga0157370_100441473 324
220 3300013104 Ga0157370_10210557 Ga0157370_102105572 324
221 3300013105 Ga0157369_10012925 Ga0157369_100129253 324
222 3300013105 Ga0157369_10043079 Ga0157369_100430793 324
223 3300013307 Ga0157372_10171321 Ga0157372_101713212 324
224 3300025904 Ga0207647_10090069 Ga0207647_100900691 324
225 3300025913 Ga0207695_10147543 Ga0207695_101475432 324
226 3300037853 Ga0436364_1334513 Ga0436364_1334513_351_1337 324
227 3300039437 Ga0436365_0023590 Ga0436365_0023590_1290_2276 324
228 3300039437 Ga0436365_0938537 Ga0436365_0938537_264_1250 324
229 3300045976 Ga0466967_0206070 Ga0466967_0206070_11_1018 324
230 iso_pu_bacteria 2511231028 2511394081 324
231 iso_pu_bacteria 2513237102 2513699952 324
232 iso_pu_bacteria 2524023205 2524438189 324
233 iso_pu_bacteria 2617270735 2617350773 324
234 iso_pu_bacteria 2744054633 2745076929 324
235 iso_pu_bacteria 2824661429 2824668263 324
236 iso_pu_bacteria 2824746037 2824751537 324
237 iso_pu_bacteria 2824773399 2824780545 324
238 iso_pu_bacteria 2857509624 2857512186 324
239 iso_pu_bacteria 2885366525 2885366938 324
240 iso_pu_bacteria 2888419890 2888421930 324
241 iso_pu_bacteria 2935675223 2935680290 324
242 iso_pu_bacteria 2935694250 2935699715 324
243 3300005457 Ga0070662_100133874 Ga0070662_1001338742 325
244 3300014326 Ga0157380_10196934 Ga0157380_101969342 325
245 3300003215 JGI25153J46596_10004246 JGI25153J46596_100042461 326
246 3300003215 JGI25153J46596_10009718 JGI25153J46596_100097182 326
247 3300003215 JGI25153J46596_10028250 JGI25153J46596_100282502 326
248 3300003354 JGI25160J50197_1001885 JGI25160J50197_10018855 326
249 3300003762 Ga0055542_1008536 Ga0055542_10085362 326
250 3300003794 Ga0055531_10005281 Ga0055531_100052813 326
251 3300005262 Ga0065165_1004931 Ga0065165_10049315 326
252 3300005262 Ga0065165_1009824 Ga0065165_10098243 326
253 3300005262 Ga0065165_1015966 Ga0065165_10159661 326
254 3300005329 Ga0070683_100005294 Ga0070683_1000052948 326
255 3300005329 Ga0070683_100005592 Ga0070683_1000055927 326
256 3300005331 Ga0070670_100121633 Ga0070670_1001216332 326
257 3300005334 Ga0068869_100038866 Ga0068869_1000388662 326
258 3300005334 Ga0068869_100088815 Ga0068869_1000888152 326
259 3300005336 Ga0070680_100016152 Ga0070680_1000161523 326
260 3300005336 Ga0070680_100035140 Ga0070680_1000351403 326
261 3300005337 Ga0070682_100096754 Ga0070682_1000967542 326
262 3300005339 Ga0070660_100029630 Ga0070660_1000296301 326
263 3300005341 Ga0070691_10105503 Ga0070691_101055032 326
264 3300005344 Ga0070661_100075427 Ga0070661_1000754272 326
265 3300005355 Ga0070671_100077140 Ga0070671_1000771402 326
266 3300005355 Ga0070671_100127629 Ga0070671_1001276292 326
267 3300005355 Ga0070671_100161101 Ga0070671_1001611011 326
268 3300005356 Ga0070674_100220894 Ga0070674_1002208941 326
269 3300005364 Ga0070673_100054667 Ga0070673_1000546673 326
270 3300005434 Ga0070709_10001417 Ga0070709_100014175 326
271 3300005434 Ga0070709_10007249 Ga0070709_100072494 326
272 3300005434 Ga0070709_10049645 Ga0070709_100496452 326
273 3300005435 Ga0070714_100018262 Ga0070714_1000182625 326
274 3300005437 Ga0070710_10000633 Ga0070710_100006337 326
275 3300005437 Ga0070710_10008834 Ga0070710_100088341 326
276 3300005439 Ga0070711_100001478 Ga0070711_1000014784 326
277 3300005439 Ga0070711_100011186 Ga0070711_1000111864 326
278 3300005455 Ga0070663_100047179 Ga0070663_1000471793 326
279 3300005455 Ga0070663_100120978 Ga0070663_1001209781 326
280 3300005455 Ga0070663_100159892 Ga0070663_1001598922 326
281 3300005456 Ga0070678_100127777 Ga0070678_1001277772 326
282 3300005456 Ga0070678_100194575 Ga0070678_1001945752 326
283 3300005457 Ga0070662_100096892 Ga0070662_1000968922 326
284 3300005458 Ga0070681_10040433 Ga0070681_100404332 326
285 3300005458 Ga0070681_10101517 Ga0070681_101015171 326
286 3300005458 Ga0070681_10153891 Ga0070681_101538912 326
287 3300005518 Ga0070699_100054802 Ga0070699_1000548022 326
288 3300005530 Ga0070679_100024858 Ga0070679_1000248585 326
289 3300005530 Ga0070679_100136505 Ga0070679_1001365052 326
290 3300005530 Ga0070679_100143535 Ga0070679_1001435352 326
291 3300005535 Ga0070684_100005206 Ga0070684_1000052064 326
292 3300005539 Ga0068853_100038556 Ga0068853_1000385563 326
293 3300005539 Ga0068853_100057494 Ga0068853_1000574942 326
294 3300005539 Ga0068853_100213997 Ga0068853_1002139972 326
295 3300005547 Ga0070693_100075808 Ga0070693_1000758082 326
296 3300005548 Ga0070665_100546352 Ga0070665_1005463521 326
297 3300005563 Ga0068855_100210097 Ga0068855_1002100973 326
298 3300005563 Ga0068855_100397248 Ga0068855_1003972481 326
