F480861
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 788 | 516 | 610 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10109974|Ga0070681_101099742 |
| Length | 365 |
| Sequence | MVRNCAPENLEIPGLVLPDHPGMTGEVIGKGMRITILFGGTNKERLVSVASAQALCEALPDADLWFWAADDSVHETQAKTLIGHSRPFEQEFTPGGRKVAAIIEQALDRAKADGRVLVLGLHGGRAENGELQAACELRDVPYTGSDSTSSHLAFDKVAAKRFAAIAGVKAPEGIPLQEIDAAFAEYGQLIAKPTYDGSSYGVIYVNARQDLVAVRNAAKTEHYLIEPRIAGVEATCGVLEKSNGELLALPPIEIVPGEGNFDYTAKYLLKSTQEICPGRFAADITAALMEKALLAHKALSCSGYSRSDFIVSDKGPVYLETNTLPGLTKASLYPKALKAKGIGFADFLKDQIVLAERRVRNTPGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 20 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 21 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 22 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 23 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 24 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 25 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 26 | 2791355199 | |||
| 27 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 28 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 29 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 30 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 31 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 32 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 33 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 34 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 35 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 36 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 37 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 38 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 39 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 40 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 41 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 42 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 43 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 44 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 45 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 46 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 47 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 48 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 49 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 50 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 51 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 52 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 53 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 54 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 55 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 56 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 57 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 58 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 59 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 60 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 61 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 62 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 63 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 64 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 65 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 66 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 67 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 68 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 69 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 70 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 71 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 72 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 73 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 74 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 75 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 76 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 77 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 78 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 79 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 80 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 81 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 82 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 83 | 2904699407 | |||
| 84 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 85 | 2906610324 | |||
| 86 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 87 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 88 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 89 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 90 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 91 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 92 | 2922368715 | |||
| 93 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 94 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 95 | 2922425934 | |||
| 96 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 97 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 98 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 99 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 100 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 101 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 102 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 103 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 104 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 105 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 106 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 107 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 108 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 109 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 110 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 111 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 112 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 113 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 114 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 115 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 116 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 117 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 118 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 119 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 120 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 121 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 122 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 123 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 124 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 125 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 126 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 127 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 128 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 129 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 130 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 131 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 132 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 133 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 134 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 135 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 136 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 137 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 138 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 139 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 140 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 141 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 142 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 143 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 144 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 145 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 146 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 147 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 148 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 149 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 150 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 151 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 152 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 154 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 155 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 156 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 163 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 165 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 166 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 171 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 172 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 173 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 175 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 177 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 180 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 181 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 182 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 183 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 184 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 185 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 186 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 187 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 188 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 189 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 190 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 191 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 193 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 194 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 195 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 197 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 198 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 199 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 200 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 201 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 203 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 204 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 205 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 207 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 208 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 209 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 210 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 229 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 231 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 232 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 233 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 239 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 278 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 279 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 280 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 284 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 285 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 286 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 287 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 288 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 289 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 290 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 291 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 292 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 293 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 294 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 295 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 296 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 297 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 298 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 302 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 304 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 305 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 306 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 309 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 310 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 311 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 312 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 313 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 314 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 315 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 316 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 319 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 320 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 321 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 322 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 323 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 387 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 388 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 389 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 390 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 391 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 393 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 394 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 395 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 396 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 397 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 398 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 399 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 400 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 401 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 402 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 403 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 404 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 405 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 406 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 407 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 435 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 436 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 437 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 438 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 439 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 445 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 447 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 448 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 450 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 451 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 452 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 453 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 454 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 455 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 456 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 457 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 458 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 459 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 460 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 461 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 462 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 463 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 465 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 466 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 467 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 468 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 469 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 470 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 471 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 472 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 473 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 474 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 476 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 477 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 478 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 479 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 481 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 483 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 484 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 485 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 486 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 487 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 488 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 489 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 490 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 491 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 492 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 493 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 494 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 495 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 496 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 497 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 498 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 499 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 500 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 501 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 502 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 503 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 504 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 505 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 506 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 507 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 508 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 509 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 510 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 511 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 512 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 513 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 514 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 515 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 516 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.91 |
| Metatranscriptomes | 0 |
| Isolates | 22.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.29 |
| Nodule | 16.88 |
| Rhizoplane | 4.7 |
| Rhizosphere | 55.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002709 | 3300001979 | Bacteria | 7951 |
| 2 | JGI24737J22298_10019055 | 3300001990 | Bacteria | 2195 |
| 3 | JGI25153J46596_10004246 | 3300003215 | Bacteria | 7754 |
| 4 | JGI25153J46596_10009718 | 3300003215 | Bacteria | 4427 |
| 5 | JGI25153J46596_10028250 | 3300003215 | Bacteria | 1949 |
| 6 | JGI25160J50197_1001885 | 3300003354 | Bacteria | 10064 |
| 7 | Ga0055542_1008536 | 3300003762 | Bacteria | 2000 |
| 8 | Ga0055531_10005281 | 3300003794 | Bacteria | 7578 |
| 9 | Ga0065165_1004931 | 3300005262 | Bacteria | 7867 |
| 10 | Ga0065165_1009824 | 3300005262 | Bacteria | 4226 |
| 11 | Ga0065165_1015966 | 3300005262 | Bacteria | 2836 |
| 12 | Ga0070683_100005294 | 3300005329 | Bacteria | 10748 |
| 13 | Ga0070683_100005592 | 3300005329 | Bacteria | 10498 |
| 14 | Ga0070670_100121633 | 3300005331 | Bacteria | 2252 |
| 15 | Ga0068869_100038866 | 3300005334 | Bacteria | 3394 |
| 16 | Ga0068869_100088815 | 3300005334 | Bacteria | 2320 |
| 17 | Ga0070680_100016152 | 3300005336 | Bacteria | 5869 |
| 18 | Ga0070680_100035140 | 3300005336 | Bacteria | 4045 |
| 19 | Ga0070682_100096754 | 3300005337 | Bacteria | 1941 |
| 20 | Ga0070660_100029630 | 3300005339 | Bacteria | 4104 |
| 21 | Ga0070691_10105503 | 3300005341 | Bacteria | 1404 |
| 22 | Ga0070661_100075427 | 3300005344 | Bacteria | 2485 |
| 23 | Ga0070671_100077140 | 3300005355 | Bacteria | 2784 |
| 24 | Ga0070671_100127629 | 3300005355 | Bacteria | 2142 |
| 25 | Ga0070671_100161101 | 3300005355 | Bacteria | 1896 |
| 26 | Ga0070674_100220894 | 3300005356 | Bacteria | 1474 |
| 27 | Ga0070673_100054667 | 3300005364 | Bacteria | 3141 |
| 28 | Ga0070709_10001417 | 3300005434 | Bacteria | 12994 |
| 29 | Ga0070709_10007249 | 3300005434 | Bacteria | 6077 |
| 30 | Ga0070709_10049645 | 3300005434 | Bacteria | 2625 |
| 31 | Ga0070709_10225001 | 3300005434 | Bacteria | 1340 |
| 32 | Ga0070709_10265907 | 3300005434 | Bacteria | 1241 |
| 33 | Ga0070714_100018262 | 3300005435 | Bacteria | 5694 |
| 34 | Ga0070714_100088352 | 3300005435 | Bacteria | 2712 |
| 35 | Ga0070713_100022889 | 3300005436 | Bacteria | 4837 |
| 36 | Ga0070713_100033799 | 3300005436 | Bacteria | 4101 |
| 37 | Ga0070713_100128657 | 3300005436 | Bacteria | 2231 |
| 38 | Ga0070710_10000633 | 3300005437 | Bacteria | 16752 |
| 39 | Ga0070710_10008834 | 3300005437 | Bacteria | 4914 |
| 40 | Ga0070710_10042841 | 3300005437 | Bacteria | 2504 |
| 41 | Ga0070711_100001478 | 3300005439 | Bacteria | 12909 |
| 42 | Ga0070711_100002216 | 3300005439 | Bacteria | 11029 |
| 43 | Ga0070711_100011186 | 3300005439 | Bacteria | 5564 |
| 44 | Ga0070663_100047179 | 3300005455 | Bacteria | 3051 |
| 45 | Ga0070663_100120978 | 3300005455 | Bacteria | 1977 |
| 46 | Ga0070663_100159892 | 3300005455 | Bacteria | 1733 |
| 47 | Ga0070678_100127777 | 3300005456 | Bacteria | 2015 |
| 48 | Ga0070678_100194575 | 3300005456 | Bacteria | 1669 |
| 49 | Ga0070662_100096892 | 3300005457 | Bacteria | 2226 |
| 50 | Ga0070662_100133874 | 3300005457 | Bacteria | 1914 |
| 51 | Ga0070681_10040433 | 3300005458 | Bacteria | 4672 |
| 52 | Ga0070681_10101517 | 3300005458 | Bacteria | 2822 |
| 53 | Ga0070681_10109974 | 3300005458 | Bacteria | 2696 |
| 54 | Ga0070681_10153891 | 3300005458 | Bacteria | 2225 |
| 55 | Ga0070706_100258990 | 3300005467 | Bacteria | 1624 |
| 56 | Ga0070698_100019627 | 3300005471 | Bacteria | 7091 |
| 57 | Ga0070699_100054802 | 3300005518 | Bacteria | 3452 |
| 58 | Ga0070679_100024858 | 3300005530 | Bacteria | 5870 |
| 59 | Ga0070679_100136505 | 3300005530 | Bacteria | 2433 |
| 60 | Ga0070679_100143535 | 3300005530 | Bacteria | 2366 |
| 61 | Ga0070684_100005206 | 3300005535 | Bacteria | 9945 |
| 62 | Ga0070684_100209620 | 3300005535 | Bacteria | 1776 |
| 63 | Ga0068853_100038556 | 3300005539 | Bacteria | 4071 |
| 64 | Ga0068853_100057494 | 3300005539 | Bacteria | 3356 |
| 65 | Ga0068853_100099309 | 3300005539 | Bacteria | 2572 |
| 66 | Ga0068853_100118906 | 3300005539 | Bacteria | 2355 |
| 67 | Ga0068853_100213997 | 3300005539 | Bacteria | 1758 |
| 68 | Ga0070693_100075808 | 3300005547 | Bacteria | 1992 |
| 69 | Ga0070665_100206548 | 3300005548 | Bacteria | 1965 |
| 70 | Ga0070665_100546352 | 3300005548 | Bacteria | 1171 |
| 71 | Ga0068855_100049698 | 3300005563 | Bacteria | 4944 |
| 72 | Ga0068855_100079756 | 3300005563 | Bacteria | 3796 |
| 73 | Ga0068855_100210097 | 3300005563 | Bacteria | 2187 |
| 74 | Ga0068855_100397248 | 3300005563 | Bacteria | 1511 |
| 75 | Ga0068855_100398324 | 3300005563 | Bacteria | 1509 |
| 76 | Ga0068857_100072650 | 3300005577 | Bacteria | 3066 |
| 77 | Ga0068857_100114359 | 3300005577 | Bacteria | 2427 |
| 78 | Ga0068854_100098644 | 3300005578 | Bacteria | 2187 |
| 79 | Ga0068856_100187170 | 3300005614 | Bacteria | 2084 |
| 80 | Ga0068856_100503048 | 3300005614 | Bacteria | 1233 |
| 81 | Ga0068852_100032693 | 3300005616 | Bacteria | 4310 |
| 82 | Ga0068859_100069977 | 3300005617 | Bacteria | 3544 |
| 83 | Ga0068864_100047790 | 3300005618 | Bacteria | 3677 |
| 84 | Ga0068861_100032076 | 3300005719 | Bacteria | 3865 |
| 85 | Ga0068863_100157256 | 3300005841 | Bacteria | 2176 |
| 86 | Ga0068863_100342243 | 3300005841 | Bacteria | 1455 |
| 87 | Ga0068860_100051464 | 3300005843 | Bacteria | 3919 |
| 88 | Ga0081455_10006756 | 3300005937 | Bacteria | 12243 |
| 89 | Ga0081540_1023138 | 3300005983 | Bacteria | 3646 |
| 90 | Ga0081540_1027848 | 3300005983 | Bacteria | 3191 |
| 91 | Ga0081540_1070485 | 3300005983 | Bacteria | 1618 |
| 92 | Ga0070717_10005443 | 3300006028 | Bacteria | 9293 |
| 93 | Ga0070717_10121422 | 3300006028 | Bacteria | 2238 |
| 94 | Ga0075365_10071742 | 3300006038 | Bacteria | 2331 |
| 95 | Ga0075365_10100654 | 3300006038 | Bacteria | 1978 |
| 96 | Ga0075363_100047166 | 3300006048 | Bacteria | 2287 |
| 97 | Ga0075364_10109173 | 3300006051 | Bacteria | 1845 |
| 98 | Ga0070715_10152801 | 3300006163 | Bacteria | 1133 |
| 99 | Ga0070716_100026542 | 3300006173 | Bacteria | 3103 |
| 100 | Ga0070716_100097370 | 3300006173 | Bacteria | 1795 |
| 101 | Ga0070716_100126542 | 3300006173 | Bacteria | 1608 |
| 102 | Ga0070712_100011086 | 3300006175 | Bacteria | 5706 |
| 103 | Ga0070712_100035217 | 3300006175 | Bacteria | 3398 |
| 104 | Ga0070712_100160308 | 3300006175 | Bacteria | 1737 |
| 105 | Ga0075362_10032986 | 3300006177 | Bacteria | 2250 |
| 106 | Ga0075367_10039628 | 3300006178 | Bacteria | 2748 |
| 107 | Ga0075367_10044973 | 3300006178 | Bacteria | 2590 |
| 108 | Ga0075367_10090256 | 3300006178 | Bacteria | 1863 |
| 109 | Ga0075366_10031599 | 3300006195 | Bacteria | 3116 |
| 110 | Ga0075366_10090918 | 3300006195 | Bacteria | 1828 |
| 111 | Ga0097621_100060854 | 3300006237 | Bacteria | 3096 |
| 112 | Ga0075370_10017964 | 3300006353 | Bacteria | 3829 |
| 113 | Ga0075370_10039171 | 3300006353 | Bacteria | 2670 |
| 114 | Ga0075428_100320575 | 3300006844 | Bacteria | 1665 |
| 115 | Ga0075429_100295759 | 3300006880 | Bacteria | 1417 |
| 116 | Ga0097620_100069979 | 3300006931 | Bacteria | 3544 |
| 117 | Ga0099822_1000022 | 3300006943 | Bacteria | 64942 |
| 118 | Ga0075435_100106565 | 3300007076 | Bacteria | 2327 |
| 119 | Ga0099794_10060117 | 3300007265 | Bacteria | 1845 |
| 120 | Ga0099795_10024142 | 3300007788 | Bacteria | 2024 |
| 121 | Ga0105240_10015270 | 3300009093 | Bacteria | 10450 |
| 122 | Ga0105240_10204385 | 3300009093 | Bacteria | 2313 |
| 123 | Ga0105240_10249530 | 3300009093 | Bacteria | 2053 |
| 124 | Ga0105240_10482159 | 3300009093 | Bacteria | 1382 |
| 125 | Ga0111539_10563759 | 3300009094 | Bacteria | 1326 |
| 126 | Ga0105245_10086340 | 3300009098 | Bacteria | 2877 |
| 127 | Ga0105245_10144896 | 3300009098 | Bacteria | 2240 |
| 128 | Ga0105247_10052860 | 3300009101 | Bacteria | 2505 |
| 129 | Ga0114129_10151279 | 3300009147 | Bacteria | 3176 |
| 130 | Ga0105241_10071350 | 3300009174 | Bacteria | 2696 |
| 131 | Ga0105241_10151253 | 3300009174 | Bacteria | 1899 |
| 132 | Ga0105241_10265661 | 3300009174 | Bacteria | 1460 |
| 133 | Ga0105248_10306356 | 3300009177 | Bacteria | 1789 |
| 134 | Ga0105248_10605922 | 3300009177 | Bacteria | 1236 |