299 3300005563 Ga0068855_100398324 Ga0068855_1003983242 326
300 3300005577 Ga0068857_100072650 Ga0068857_1000726502 326
301 3300005577 Ga0068857_100114359 Ga0068857_1001143592 326
302 3300005578 Ga0068854_100098644 Ga0068854_1000986442 326
303 3300005614 Ga0068856_100187170 Ga0068856_1001871702 326
304 3300005614 Ga0068856_100503048 Ga0068856_1005030481 326
305 3300005616 Ga0068852_100032693 Ga0068852_1000326932 326
306 3300005617 Ga0068859_100069977 Ga0068859_1000699773 326
307 3300005618 Ga0068864_100047790 Ga0068864_1000477903 326
308 3300005719 Ga0068861_100032076 Ga0068861_1000320763 326
309 3300005841 Ga0068863_100157256 Ga0068863_1001572562 326
310 3300005841 Ga0068863_100342243 Ga0068863_1003422432 326
311 3300005843 Ga0068860_100051464 Ga0068860_1000514642 326
312 3300005937 Ga0081455_10006756 Ga0081455_100067568 326
313 3300005983 Ga0081540_1027848 Ga0081540_10278482 326
314 3300006028 Ga0070717_10005443 Ga0070717_100054437 326
315 3300006028 Ga0070717_10121422 Ga0070717_101214222 326
316 3300006038 Ga0075365_10071742 Ga0075365_100717422 326
317 3300006038 Ga0075365_10100654 Ga0075365_101006542 326
318 3300006048 Ga0075363_100047166 Ga0075363_1000471662 326
319 3300006051 Ga0075364_10109173 Ga0075364_101091731 326
320 3300006163 Ga0070715_10152801 Ga0070715_101528011 326
321 3300006173 Ga0070716_100026542 Ga0070716_1000265422 326
322 3300006173 Ga0070716_100097370 Ga0070716_1000973702 326
323 3300006175 Ga0070712_100011086 Ga0070712_1000110861 326
324 3300006175 Ga0070712_100035217 Ga0070712_1000352172 326
325 3300006175 Ga0070712_100160308 Ga0070712_1001603081 326
326 3300006177 Ga0075362_10032986 Ga0075362_100329862 326
327 3300006178 Ga0075367_10039628 Ga0075367_100396282 326
328 3300006178 Ga0075367_10044973 Ga0075367_100449732 326
329 3300006178 Ga0075367_10090256 Ga0075367_100902562 326
330 3300006195 Ga0075366_10031599 Ga0075366_100315993 326
331 3300006195 Ga0075366_10090918 Ga0075366_100909182 326
332 3300006237 Ga0097621_100060854 Ga0097621_1000608542 326
333 3300006353 Ga0075370_10017964 Ga0075370_100179643 326
334 3300006353 Ga0075370_10039171 Ga0075370_100391712 326
335 3300006844 Ga0075428_100320575 Ga0075428_1003205752 326
336 3300006880 Ga0075429_100295759 Ga0075429_1002957591 326
337 3300006931 Ga0097620_100069979 Ga0097620_1000699793 326
338 3300006943 Ga0099822_1000022 Ga0099822_100002212 326
339 3300007076 Ga0075435_100106565 Ga0075435_1001065652 326
340 3300007265 Ga0099794_10060117 Ga0099794_100601172 326
341 3300007788 Ga0099795_10024142 Ga0099795_100241421 326
342 3300009093 Ga0105240_10015270 Ga0105240_100152706 326
343 3300009093 Ga0105240_10204385 Ga0105240_102043852 326
344 3300009093 Ga0105240_10249530 Ga0105240_102495301 326
345 3300009094 Ga0111539_10563759 Ga0111539_105637591 326
346 3300009098 Ga0105245_10086340 Ga0105245_100863402 326
347 3300009098 Ga0105245_10144896 Ga0105245_101448962 326
348 3300009101 Ga0105247_10052860 Ga0105247_100528602 326
349 3300009147 Ga0114129_10151279 Ga0114129_101512793 326
350 3300009174 Ga0105241_10071350 Ga0105241_100713502 326
351 3300009174 Ga0105241_10151253 Ga0105241_101512532 326
352 3300009174 Ga0105241_10265661 Ga0105241_102656612 326
353 3300009177 Ga0105248_10306356 Ga0105248_103063562 326
354 3300009177 Ga0105248_10605922 Ga0105248_106059222 326
355 3300009545 Ga0105237_10015378 Ga0105237_100153783 326
356 3300009545 Ga0105237_10062087 Ga0105237_100620872 326
357 3300009551 Ga0105238_10039569 Ga0105238_100395692 326
358 3300009551 Ga0105238_10059830 Ga0105238_100598304 326
359 3300009551 Ga0105238_10341775 Ga0105238_103417751 326
360 3300009553 Ga0105249_10323730 Ga0105249_103237301 326
361 3300009553 Ga0105249_10410469 Ga0105249_104104691 326
362 3300010375 Ga0105239_10044175 Ga0105239_100441752 326
363 3300010375 Ga0105239_10090525 Ga0105239_100905255 326
364 3300010375 Ga0105239_10111939 Ga0105239_101119393 326
365 3300011119 Ga0105246_10056010 Ga0105246_100560102 326
366 3300011119 Ga0105246_10106980 Ga0105246_101069802 326
367 3300013105 Ga0157369_10065240 Ga0157369_100652403 326
368 3300013105 Ga0157369_10211345 Ga0157369_102113452 326
369 3300013296 Ga0157374_10138837 Ga0157374_101388372 326
370 3300013307 Ga0157372_10296379 Ga0157372_102963792 326
371 3300014325 Ga0163163_10098820 Ga0163163_100988202 326
372 3300014325 Ga0163163_10193757 Ga0163163_101937572 326
373 3300014497 Ga0182008_10049174 Ga0182008_100491741 326
374 3300014969 Ga0157376_10319272 Ga0157376_103192722 326
375 3300021324 Ga0214545_1000003 Ga0214545_1000003430 326
376 3300021327 Ga0214543_1000002 Ga0214543_1000002337 326
377 3300021384 Ga0213876_10010096 Ga0213876_100100964 326
378 3300021384 Ga0213876_10110693 Ga0213876_101106931 326
379 3300025253 Ga0209677_101595 Ga0209677_1015954 326
380 3300025254 Ga0209148_1000424 Ga0209148_100042442 326
381 3300025261 Ga0209233_1001581 Ga0209233_10015812 326
382 3300025261 Ga0209233_1002935 Ga0209233_10029354 326
383 3300025272 Ga0209455_1002609 Ga0209455_10026094 326
384 3300025272 Ga0209455_1003259 Ga0209455_10032593 326
385 3300025297 Ga0209758_1000141 Ga0209758_1000141153 326
386 3300025297 Ga0209758_1005684 Ga0209758_10056848 326
387 3300025297 Ga0209758_1015210 Ga0209758_10152102 326
388 3300025299 Ga0209256_1006007 Ga0209256_10060074 326
389 3300025299 Ga0209256_1018545 Ga0209256_10185452 326
390 3300025302 Ga0207426_1003443 Ga0207426_10034432 326
391 3300025302 Ga0207426_1004449 Ga0207426_10044494 326
392 3300025302 Ga0207426_1035836 Ga0207426_10358362 326
393 3300025304 Ga0209257_1000426 Ga0209257_100042631 326
394 3300025898 Ga0207692_10001428 Ga0207692_100014281 326
395 3300025904 Ga0207647_10044552 Ga0207647_100445523 326
396 3300025906 Ga0207699_10000390 Ga0207699_100003909 326
397 3300025906 Ga0207699_10041162 Ga0207699_100411622 326
398 3300025907 Ga0207645_10103780 Ga0207645_101037801 326
399 3300025908 Ga0207643_10037027 Ga0207643_100370272 326
400 3300025911 Ga0207654_10073979 Ga0207654_100739792 326
401 3300025912 Ga0207707_10000178 Ga0207707_100001787 326
402 3300025912 Ga0207707_10051598 Ga0207707_100515982 326
403 3300025912 Ga0207707_10279084 Ga0207707_102790842 326
404 3300025912 Ga0207707_10281805 Ga0207707_102818052 326
405 3300025913 Ga0207695_10000062 Ga0207695_10000062271 326
406 3300025913 Ga0207695_10094476 Ga0207695_100944761 326
407 3300025913 Ga0207695_10142177 Ga0207695_101421772 326
408 3300025914 Ga0207671_10004982 Ga0207671_100049829 326
409 3300025914 Ga0207671_10041566 Ga0207671_100415663 326
410 3300025914 Ga0207671_10058580 Ga0207671_100585802 326
411 3300025914 Ga0207671_10317253 Ga0207671_103172531 326
412 3300025915 Ga0207693_10010089 Ga0207693_100100893 326
413 3300025915 Ga0207693_10030018 Ga0207693_100300184 326
414 3300025916 Ga0207663_10006434 Ga0207663_100064344 326
415 3300025916 Ga0207663_10014546 Ga0207663_100145463 326
416 3300025917 Ga0207660_10025918 Ga0207660_100259182 326
417 3300025917 Ga0207660_10085211 Ga0207660_100852112 326
418 3300025917 Ga0207660_10098702 Ga0207660_100987023 326
419 3300025920 Ga0207649_10045452 Ga0207649_100454522 326
420 3300025920 Ga0207649_10058057 Ga0207649_100580572 326
421 3300025921 Ga0207652_10019378 Ga0207652_100193784 326
422 3300025921 Ga0207652_10080871 Ga0207652_100808712 326
423 3300025924 Ga0207694_10108854 Ga0207694_101088542 326
424 3300025924 Ga0207694_10296308 Ga0207694_102963082 326
425 3300025925 Ga0207650_10120108 Ga0207650_101201082 326
426 3300025927 Ga0207687_10109490 Ga0207687_101094902 326
427 3300025927 Ga0207687_10255925 Ga0207687_102559251 326
428 3300025928 Ga0207700_10028238 Ga0207700_100282383 326
429 3300025929 Ga0207664_10155134 Ga0207664_101551342 326
430 3300025931 Ga0207644_10034683 Ga0207644_100346833 326
431 3300025933 Ga0207706_10136540 Ga0207706_101365402 326
432 3300025933 Ga0207706_10221238 Ga0207706_102212382 326
433 3300025939 Ga0207665_10208894 Ga0207665_102088941 326
434 3300025941 Ga0207711_10071760 Ga0207711_100717603 326
435 3300025941 Ga0207711_10275787 Ga0207711_102757872 326
436 3300025944 Ga0207661_10004270 Ga0207661_100042705 326
437 3300025944 Ga0207661_10019900 Ga0207661_100199002 326
438 3300025945 Ga0207679_10229934 Ga0207679_102299342 326
439 3300025949 Ga0207667_10051910 Ga0207667_100519102 326
440 3300025949 Ga0207667_10141704 Ga0207667_101417042 326
441 3300025949 Ga0207667_10236332 Ga0207667_102363321 326
442 3300025960 Ga0207651_10037284 Ga0207651_100372843 326
443 3300025960 Ga0207651_10255195 Ga0207651_102551951 326
444 3300026041 Ga0207639_10010472 Ga0207639_100104723 326
445 3300026041 Ga0207639_10037559 Ga0207639_100375593 326
446 3300026041 Ga0207639_10262309 Ga0207639_102623091 326
447 3300026067 Ga0207678_10039941 Ga0207678_100399414 326
448 3300026067 Ga0207678_10042373 Ga0207678_100423733 326
449 3300026067 Ga0207678_10130864 Ga0207678_101308642 326
450 3300026067 Ga0207678_10252210 Ga0207678_102522101 326
451 3300026075 Ga0207708_10060504 Ga0207708_100605043 326
452 3300026078 Ga0207702_10428523 Ga0207702_104285231 326
453 3300026078 Ga0207702_10442352 Ga0207702_104423522 326
454 3300026116 Ga0207674_10057562 Ga0207674_100575623 326
455 3300026116 Ga0207674_10082897 Ga0207674_100828973 326
456 3300026116 Ga0207674_10117039 Ga0207674_101170392 326
457 3300026118 Ga0207675_100033143 Ga0207675_1000331434 326