| 135 | Ga0105237_10015378 | 3300009545 | Bacteria | 7967 |
| 136 | Ga0105237_10062087 | 3300009545 | Bacteria | 3735 |
| 137 | Ga0105237_10074463 | 3300009545 | Bacteria | 3387 |
| 138 | Ga0105237_10153473 | 3300009545 | Bacteria | 2299 |
| 139 | Ga0105238_10035119 | 3300009551 | Bacteria | 5099 |
| 140 | Ga0105238_10039569 | 3300009551 | Bacteria | 4781 |
| 141 | Ga0105238_10059830 | 3300009551 | Bacteria | 3815 |
| 142 | Ga0105238_10341775 | 3300009551 | Bacteria | 1485 |
| 143 | Ga0105249_10323730 | 3300009553 | Bacteria | 1553 |
| 144 | Ga0105249_10410469 | 3300009553 | Bacteria | 1386 |
| 145 | Ga0105239_10044175 | 3300010375 | Bacteria | 4885 |
| 146 | Ga0105239_10090525 | 3300010375 | Bacteria | 3375 |
| 147 | Ga0105239_10111939 | 3300010375 | Bacteria | 3026 |
| 148 | Ga0105239_10118056 | 3300010375 | Bacteria | 2944 |
| 149 | Ga0105246_10056010 | 3300011119 | Bacteria | 2723 |
| 150 | Ga0105246_10106980 | 3300011119 | Bacteria | 2047 |
| 151 | Ga0157370_10044147 | 3300013104 | Bacteria | 4286 |
| 152 | Ga0157370_10210557 | 3300013104 | Bacteria | 1802 |
| 153 | Ga0157369_10012925 | 3300013105 | Bacteria | 9461 |
| 154 | Ga0157369_10043079 | 3300013105 | Bacteria | 4921 |
| 155 | Ga0157369_10065240 | 3300013105 | Bacteria | 3919 |
| 156 | Ga0157369_10211345 | 3300013105 | Bacteria | 2033 |
| 157 | Ga0157369_10549082 | 3300013105 | Bacteria | 1194 |
| 158 | Ga0157374_10032938 | 3300013296 | Bacteria | 4723 |
| 159 | Ga0157374_10138837 | 3300013296 | Bacteria | 2358 |
| 160 | Ga0157372_10171321 | 3300013307 | Bacteria | 2511 |
| 161 | Ga0157372_10296379 | 3300013307 | Bacteria | 1881 |
| 162 | Ga0163163_10098820 | 3300014325 | Bacteria | 2940 |
| 163 | Ga0163163_10193757 | 3300014325 | Bacteria | 2080 |
| 164 | Ga0157380_10196934 | 3300014326 | Bacteria | 1784 |
| 165 | Ga0182008_10049174 | 3300014497 | Bacteria | 2093 |
| 166 | Ga0157376_10319272 | 3300014969 | Bacteria | 1476 |
| 167 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 168 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 169 | Ga0213876_10010096 | 3300021384 | Bacteria | 5073 |
| 170 | Ga0213876_10110693 | 3300021384 | Bacteria | 1458 |
| 171 | Ga0209677_101595 | 3300025253 | Bacteria | 9567 |
| 172 | Ga0209677_103126 | 3300025253 | Bacteria | 5624 |
| 173 | Ga0209148_1000424 | 3300025254 | Bacteria | 47087 |
| 174 | Ga0209233_1001581 | 3300025261 | Bacteria | 8917 |
| 175 | Ga0209233_1002935 | 3300025261 | Bacteria | 6096 |
| 176 | Ga0209455_1002609 | 3300025272 | Bacteria | 6856 |
| 177 | Ga0209455_1003259 | 3300025272 | Bacteria | 5843 |
| 178 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 179 | Ga0209758_1005684 | 3300025297 | Bacteria | 9427 |
| 180 | Ga0209758_1015210 | 3300025297 | Bacteria | 4008 |
| 181 | Ga0209256_1006007 | 3300025299 | Bacteria | 6649 |
| 182 | Ga0209256_1018545 | 3300025299 | Bacteria | 2254 |
| 183 | Ga0207426_1003443 | 3300025302 | Bacteria | 8598 |
| 184 | Ga0207426_1004449 | 3300025302 | Bacteria | 6833 |
| 185 | Ga0207426_1035836 | 3300025302 | Bacteria | 1581 |
| 186 | Ga0209257_1000426 | 3300025304 | Bacteria | 81095 |
| 187 | Ga0207692_10001428 | 3300025898 | Bacteria | 8939 |
| 188 | Ga0207692_10009587 | 3300025898 | Bacteria | 4051 |
| 189 | Ga0207647_10044552 | 3300025904 | Bacteria | 2771 |
| 190 | Ga0207647_10090069 | 3300025904 | Bacteria | 1831 |
| 191 | Ga0207699_10000390 | 3300025906 | Bacteria | 22928 |
| 192 | Ga0207699_10041162 | 3300025906 | Bacteria | 2667 |
| 193 | Ga0207699_10314054 | 3300025906 | Bacteria | 1097 |
| 194 | Ga0207645_10103780 | 3300025907 | Bacteria | 1836 |
| 195 | Ga0207643_10037027 | 3300025908 | Bacteria | 2737 |
| 196 | Ga0207684_10239989 | 3300025910 | Bacteria | 1564 |
| 197 | Ga0207654_10073979 | 3300025911 | Bacteria | 2032 |
| 198 | Ga0207707_10000178 | 3300025912 | Bacteria | 66057 |
| 199 | Ga0207707_10051598 | 3300025912 | Bacteria | 3582 |
| 200 | Ga0207707_10279084 | 3300025912 | Bacteria | 1447 |
| 201 | Ga0207707_10281805 | 3300025912 | Bacteria | 1439 |
| 202 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 203 | Ga0207695_10094476 | 3300025913 | Bacteria | 2997 |
| 204 | Ga0207695_10142177 | 3300025913 | Bacteria | 2347 |
| 205 | Ga0207695_10147543 | 3300025913 | Bacteria | 2294 |
| 206 | Ga0207671_10004982 | 3300025914 | Bacteria | 12436 |
| 207 | Ga0207671_10014027 | 3300025914 | Bacteria | 6355 |
| 208 | Ga0207671_10041566 | 3300025914 | Bacteria | 3403 |
| 209 | Ga0207671_10058580 | 3300025914 | Bacteria | 2856 |
| 210 | Ga0207671_10317253 | 3300025914 | Bacteria | 1233 |
| 211 | Ga0207693_10010089 | 3300025915 | Bacteria | 7672 |
| 212 | Ga0207693_10018488 | 3300025915 | Bacteria | 5551 |
| 213 | Ga0207693_10030018 | 3300025915 | Bacteria | 4292 |
| 214 | Ga0207663_10006434 | 3300025916 | Bacteria | 6008 |
| 215 | Ga0207663_10014546 | 3300025916 | Bacteria | 4312 |
| 216 | Ga0207663_10021194 | 3300025916 | Bacteria | 3696 |
| 217 | Ga0207660_10025918 | 3300025917 | Bacteria | 3987 |
| 218 | Ga0207660_10085211 | 3300025917 | Bacteria | 2330 |
| 219 | Ga0207660_10098702 | 3300025917 | Bacteria | 2179 |
| 220 | Ga0207649_10045452 | 3300025920 | Bacteria | 2693 |
| 221 | Ga0207649_10058057 | 3300025920 | Bacteria | 2422 |
| 222 | Ga0207649_10091445 | 3300025920 | Bacteria | 1993 |
| 223 | Ga0207652_10019378 | 3300025921 | Bacteria | 5594 |
| 224 | Ga0207652_10080871 | 3300025921 | Bacteria | 2841 |
| 225 | Ga0207694_10082859 | 3300025924 | Bacteria | 2521 |
| 226 | Ga0207694_10108854 | 3300025924 | Bacteria | 2202 |
| 227 | Ga0207694_10296308 | 3300025924 | Bacteria | 1331 |
| 228 | Ga0207650_10120108 | 3300025925 | Bacteria | 2045 |
| 229 | Ga0207687_10109490 | 3300025927 | Bacteria | 2047 |
| 230 | Ga0207687_10255925 | 3300025927 | Bacteria | 1394 |
| 231 | Ga0207700_10028238 | 3300025928 | Bacteria | 3941 |
| 232 | Ga0207700_10242324 | 3300025928 | Bacteria | 1537 |
| 233 | Ga0207664_10155134 | 3300025929 | Bacteria | 1949 |
| 234 | Ga0207664_10189006 | 3300025929 | Bacteria | 1772 |
| 235 | Ga0207644_10034683 | 3300025931 | Bacteria | 3532 |
| 236 | Ga0207706_10136540 | 3300025933 | Bacteria | 2157 |
| 237 | Ga0207706_10221238 | 3300025933 | Bacteria | 1658 |
| 238 | Ga0207665_10208097 | 3300025939 | Bacteria | 1428 |
| 239 | Ga0207665_10208894 | 3300025939 | Bacteria | 1425 |
| 240 | Ga0207711_10071760 | 3300025941 | Bacteria | 3005 |
| 241 | Ga0207711_10275787 | 3300025941 | Bacteria | 1548 |
| 242 | Ga0207661_10004270 | 3300025944 | Bacteria | 10004 |
| 243 | Ga0207661_10019900 | 3300025944 | Bacteria | 5009 |
| 244 | Ga0207679_10229934 | 3300025945 | Bacteria | 1565 |
| 245 | Ga0207667_10051910 | 3300025949 | Bacteria | 4321 |
| 246 | Ga0207667_10141704 | 3300025949 | Bacteria | 2475 |
| 247 | Ga0207667_10206222 | 3300025949 | Bacteria | 2015 |
| 248 | Ga0207667_10236332 | 3300025949 | Bacteria | 1871 |
| 249 | Ga0207651_10037284 | 3300025960 | Bacteria | 3184 |
| 250 | Ga0207651_10255195 | 3300025960 | Bacteria | 1437 |
| 251 | Ga0207639_10010472 | 3300026041 | Bacteria | 6423 |
| 252 | Ga0207639_10037559 | 3300026041 | Bacteria | 3598 |
| 253 | Ga0207639_10143918 | 3300026041 | Bacteria | 1990 |
| 254 | Ga0207639_10262309 | 3300026041 | Bacteria | 1512 |
| 255 | Ga0207678_10039941 | 3300026067 | Bacteria | 4070 |
| 256 | Ga0207678_10042373 | 3300026067 | Bacteria | 3943 |
| 257 | Ga0207678_10130864 | 3300026067 | Bacteria | 2140 |
| 258 | Ga0207678_10252210 | 3300026067 | Bacteria | 1511 |
| 259 | Ga0207708_10060504 | 3300026075 | Bacteria | 2891 |
| 260 | Ga0207702_10428523 | 3300026078 | Bacteria | 1280 |
| 261 | Ga0207702_10442352 | 3300026078 | Bacteria | 1260 |
| 262 | Ga0207674_10057562 | 3300026116 | Bacteria | 3940 |
| 263 | Ga0207674_10082897 | 3300026116 | Bacteria | 3207 |
| 264 | Ga0207674_10117039 | 3300026116 | Bacteria | 2636 |
| 265 | Ga0207675_100033143 | 3300026118 | Bacteria | 4813 |
| 266 | Ga0207683_10088917 | 3300026121 | Bacteria | 2749 |
| 267 | Ga0207698_10141215 | 3300026142 | Bacteria | 2075 |
| 268 | Ga0207698_10468616 | 3300026142 | Bacteria | 1219 |
| 269 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 270 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 271 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 272 | Ga0268266_10006027 | 3300028379 | Bacteria | 11179 |
| 273 | Ga0268266_10064115 | 3300028379 | Bacteria | 3173 |
| 274 | Ga0268266_10162581 | 3300028379 | Bacteria | 2021 |
| 275 | Ga0268265_10010132 | 3300028380 | Bacteria | 6365 |
| 276 | Ga0268265_10369527 | 3300028380 | Bacteria | 1316 |
| 277 | Ga0268264_10141202 | 3300028381 | Bacteria | 2148 |
| 278 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 279 | Ga0307515_10039862 | 3300028794 | Bacteria | 7450 |
| 280 | Ga0265339_10009066 | 3300031249 | Bacteria | 6285 |
| 281 | Ga0265331_10021647 | 3300031250 | Bacteria | 3288 |
| 282 | Ga0265314_10081846 | 3300031711 | Bacteria | 2125 |
| 283 | Ga0265342_10006824 | 3300031712 | Bacteria | 8440 |
| 284 | Ga0307516_10045593 | 3300031730 | Bacteria | 4329 |
| 285 | Ga0307516_10049467 | 3300031730 | Bacteria | 4131 |
| 286 | Ga0307516_10153314 | 3300031730 | Bacteria | 2062 |
| 287 | Ga0307406_10104987 | 3300031901 | Bacteria | 1932 |
| 288 | Ga0307416_100092339 | 3300032002 | Bacteria | 2603 |
| 289 | Ga0307415_100407808 | 3300032126 | Bacteria | 1162 |
| 290 | Ga0307510_10036621 | 3300033180 | Bacteria | 5458 |
| 291 | Ga0307510_10130239 | 3300033180 | Bacteria | 2192 |
| 292 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 293 | Ga0373926_0010149 | 3300035083 | Bacteria | 3152 |
| 294 | Ga0373926_0011513 | 3300035083 | Bacteria | 2977 |
| 295 | Ga0373944_0010032 | 3300035089 | Bacteria | 2576 |
| 296 | Ga0373953_0010516 | 3300035117 | Bacteria | 3223 |
| 297 | Ga0373956_0057759 | 3300035119 | Bacteria | 1754 |
| 298 | Ga0373943_0006580 | 3300035170 | Bacteria | 5212 |
| 299 | Ga0373943_0076550 | 3300035170 | Bacteria | 1707 |
| 300 | Ga0373946_0051217 | 3300035171 | Bacteria | 1727 |
| 301 | Ga0373924_0012841 | 3300035410 | Bacteria | 3136 |
| 302 | Ga0373935_0000259 | 3300035692 | Bacteria | 26229 |
| 303 | Ga0373927_0000339 | 3300035695 | Bacteria | 36731 |
| 304 | Ga0373927_0002379 | 3300035695 | Bacteria | 13707 |
| 305 | Ga0373927_0012044 | 3300035695 | Bacteria | 5753 |
| 306 | Ga0373927_0016655 | 3300035695 | Bacteria | 4849 |
| 307 | Ga0373927_0088787 | 3300035695 | Bacteria | 2007 |
| 308 | Ga0373933_0003061 | 3300035724 | Bacteria | 9333 |
| 309 | Ga0373947_0000217 | 3300035725 | Bacteria | 32254 |
| 310 | Ga0373947_0011904 | 3300035725 | Bacteria | 4984 |
| 311 | Ga0373947_0048091 | 3300035725 | Bacteria | 2558 |
| 312 | Ga0373937_0022213 | 3300036401 | Bacteria | 5702 |
| 313 | Ga0373937_0070599 | 3300036401 | Bacteria | 3222 |
| 314 | Ga0373937_0469908 | 3300036401 | Bacteria | 1194 |
| 315 | Ga0373925_0004501 | 3300037068 | Bacteria | 10530 |
| 316 | Ga0373925_0173209 | 3300037068 | Bacteria | 1704 |
| 317 | Ga0373925_0179546 | 3300037068 | Bacteria | 1675 |
| 318 | Ga0395905_0019046 | 3300037471 | Bacteria | 6510 |
| 319 | Ga0436364_1334513 | 3300037853 | Bacteria | 1377 |
| 320 | Ga0395901_0057616 | 3300038443 | Bacteria | 4041 |
| 321 | Ga0395901_0064581 | 3300038443 | Bacteria | 3811 |
| 322 | Ga0436365_0023590 | 3300039437 | Bacteria | 4181 |
| 323 | Ga0436365_0938537 | 3300039437 | Bacteria | 1885 |
| 324 | Ga0436365_1446014 | 3300039437 | Bacteria | 2887 |
| 325 | Ga0436365_1446425 | 3300039437 | Bacteria | 5355 |
| 326 | Ga0436365_1673545 | 3300039437 | Bacteria | 1541 |
| 327 | Ga0436361_0081107 | 3300039447 | Bacteria | 1539 |
| 328 | Ga0436361_1114449 | 3300039447 | Bacteria | 1717 |
| 329 | Ga0436363_0742244 | 3300039450 | Bacteria | 1531 |
| 330 | Ga0436362_0646134 | 3300039453 | Bacteria | 7178 |
| 331 | Ga0466969_0044014 | 3300044656 | Bacteria | 2223 |
| 332 | Ga0466969_0085228 | 3300044656 | Bacteria | 1502 |
| 333 | Ga0466972_0000520 | 3300044658 | Bacteria | 19029 |
| 334 | Ga0466972_0004454 | 3300044658 | Bacteria | 7005 |
| 335 | Ga0466966_0059000 | 3300044684 | Bacteria | 2424 |
| 336 | Ga0466966_0066368 | 3300044684 | Bacteria | 2268 |
| 337 | Ga0466961_0000149 | 3300044693 | Bacteria | 47561 |
| 338 | Ga0466960_0003292 | 3300044901 | Bacteria | 6199 |
| 339 | Ga0466959_0004087 | 3300045049 | Bacteria | 9713 |
| 340 | Ga0466958_0107640 | 3300045836 | Bacteria | 1739 |
| 341 | Ga0466967_0206070 | 3300045976 | Bacteria | 1864 |
| 342 | Ga0466967_0412996 | 3300045976 | Bacteria | 1314 |
| 343 | Ga0495592_0045306 | 3300046454 | Bacteria | 3283 |
| 344 | Ga0495603_0000352 | 3300046455 | Bacteria | 24722 |
| 345 | Ga0495603_0013852 | 3300046455 | Bacteria | 4881 |
| 346 | Ga0495603_0168157 | 3300046455 | Bacteria | 1270 |
| 347 | Ga0495629_0003719 | 3300046459 | Bacteria | 11498 |
| 348 | Ga0495629_0042670 | 3300046459 | Bacteria | 3186 |
| 349 | Ga0495629_0077072 | 3300046459 | Bacteria | 2327 |
| 350 | Ga0495629_0118718 | 3300046459 | Bacteria | 1843 |
| 351 | Ga0495638_0002610 | 3300046460 | Bacteria | 14544 |
| 352 | Ga0495638_0150487 | 3300046460 | Bacteria | 1350 |
| 353 | Ga0495638_0173691 | 3300046460 | Bacteria | 1234 |
| 354 | Ga0495641_0018952 | 3300046461 | Bacteria | 3536 |
| 355 | Ga0495641_0026296 | 3300046461 | Bacteria | 2841 |
| 356 | Ga0495580_0047201 | 3300046472 | Bacteria | 3053 |
| 357 | Ga0495580_0062999 | 3300046472 | Bacteria | 2601 |
| 358 | Ga0495639_0001973 | 3300046475 | Bacteria | 9084 |
| 359 | Ga0495639_0002472 | 3300046475 | Bacteria | 8065 |
| 360 | Ga0495662_0000872 | 3300046476 | Bacteria | 14723 |
| 361 | Ga0495664_0013868 | 3300046477 | Bacteria | 4570 |
| 362 | Ga0495664_0032321 | 3300046477 | Bacteria | 3070 |
| 363 | Ga0495664_0154024 | 3300046477 | Bacteria | 1394 |
| 364 | Ga0495585_0047515 | 3300046492 | Bacteria | 2390 |
| 365 | Ga0495594_0001257 | 3300046499 | Bacteria | 13294 |
| 366 | Ga0495594_0019990 | 3300046499 | Bacteria | 3564 |
| 367 | Ga0495596_0041048 | 3300046500 | Bacteria | 1825 |
| 368 | Ga0495606_0021592 | 3300046507 | Bacteria | 4713 |
| 369 | Ga0495606_0050798 | 3300046507 | Bacteria | 2709 |
| 370 | Ga0495608_0144634 | 3300046511 | Bacteria | 1517 |
| 371 | Ga0495608_0154648 | 3300046511 | Bacteria | 1460 |
| 372 | Ga0495618_0098788 | 3300046514 | Bacteria | 1868 |
| 373 | Ga0495628_0059443 | 3300046516 | Bacteria | 3001 |
| 374 | Ga0495628_0076574 | 3300046516 | Bacteria | 2603 |
| 375 | Ga0495628_0192352 | 3300046516 | Bacteria | 1540 |
| 376 | Ga0495632_0067308 | 3300046519 | Bacteria | 1727 |
| 377 | Ga0495644_0048274 | 3300046523 | Bacteria | 1599 |
| 378 | Ga0495666_0041105 | 3300046526 | Bacteria | 2240 |
| 379 | Ga0495652_0033678 | 3300046529 | Bacteria | 4470 |
| 380 | Ga0495652_0136093 | 3300046529 | Bacteria | 1938 |
| 381 | Ga0495665_0000361 | 3300046531 | Bacteria | 22971 |
| 382 | Ga0495665_0082956 | 3300046531 | Bacteria | 1685 |
| 383 | Ga0495640_0003002 | 3300046533 | Bacteria | 13580 |
| 384 | Ga0495640_0036139 | 3300046533 | Bacteria | 3491 |
| 385 | Ga0495640_0036471 | 3300046533 | Bacteria | 3473 |
| 386 | Ga0495609_0082180 | 3300046538 | Bacteria | 1408 |
| 387 | Ga0495597_0034517 | 3300046542 | Bacteria | 2286 |
| 388 | Ga0495645_0020761 | 3300046543 | Bacteria | 4744 |
| 389 | Ga0495645_0113386 | 3300046543 | Bacteria | 1916 |
| 390 | Ga0495645_0120232 | 3300046543 | Bacteria | 1850 |
| 391 | Ga0495622_0079669 | 3300046557 | Bacteria | 1507 |
| 392 | Ga0495633_0123606 | 3300046558 | Bacteria | 1198 |
| 393 | Ga0495667_0038334 | 3300046559 | Bacteria | 3191 |
| 394 | Ga0495656_0018728 | 3300046615 | Bacteria | 2665 |
| 395 | Ga0495656_0138565 | 3300046615 | Bacteria | 1164 |
| 396 | Ga0495668_0016367 | 3300046616 | Bacteria | 4310 |
| 397 | Ga0495634_0000249 | 3300046642 | Bacteria | 50835 |
| 398 | Ga0495634_0034343 | 3300046642 | Bacteria | 3481 |
| 399 | Ga0495625_0153889 | 3300046660 | Bacteria | 1544 |
| 400 | Ga0495635_0000239 | 3300046663 | Bacteria | 34889 |
| 401 | Ga0495635_0011527 | 3300046663 | Bacteria | 6197 |
| 402 | Ga0495635_0106089 | 3300046663 | Bacteria | 1919 |
| 403 | Ga0495659_0038199 | 3300046664 | Bacteria | 1704 |
| 404 | Ga0495588_0003787 | 3300046674 | Bacteria | 6628 |
| 405 | Ga0495588_0014080 | 3300046674 | Bacteria | 3823 |
| 406 | Ga0495657_0003492 | 3300046675 | Bacteria | 12822 |
| 407 | Ga0495599_0022511 | 3300046678 | Bacteria | 3935 |
| 408 | Ga0495623_0002296 | 3300046679 | Bacteria | 12741 |
| 409 | Ga0495623_0047010 | 3300046679 | Bacteria | 2739 |
| 410 | Ga0495646_0005453 | 3300046680 | Bacteria | 8043 |
| 411 | Ga0495647_0001674 | 3300046681 | Bacteria | 6865 |
| 412 | Ga0495647_0019253 | 3300046681 | Bacteria | 2439 |
| 413 | Ga0495658_0001058 | 3300046683 | Bacteria | 14532 |
| 414 | Ga0495658_0071454 | 3300046683 | Bacteria | 2016 |
| 415 | Ga0495613_0000929 | 3300046689 | Bacteria | 22466 |
| 416 | Ga0495613_0208176 | 3300046689 | Bacteria | 1376 |
| 417 | Ga0495624_0099539 | 3300046690 | Bacteria | 1790 |
| 418 | Ga0495624_0104140 | 3300046690 | Bacteria | 1746 |
| 419 | Ga0495624_0204832 | 3300046690 | Bacteria | 1198 |
| 420 | Ga0495600_0035084 | 3300046809 | Bacteria | 3257 |
| 421 | Ga0495600_0077649 | 3300046809 | Bacteria | 2168 |
| 422 | Ga0495660_0046424 | 3300046810 | Bacteria | 2382 |
| 423 | Ga0495581_0016881 | 3300047315 | Bacteria | 4243 |
| 424 | Ga0495581_0199072 | 3300047315 | Bacteria | 1172 |
| 425 | Ga0495604_0005469 | 3300047317 | Bacteria | 10075 |
| 426 | Ga0495604_0045025 | 3300047317 | Bacteria | 3445 |
| 427 | Ga0495604_0066699 | 3300047317 | Bacteria | 2736 |
| 428 | Ga0495674_0001854 | 3300047319 | Bacteria | 20818 |
| 429 | Ga0495674_0087826 | 3300047319 | Bacteria | 2660 |
| 430 | Ga0495674_0118713 | 3300047319 | Bacteria | 2236 |
| 431 | Ga0495672_0027086 | 3300047320 | Bacteria | 3648 |
| 432 | Ga0495676_0022316 | 3300047321 | Bacteria | 5509 |
| 433 | Ga0495676_0029475 | 3300047321 | Bacteria | 4672 |
| 434 | Ga0495676_0195425 | 3300047321 | Bacteria | 1409 |
| 435 | Ga0495676_0290494 | 3300047321 | Bacteria | 1105 |
| 436 | Ga0495680_0032224 | 3300047322 | Bacteria | 4257 |
| 437 | Ga0495687_019183 | 3300047443 | Bacteria | 3362 |
| 438 | Ga0495675_0002807 | 3300047444 | Bacteria | 10441 |
| 439 | Ga0495677_0078335 | 3300047445 | Bacteria | 1237 |
| 440 | Ga0495685_039846 | 3300047447 | Bacteria | 1608 |
| 441 | Ga0495673_0033616 | 3300047469 | Bacteria | 2378 |
| 442 | Ga0495684_0009436 | 3300047471 | Bacteria | 7533 |
| 443 | Ga0495684_0043713 | 3300047471 | Bacteria | 3431 |
| 444 | Ga0495686_0073671 | 3300047472 | Bacteria | 2097 |
| 445 | Ga0495593_0000034 | 3300047673 | Bacteria | 57993 |
| 446 | Ga0495593_0158705 | 3300047673 | Bacteria | 1142 |
| 447 | Ga0495602_0049097 | 3300048088 | Bacteria | 3783 |
| 448 | Ga0495615_0008880 | 3300048090 | Bacteria | 1957 |
| 449 | Ga0496100_0094668 | 3300048903 | Bacteria | 2046 |
| 450 | Ga0496101_0040575 | 3300048904 | Bacteria | 3315 |
| 451 | Ga0496101_0143524 | 3300048904 | Bacteria | 1822 |
| 452 | Ga0496103_0005710 | 3300048906 | Bacteria | 7435 |
| 453 | Ga0496104_0015916 | 3300048907 | Bacteria | 6825 |
| 454 | Ga0496104_0253556 | 3300048907 | Bacteria | 1672 |
| 455 | Ga0496104_0356272 | 3300048907 | Bacteria | 1376 |
| 456 | Ga0496104_0412918 | 3300048907 | Bacteria | 1262 |
| 457 | Ga0496105_0034901 | 3300048908 | Bacteria | 4138 |
| 458 | Ga0496105_0051425 | 3300048908 | Bacteria | 3404 |
| 459 | Ga0496105_0168740 | 3300048908 | Bacteria | 1795 |
| 460 | Ga0496106_0032306 | 3300048909 | Bacteria | 3902 |
| 461 | Ga0496107_0051082 | 3300048910 | Bacteria | 2981 |
| 462 | Ga0496107_0178459 | 3300048910 | Bacteria | 1577 |
| 463 | Ga0496107_0184688 | 3300048910 | Bacteria | 1549 |
| 464 | Ga0496107_0272553 | 3300048910 | Bacteria | 1260 |
| 465 | Ga0496109_0054328 | 3300048912 | Bacteria | 3653 |
| 466 | Ga0496109_0131145 | 3300048912 | Bacteria | 2339 |
| 467 | Ga0496109_0206443 | 3300048912 | Bacteria | 1847 |
| 468 | Ga0496110_0013275 | 3300048913 | Bacteria | 6803 |
| 469 | Ga0496110_0067610 | 3300048913 | Bacteria | 3162 |
| 470 | Ga0496110_0099197 | 3300048913 | Bacteria | 2611 |
| 471 | Ga0496110_0100133 | 3300048913 | Bacteria | 2598 |
| 472 | Ga0496110_0248830 | 3300048913 | Bacteria | 1618 |
| 473 | Ga0496112_0035334 | 3300048915 | Bacteria | 4868 |
| 474 | Ga0496112_0035784 | 3300048915 | Bacteria | 4839 |
| 475 | Ga0496112_0138008 | 3300048915 | Bacteria | 2408 |
| 476 | Ga0496113_0083357 | 3300048916 | Bacteria | 2453 |
| 477 | Ga0496113_0163077 | 3300048916 | Bacteria | 1763 |
| 478 | Ga0496113_0317986 | 3300048916 | Bacteria | 1247 |
| 479 | Ga0496114_0028100 | 3300048917 | Bacteria | 4613 |
| 480 | Ga0496114_0071880 | 3300048917 | Bacteria | 2908 |
| 481 | Ga0496114_0133540 | 3300048917 | Bacteria | 2145 |
| 482 | Ga0496114_0370647 | 3300048917 | Bacteria | 1267 |
| 483 | Ga0496115_0037983 | 3300048918 | Bacteria | 3819 |
| 484 | Ga0496115_0121411 | 3300048918 | Bacteria | 2150 |
| 485 | Ga0496116_0101606 | 3300048919 | Bacteria | 1716 |
| 486 | Ga0496117_0047573 | 3300048920 | Bacteria | 3074 |
| 487 | Ga0496118_0017089 | 3300048921 | Bacteria | 6622 |
| 488 | Ga0496119_0058779 | 3300048922 | Bacteria | 2314 |
| 489 | Ga0496119_0193247 | 3300048922 | Bacteria | 1059 |
| 490 | Ga0496120_0021761 | 3300048923 | Bacteria | 4044 |
| 491 | Ga0496121_0015642 | 3300048924 | Bacteria | 7916 |
| 492 | Ga0496121_0050475 | 3300048924 | Bacteria | 3514 |
| 493 | Ga0496121_0050757 | 3300048924 | Bacteria | 3501 |
| 494 | Ga0496121_0077328 | 3300048924 | Bacteria | 2650 |
| 495 | Ga0496121_0118993 | 3300048924 | Bacteria | 1998 |
| 496 | Ga0496122_0080318 | 3300048925 | Bacteria | 2275 |
| 497 | Ga0496124_0275469 | 3300048927 | Bacteria | 1230 |
| 498 | Ga0496125_0028183 | 3300048928 | Bacteria | 5078 |
| 499 | Ga0496125_0135448 | 3300048928 | Bacteria | 1724 |
| 500 | Ga0496126_0009402 | 3300048929 | Bacteria | 10385 |
| 501 | Ga0496126_0020832 | 3300048929 | Bacteria | 6418 |
| 502 | Ga0496126_0030411 | 3300048929 | Bacteria | 5116 |
| 503 | Ga0496126_0031723 | 3300048929 | Bacteria | 4986 |
| 504 | Ga0496126_0111509 | 3300048929 | Bacteria | 2382 |
| 505 | Ga0496126_0144421 | 3300048929 | Bacteria | 2045 |
| 506 | Ga0496126_0235808 | 3300048929 | Bacteria | 1531 |
| 507 | Ga0501032_0003534 | 3300049569 | Bacteria | 11926 |
| 508 | Ga0501032_0076324 | 3300049569 | Bacteria | 2231 |
| 509 | Ga0501033_0000249 | 3300049570 | Bacteria | 52045 |
| 510 | Ga0501033_0000951 | 3300049570 | Bacteria | 26299 |
| 511 | Ga0501034_0001938 | 3300049571 | Bacteria | 26206 |
| 512 | Ga0501036_0004433 | 3300049572 | Bacteria | 11343 |
| 513 | Ga0501036_0090479 | 3300049572 | Bacteria | 2585 |
| 514 | Ga0501037_0000112 | 3300049573 | Bacteria | 75698 |
| 515 | Ga0501037_0004019 | 3300049573 | Bacteria | 10664 |
| 516 | Ga0501038_0000160 | 3300049574 | Bacteria | 57443 |
| 517 | Ga0501038_0018478 | 3300049574 | Bacteria | 6294 |
| 518 | Ga0501039_0011683 | 3300049575 | Bacteria | 6689 |
| 519 | Ga0501039_0049318 | 3300049575 | Bacteria | 3254 |
| 520 | Ga0501039_0168331 | 3300049575 | Bacteria | 1723 |
| 521 | Ga0501042_0068679 | 3300049578 | Bacteria | 2534 |
| 522 | Ga0501043_0000278 | 3300049579 | Bacteria | 46214 |
| 523 | Ga0501043_0016672 | 3300049579 | Bacteria | 5756 |
| 524 | Ga0501046_0000937 | 3300049580 | Bacteria | 28581 |
| 525 | Ga0501046_0029168 | 3300049580 | Bacteria | 4487 |
| 526 | Ga0501047_0000275 | 3300049581 | Bacteria | 59536 |
| 527 | Ga0501048_0001248 | 3300049582 | Bacteria | 19253 |
| 528 | Ga0501067_0000258 | 3300049583 | Bacteria | 28937 |
| 529 | Ga0501067_0126237 | 3300049583 | Bacteria | 1424 |
| 530 | Ga0501068_0004146 | 3300049584 | Bacteria | 7852 |
| 531 | Ga0501069_0002032 | 3300049585 | Bacteria | 10137 |
| 532 | Ga0501070_0002548 | 3300049586 | Bacteria | 15964 |
| 533 | Ga0501070_0044688 | 3300049586 | Bacteria | 3684 |
| 534 | Ga0501071_0038499 | 3300049587 | Bacteria | 3418 |
| 535 | Ga0501071_0077213 | 3300049587 | Bacteria | 2433 |
| 536 | Ga0501072_0006863 | 3300049588 | Bacteria | 8639 |
| 537 | Ga0501073_0000103 | 3300049589 | Bacteria | 53962 |
| 538 | Ga0501074_0025367 | 3300049590 | Bacteria | 4305 |
| 539 | Ga0501079_0000451 | 3300049741 | Bacteria | 26871 |
| 540 | Ga0501080_0002998 | 3300049742 | Bacteria | 14886 |
| 541 | Ga0501080_0022860 | 3300049742 | Bacteria | 5796 |
| 542 | Ga0501081_0333418 | 3300049743 | Bacteria | 1116 |
| 543 | Ga0501083_0013394 | 3300049744 | Bacteria | 5732 |
| 544 | Ga0501035_0000766 | 3300049822 | Bacteria | 34513 |
| 545 | Ga0501044_0000418 | 3300049823 | Bacteria | 52554 |
| 546 | Ga0501044_0071079 | 3300049823 | Bacteria | 3539 |
| 547 | Ga0501044_0080760 | 3300049823 | Bacteria | 3293 |
| 548 | Ga0501045_0012804 | 3300049824 | Bacteria | 5910 |
| 549 | nmdc:mga03n38_77785_c1 | 3300050490 | Bacteria | 1551 |
| 550 | nmdc:mga00v17_106119_c1 | 3300050491 | Bacteria | 1778 |
| 551 | nmdc:mga00v17_156197_c1 | 3300050491 | Bacteria | 1467 |
| 552 | nmdc:mga0yw44_1397_c1 | 3300050492 | Bacteria | 9573 |
| 553 | nmdc:mga0yw44_20742_c1 | 3300050492 | Bacteria | 3653 |
| 554 | nmdc:mga0yw44_57310_c1 | 3300050492 | Bacteria | 2376 |
| 555 | nmdc:mga06z11_84251_c1 | 3300050494 | Bacteria | 1713 |
| 556 | nmdc:mga06z11_86734_c1 | 3300050494 | Bacteria | 1691 |
| 557 | nmdc:mga07m45_45292_c1 | 3300050496 | Bacteria | 2470 |
| 558 | nmdc:mga07m45_48977_c1 | 3300050496 | Bacteria | 2377 |
| 559 | nmdc:mga05p37_62404_c1 | 3300050507 | Bacteria | 4586 |
| 560 | nmdc:mga09592_255513_c1 | 3300050508 | Bacteria | 1519 |
| 561 | nmdc:mga08y16_302874_c1 | 3300050511 | Bacteria | 1647 |
| 562 | nmdc:mga0n895_181060_c1 | 3300050512 | Bacteria | 2139 |
| 563 | nmdc:mga0rr50_27857_c1 | 3300050513 | Bacteria | 3963 |
| 564 | nmdc:mga0sz30_20733_c1 | 3300050516 | Bacteria | 2654 |
| 565 | Ga0495601_0097002 | 3300053077 | Bacteria | 1902 |
| 566 | Ga0495601_0103756 | 3300053077 | Bacteria | 1838 |
| 567 | Ga0500610_0063990 | 3300053079 | Bacteria | 1919 |
| 568 | Ga0500635_0016901 | 3300053080 | Bacteria | 2177 |
| 569 | Ga0495619_0191674 | 3300053085 | Bacteria | 1415 |
| 570 | Ga0500578_0045489 | 3300053086 | Bacteria | 2816 |
| 571 | Ga0500643_000267 | 3300053087 | Bacteria | 46005 |
| 572 | Ga0500643_041816 | 3300053087 | Bacteria | 1344 |
| 573 | Ga0500651_0060147 | 3300053093 | Bacteria | 2374 |