458 3300026121 Ga0207683_10088917 Ga0207683_100889173 326
459 3300026142 Ga0207698_10141215 Ga0207698_101412152 326
460 3300026142 Ga0207698_10468616 Ga0207698_104686161 326
461 3300027296 Ga0209389_1000023 Ga0209389_100002313 326
462 3300027357 Ga0209589_1000010 Ga0209589_1000010146 326
463 3300027361 Ga0209489_100011 Ga0209489_10001190 326
464 3300028379 Ga0268266_10006027 Ga0268266_100060272 326
465 3300028379 Ga0268266_10064115 Ga0268266_100641152 326
466 3300028380 Ga0268265_10010132 Ga0268265_100101322 326
467 3300028380 Ga0268265_10369527 Ga0268265_103695271 326
468 3300028381 Ga0268264_10141202 Ga0268264_101412022 326
469 3300028786 Ga0307517_10000085 Ga0307517_10000085110 326
470 3300028794 Ga0307515_10039862 Ga0307515_100398624 326
471 3300031249 Ga0265339_10009066 Ga0265339_100090664 326
472 3300031250 Ga0265331_10021647 Ga0265331_100216472 326
473 3300031711 Ga0265314_10081846 Ga0265314_100818462 326
474 3300031712 Ga0265342_10006824 Ga0265342_100068248 326
475 3300031730 Ga0307516_10045593 Ga0307516_100455932 326
476 3300031730 Ga0307516_10049467 Ga0307516_100494672 326
477 3300031730 Ga0307516_10153314 Ga0307516_101533142 326
478 3300031901 Ga0307406_10104987 Ga0307406_101049872 326
479 3300032002 Ga0307416_100092339 Ga0307416_1000923392 326
480 3300032126 Ga0307415_100407808 Ga0307415_1004078081 326
481 3300033180 Ga0307510_10036621 Ga0307510_100366211 326
482 3300033180 Ga0307510_10130239 Ga0307510_101302392 326
483 3300033442 Ga0315911_1000010 Ga0315911_1000010167 326
484 3300035083 Ga0373926_0010149 Ga0373926_0010149_441_1427 326
485 3300035170 Ga0373943_0006580 Ga0373943_0006580_482_1468 326
486 3300035170 Ga0373943_0076550 Ga0373943_0076550_528_1514 326
487 3300035171 Ga0373946_0051217 Ga0373946_0051217_601_1587 326
488 3300035692 Ga0373935_0000259 Ga0373935_0000259_17296_18282 326
489 3300035695 Ga0373927_0000339 Ga0373927_0000339_34505_35491 326
490 3300035695 Ga0373927_0002379 Ga0373927_0002379_3380_4366 326
491 3300035695 Ga0373927_0016655 Ga0373927_0016655_361_1359 326
492 3300035695 Ga0373927_0088787 Ga0373927_0088787_534_1532 326
493 3300035724 Ga0373933_0003061 Ga0373933_0003061_900_1898 326
494 3300035725 Ga0373947_0000217 Ga0373947_0000217_15262_16248 326
495 3300035725 Ga0373947_0011904 Ga0373947_0011904_946_1932 326
496 3300036401 Ga0373937_0022213 Ga0373937_0022213_779_1777 326
497 3300036401 Ga0373937_0070599 Ga0373937_0070599_10_996 326
498 3300037068 Ga0373925_0004501 Ga0373925_0004501_7317_8303 326
499 3300037068 Ga0373925_0173209 Ga0373925_0173209_611_1609 326
500 3300037471 Ga0395905_0019046 Ga0395905_0019046_3217_4209 326
501 3300038443 Ga0395901_0057616 Ga0395901_0057616_642_1628 326
502 3300038443 Ga0395901_0064581 Ga0395901_0064581_288_1280 326
503 3300039437 Ga0436365_1446014 Ga0436365_1446014_1223_2215 326
504 3300039437 Ga0436365_1446425 Ga0436365_1446425_3098_4090 326
505 3300039437 Ga0436365_1673545 Ga0436365_1673545_132_1124 326
506 3300039447 Ga0436361_0081107 Ga0436361_0081107_92_1093 326
507 3300039447 Ga0436361_1114449 Ga0436361_1114449_254_1255 326
508 3300039450 Ga0436363_0742244 Ga0436363_0742244_131_1123 326
509 3300039453 Ga0436362_0646134 Ga0436362_0646134_1590_2582 326
510 3300044656 Ga0466969_0085228 Ga0466969_0085228_80_1066 326
511 3300044658 Ga0466972_0000520 Ga0466972_0000520_2463_3449 326
512 3300044658 Ga0466972_0004454 Ga0466972_0004454_5407_6393 326
513 3300044684 Ga0466966_0059000 Ga0466966_0059000_1325_2320 326
514 3300044684 Ga0466966_0066368 Ga0466966_0066368_279_1328 326
515 3300044693 Ga0466961_0000149 Ga0466961_0000149_42677_43663 326
516 3300044901 Ga0466960_0003292 Ga0466960_0003292_633_1619 326
517 3300045049 Ga0466959_0004087 Ga0466959_0004087_415_1407 326
518 3300045836 Ga0466958_0107640 Ga0466958_0107640_345_1337 326
519 3300045976 Ga0466967_0412996 Ga0466967_0412996_293_1291 326
520 3300046454 Ga0495592_0045306 Ga0495592_0045306_1318_2304 326
521 3300046455 Ga0495603_0000352 Ga0495603_0000352_6701_7687 326
522 3300046455 Ga0495603_0013852 Ga0495603_0013852_1455_2441 326
523 3300046455 Ga0495603_0168157 Ga0495603_0168157_203_1195 326
524 3300046459 Ga0495629_0003719 Ga0495629_0003719_5533_6519 326
525 3300046459 Ga0495629_0042670 Ga0495629_0042670_1435_2421 326
526 3300046459 Ga0495629_0118718 Ga0495629_0118718_714_1706 326
527 3300046460 Ga0495638_0002610 Ga0495638_0002610_13415_14401 326
528 3300046460 Ga0495638_0150487 Ga0495638_0150487_142_1128 326
529 3300046460 Ga0495638_0173691 Ga0495638_0173691_13_1005 326
530 3300046461 Ga0495641_0018952 Ga0495641_0018952_1068_2060 326
531 3300046461 Ga0495641_0026296 Ga0495641_0026296_1768_2754 326