| 574 | Ga0500566_0000185 | 3300053094 | Bacteria | 32171 |
| 575 | Ga0500566_0001146 | 3300053094 | Bacteria | 15389 |
| 576 | Ga0500566_0001213 | 3300053094 | Bacteria | 15085 |
| 577 | Ga0500640_040072 | 3300053095 | Bacteria | 2058 |
| 578 | Ga0500555_026660 | 3300053103 | Bacteria | 1651 |
| 579 | Ga0500562_001577 | 3300053108 | Bacteria | 5663 |
| 580 | Ga0500572_000384 | 3300053111 | Bacteria | 15705 |
| 581 | Ga0500572_008551 | 3300053111 | Bacteria | 2397 |
| 582 | Ga0500594_0032137 | 3300053118 | Bacteria | 1389 |
| 583 | Ga0500595_003818 | 3300053119 | Bacteria | 6928 |
| 584 | Ga0500607_115620 | 3300053121 | Bacteria | 1307 |
| 585 | Ga0500614_001219 | 3300053123 | Bacteria | 6263 |
| 586 | Ga0500642_0066734 | 3300053130 | Bacteria | 1628 |
| 587 | Ga0500652_041981 | 3300053131 | Bacteria | 1844 |
| 588 | Ga0500658_0043983 | 3300053134 | Bacteria | 1800 |
| 589 | Ga0500559_0000863 | 3300053136 | Bacteria | 19480 |
| 590 | Ga0500559_0102704 | 3300053136 | Bacteria | 1318 |
| 591 | Ga0500564_055337 | 3300053138 | Bacteria | 1809 |
| 592 | Ga0500588_0009279 | 3300053146 | Bacteria | 2334 |
| 593 | Ga0500590_133198 | 3300053148 | Bacteria | 1147 |
| 594 | Ga0500603_002337 | 3300053150 | Bacteria | 4164 |
| 595 | Ga0500603_031697 | 3300053150 | Bacteria | 1367 |
| 596 | Ga0500616_0000166 | 3300053153 | Bacteria | 110141 |
| 597 | Ga0500630_013860 | 3300053159 | Bacteria | 3968 |
| 598 | Ga0500634_0052688 | 3300053161 | Bacteria | 2184 |
| 599 | Ga0500638_001014 | 3300053162 | Bacteria | 8145 |
| 600 | Ga0500639_000010 | 3300053163 | Bacteria | 136747 |
| 601 | Ga0500636_0001916 | 3300053177 | Bacteria | 11425 |
| 602 | Ga0500637_0000121 | 3300053178 | Bacteria | 28204 |
| 603 | Ga0500637_0027260 | 3300053178 | Bacteria | 3153 |
| 604 | Ga0500611_014364 | 3300053727 | Bacteria | 1380 |
| 605 | Ga0500596_002495 | 3300053735 | Bacteria | 3628 |
| 606 | Ga0500596_004734 | 3300053735 | Bacteria | 2469 |
| 607 | Ga0500599_000459 | 3300053736 | Bacteria | 4213 |
| 608 | Ga0501084_0003972 | 3300054114 | Bacteria | 12046 |
| 609 | Ga0500661_000452 | 3300055283 | Bacteria | 7586 |
| 610 | Ga0501082_0025989 | 3300060353 | Bacteria | 5046 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0067610 | Ga0496110_0067610_2235_3146 | 299 |
| 2 | 3300044656 | Ga0466969_0044014 | Ga0466969_0044014_483_1478 | 308 |
| 3 | 3300005434 | Ga0070709_10265907 | Ga0070709_102659071 | 309 |
| 4 | 3300025929 | Ga0207664_10189006 | Ga0207664_101890062 | 309 |
| 5 | 3300035083 | Ga0373926_0011513 | Ga0373926_0011513_1704_2702 | 310 |
| 6 | 3300035089 | Ga0373944_0010032 | Ga0373944_0010032_102_1100 | 310 |
| 7 | 3300035117 | Ga0373953_0010516 | Ga0373953_0010516_1133_2131 | 310 |
| 8 | 3300035119 | Ga0373956_0057759 | Ga0373956_0057759_200_1201 | 310 |
| 9 | 3300035410 | Ga0373924_0012841 | Ga0373924_0012841_1175_2173 | 310 |
| 10 | 3300035695 | Ga0373927_0012044 | Ga0373927_0012044_3481_4479 | 310 |
| 11 | 3300035725 | Ga0373947_0048091 | Ga0373947_0048091_1336_2337 | 310 |
| 12 | 3300036401 | Ga0373937_0469908 | Ga0373937_0469908_136_1134 | 310 |
| 13 | 3300046459 | Ga0495629_0077072 | Ga0495629_0077072_1289_2290 | 310 |
| 14 | 3300046472 | Ga0495580_0047201 | Ga0495580_0047201_1961_2962 | 310 |
| 15 | 3300046475 | Ga0495639_0002472 | Ga0495639_0002472_4453_5454 | 310 |
| 16 | 3300046511 | Ga0495608_0144634 | Ga0495608_0144634_41_1042 | 310 |
| 17 | 3300046514 | Ga0495618_0098788 | Ga0495618_0098788_587_1588 | 310 |
| 18 | 3300046516 | Ga0495628_0076574 | Ga0495628_0076574_15_1016 | 310 |
| 19 | 3300046531 | Ga0495665_0082956 | Ga0495665_0082956_374_1372 | 310 |
| 20 | 3300046543 | Ga0495645_0120232 | Ga0495645_0120232_556_1557 | 310 |
| 21 | 3300046642 | Ga0495634_0034343 | Ga0495634_0034343_614_1615 | 310 |
| 22 | 3300046663 | Ga0495635_0106089 | Ga0495635_0106089_136_1137 | 310 |
| 23 | 3300046679 | Ga0495623_0047010 | Ga0495623_0047010_1454_2455 | 310 |
| 24 | 3300046681 | Ga0495647_0019253 | Ga0495647_0019253_930_1928 | 310 |
| 25 | 3300046683 | Ga0495658_0071454 | Ga0495658_0071454_964_1962 | 310 |
| 26 | 3300047315 | Ga0495581_0016881 | Ga0495581_0016881_76_1077 | 310 |
| 27 | 3300047317 | Ga0495604_0045025 | Ga0495604_0045025_221_1222 | 310 |
| 28 | 3300047319 | Ga0495674_0087826 | Ga0495674_0087826_112_1113 | 310 |
| 29 | 3300047321 | Ga0495676_0195425 | Ga0495676_0195425_142_1143 | 310 |
| 30 | 3300047471 | Ga0495684_0009436 | Ga0495684_0009436_1398_2396 | 310 |
| 31 | 3300053077 | Ga0495601_0103756 | Ga0495601_0103756_494_1495 | 310 |
| 32 | 3300037068 | Ga0373925_0179546 | Ga0373925_0179546_612_1559 | 313 |
| 33 | 3300048929 | Ga0496126_0020832 | Ga0496126_0020832_4540_5538 | 314 |
| 34 | 3300005467 | Ga0070706_100258990 | Ga0070706_1002589901 | 316 |
| 35 | 3300005471 | Ga0070698_100019627 | Ga0070698_1000196274 | 316 |
| 36 | 3300025253 | Ga0209677_103126 | Ga0209677_1031263 | 316 |
| 37 | 3300025910 | Ga0207684_10239989 | Ga0207684_102399891 | 316 |
| 38 | 3300005983 | Ga0081540_1070485 | Ga0081540_10704853 | 317 |
| 39 | 3300005539 | Ga0068853_100099309 | Ga0068853_1000993091 | 320 |
| 40 | 3300005548 | Ga0070665_100206548 | Ga0070665_1002065481 | 320 |
| 41 | 3300005563 | Ga0068855_100049698 | Ga0068855_1000496982 | 320 |
| 42 | 3300010375 | Ga0105239_10118056 | Ga0105239_101180562 | 320 |
| 43 | 3300025924 | Ga0207694_10082859 | Ga0207694_100828593 | 320 |
| 44 | 3300025949 | Ga0207667_10206222 | Ga0207667_102062221 | 320 |
| 45 | 3300026041 | Ga0207639_10143918 | Ga0207639_101439182 | 320 |
| 46 | 3300028379 | Ga0268266_10162581 | Ga0268266_101625811 | 320 |
| 47 | 3300048917 | Ga0496114_0133540 | Ga0496114_0133540_321_1352 | 320 |
| 48 | 3300009545 | Ga0105237_10074463 | Ga0105237_100744633 | 321 |
| 49 | 3300009551 | Ga0105238_10035119 | Ga0105238_100351193 | 321 |
| 50 | 3300013296 | Ga0157374_10032938 | Ga0157374_100329385 | 321 |
| 51 | 3300025914 | Ga0207671_10014027 | Ga0207671_100140275 | 321 |
| 52 | 3300046557 | Ga0495622_0079669 | Ga0495622_0079669_373_1347 | 322 |
| 53 | iso_pu_bacteria | 2507262055 | 2507511009 | 322 |
| 54 | iso_pu_bacteria | 2508501009 | 2508544830 | 322 |
| 55 | iso_pu_bacteria | 2508501042 | 2508696942 | 322 |
| 56 | iso_pu_bacteria | 2508501128 | 2509148872 | 322 |
| 57 | iso_pu_bacteria | 2513237092 | 2513623483 | 322 |
| 58 | iso_pu_bacteria | 2513237094 | 2513637471 | 322 |
| 59 | iso_pu_bacteria | 2513237096 | 2513655023 | 322 |
| 60 | iso_pu_bacteria | 2513237101 | 2513697429 | 322 |
| 61 | iso_pu_bacteria | 2513237104 | 2513716914 | 322 |
| 62 | iso_pu_bacteria | 2513237137 | 2513861038 | 322 |
| 63 | iso_pu_bacteria | 2513237139 | 2513874649 | 322 |
| 64 | iso_pu_bacteria | 2513237145 | 2513915954 | 322 |
| 65 | iso_pu_bacteria | 2515154112 | 2515625439 | 322 |
| 66 | iso_pu_bacteria | 2517572143 | 2517894740 | 322 |
| 67 | iso_pu_bacteria | 2524023228 | 2524534489 | 322 |
| 68 | iso_pu_bacteria | 2528768022 | 2528849823 | 322 |
| 69 | iso_pu_bacteria | 2667528175 | 2671119154 | 322 |
| 70 | iso_pu_bacteria | 2721755755 | 2723843079 | 322 |
| 71 | iso_pu_bacteria | 2791355196 | 2793064661 | 322 |
| 72 | iso_pu_bacteria | 2791355199 | 2793079514 | 322 |
| 73 | iso_pu_bacteria | 2802429603 | 2805916646 | 322 |
| 74 | iso_pu_bacteria | 2824600985 | 2824607727 | 322 |
| 75 | iso_pu_bacteria | 2824609381 | 2824617135 | 322 |
| 76 | iso_pu_bacteria | 2824617872 | 2824624257 | 322 |
| 77 | iso_pu_bacteria | 2824626560 | 2824633061 | 322 |
| 78 | iso_pu_bacteria | 2824635225 | 2824643384 | 322 |
| 79 | iso_pu_bacteria | 2824644064 | 2824648779 | 322 |
| 80 | iso_pu_bacteria | 2824653114 | 2824658708 | 322 |
| 81 | iso_pu_bacteria | 2824671348 | 2824676175 | 322 |
| 82 | iso_pu_bacteria | 2824687955 | 2824692367 | 322 |
| 83 | iso_pu_bacteria | 2824696289 | 2824704000 | 322 |
| 84 | iso_pu_bacteria | 2824704595 | 2824713584 | 322 |
| 85 | iso_pu_bacteria | 2824714736 | 2824722396 | 322 |
| 86 | iso_pu_bacteria | 2824723954 | 2824731665 | 322 |
| 87 | iso_pu_bacteria | 2824753945 | 2824761221 | 322 |
| 88 | iso_pu_bacteria | 2824763712 | 2824771854 | 322 |
| 89 | iso_pu_bacteria | 2838122688 | 2838127893 | 322 |
| 90 | iso_pu_bacteria | 2841941048 | 2841943186 | 322 |
| 91 | iso_pu_bacteria | 2841949485 | 2841954083 | 322 |
| 92 | iso_pu_bacteria | 2841957949 | 2841960222 | 322 |
| 93 | iso_pu_bacteria | 2841983080 | 2841987990 | 322 |
| 94 | iso_pu_bacteria | 2847939898 | 2847944240 | 322 |
| 95 | iso_pu_bacteria | 2849076700 | 2849081527 | 322 |
| 96 | iso_pu_bacteria | 2874590934 | 2874597746 | 322 |
| 97 | iso_pu_bacteria | 2874604998 | 2874612590 | 322 |
| 98 | iso_pu_bacteria | 2874612657 | 2874617700 | 322 |
| 99 | iso_pu_bacteria | 2874620515 | 2874623438 | 322 |
| 100 | iso_pu_bacteria | 2874645413 | 2874651275 | 322 |
| 101 | iso_pu_bacteria | 2876761206 | 2876762405 | 322 |
| 102 | iso_pu_bacteria | 2876771140 | 2876776346 | 322 |
| 103 | iso_pu_bacteria | 2876808645 | 2876812896 | 322 |
| 104 | iso_pu_bacteria | 2876818435 | 2876820914 | 322 |
| 105 | iso_pu_bacteria | 2879074833 | 2879081791 | 322 |
| 106 | iso_pu_bacteria | 2879099564 | 2879101352 | 322 |
| 107 | iso_pu_bacteria | 2879110137 | 2879118031 | 322 |
| 108 | iso_pu_bacteria | 2879127579 | 2879130506 | 322 |
| 109 | iso_pu_bacteria | 2879142872 | 2879146392 | 322 |
| 110 | iso_pu_bacteria | 2881364244 | 2881370677 | 322 |
| 111 | iso_pu_bacteria | 2881665667 | 2881672687 | 322 |
| 112 | iso_pu_bacteria | 2885374607 | 2885378763 | 322 |
| 113 | iso_pu_bacteria | 2885409591 | 2885413435 | 322 |
| 114 | iso_pu_bacteria | 2888378607 | 2888381527 | 322 |
| 115 | iso_pu_bacteria | 2888388044 | 2888389112 | 322 |
| 116 | iso_pu_bacteria | 2889033259 | 2889033619 | 322 |
| 117 | iso_pu_bacteria | 2903748898 | 2903751423 | 322 |
| 118 | iso_pu_bacteria | 2904666416 | 2904667331 | 322 |
| 119 | iso_pu_bacteria | 2904699407 | 2904705786 | 322 |
| 120 | iso_pu_bacteria | 2904711408 | 2904719225 | 322 |
| 121 | iso_pu_bacteria | 2906610324 | 2906611460 | 322 |
| 122 | iso_pu_bacteria | 2906626472 | 2906635176 | 322 |
| 123 | iso_pu_bacteria | 2906635258 | 2906641702 | 322 |
| 124 | iso_pu_bacteria | 2906660503 | 2906660804 | 322 |
| 125 | iso_pu_bacteria | 2908739725 | 2908745052 | 322 |
| 126 | iso_pu_bacteria | 2922361189 | 2922366988 | 322 |
| 127 | iso_pu_bacteria | 2922368715 | 2922371195 | 322 |
| 128 | iso_pu_bacteria | 2922386360 | 2922390231 | 322 |
| 129 | iso_pu_bacteria | 2922425934 | 2922427897 | 322 |
| 130 | iso_pu_bacteria | 2929615660 | 2929619579 | 322 |
| 131 | iso_pu_bacteria | 2929624759 | 2929627951 | 322 |
| 132 | iso_pu_bacteria | 2932784394 | 2932785909 | 322 |
| 133 | iso_pu_bacteria | 2932809354 | 2932817280 | 322 |
| 134 | iso_pu_bacteria | 2932818245 | 2932826877 | 322 |
| 135 | iso_pu_bacteria | 2932828146 | 2932830953 | 322 |
| 136 | iso_pu_bacteria | 2933577622 | 2933581499 | 322 |
| 137 | iso_pu_bacteria | 2935616580 | 2935621018 | 322 |
| 138 | iso_pu_bacteria | 2935630451 | 2935632175 | 322 |
| 139 | iso_pu_bacteria | 2935638405 | 2935640094 | 322 |
| 140 | iso_pu_bacteria | 2935665750 | 2935667067 | 322 |
| 141 | iso_pu_bacteria | 2935684952 | 2935690199 | 322 |
| 142 | iso_pu_bacteria | 2935703347 | 2935704823 | 322 |
| 143 | iso_pu_bacteria | 2935713505 | 2935718104 | 322 |
| 144 | iso_pu_bacteria | 2935722832 | 2935726746 | 322 |
| 145 | iso_pu_bacteria | 2935732158 | 2935735515 | 322 |
| 146 | iso_pu_bacteria | 2935741537 | 2935745214 | 322 |
| 147 | iso_pu_bacteria | 2935750917 | 2935755210 | 322 |
| 148 | iso_pu_bacteria | 2935760218 | 2935762273 | 322 |
| 149 | iso_pu_bacteria | 2935769743 | 2935773660 | 322 |
| 150 | iso_pu_bacteria | 2935777560 | 2935780215 | 322 |
| 151 | iso_pu_bacteria | 2935785616 | 2935788435 | 322 |
| 152 | iso_pu_bacteria | 2935793552 | 2935796591 | 322 |
| 153 | iso_pu_bacteria | 2935801545 | 2935803775 | 322 |
| 154 | iso_pu_bacteria | 2935810662 | 2935811691 | 322 |
| 155 | iso_pu_bacteria | 2935827899 | 2935829577 | 322 |
| 156 | iso_pu_bacteria | 2935837841 | 2935843089 | 322 |
| 157 | iso_pu_bacteria | 2935855204 | 2935858825 | 322 |
| 158 | iso_pu_bacteria | 2935864058 | 2935866777 | 322 |
| 159 | iso_pu_bacteria | 2935873716 | 2935876908 | 322 |
| 160 | iso_pu_bacteria | 2935959822 | 2935962047 | 322 |
| 161 | iso_pu_bacteria | 2935975950 | 2935976650 | 322 |
| 162 | iso_pu_bacteria | 2935984226 | 2935990726 | 322 |
| 163 | iso_pu_bacteria | 2935992306 | 2935993455 | 322 |
| 164 | iso_pu_bacteria | 2936002035 | 2936004350 | 322 |
| 165 | iso_pu_bacteria | 2936037263 | 2936038273 | 322 |
| 166 | iso_pu_bacteria | 2940556831 | 2940561509 | 322 |
| 167 | iso_pu_bacteria | 2941507105 | 2941508123 | 322 |
| 168 | iso_pu_bacteria | 2941515067 | 2941515372 | 322 |
| 169 | iso_pu_bacteria | 2941523033 | 2941524053 | 322 |
| 170 | iso_pu_bacteria | 2941538514 | 2941544313 | 322 |
| 171 | iso_pu_bacteria | 3005474847 | 3005477607 | 322 |
| 172 | iso_pu_bacteria | 3005483717 | 3005486186 | 322 |
| 173 | iso_pu_bacteria | 3005587118 | 3005588495 | 322 |
| 174 | iso_pu_bacteria | 3005710791 | 3005712619 | 322 |
| 175 | iso_pu_bacteria | 3005718088 | 3005719680 | 322 |
| 176 | iso_pu_bacteria | 8006926726 | 8006932251 | 322 |
| 177 | iso_pu_bacteria | 8006933436 | 8006933610 | 322 |
| 178 | iso_pu_bacteria | 8006964411 | 8006966524 | 322 |
| 179 | iso_pu_bacteria | 8006973647 | 8006983283 | 322 |
| 180 | iso_pu_bacteria | 8016511872 | 8016516432 | 322 |
| 181 | iso_pu_bacteria | 8016530956 | 8016537364 | 322 |
| 182 | iso_pu_bacteria | 8016539877 | 8016541633 | 322 |
| 183 | iso_pu_bacteria | 8016548790 | 8016551635 | 322 |
| 184 | iso_pu_bacteria | 8016557553 | 8016560021 | 322 |
| 185 | iso_pu_bacteria | 8016566248 | 8016567018 | 322 |
| 186 | iso_pu_bacteria | 8016595262 | 8016597946 | 322 |
| 187 | iso_pu_bacteria | 8016603502 | 8016604086 | 322 |
| 188 | iso_pu_bacteria | 8016613128 | 8016620668 | 322 |
| 189 | iso_pu_bacteria | 8016622563 | 8016629330 | 322 |
| 190 | iso_pu_bacteria | 8017057580 | 8017060105 | 322 |
| 191 | iso_pu_bacteria | 8019530166 | 8019537047 | 322 |
| 192 | iso_pu_bacteria | 8019538911 | 8019542493 | 322 |
| 193 | iso_pu_bacteria | 8019547302 | 8019548261 | 322 |
| 194 | iso_pu_bacteria | 8019555841 | 8019559547 | 322 |
| 195 | iso_pu_bacteria | 8019565922 | 8019569650 | 322 |
| 196 | iso_pu_bacteria | 8019576017 | 8019579615 | 322 |
| 197 | iso_pu_bacteria | 8019586578 | 8019587326 | 322 |
| 198 | iso_pu_bacteria | 8019597564 | 8019604015 | 322 |
| 199 | iso_pu_bacteria | 8019608314 | 8019614513 | 322 |
| 200 | iso_pu_bacteria | 8019619141 | 8019625140 | 322 |
| 201 | iso_pu_bacteria | 8019629233 | 8019637040 | 322 |
| 202 | iso_pu_bacteria | 8019638758 | 8019642563 | 322 |
| 203 | iso_pu_bacteria | 8019648815 | 8019650022 | 322 |
| 204 | iso_pu_bacteria | 8019659431 | 8019664882 | 322 |
| 205 | iso_pu_bacteria | 8019668869 | 8019674442 | 322 |
| 206 | iso_pu_bacteria | 8019678201 | 8019681661 | 322 |
| 207 | iso_pu_bacteria | 8055742211 | 8055749163 | 322 |
| 208 | iso_pu_bacteria | 8056673599 | 8056674868 | 322 |
| 209 | iso_pu_bacteria | 8056681323 | 8056682385 | 322 |
| 210 | iso_pu_bacteria | 8056967851 | 8056969724 | 322 |
| 211 | iso_pu_bacteria | 2513237141 | 2513892082 | 323 |
| 212 | 3300005436 | Ga0070713_100033799 | Ga0070713_1000337991 | 324 |
| 213 | 3300005436 | Ga0070713_100128657 | Ga0070713_1001286572 | 324 |
| 214 | 3300005535 | Ga0070684_100209620 | Ga0070684_1002096202 | 324 |
| 215 | 3300005539 | Ga0068853_100118906 | Ga0068853_1001189062 | 324 |
| 216 | 3300005563 | Ga0068855_100079756 | Ga0068855_1000797563 | 324 |
| 217 | 3300009093 | Ga0105240_10482159 | Ga0105240_104821592 | 324 |
| 218 | 3300009545 | Ga0105237_10153473 | Ga0105237_101534732 | 324 |
| 219 | 3300013104 | Ga0157370_10044147 | Ga0157370_100441473 | 324 |
| 220 | 3300013104 | Ga0157370_10210557 | Ga0157370_102105572 | 324 |
| 221 | 3300013105 | Ga0157369_10012925 | Ga0157369_100129253 | 324 |
| 222 | 3300013105 | Ga0157369_10043079 | Ga0157369_100430793 | 324 |
| 223 | 3300013307 | Ga0157372_10171321 | Ga0157372_101713212 | 324 |
| 224 | 3300025904 | Ga0207647_10090069 | Ga0207647_100900691 | 324 |
| 225 | 3300025913 | Ga0207695_10147543 | Ga0207695_101475432 | 324 |
| 226 | 3300037853 | Ga0436364_1334513 | Ga0436364_1334513_351_1337 | 324 |
| 227 | 3300039437 | Ga0436365_0023590 | Ga0436365_0023590_1290_2276 | 324 |
| 228 | 3300039437 | Ga0436365_0938537 | Ga0436365_0938537_264_1250 | 324 |
| 229 | 3300045976 | Ga0466967_0206070 | Ga0466967_0206070_11_1018 | 324 |
| 230 | iso_pu_bacteria | 2511231028 | 2511394081 | 324 |
| 231 | iso_pu_bacteria | 2513237102 | 2513699952 | 324 |
| 232 | iso_pu_bacteria | 2524023205 | 2524438189 | 324 |
| 233 | iso_pu_bacteria | 2617270735 | 2617350773 | 324 |
| 234 | iso_pu_bacteria | 2744054633 | 2745076929 | 324 |
| 235 | iso_pu_bacteria | 2824661429 | 2824668263 | 324 |
| 236 | iso_pu_bacteria | 2824746037 | 2824751537 | 324 |
| 237 | iso_pu_bacteria | 2824773399 | 2824780545 | 324 |
| 238 | iso_pu_bacteria | 2857509624 | 2857512186 | 324 |
| 239 | iso_pu_bacteria | 2885366525 | 2885366938 | 324 |
| 240 | iso_pu_bacteria | 2888419890 | 2888421930 | 324 |
| 241 | iso_pu_bacteria | 2935675223 | 2935680290 | 324 |
| 242 | iso_pu_bacteria | 2935694250 | 2935699715 | 324 |
| 243 | 3300005457 | Ga0070662_100133874 | Ga0070662_1001338742 | 325 |
| 244 | 3300014326 | Ga0157380_10196934 | Ga0157380_101969342 | 325 |
| 245 | 3300003215 | JGI25153J46596_10004246 | JGI25153J46596_100042461 | 326 |
| 246 | 3300003215 | JGI25153J46596_10009718 | JGI25153J46596_100097182 | 326 |
| 247 | 3300003215 | JGI25153J46596_10028250 | JGI25153J46596_100282502 | 326 |
| 248 | 3300003354 | JGI25160J50197_1001885 | JGI25160J50197_10018855 | 326 |
| 249 | 3300003762 | Ga0055542_1008536 | Ga0055542_10085362 | 326 |
| 250 | 3300003794 | Ga0055531_10005281 | Ga0055531_100052813 | 326 |
| 251 | 3300005262 | Ga0065165_1004931 | Ga0065165_10049315 | 326 |
| 252 | 3300005262 | Ga0065165_1009824 | Ga0065165_10098243 | 326 |
| 253 | 3300005262 | Ga0065165_1015966 | Ga0065165_10159661 | 326 |
| 254 | 3300005329 | Ga0070683_100005294 | Ga0070683_1000052948 | 326 |
| 255 | 3300005329 | Ga0070683_100005592 | Ga0070683_1000055927 | 326 |
| 256 | 3300005331 | Ga0070670_100121633 | Ga0070670_1001216332 | 326 |
| 257 | 3300005334 | Ga0068869_100038866 | Ga0068869_1000388662 | 326 |
| 258 | 3300005334 | Ga0068869_100088815 | Ga0068869_1000888152 | 326 |
| 259 | 3300005336 | Ga0070680_100016152 | Ga0070680_1000161523 | 326 |
| 260 | 3300005336 | Ga0070680_100035140 | Ga0070680_1000351403 | 326 |
| 261 | 3300005337 | Ga0070682_100096754 | Ga0070682_1000967542 | 326 |
| 262 | 3300005339 | Ga0070660_100029630 | Ga0070660_1000296301 | 326 |
| 263 | 3300005341 | Ga0070691_10105503 | Ga0070691_101055032 | 326 |
| 264 | 3300005344 | Ga0070661_100075427 | Ga0070661_1000754272 | 326 |
| 265 | 3300005355 | Ga0070671_100077140 | Ga0070671_1000771402 | 326 |
| 266 | 3300005355 | Ga0070671_100127629 | Ga0070671_1001276292 | 326 |
| 267 | 3300005355 | Ga0070671_100161101 | Ga0070671_1001611011 | 326 |
| 268 | 3300005356 | Ga0070674_100220894 | Ga0070674_1002208941 | 326 |
| 269 | 3300005364 | Ga0070673_100054667 | Ga0070673_1000546673 | 326 |
| 270 | 3300005434 | Ga0070709_10001417 | Ga0070709_100014175 | 326 |
| 271 | 3300005434 | Ga0070709_10007249 | Ga0070709_100072494 | 326 |
| 272 | 3300005434 | Ga0070709_10049645 | Ga0070709_100496452 | 326 |
| 273 | 3300005435 | Ga0070714_100018262 | Ga0070714_1000182625 | 326 |
| 274 | 3300005437 | Ga0070710_10000633 | Ga0070710_100006337 | 326 |
| 275 | 3300005437 | Ga0070710_10008834 | Ga0070710_100088341 | 326 |
| 276 | 3300005439 | Ga0070711_100001478 | Ga0070711_1000014784 | 326 |
| 277 | 3300005439 | Ga0070711_100011186 | Ga0070711_1000111864 | 326 |
| 278 | 3300005455 | Ga0070663_100047179 | Ga0070663_1000471793 | 326 |
| 279 | 3300005455 | Ga0070663_100120978 | Ga0070663_1001209781 | 326 |
| 280 | 3300005455 | Ga0070663_100159892 | Ga0070663_1001598922 | 326 |
| 281 | 3300005456 | Ga0070678_100127777 | Ga0070678_1001277772 | 326 |
| 282 | 3300005456 | Ga0070678_100194575 | Ga0070678_1001945752 | 326 |
| 283 | 3300005457 | Ga0070662_100096892 | Ga0070662_1000968922 | 326 |
| 284 | 3300005458 | Ga0070681_10040433 | Ga0070681_100404332 | 326 |
| 285 | 3300005458 | Ga0070681_10101517 | Ga0070681_101015171 | 326 |
| 286 | 3300005458 | Ga0070681_10153891 | Ga0070681_101538912 | 326 |
| 287 | 3300005518 | Ga0070699_100054802 | Ga0070699_1000548022 | 326 |
| 288 | 3300005530 | Ga0070679_100024858 | Ga0070679_1000248585 | 326 |
| 289 | 3300005530 | Ga0070679_100136505 | Ga0070679_1001365052 | 326 |
| 290 | 3300005530 | Ga0070679_100143535 | Ga0070679_1001435352 | 326 |
| 291 | 3300005535 | Ga0070684_100005206 | Ga0070684_1000052064 | 326 |
| 292 | 3300005539 | Ga0068853_100038556 | Ga0068853_1000385563 | 326 |
| 293 | 3300005539 | Ga0068853_100057494 | Ga0068853_1000574942 | 326 |
| 294 | 3300005539 | Ga0068853_100213997 | Ga0068853_1002139972 | 326 |
| 295 | 3300005547 | Ga0070693_100075808 | Ga0070693_1000758082 | 326 |
| 296 | 3300005548 | Ga0070665_100546352 | Ga0070665_1005463521 | 326 |
| 297 | 3300005563 | Ga0068855_100210097 | Ga0068855_1002100973 | 326 |
| 298 | 3300005563 | Ga0068855_100397248 | Ga0068855_1003972481 | 326 |
| 299 | 3300005563 | Ga0068855_100398324 | Ga0068855_1003983242 | 326 |
| 300 | 3300005577 | Ga0068857_100072650 | Ga0068857_1000726502 | 326 |
| 301 | 3300005577 | Ga0068857_100114359 | Ga0068857_1001143592 | 326 |
| 302 | 3300005578 | Ga0068854_100098644 | Ga0068854_1000986442 | 326 |
| 303 | 3300005614 | Ga0068856_100187170 | Ga0068856_1001871702 | 326 |
| 304 | 3300005614 | Ga0068856_100503048 | Ga0068856_1005030481 | 326 |
| 305 | 3300005616 | Ga0068852_100032693 | Ga0068852_1000326932 | 326 |
| 306 | 3300005617 | Ga0068859_100069977 | Ga0068859_1000699773 | 326 |
| 307 | 3300005618 | Ga0068864_100047790 | Ga0068864_1000477903 | 326 |
| 308 | 3300005719 | Ga0068861_100032076 | Ga0068861_1000320763 | 326 |
| 309 | 3300005841 | Ga0068863_100157256 | Ga0068863_1001572562 | 326 |
| 310 | 3300005841 | Ga0068863_100342243 | Ga0068863_1003422432 | 326 |
| 311 | 3300005843 | Ga0068860_100051464 | Ga0068860_1000514642 | 326 |
| 312 | 3300005937 | Ga0081455_10006756 | Ga0081455_100067568 | 326 |
| 313 | 3300005983 | Ga0081540_1027848 | Ga0081540_10278482 | 326 |
| 314 | 3300006028 | Ga0070717_10005443 | Ga0070717_100054437 | 326 |
| 315 | 3300006028 | Ga0070717_10121422 | Ga0070717_101214222 | 326 |
| 316 | 3300006038 | Ga0075365_10071742 | Ga0075365_100717422 | 326 |
| 317 | 3300006038 | Ga0075365_10100654 | Ga0075365_101006542 | 326 |
| 318 | 3300006048 | Ga0075363_100047166 | Ga0075363_1000471662 | 326 |
| 319 | 3300006051 | Ga0075364_10109173 | Ga0075364_101091731 | 326 |
| 320 | 3300006163 | Ga0070715_10152801 | Ga0070715_101528011 | 326 |
| 321 | 3300006173 | Ga0070716_100026542 | Ga0070716_1000265422 | 326 |
| 322 | 3300006173 | Ga0070716_100097370 | Ga0070716_1000973702 | 326 |
| 323 | 3300006175 | Ga0070712_100011086 | Ga0070712_1000110861 | 326 |
| 324 | 3300006175 | Ga0070712_100035217 | Ga0070712_1000352172 | 326 |
| 325 | 3300006175 | Ga0070712_100160308 | Ga0070712_1001603081 | 326 |
| 326 | 3300006177 | Ga0075362_10032986 | Ga0075362_100329862 | 326 |
| 327 | 3300006178 | Ga0075367_10039628 | Ga0075367_100396282 | 326 |
| 328 | 3300006178 | Ga0075367_10044973 | Ga0075367_100449732 | 326 |
| 329 | 3300006178 | Ga0075367_10090256 | Ga0075367_100902562 | 326 |
| 330 | 3300006195 | Ga0075366_10031599 | Ga0075366_100315993 | 326 |
| 331 | 3300006195 | Ga0075366_10090918 | Ga0075366_100909182 | 326 |
| 332 | 3300006237 | Ga0097621_100060854 | Ga0097621_1000608542 | 326 |
| 333 | 3300006353 | Ga0075370_10017964 | Ga0075370_100179643 | 326 |
| 334 | 3300006353 | Ga0075370_10039171 | Ga0075370_100391712 | 326 |
| 335 | 3300006844 | Ga0075428_100320575 | Ga0075428_1003205752 | 326 |
| 336 | 3300006880 | Ga0075429_100295759 | Ga0075429_1002957591 | 326 |
| 337 | 3300006931 | Ga0097620_100069979 | Ga0097620_1000699793 | 326 |
| 338 | 3300006943 | Ga0099822_1000022 | Ga0099822_100002212 | 326 |
| 339 | 3300007076 | Ga0075435_100106565 | Ga0075435_1001065652 | 326 |
| 340 | 3300007265 | Ga0099794_10060117 | Ga0099794_100601172 | 326 |
| 341 | 3300007788 | Ga0099795_10024142 | Ga0099795_100241421 | 326 |
| 342 | 3300009093 | Ga0105240_10015270 | Ga0105240_100152706 | 326 |
| 343 | 3300009093 | Ga0105240_10204385 | Ga0105240_102043852 | 326 |
| 344 | 3300009093 | Ga0105240_10249530 | Ga0105240_102495301 | 326 |
| 345 | 3300009094 | Ga0111539_10563759 | Ga0111539_105637591 | 326 |
| 346 | 3300009098 | Ga0105245_10086340 | Ga0105245_100863402 | 326 |
| 347 | 3300009098 | Ga0105245_10144896 | Ga0105245_101448962 | 326 |
| 348 | 3300009101 | Ga0105247_10052860 | Ga0105247_100528602 | 326 |
| 349 | 3300009147 | Ga0114129_10151279 | Ga0114129_101512793 | 326 |
| 350 | 3300009174 | Ga0105241_10071350 | Ga0105241_100713502 | 326 |
| 351 | 3300009174 | Ga0105241_10151253 | Ga0105241_101512532 | 326 |
| 352 | 3300009174 | Ga0105241_10265661 | Ga0105241_102656612 | 326 |
| 353 | 3300009177 | Ga0105248_10306356 | Ga0105248_103063562 | 326 |
| 354 | 3300009177 | Ga0105248_10605922 | Ga0105248_106059222 | 326 |
| 355 | 3300009545 | Ga0105237_10015378 | Ga0105237_100153783 | 326 |
| 356 | 3300009545 | Ga0105237_10062087 | Ga0105237_100620872 | 326 |
| 357 | 3300009551 | Ga0105238_10039569 | Ga0105238_100395692 | 326 |
| 358 | 3300009551 | Ga0105238_10059830 | Ga0105238_100598304 | 326 |
| 359 | 3300009551 | Ga0105238_10341775 | Ga0105238_103417751 | 326 |
| 360 | 3300009553 | Ga0105249_10323730 | Ga0105249_103237301 | 326 |
| 361 | 3300009553 | Ga0105249_10410469 | Ga0105249_104104691 | 326 |
| 362 | 3300010375 | Ga0105239_10044175 | Ga0105239_100441752 | 326 |
| 363 | 3300010375 | Ga0105239_10090525 | Ga0105239_100905255 | 326 |
| 364 | 3300010375 | Ga0105239_10111939 | Ga0105239_101119393 | 326 |
| 365 | 3300011119 | Ga0105246_10056010 | Ga0105246_100560102 | 326 |
| 366 | 3300011119 | Ga0105246_10106980 | Ga0105246_101069802 | 326 |
| 367 | 3300013105 | Ga0157369_10065240 | Ga0157369_100652403 | 326 |
| 368 | 3300013105 | Ga0157369_10211345 | Ga0157369_102113452 | 326 |