532 3300046472 Ga0495580_0062999 Ga0495580_0062999_1282_2268 326
533 3300046475 Ga0495639_0001973 Ga0495639_0001973_1435_2421 326
534 3300046476 Ga0495662_0000872 Ga0495662_0000872_6410_7396 326
535 3300046477 Ga0495664_0013868 Ga0495664_0013868_596_1591 326
536 3300046477 Ga0495664_0032321 Ga0495664_0032321_1633_2622 326
537 3300046477 Ga0495664_0154024 Ga0495664_0154024_163_1155 326
538 3300046492 Ga0495585_0047515 Ga0495585_0047515_1310_2302 326
539 3300046499 Ga0495594_0001257 Ga0495594_0001257_10935_11921 326
540 3300046499 Ga0495594_0019990 Ga0495594_0019990_2029_3021 326
541 3300046500 Ga0495596_0041048 Ga0495596_0041048_618_1610 326
542 3300046507 Ga0495606_0021592 Ga0495606_0021592_2242_3228 326
543 3300046507 Ga0495606_0050798 Ga0495606_0050798_1001_2014 326
544 3300046511 Ga0495608_0154648 Ga0495608_0154648_240_1226 326
545 3300046516 Ga0495628_0059443 Ga0495628_0059443_1837_2826 326
546 3300046516 Ga0495628_0192352 Ga0495628_0192352_265_1251 326
547 3300046519 Ga0495632_0067308 Ga0495632_0067308_37_1029 326
548 3300046523 Ga0495644_0048274 Ga0495644_0048274_578_1570 326
549 3300046526 Ga0495666_0041105 Ga0495666_0041105_202_1188 326
550 3300046529 Ga0495652_0033678 Ga0495652_0033678_773_1759 326
551 3300046529 Ga0495652_0136093 Ga0495652_0136093_882_1868 326
552 3300046531 Ga0495665_0000361 Ga0495665_0000361_6401_7387 326
553 3300046533 Ga0495640_0003002 Ga0495640_0003002_6400_7386 326
554 3300046533 Ga0495640_0036139 Ga0495640_0036139_502_1491 326
555 3300046533 Ga0495640_0036471 Ga0495640_0036471_2273_3259 326
556 3300046538 Ga0495609_0082180 Ga0495609_0082180_236_1228 326
557 3300046542 Ga0495597_0034517 Ga0495597_0034517_618_1604 326
558 3300046543 Ga0495645_0020761 Ga0495645_0020761_24_1013 326
559 3300046543 Ga0495645_0113386 Ga0495645_0113386_447_1442 326
560 3300046558 Ga0495633_0123606 Ga0495633_0123606_92_1084 326
561 3300046559 Ga0495667_0038334 Ga0495667_0038334_1246_2235 326
562 3300046615 Ga0495656_0018728 Ga0495656_0018728_363_1355 326
563 3300046615 Ga0495656_0138565 Ga0495656_0138565_120_1112 326
564 3300046616 Ga0495668_0016367 Ga0495668_0016367_2428_3414 326
565 3300046642 Ga0495634_0000249 Ga0495634_0000249_6005_6991 326
566 3300046660 Ga0495625_0153889 Ga0495625_0153889_490_1482 326
567 3300046663 Ga0495635_0000239 Ga0495635_0000239_3664_4650 326
568 3300046663 Ga0495635_0011527 Ga0495635_0011527_584_1570 326
569 3300046664 Ga0495659_0038199 Ga0495659_0038199_626_1618 326
570 3300046674 Ga0495588_0003787 Ga0495588_0003787_1770_2756 326
571 3300046674 Ga0495588_0014080 Ga0495588_0014080_217_1203 326
572 3300046675 Ga0495657_0003492 Ga0495657_0003492_8268_9257 326
573 3300046678 Ga0495599_0022511 Ga0495599_0022511_1107_2096 326
574 3300046679 Ga0495623_0002296 Ga0495623_0002296_8764_9753 326
575 3300046680 Ga0495646_0005453 Ga0495646_0005453_1202_2188 326
576 3300046681 Ga0495647_0001674 Ga0495647_0001674_4534_5520 326
577 3300046683 Ga0495658_0001058 Ga0495658_0001058_4662_5648 326
578 3300046689 Ga0495613_0000929 Ga0495613_0000929_16758_17744 326
579 3300046689 Ga0495613_0208176 Ga0495613_0208176_379_1365 326
580 3300046690 Ga0495624_0099539 Ga0495624_0099539_379_1365 326
581 3300046690 Ga0495624_0104140 Ga0495624_0104140_549_1535 326
582 3300046690 Ga0495624_0204832 Ga0495624_0204832_35_1027 326
583 3300046809 Ga0495600_0035084 Ga0495600_0035084_1391_2377 326
584 3300046809 Ga0495600_0077649 Ga0495600_0077649_1140_2129 326
585 3300046810 Ga0495660_0046424 Ga0495660_0046424_495_1481 326
586 3300047315 Ga0495581_0199072 Ga0495581_0199072_23_1009 326
587 3300047317 Ga0495604_0005469 Ga0495604_0005469_1431_2420 326
588 3300047317 Ga0495604_0066699 Ga0495604_0066699_1435_2421 326
589 3300047319 Ga0495674_0001854 Ga0495674_0001854_13372_14358 326
590 3300047319 Ga0495674_0118713 Ga0495674_0118713_77_1066 326
591 3300047320 Ga0495672_0027086 Ga0495672_0027086_1966_2958 326
592 3300047321 Ga0495676_0022316 Ga0495676_0022316_4196_5182 326
593 3300047321 Ga0495676_0029475 Ga0495676_0029475_1555_2547 326
594 3300047321 Ga0495676_0290494 Ga0495676_0290494_12_998 326
595 3300047322 Ga0495680_0032224 Ga0495680_0032224_1417_2406 326
596 3300047443 Ga0495687_019183 Ga0495687_019183_2032_3018 326
597 3300047444 Ga0495675_0002807 Ga0495675_0002807_1173_2162 326
598 3300047445 Ga0495677_0078335 Ga0495677_0078335_30_1022 326
599 3300047447 Ga0495685_039846 Ga0495685_039846_270_1262 326
600 3300047469 Ga0495673_0033616 Ga0495673_0033616_778_1764 326
601 3300047471 Ga0495684_0043713 Ga0495684_0043713_980_1969 326
602 3300047472 Ga0495686_0073671 Ga0495686_0073671_35_1021 326