| 369 | 3300013296 | Ga0157374_10138837 | Ga0157374_101388372 | 326 |
| 370 | 3300013307 | Ga0157372_10296379 | Ga0157372_102963792 | 326 |
| 371 | 3300014325 | Ga0163163_10098820 | Ga0163163_100988202 | 326 |
| 372 | 3300014325 | Ga0163163_10193757 | Ga0163163_101937572 | 326 |
| 373 | 3300014497 | Ga0182008_10049174 | Ga0182008_100491741 | 326 |
| 374 | 3300014969 | Ga0157376_10319272 | Ga0157376_103192722 | 326 |
| 375 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003430 | 326 |
| 376 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002337 | 326 |
| 377 | 3300021384 | Ga0213876_10010096 | Ga0213876_100100964 | 326 |
| 378 | 3300021384 | Ga0213876_10110693 | Ga0213876_101106931 | 326 |
| 379 | 3300025253 | Ga0209677_101595 | Ga0209677_1015954 | 326 |
| 380 | 3300025254 | Ga0209148_1000424 | Ga0209148_100042442 | 326 |
| 381 | 3300025261 | Ga0209233_1001581 | Ga0209233_10015812 | 326 |
| 382 | 3300025261 | Ga0209233_1002935 | Ga0209233_10029354 | 326 |
| 383 | 3300025272 | Ga0209455_1002609 | Ga0209455_10026094 | 326 |
| 384 | 3300025272 | Ga0209455_1003259 | Ga0209455_10032593 | 326 |
| 385 | 3300025297 | Ga0209758_1000141 | Ga0209758_1000141153 | 326 |
| 386 | 3300025297 | Ga0209758_1005684 | Ga0209758_10056848 | 326 |
| 387 | 3300025297 | Ga0209758_1015210 | Ga0209758_10152102 | 326 |
| 388 | 3300025299 | Ga0209256_1006007 | Ga0209256_10060074 | 326 |
| 389 | 3300025299 | Ga0209256_1018545 | Ga0209256_10185452 | 326 |
| 390 | 3300025302 | Ga0207426_1003443 | Ga0207426_10034432 | 326 |
| 391 | 3300025302 | Ga0207426_1004449 | Ga0207426_10044494 | 326 |
| 392 | 3300025302 | Ga0207426_1035836 | Ga0207426_10358362 | 326 |
| 393 | 3300025304 | Ga0209257_1000426 | Ga0209257_100042631 | 326 |
| 394 | 3300025898 | Ga0207692_10001428 | Ga0207692_100014281 | 326 |
| 395 | 3300025904 | Ga0207647_10044552 | Ga0207647_100445523 | 326 |
| 396 | 3300025906 | Ga0207699_10000390 | Ga0207699_100003909 | 326 |
| 397 | 3300025906 | Ga0207699_10041162 | Ga0207699_100411622 | 326 |
| 398 | 3300025907 | Ga0207645_10103780 | Ga0207645_101037801 | 326 |
| 399 | 3300025908 | Ga0207643_10037027 | Ga0207643_100370272 | 326 |
| 400 | 3300025911 | Ga0207654_10073979 | Ga0207654_100739792 | 326 |
| 401 | 3300025912 | Ga0207707_10000178 | Ga0207707_100001787 | 326 |
| 402 | 3300025912 | Ga0207707_10051598 | Ga0207707_100515982 | 326 |
| 403 | 3300025912 | Ga0207707_10279084 | Ga0207707_102790842 | 326 |
| 404 | 3300025912 | Ga0207707_10281805 | Ga0207707_102818052 | 326 |
| 405 | 3300025913 | Ga0207695_10000062 | Ga0207695_10000062271 | 326 |
| 406 | 3300025913 | Ga0207695_10094476 | Ga0207695_100944761 | 326 |
| 407 | 3300025913 | Ga0207695_10142177 | Ga0207695_101421772 | 326 |
| 408 | 3300025914 | Ga0207671_10004982 | Ga0207671_100049829 | 326 |
| 409 | 3300025914 | Ga0207671_10041566 | Ga0207671_100415663 | 326 |
| 410 | 3300025914 | Ga0207671_10058580 | Ga0207671_100585802 | 326 |
| 411 | 3300025914 | Ga0207671_10317253 | Ga0207671_103172531 | 326 |
| 412 | 3300025915 | Ga0207693_10010089 | Ga0207693_100100893 | 326 |
| 413 | 3300025915 | Ga0207693_10030018 | Ga0207693_100300184 | 326 |
| 414 | 3300025916 | Ga0207663_10006434 | Ga0207663_100064344 | 326 |
| 415 | 3300025916 | Ga0207663_10014546 | Ga0207663_100145463 | 326 |
| 416 | 3300025917 | Ga0207660_10025918 | Ga0207660_100259182 | 326 |
| 417 | 3300025917 | Ga0207660_10085211 | Ga0207660_100852112 | 326 |
| 418 | 3300025917 | Ga0207660_10098702 | Ga0207660_100987023 | 326 |
| 419 | 3300025920 | Ga0207649_10045452 | Ga0207649_100454522 | 326 |
| 420 | 3300025920 | Ga0207649_10058057 | Ga0207649_100580572 | 326 |
| 421 | 3300025921 | Ga0207652_10019378 | Ga0207652_100193784 | 326 |
| 422 | 3300025921 | Ga0207652_10080871 | Ga0207652_100808712 | 326 |
| 423 | 3300025924 | Ga0207694_10108854 | Ga0207694_101088542 | 326 |
| 424 | 3300025924 | Ga0207694_10296308 | Ga0207694_102963082 | 326 |
| 425 | 3300025925 | Ga0207650_10120108 | Ga0207650_101201082 | 326 |
| 426 | 3300025927 | Ga0207687_10109490 | Ga0207687_101094902 | 326 |
| 427 | 3300025927 | Ga0207687_10255925 | Ga0207687_102559251 | 326 |
| 428 | 3300025928 | Ga0207700_10028238 | Ga0207700_100282383 | 326 |
| 429 | 3300025929 | Ga0207664_10155134 | Ga0207664_101551342 | 326 |
| 430 | 3300025931 | Ga0207644_10034683 | Ga0207644_100346833 | 326 |
| 431 | 3300025933 | Ga0207706_10136540 | Ga0207706_101365402 | 326 |
| 432 | 3300025933 | Ga0207706_10221238 | Ga0207706_102212382 | 326 |
| 433 | 3300025939 | Ga0207665_10208894 | Ga0207665_102088941 | 326 |
| 434 | 3300025941 | Ga0207711_10071760 | Ga0207711_100717603 | 326 |
| 435 | 3300025941 | Ga0207711_10275787 | Ga0207711_102757872 | 326 |
| 436 | 3300025944 | Ga0207661_10004270 | Ga0207661_100042705 | 326 |
| 437 | 3300025944 | Ga0207661_10019900 | Ga0207661_100199002 | 326 |
| 438 | 3300025945 | Ga0207679_10229934 | Ga0207679_102299342 | 326 |
| 439 | 3300025949 | Ga0207667_10051910 | Ga0207667_100519102 | 326 |
| 440 | 3300025949 | Ga0207667_10141704 | Ga0207667_101417042 | 326 |
| 441 | 3300025949 | Ga0207667_10236332 | Ga0207667_102363321 | 326 |
| 442 | 3300025960 | Ga0207651_10037284 | Ga0207651_100372843 | 326 |
| 443 | 3300025960 | Ga0207651_10255195 | Ga0207651_102551951 | 326 |
| 444 | 3300026041 | Ga0207639_10010472 | Ga0207639_100104723 | 326 |
| 445 | 3300026041 | Ga0207639_10037559 | Ga0207639_100375593 | 326 |
| 446 | 3300026041 | Ga0207639_10262309 | Ga0207639_102623091 | 326 |
| 447 | 3300026067 | Ga0207678_10039941 | Ga0207678_100399414 | 326 |
| 448 | 3300026067 | Ga0207678_10042373 | Ga0207678_100423733 | 326 |
| 449 | 3300026067 | Ga0207678_10130864 | Ga0207678_101308642 | 326 |
| 450 | 3300026067 | Ga0207678_10252210 | Ga0207678_102522101 | 326 |
| 451 | 3300026075 | Ga0207708_10060504 | Ga0207708_100605043 | 326 |
| 452 | 3300026078 | Ga0207702_10428523 | Ga0207702_104285231 | 326 |
| 453 | 3300026078 | Ga0207702_10442352 | Ga0207702_104423522 | 326 |
| 454 | 3300026116 | Ga0207674_10057562 | Ga0207674_100575623 | 326 |
| 455 | 3300026116 | Ga0207674_10082897 | Ga0207674_100828973 | 326 |
| 456 | 3300026116 | Ga0207674_10117039 | Ga0207674_101170392 | 326 |
| 457 | 3300026118 | Ga0207675_100033143 | Ga0207675_1000331434 | 326 |
| 458 | 3300026121 | Ga0207683_10088917 | Ga0207683_100889173 | 326 |
| 459 | 3300026142 | Ga0207698_10141215 | Ga0207698_101412152 | 326 |
| 460 | 3300026142 | Ga0207698_10468616 | Ga0207698_104686161 | 326 |
| 461 | 3300027296 | Ga0209389_1000023 | Ga0209389_100002313 | 326 |
| 462 | 3300027357 | Ga0209589_1000010 | Ga0209589_1000010146 | 326 |
| 463 | 3300027361 | Ga0209489_100011 | Ga0209489_10001190 | 326 |
| 464 | 3300028379 | Ga0268266_10006027 | Ga0268266_100060272 | 326 |
| 465 | 3300028379 | Ga0268266_10064115 | Ga0268266_100641152 | 326 |
| 466 | 3300028380 | Ga0268265_10010132 | Ga0268265_100101322 | 326 |
| 467 | 3300028380 | Ga0268265_10369527 | Ga0268265_103695271 | 326 |
| 468 | 3300028381 | Ga0268264_10141202 | Ga0268264_101412022 | 326 |
| 469 | 3300028786 | Ga0307517_10000085 | Ga0307517_10000085110 | 326 |
| 470 | 3300028794 | Ga0307515_10039862 | Ga0307515_100398624 | 326 |
| 471 | 3300031249 | Ga0265339_10009066 | Ga0265339_100090664 | 326 |
| 472 | 3300031250 | Ga0265331_10021647 | Ga0265331_100216472 | 326 |
| 473 | 3300031711 | Ga0265314_10081846 | Ga0265314_100818462 | 326 |
| 474 | 3300031712 | Ga0265342_10006824 | Ga0265342_100068248 | 326 |
| 475 | 3300031730 | Ga0307516_10045593 | Ga0307516_100455932 | 326 |
| 476 | 3300031730 | Ga0307516_10049467 | Ga0307516_100494672 | 326 |
| 477 | 3300031730 | Ga0307516_10153314 | Ga0307516_101533142 | 326 |
| 478 | 3300031901 | Ga0307406_10104987 | Ga0307406_101049872 | 326 |
| 479 | 3300032002 | Ga0307416_100092339 | Ga0307416_1000923392 | 326 |
| 480 | 3300032126 | Ga0307415_100407808 | Ga0307415_1004078081 | 326 |
| 481 | 3300033180 | Ga0307510_10036621 | Ga0307510_100366211 | 326 |
| 482 | 3300033180 | Ga0307510_10130239 | Ga0307510_101302392 | 326 |
| 483 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010167 | 326 |
| 484 | 3300035083 | Ga0373926_0010149 | Ga0373926_0010149_441_1427 | 326 |
| 485 | 3300035170 | Ga0373943_0006580 | Ga0373943_0006580_482_1468 | 326 |
| 486 | 3300035170 | Ga0373943_0076550 | Ga0373943_0076550_528_1514 | 326 |
| 487 | 3300035171 | Ga0373946_0051217 | Ga0373946_0051217_601_1587 | 326 |
| 488 | 3300035692 | Ga0373935_0000259 | Ga0373935_0000259_17296_18282 | 326 |
| 489 | 3300035695 | Ga0373927_0000339 | Ga0373927_0000339_34505_35491 | 326 |
| 490 | 3300035695 | Ga0373927_0002379 | Ga0373927_0002379_3380_4366 | 326 |
| 491 | 3300035695 | Ga0373927_0016655 | Ga0373927_0016655_361_1359 | 326 |
| 492 | 3300035695 | Ga0373927_0088787 | Ga0373927_0088787_534_1532 | 326 |
| 493 | 3300035724 | Ga0373933_0003061 | Ga0373933_0003061_900_1898 | 326 |
| 494 | 3300035725 | Ga0373947_0000217 | Ga0373947_0000217_15262_16248 | 326 |
| 495 | 3300035725 | Ga0373947_0011904 | Ga0373947_0011904_946_1932 | 326 |
| 496 | 3300036401 | Ga0373937_0022213 | Ga0373937_0022213_779_1777 | 326 |
| 497 | 3300036401 | Ga0373937_0070599 | Ga0373937_0070599_10_996 | 326 |
| 498 | 3300037068 | Ga0373925_0004501 | Ga0373925_0004501_7317_8303 | 326 |
| 499 | 3300037068 | Ga0373925_0173209 | Ga0373925_0173209_611_1609 | 326 |
| 500 | 3300037471 | Ga0395905_0019046 | Ga0395905_0019046_3217_4209 | 326 |
| 501 | 3300038443 | Ga0395901_0057616 | Ga0395901_0057616_642_1628 | 326 |
| 502 | 3300038443 | Ga0395901_0064581 | Ga0395901_0064581_288_1280 | 326 |
| 503 | 3300039437 | Ga0436365_1446014 | Ga0436365_1446014_1223_2215 | 326 |
| 504 | 3300039437 | Ga0436365_1446425 | Ga0436365_1446425_3098_4090 | 326 |
| 505 | 3300039437 | Ga0436365_1673545 | Ga0436365_1673545_132_1124 | 326 |
| 506 | 3300039447 | Ga0436361_0081107 | Ga0436361_0081107_92_1093 | 326 |
| 507 | 3300039447 | Ga0436361_1114449 | Ga0436361_1114449_254_1255 | 326 |
| 508 | 3300039450 | Ga0436363_0742244 | Ga0436363_0742244_131_1123 | 326 |
| 509 | 3300039453 | Ga0436362_0646134 | Ga0436362_0646134_1590_2582 | 326 |
| 510 | 3300044656 | Ga0466969_0085228 | Ga0466969_0085228_80_1066 | 326 |
| 511 | 3300044658 | Ga0466972_0000520 | Ga0466972_0000520_2463_3449 | 326 |
| 512 | 3300044658 | Ga0466972_0004454 | Ga0466972_0004454_5407_6393 | 326 |
| 513 | 3300044684 | Ga0466966_0059000 | Ga0466966_0059000_1325_2320 | 326 |
| 514 | 3300044684 | Ga0466966_0066368 | Ga0466966_0066368_279_1328 | 326 |
| 515 | 3300044693 | Ga0466961_0000149 | Ga0466961_0000149_42677_43663 | 326 |
| 516 | 3300044901 | Ga0466960_0003292 | Ga0466960_0003292_633_1619 | 326 |
| 517 | 3300045049 | Ga0466959_0004087 | Ga0466959_0004087_415_1407 | 326 |
| 518 | 3300045836 | Ga0466958_0107640 | Ga0466958_0107640_345_1337 | 326 |
| 519 | 3300045976 | Ga0466967_0412996 | Ga0466967_0412996_293_1291 | 326 |
| 520 | 3300046454 | Ga0495592_0045306 | Ga0495592_0045306_1318_2304 | 326 |
| 521 | 3300046455 | Ga0495603_0000352 | Ga0495603_0000352_6701_7687 | 326 |
| 522 | 3300046455 | Ga0495603_0013852 | Ga0495603_0013852_1455_2441 | 326 |
| 523 | 3300046455 | Ga0495603_0168157 | Ga0495603_0168157_203_1195 | 326 |
| 524 | 3300046459 | Ga0495629_0003719 | Ga0495629_0003719_5533_6519 | 326 |
| 525 | 3300046459 | Ga0495629_0042670 | Ga0495629_0042670_1435_2421 | 326 |
| 526 | 3300046459 | Ga0495629_0118718 | Ga0495629_0118718_714_1706 | 326 |
| 527 | 3300046460 | Ga0495638_0002610 | Ga0495638_0002610_13415_14401 | 326 |
| 528 | 3300046460 | Ga0495638_0150487 | Ga0495638_0150487_142_1128 | 326 |
| 529 | 3300046460 | Ga0495638_0173691 | Ga0495638_0173691_13_1005 | 326 |
| 530 | 3300046461 | Ga0495641_0018952 | Ga0495641_0018952_1068_2060 | 326 |
| 531 | 3300046461 | Ga0495641_0026296 | Ga0495641_0026296_1768_2754 | 326 |
| 532 | 3300046472 | Ga0495580_0062999 | Ga0495580_0062999_1282_2268 | 326 |
| 533 | 3300046475 | Ga0495639_0001973 | Ga0495639_0001973_1435_2421 | 326 |
| 534 | 3300046476 | Ga0495662_0000872 | Ga0495662_0000872_6410_7396 | 326 |
| 535 | 3300046477 | Ga0495664_0013868 | Ga0495664_0013868_596_1591 | 326 |
| 536 | 3300046477 | Ga0495664_0032321 | Ga0495664_0032321_1633_2622 | 326 |
| 537 | 3300046477 | Ga0495664_0154024 | Ga0495664_0154024_163_1155 | 326 |
| 538 | 3300046492 | Ga0495585_0047515 | Ga0495585_0047515_1310_2302 | 326 |
| 539 | 3300046499 | Ga0495594_0001257 | Ga0495594_0001257_10935_11921 | 326 |
| 540 | 3300046499 | Ga0495594_0019990 | Ga0495594_0019990_2029_3021 | 326 |
| 541 | 3300046500 | Ga0495596_0041048 | Ga0495596_0041048_618_1610 | 326 |
| 542 | 3300046507 | Ga0495606_0021592 | Ga0495606_0021592_2242_3228 | 326 |
| 543 | 3300046507 | Ga0495606_0050798 | Ga0495606_0050798_1001_2014 | 326 |
| 544 | 3300046511 | Ga0495608_0154648 | Ga0495608_0154648_240_1226 | 326 |
| 545 | 3300046516 | Ga0495628_0059443 | Ga0495628_0059443_1837_2826 | 326 |
| 546 | 3300046516 | Ga0495628_0192352 | Ga0495628_0192352_265_1251 | 326 |
| 547 | 3300046519 | Ga0495632_0067308 | Ga0495632_0067308_37_1029 | 326 |
| 548 | 3300046523 | Ga0495644_0048274 | Ga0495644_0048274_578_1570 | 326 |