603 3300047673 Ga0495593_0000034 Ga0495593_0000034_51855_52841 326
604 3300047673 Ga0495593_0158705 Ga0495593_0158705_13_999 326
605 3300048088 Ga0495602_0049097 Ga0495602_0049097_1660_2649 326
606 3300048090 Ga0495615_0008880 Ga0495615_0008880_609_1601 326
607 3300048903 Ga0496100_0094668 Ga0496100_0094668_279_1271 326
608 3300048904 Ga0496101_0040575 Ga0496101_0040575_896_1888 326
609 3300048904 Ga0496101_0143524 Ga0496101_0143524_554_1540 326
610 3300048906 Ga0496103_0005710 Ga0496103_0005710_1121_2107 326
611 3300048907 Ga0496104_0015916 Ga0496104_0015916_2933_3919 326
612 3300048907 Ga0496104_0253556 Ga0496104_0253556_94_1080 326
613 3300048907 Ga0496104_0356272 Ga0496104_0356272_181_1170 326
614 3300048907 Ga0496104_0412918 Ga0496104_0412918_258_1250 326
615 3300048908 Ga0496105_0034901 Ga0496105_0034901_2298_3284 326
616 3300048908 Ga0496105_0051425 Ga0496105_0051425_1267_2253 326
617 3300048908 Ga0496105_0168740 Ga0496105_0168740_16_1035 326
618 3300048909 Ga0496106_0032306 Ga0496106_0032306_1658_2650 326
619 3300048910 Ga0496107_0051082 Ga0496107_0051082_974_1960 326
620 3300048910 Ga0496107_0178459 Ga0496107_0178459_252_1241 326
621 3300048910 Ga0496107_0184688 Ga0496107_0184688_194_1180 326
622 3300048910 Ga0496107_0272553 Ga0496107_0272553_18_1016 326
623 3300048912 Ga0496109_0054328 Ga0496109_0054328_409_1401 326
624 3300048912 Ga0496109_0131145 Ga0496109_0131145_40_1026 326
625 3300048912 Ga0496109_0206443 Ga0496109_0206443_501_1493 326
626 3300048913 Ga0496110_0013275 Ga0496110_0013275_2014_3006 326
627 3300048913 Ga0496110_0099197 Ga0496110_0099197_1480_2472 326
628 3300048913 Ga0496110_0100133 Ga0496110_0100133_183_1175 326
629 3300048913 Ga0496110_0248830 Ga0496110_0248830_594_1580 326
630 3300048915 Ga0496112_0035334 Ga0496112_0035334_2578_3567 326
631 3300048915 Ga0496112_0035784 Ga0496112_0035784_1759_2751 326
632 3300048915 Ga0496112_0138008 Ga0496112_0138008_942_1928 326
633 3300048916 Ga0496113_0083357 Ga0496113_0083357_268_1254 326
634 3300048916 Ga0496113_0163077 Ga0496113_0163077_527_1516 326
635 3300048916 Ga0496113_0317986 Ga0496113_0317986_209_1228 326
636 3300048917 Ga0496114_0028100 Ga0496114_0028100_1077_2069 326
637 3300048917 Ga0496114_0071880 Ga0496114_0071880_875_1861 326
638 3300048917 Ga0496114_0370647 Ga0496114_0370647_114_1100 326
639 3300048918 Ga0496115_0037983 Ga0496115_0037983_22_1020 326
640 3300048918 Ga0496115_0121411 Ga0496115_0121411_532_1518 326
641 3300048919 Ga0496116_0101606 Ga0496116_0101606_483_1469 326
642 3300048920 Ga0496117_0047573 Ga0496117_0047573_1062_2051 326
643 3300048921 Ga0496118_0017089 Ga0496118_0017089_942_1931 326
644 3300048922 Ga0496119_0058779 Ga0496119_0058779_177_1163 326
645 3300048922 Ga0496119_0193247 Ga0496119_0193247_27_1016 326
646 3300048923 Ga0496120_0021761 Ga0496120_0021761_1521_2507 326
647 3300048924 Ga0496121_0015642 Ga0496121_0015642_6065_7051 326
648 3300048924 Ga0496121_0050475 Ga0496121_0050475_2368_3354 326
649 3300048924 Ga0496121_0050757 Ga0496121_0050757_1069_2061 326
650 3300048924 Ga0496121_0077328 Ga0496121_0077328_378_1370 326
651 3300048924 Ga0496121_0118993 Ga0496121_0118993_814_1803 326
652 3300048925 Ga0496122_0080318 Ga0496122_0080318_398_1384 326
653 3300048927 Ga0496124_0275469 Ga0496124_0275469_199_1191 326
654 3300048928 Ga0496125_0028183 Ga0496125_0028183_2569_3555 326
655 3300048928 Ga0496125_0135448 Ga0496125_0135448_393_1379 326
656 3300048929 Ga0496126_0009402 Ga0496126_0009402_1455_2453 326
657 3300048929 Ga0496126_0030411 Ga0496126_0030411_424_1416 326
658 3300048929 Ga0496126_0031723 Ga0496126_0031723_386_1378 326
659 3300048929 Ga0496126_0111509 Ga0496126_0111509_832_1818 326
660 3300048929 Ga0496126_0144421 Ga0496126_0144421_389_1375 326
661 3300048929 Ga0496126_0235808 Ga0496126_0235808_233_1225 326
662 3300049569 Ga0501032_0003534 Ga0501032_0003534_2824_3813 326
663 3300049569 Ga0501032_0076324 Ga0501032_0076324_1018_2007 326
664 3300049570 Ga0501033_0000249 Ga0501033_0000249_24552_25541 326
665 3300049570 Ga0501033_0000951 Ga0501033_0000951_18733_19722 326
666 3300049571 Ga0501034_0001938 Ga0501034_0001938_4503_5492 326
667 3300049572 Ga0501036_0004433 Ga0501036_0004433_4419_5408 326
668 3300049572 Ga0501036_0090479 Ga0501036_0090479_105_1094 326
669 3300049573 Ga0501037_0000112 Ga0501037_0000112_26015_27004 326
670 3300049573 Ga0501037_0004019 Ga0501037_0004019_6863_7852 326
671 3300049574 Ga0501038_0000160 Ga0501038_0000160_46745_47734 326
672 3300049574 Ga0501038_0018478 Ga0501038_0018478_1665_2654 326
673 3300049575 Ga0501039_0011683 Ga0501039_0011683_3265_4254 326
674 3300049575 Ga0501039_0049318 Ga0501039_0049318_2073_3062 326
675 3300049575 Ga0501039_0168331 Ga0501039_0168331_596_1588 326
676 3300049578 Ga0501042_0068679 Ga0501042_0068679_976_1965 326
677 3300049579 Ga0501043_0000278 Ga0501043_0000278_29902_30891 326
678 3300049579 Ga0501043_0016672 Ga0501043_0016672_2089_3078 326
679 3300049580 Ga0501046_0000937 Ga0501046_0000937_5410_6399 326
680 3300049580 Ga0501046_0029168 Ga0501046_0029168_1558_2547 326
681 3300049581 Ga0501047_0000275 Ga0501047_0000275_40512_41501 326
682 3300049582 Ga0501048_0001248 Ga0501048_0001248_8009_8998 326
683 3300049583 Ga0501067_0000258 Ga0501067_0000258_10002_10991 326
684 3300049583 Ga0501067_0126237 Ga0501067_0126237_96_1085 326
685 3300049584 Ga0501068_0004146 Ga0501068_0004146_5632_6621 326
686 3300049585 Ga0501069_0002032 Ga0501069_0002032_9061_10050 326
687 3300049586 Ga0501070_0002548 Ga0501070_0002548_7980_8969 326
688 3300049586 Ga0501070_0044688 Ga0501070_0044688_478_1470 326
689 3300049587 Ga0501071_0038499 Ga0501071_0038499_1462_2451 326
690 3300049587 Ga0501071_0077213 Ga0501071_0077213_1052_2044 326
691 3300049588 Ga0501072_0006863 Ga0501072_0006863_6454_7443 326
692 3300049589 Ga0501073_0000103 Ga0501073_0000103_20926_21915 326
693 3300049590 Ga0501074_0025367 Ga0501074_0025367_755_1747 326
694 3300049741 Ga0501079_0000451 Ga0501079_0000451_15419_16408 326
695 3300049742 Ga0501080_0002998 Ga0501080_0002998_11676_12665 326
696 3300049742 Ga0501080_0022860 Ga0501080_0022860_4532_5524 326
697 3300049743 Ga0501081_0333418 Ga0501081_0333418_31_1017 326
698 3300049744 Ga0501083_0013394 Ga0501083_0013394_3575_4564 326
699 3300049822 Ga0501035_0000766 Ga0501035_0000766_20926_21915 326
700 3300049823 Ga0501044_0000418 Ga0501044_0000418_47058_48047 326
701 3300049823 Ga0501044_0071079 Ga0501044_0071079_181_1170 326
702 3300049823 Ga0501044_0080760 Ga0501044_0080760_209_1201 326
703 3300049824 Ga0501045_0012804 Ga0501045_0012804_2304_3293 326
704 3300050490 nmdc:mga03n38_77785_c1 nmdc:mga03n38_77785_c1_329_1324 326
705 3300050491 nmdc:mga00v17_106119_c1 nmdc:mga00v17_106119_c1_387_1373 326
706 3300050491 nmdc:mga00v17_156197_c1 nmdc:mga00v17_156197_c1_331_1323 326
707 3300050492 nmdc:mga0yw44_1397_c1 nmdc:mga0yw44_1397_c1_7411_8403 326
708 3300050492 nmdc:mga0yw44_20742_c1 nmdc:mga0yw44_20742_c1_1131_2117 326
709 3300050492 nmdc:mga0yw44_57310_c1 nmdc:mga0yw44_57310_c1_695_1681 326
710 3300050494 nmdc:mga06z11_84251_c1 nmdc:mga06z11_84251_c1_222_1208 326
711 3300050494 nmdc:mga06z11_86734_c1 nmdc:mga06z11_86734_c1_132_1124 326
712 3300050496 nmdc:mga07m45_45292_c1 nmdc:mga07m45_45292_c1_417_1409 326
713 3300050496 nmdc:mga07m45_48977_c1 nmdc:mga07m45_48977_c1_565_1575 326
714 3300050507 nmdc:mga05p37_62404_c1 nmdc:mga05p37_62404_c1_2919_3911 326
715 3300050508 nmdc:mga09592_255513_c1 nmdc:mga09592_255513_c1_399_1391 326
716 3300050511 nmdc:mga08y16_302874_c1 nmdc:mga08y16_302874_c1_516_1508 326
717 3300050512 nmdc:mga0n895_181060_c1 nmdc:mga0n895_181060_c1_654_1646 326
718 3300050513 nmdc:mga0rr50_27857_c1 nmdc:mga0rr50_27857_c1_2397_3389 326
719 3300050516 nmdc:mga0sz30_20733_c1 nmdc:mga0sz30_20733_c1_787_1773 326
720 3300053077 Ga0495601_0097002 Ga0495601_0097002_572_1558 326
721 3300053079 Ga0500610_0063990 Ga0500610_0063990_152_1138 326
722 3300053080 Ga0500635_0016901 Ga0500635_0016901_190_1182 326
723 3300053085 Ga0495619_0191674 Ga0495619_0191674_317_1303 326
724 3300053086 Ga0500578_0045489 Ga0500578_0045489_1368_2354 326
725 3300053087 Ga0500643_000267 Ga0500643_000267_9125_10111 326
726 3300053087 Ga0500643_041816 Ga0500643_041816_14_1006 326
727 3300053093 Ga0500651_0060147 Ga0500651_0060147_470_1456 326
728 3300053094 Ga0500566_0000185 Ga0500566_0000185_2726_3712 326
729 3300053094 Ga0500566_0001146 Ga0500566_0001146_3246_4238 326
730 3300053094 Ga0500566_0001213 Ga0500566_0001213_12951_13943 326
731 3300053095 Ga0500640_040072 Ga0500640_040072_332_1324 326
732 3300053103 Ga0500555_026660 Ga0500555_026660_128_1120 326
733 3300053108 Ga0500562_001577 Ga0500562_001577_1381_2367 326
734 3300053111 Ga0500572_000384 Ga0500572_000384_13640_14629 326
735 3300053111 Ga0500572_008551 Ga0500572_008551_986_1978 326
736 3300053118 Ga0500594_0032137 Ga0500594_0032137_86_1078 326
737 3300053119 Ga0500595_003818 Ga0500595_003818_1734_2726 326
738 3300053121 Ga0500607_115620 Ga0500607_115620_221_1207 326
739 3300053123 Ga0500614_001219 Ga0500614_001219_1133_2125 326
740 3300053130 Ga0500642_0066734 Ga0500642_0066734_352_1338 326
741 3300053131 Ga0500652_041981 Ga0500652_041981_828_1808 326
742 3300053134 Ga0500658_0043983 Ga0500658_0043983_590_1576 326
743 3300053136 Ga0500559_0000863 Ga0500559_0000863_2371_3360 326
744 3300053136 Ga0500559_0102704 Ga0500559_0102704_191_1183 326
745 3300053138 Ga0500564_055337 Ga0500564_055337_201_1187 326
746 3300053146 Ga0500588_0009279 Ga0500588_0009279_615_1601 326
747 3300053148 Ga0500590_133198 Ga0500590_133198_95_1087 326
748 3300053150 Ga0500603_002337 Ga0500603_002337_1138_2130 326
749 3300053150 Ga0500603_031697 Ga0500603_031697_220_1212 326
750 3300053153 Ga0500616_0000166 Ga0500616_0000166_77982_79019 326
751 3300053159 Ga0500630_013860 Ga0500630_013860_104_1096 326
752 3300053161 Ga0500634_0052688 Ga0500634_0052688_954_1946 326
753 3300053162 Ga0500638_001014 Ga0500638_001014_5008_6000 326
754 3300053163 Ga0500639_000010 Ga0500639_000010_1249_2241 326
755 3300053177 Ga0500636_0001916 Ga0500636_0001916_8026_9012 326
756 3300053178 Ga0500637_0000121 Ga0500637_0000121_15276_16268 326
757 3300053178 Ga0500637_0027260 Ga0500637_0027260_1700_2692 326
758 3300053727 Ga0500611_014364 Ga0500611_014364_367_1359 326
759 3300053735 Ga0500596_002495 Ga0500596_002495_1628_2620 326
760 3300053735 Ga0500596_004734 Ga0500596_004734_1404_2393 326
761 3300053736 Ga0500599_000459 Ga0500599_000459_2741_3721 326
762 3300054114 Ga0501084_0003972 Ga0501084_0003972_3352_4341 326
763 3300055283 Ga0500661_000452 Ga0500661_000452_2914_3906 326
764 3300060353 Ga0501082_0025989 Ga0501082_0025989_694_1683 326
765 iso_pu_bacteria 2824679649 2824682888 326
766 iso_pu_bacteria 2824732956 2824740348 326
767 iso_pu_bacteria 2842038055 2842042707 326
768 iso_pu_bacteria 2842045827 2842050750 326
769 iso_pu_bacteria 2908775508 2908781596 326
770 iso_pu_bacteria 2922393267 2922393567 326
771 3300001979 JGI24740J21852_10002709 JGI24740J21852_100027094 328
772 3300001990 JGI24737J22298_10019055 JGI24737J22298_100190552 328
773 3300005434 Ga0070709_10225001 Ga0070709_102250011 328
774 3300005435 Ga0070714_100088352 Ga0070714_1000883522 328
775 3300005436 Ga0070713_100022889 Ga0070713_1000228891 328
776 3300005437 Ga0070710_10042841 Ga0070710_100428412 328
777 3300005439 Ga0070711_100002216 Ga0070711_1000022164 328
778 3300005458 Ga0070681_10109974 Ga0070681_101099742 328
779 3300005983 Ga0081540_1023138 Ga0081540_10231383 328
780 3300006173 Ga0070716_100126542 Ga0070716_1001265421 328
781 3300013105 Ga0157369_10549082 Ga0157369_105490821 328
782 3300025898 Ga0207692_10009587 Ga0207692_100095874 328
783 3300025906 Ga0207699_10314054 Ga0207699_103140541 328
784 3300025915 Ga0207693_10018488 Ga0207693_100184884 328
785 3300025916 Ga0207663_10021194 Ga0207663_100211942 328
786 3300025920 Ga0207649_10091445 Ga0207649_100914452 328
787 3300025928 Ga0207700_10242324 Ga0207700_102423242 328
788 3300025939 Ga0207665_10208097 Ga0207665_102080971 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

177

353

0.93

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

33

145

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d8d-assembly3.cif.gz_F crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii 0.8656 2 322
8evx-assembly1.cif.gz_B ddla from pseudomonas aeruginosa pao1 in complex with adp and phosphorylated d-cycloserine 0.8631 1 325
4zqi-assembly1.cif.gz_B crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8592 2 322
4egj-assembly6.cif.gz_D-2 crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans 0.8575 2 322
3r5x-assembly1.cif.gz_B crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8565 1 327
ID Description Score Start End Superfamily
af_P9WP31_235_360_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9153 198 316 3.30.470.20
2i8cA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.912 111 327 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9092 111 322 3.30.470.20
1ehiB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9021 195 327 3.30.470.20
2yzgC02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8996 113 322 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A401TUI9-F1-model_v4 D-alanine--D-alanine ligase N-terminal domain-containing protein 0.9786 1 183 GO:0005524
GO:0008716
AF-A0A401TUI9-F1-model_v4 D-alanine--D-alanine ligase N-terminal domain-containing protein 0.9682 1 183 GO:0005524
GO:0008716
AF-A0A059X5R8-F1-model_v4 D-ala D-ala ligase C-terminus 0.9668 43 327 GO:0005524
GO:0008716
GO:0046872
GO:0071555
AF-A0A0F2PWU2-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) 0.9642 1 325 GO:0005524
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A534YM77-F1-model_v4 D-alanine--D-alanine ligase 0.9555 2 277 GO:0005524
GO:0008716
GO:0046872
GO:0071555

Feature Viewer

pLDDT pTM Quality
90.49 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map