| 549 | 3300046526 | Ga0495666_0041105 | Ga0495666_0041105_202_1188 | 326 |
| 550 | 3300046529 | Ga0495652_0033678 | Ga0495652_0033678_773_1759 | 326 |
| 551 | 3300046529 | Ga0495652_0136093 | Ga0495652_0136093_882_1868 | 326 |
| 552 | 3300046531 | Ga0495665_0000361 | Ga0495665_0000361_6401_7387 | 326 |
| 553 | 3300046533 | Ga0495640_0003002 | Ga0495640_0003002_6400_7386 | 326 |
| 554 | 3300046533 | Ga0495640_0036139 | Ga0495640_0036139_502_1491 | 326 |
| 555 | 3300046533 | Ga0495640_0036471 | Ga0495640_0036471_2273_3259 | 326 |
| 556 | 3300046538 | Ga0495609_0082180 | Ga0495609_0082180_236_1228 | 326 |
| 557 | 3300046542 | Ga0495597_0034517 | Ga0495597_0034517_618_1604 | 326 |
| 558 | 3300046543 | Ga0495645_0020761 | Ga0495645_0020761_24_1013 | 326 |
| 559 | 3300046543 | Ga0495645_0113386 | Ga0495645_0113386_447_1442 | 326 |
| 560 | 3300046558 | Ga0495633_0123606 | Ga0495633_0123606_92_1084 | 326 |
| 561 | 3300046559 | Ga0495667_0038334 | Ga0495667_0038334_1246_2235 | 326 |
| 562 | 3300046615 | Ga0495656_0018728 | Ga0495656_0018728_363_1355 | 326 |
| 563 | 3300046615 | Ga0495656_0138565 | Ga0495656_0138565_120_1112 | 326 |
| 564 | 3300046616 | Ga0495668_0016367 | Ga0495668_0016367_2428_3414 | 326 |
| 565 | 3300046642 | Ga0495634_0000249 | Ga0495634_0000249_6005_6991 | 326 |
| 566 | 3300046660 | Ga0495625_0153889 | Ga0495625_0153889_490_1482 | 326 |
| 567 | 3300046663 | Ga0495635_0000239 | Ga0495635_0000239_3664_4650 | 326 |
| 568 | 3300046663 | Ga0495635_0011527 | Ga0495635_0011527_584_1570 | 326 |
| 569 | 3300046664 | Ga0495659_0038199 | Ga0495659_0038199_626_1618 | 326 |
| 570 | 3300046674 | Ga0495588_0003787 | Ga0495588_0003787_1770_2756 | 326 |
| 571 | 3300046674 | Ga0495588_0014080 | Ga0495588_0014080_217_1203 | 326 |
| 572 | 3300046675 | Ga0495657_0003492 | Ga0495657_0003492_8268_9257 | 326 |
| 573 | 3300046678 | Ga0495599_0022511 | Ga0495599_0022511_1107_2096 | 326 |
| 574 | 3300046679 | Ga0495623_0002296 | Ga0495623_0002296_8764_9753 | 326 |
| 575 | 3300046680 | Ga0495646_0005453 | Ga0495646_0005453_1202_2188 | 326 |
| 576 | 3300046681 | Ga0495647_0001674 | Ga0495647_0001674_4534_5520 | 326 |
| 577 | 3300046683 | Ga0495658_0001058 | Ga0495658_0001058_4662_5648 | 326 |
| 578 | 3300046689 | Ga0495613_0000929 | Ga0495613_0000929_16758_17744 | 326 |
| 579 | 3300046689 | Ga0495613_0208176 | Ga0495613_0208176_379_1365 | 326 |
| 580 | 3300046690 | Ga0495624_0099539 | Ga0495624_0099539_379_1365 | 326 |
| 581 | 3300046690 | Ga0495624_0104140 | Ga0495624_0104140_549_1535 | 326 |
| 582 | 3300046690 | Ga0495624_0204832 | Ga0495624_0204832_35_1027 | 326 |
| 583 | 3300046809 | Ga0495600_0035084 | Ga0495600_0035084_1391_2377 | 326 |
| 584 | 3300046809 | Ga0495600_0077649 | Ga0495600_0077649_1140_2129 | 326 |
| 585 | 3300046810 | Ga0495660_0046424 | Ga0495660_0046424_495_1481 | 326 |
| 586 | 3300047315 | Ga0495581_0199072 | Ga0495581_0199072_23_1009 | 326 |
| 587 | 3300047317 | Ga0495604_0005469 | Ga0495604_0005469_1431_2420 | 326 |
| 588 | 3300047317 | Ga0495604_0066699 | Ga0495604_0066699_1435_2421 | 326 |
| 589 | 3300047319 | Ga0495674_0001854 | Ga0495674_0001854_13372_14358 | 326 |
| 590 | 3300047319 | Ga0495674_0118713 | Ga0495674_0118713_77_1066 | 326 |
| 591 | 3300047320 | Ga0495672_0027086 | Ga0495672_0027086_1966_2958 | 326 |
| 592 | 3300047321 | Ga0495676_0022316 | Ga0495676_0022316_4196_5182 | 326 |
| 593 | 3300047321 | Ga0495676_0029475 | Ga0495676_0029475_1555_2547 | 326 |
| 594 | 3300047321 | Ga0495676_0290494 | Ga0495676_0290494_12_998 | 326 |
| 595 | 3300047322 | Ga0495680_0032224 | Ga0495680_0032224_1417_2406 | 326 |
| 596 | 3300047443 | Ga0495687_019183 | Ga0495687_019183_2032_3018 | 326 |
| 597 | 3300047444 | Ga0495675_0002807 | Ga0495675_0002807_1173_2162 | 326 |
| 598 | 3300047445 | Ga0495677_0078335 | Ga0495677_0078335_30_1022 | 326 |
| 599 | 3300047447 | Ga0495685_039846 | Ga0495685_039846_270_1262 | 326 |
| 600 | 3300047469 | Ga0495673_0033616 | Ga0495673_0033616_778_1764 | 326 |
| 601 | 3300047471 | Ga0495684_0043713 | Ga0495684_0043713_980_1969 | 326 |
| 602 | 3300047472 | Ga0495686_0073671 | Ga0495686_0073671_35_1021 | 326 |
| 603 | 3300047673 | Ga0495593_0000034 | Ga0495593_0000034_51855_52841 | 326 |
| 604 | 3300047673 | Ga0495593_0158705 | Ga0495593_0158705_13_999 | 326 |
| 605 | 3300048088 | Ga0495602_0049097 | Ga0495602_0049097_1660_2649 | 326 |
| 606 | 3300048090 | Ga0495615_0008880 | Ga0495615_0008880_609_1601 | 326 |
| 607 | 3300048903 | Ga0496100_0094668 | Ga0496100_0094668_279_1271 | 326 |
| 608 | 3300048904 | Ga0496101_0040575 | Ga0496101_0040575_896_1888 | 326 |
| 609 | 3300048904 | Ga0496101_0143524 | Ga0496101_0143524_554_1540 | 326 |
| 610 | 3300048906 | Ga0496103_0005710 | Ga0496103_0005710_1121_2107 | 326 |
| 611 | 3300048907 | Ga0496104_0015916 | Ga0496104_0015916_2933_3919 | 326 |
| 612 | 3300048907 | Ga0496104_0253556 | Ga0496104_0253556_94_1080 | 326 |
| 613 | 3300048907 | Ga0496104_0356272 | Ga0496104_0356272_181_1170 | 326 |
| 614 | 3300048907 | Ga0496104_0412918 | Ga0496104_0412918_258_1250 | 326 |
| 615 | 3300048908 | Ga0496105_0034901 | Ga0496105_0034901_2298_3284 | 326 |
| 616 | 3300048908 | Ga0496105_0051425 | Ga0496105_0051425_1267_2253 | 326 |
| 617 | 3300048908 | Ga0496105_0168740 | Ga0496105_0168740_16_1035 | 326 |
| 618 | 3300048909 | Ga0496106_0032306 | Ga0496106_0032306_1658_2650 | 326 |
| 619 | 3300048910 | Ga0496107_0051082 | Ga0496107_0051082_974_1960 | 326 |
| 620 | 3300048910 | Ga0496107_0178459 | Ga0496107_0178459_252_1241 | 326 |
| 621 | 3300048910 | Ga0496107_0184688 | Ga0496107_0184688_194_1180 | 326 |
| 622 | 3300048910 | Ga0496107_0272553 | Ga0496107_0272553_18_1016 | 326 |
| 623 | 3300048912 | Ga0496109_0054328 | Ga0496109_0054328_409_1401 | 326 |
| 624 | 3300048912 | Ga0496109_0131145 | Ga0496109_0131145_40_1026 | 326 |
| 625 | 3300048912 | Ga0496109_0206443 | Ga0496109_0206443_501_1493 | 326 |
| 626 | 3300048913 | Ga0496110_0013275 | Ga0496110_0013275_2014_3006 | 326 |
| 627 | 3300048913 | Ga0496110_0099197 | Ga0496110_0099197_1480_2472 | 326 |
| 628 | 3300048913 | Ga0496110_0100133 | Ga0496110_0100133_183_1175 | 326 |
| 629 | 3300048913 | Ga0496110_0248830 | Ga0496110_0248830_594_1580 | 326 |
| 630 | 3300048915 | Ga0496112_0035334 | Ga0496112_0035334_2578_3567 | 326 |
| 631 | 3300048915 | Ga0496112_0035784 | Ga0496112_0035784_1759_2751 | 326 |
| 632 | 3300048915 | Ga0496112_0138008 | Ga0496112_0138008_942_1928 | 326 |
| 633 | 3300048916 | Ga0496113_0083357 | Ga0496113_0083357_268_1254 | 326 |
| 634 | 3300048916 | Ga0496113_0163077 | Ga0496113_0163077_527_1516 | 326 |
| 635 | 3300048916 | Ga0496113_0317986 | Ga0496113_0317986_209_1228 | 326 |
| 636 | 3300048917 | Ga0496114_0028100 | Ga0496114_0028100_1077_2069 | 326 |
| 637 | 3300048917 | Ga0496114_0071880 | Ga0496114_0071880_875_1861 | 326 |
| 638 | 3300048917 | Ga0496114_0370647 | Ga0496114_0370647_114_1100 | 326 |
| 639 | 3300048918 | Ga0496115_0037983 | Ga0496115_0037983_22_1020 | 326 |
| 640 | 3300048918 | Ga0496115_0121411 | Ga0496115_0121411_532_1518 | 326 |
| 641 | 3300048919 | Ga0496116_0101606 | Ga0496116_0101606_483_1469 | 326 |
| 642 | 3300048920 | Ga0496117_0047573 | Ga0496117_0047573_1062_2051 | 326 |
| 643 | 3300048921 | Ga0496118_0017089 | Ga0496118_0017089_942_1931 | 326 |
| 644 | 3300048922 | Ga0496119_0058779 | Ga0496119_0058779_177_1163 | 326 |
| 645 | 3300048922 | Ga0496119_0193247 | Ga0496119_0193247_27_1016 | 326 |
| 646 | 3300048923 | Ga0496120_0021761 | Ga0496120_0021761_1521_2507 | 326 |
| 647 | 3300048924 | Ga0496121_0015642 | Ga0496121_0015642_6065_7051 | 326 |
| 648 | 3300048924 | Ga0496121_0050475 | Ga0496121_0050475_2368_3354 | 326 |
| 649 | 3300048924 | Ga0496121_0050757 | Ga0496121_0050757_1069_2061 | 326 |
| 650 | 3300048924 | Ga0496121_0077328 | Ga0496121_0077328_378_1370 | 326 |
| 651 | 3300048924 | Ga0496121_0118993 | Ga0496121_0118993_814_1803 | 326 |
| 652 | 3300048925 | Ga0496122_0080318 | Ga0496122_0080318_398_1384 | 326 |
| 653 | 3300048927 | Ga0496124_0275469 | Ga0496124_0275469_199_1191 | 326 |
| 654 | 3300048928 | Ga0496125_0028183 | Ga0496125_0028183_2569_3555 | 326 |
| 655 | 3300048928 | Ga0496125_0135448 | Ga0496125_0135448_393_1379 | 326 |
| 656 | 3300048929 | Ga0496126_0009402 | Ga0496126_0009402_1455_2453 | 326 |
| 657 | 3300048929 | Ga0496126_0030411 | Ga0496126_0030411_424_1416 | 326 |
| 658 | 3300048929 | Ga0496126_0031723 | Ga0496126_0031723_386_1378 | 326 |
| 659 | 3300048929 | Ga0496126_0111509 | Ga0496126_0111509_832_1818 | 326 |
| 660 | 3300048929 | Ga0496126_0144421 | Ga0496126_0144421_389_1375 | 326 |
| 661 | 3300048929 | Ga0496126_0235808 | Ga0496126_0235808_233_1225 | 326 |
| 662 | 3300049569 | Ga0501032_0003534 | Ga0501032_0003534_2824_3813 | 326 |
| 663 | 3300049569 | Ga0501032_0076324 | Ga0501032_0076324_1018_2007 | 326 |
| 664 | 3300049570 | Ga0501033_0000249 | Ga0501033_0000249_24552_25541 | 326 |
| 665 | 3300049570 | Ga0501033_0000951 | Ga0501033_0000951_18733_19722 | 326 |
| 666 | 3300049571 | Ga0501034_0001938 | Ga0501034_0001938_4503_5492 | 326 |
| 667 | 3300049572 | Ga0501036_0004433 | Ga0501036_0004433_4419_5408 | 326 |
| 668 | 3300049572 | Ga0501036_0090479 | Ga0501036_0090479_105_1094 | 326 |
| 669 | 3300049573 | Ga0501037_0000112 | Ga0501037_0000112_26015_27004 | 326 |
| 670 | 3300049573 | Ga0501037_0004019 | Ga0501037_0004019_6863_7852 | 326 |
| 671 | 3300049574 | Ga0501038_0000160 | Ga0501038_0000160_46745_47734 | 326 |
| 672 | 3300049574 | Ga0501038_0018478 | Ga0501038_0018478_1665_2654 | 326 |
| 673 | 3300049575 | Ga0501039_0011683 | Ga0501039_0011683_3265_4254 | 326 |
| 674 | 3300049575 | Ga0501039_0049318 | Ga0501039_0049318_2073_3062 | 326 |
| 675 | 3300049575 | Ga0501039_0168331 | Ga0501039_0168331_596_1588 | 326 |
| 676 | 3300049578 | Ga0501042_0068679 | Ga0501042_0068679_976_1965 | 326 |
| 677 | 3300049579 | Ga0501043_0000278 | Ga0501043_0000278_29902_30891 | 326 |
| 678 | 3300049579 | Ga0501043_0016672 | Ga0501043_0016672_2089_3078 | 326 |
| 679 | 3300049580 | Ga0501046_0000937 | Ga0501046_0000937_5410_6399 | 326 |
| 680 | 3300049580 | Ga0501046_0029168 | Ga0501046_0029168_1558_2547 | 326 |
| 681 | 3300049581 | Ga0501047_0000275 | Ga0501047_0000275_40512_41501 | 326 |
| 682 | 3300049582 | Ga0501048_0001248 | Ga0501048_0001248_8009_8998 | 326 |
| 683 | 3300049583 | Ga0501067_0000258 | Ga0501067_0000258_10002_10991 | 326 |
| 684 | 3300049583 | Ga0501067_0126237 | Ga0501067_0126237_96_1085 | 326 |
| 685 | 3300049584 | Ga0501068_0004146 | Ga0501068_0004146_5632_6621 | 326 |
| 686 | 3300049585 | Ga0501069_0002032 | Ga0501069_0002032_9061_10050 | 326 |
| 687 | 3300049586 | Ga0501070_0002548 | Ga0501070_0002548_7980_8969 | 326 |
| 688 | 3300049586 | Ga0501070_0044688 | Ga0501070_0044688_478_1470 | 326 |
| 689 | 3300049587 | Ga0501071_0038499 | Ga0501071_0038499_1462_2451 | 326 |
| 690 | 3300049587 | Ga0501071_0077213 | Ga0501071_0077213_1052_2044 | 326 |
| 691 | 3300049588 | Ga0501072_0006863 | Ga0501072_0006863_6454_7443 | 326 |
| 692 | 3300049589 | Ga0501073_0000103 | Ga0501073_0000103_20926_21915 | 326 |
| 693 | 3300049590 | Ga0501074_0025367 | Ga0501074_0025367_755_1747 | 326 |
| 694 | 3300049741 | Ga0501079_0000451 | Ga0501079_0000451_15419_16408 | 326 |
| 695 | 3300049742 | Ga0501080_0002998 | Ga0501080_0002998_11676_12665 | 326 |
| 696 | 3300049742 | Ga0501080_0022860 | Ga0501080_0022860_4532_5524 | 326 |
| 697 | 3300049743 | Ga0501081_0333418 | Ga0501081_0333418_31_1017 | 326 |
| 698 | 3300049744 | Ga0501083_0013394 | Ga0501083_0013394_3575_4564 | 326 |
| 699 | 3300049822 | Ga0501035_0000766 | Ga0501035_0000766_20926_21915 | 326 |
| 700 | 3300049823 | Ga0501044_0000418 | Ga0501044_0000418_47058_48047 | 326 |
| 701 | 3300049823 | Ga0501044_0071079 | Ga0501044_0071079_181_1170 | 326 |
| 702 | 3300049823 | Ga0501044_0080760 | Ga0501044_0080760_209_1201 | 326 |
| 703 | 3300049824 | Ga0501045_0012804 | Ga0501045_0012804_2304_3293 | 326 |
| 704 | 3300050490 | nmdc:mga03n38_77785_c1 | nmdc:mga03n38_77785_c1_329_1324 | 326 |
| 705 | 3300050491 | nmdc:mga00v17_106119_c1 | nmdc:mga00v17_106119_c1_387_1373 | 326 |
| 706 | 3300050491 | nmdc:mga00v17_156197_c1 | nmdc:mga00v17_156197_c1_331_1323 | 326 |
| 707 | 3300050492 | nmdc:mga0yw44_1397_c1 | nmdc:mga0yw44_1397_c1_7411_8403 | 326 |
| 708 | 3300050492 | nmdc:mga0yw44_20742_c1 | nmdc:mga0yw44_20742_c1_1131_2117 | 326 |
| 709 | 3300050492 | nmdc:mga0yw44_57310_c1 | nmdc:mga0yw44_57310_c1_695_1681 | 326 |
| 710 | 3300050494 | nmdc:mga06z11_84251_c1 | nmdc:mga06z11_84251_c1_222_1208 | 326 |
| 711 | 3300050494 | nmdc:mga06z11_86734_c1 | nmdc:mga06z11_86734_c1_132_1124 | 326 |
| 712 | 3300050496 | nmdc:mga07m45_45292_c1 | nmdc:mga07m45_45292_c1_417_1409 | 326 |
| 713 | 3300050496 | nmdc:mga07m45_48977_c1 | nmdc:mga07m45_48977_c1_565_1575 | 326 |
| 714 | 3300050507 | nmdc:mga05p37_62404_c1 | nmdc:mga05p37_62404_c1_2919_3911 | 326 |
| 715 | 3300050508 | nmdc:mga09592_255513_c1 | nmdc:mga09592_255513_c1_399_1391 | 326 |
| 716 | 3300050511 | nmdc:mga08y16_302874_c1 | nmdc:mga08y16_302874_c1_516_1508 | 326 |
| 717 | 3300050512 | nmdc:mga0n895_181060_c1 | nmdc:mga0n895_181060_c1_654_1646 | 326 |
| 718 | 3300050513 | nmdc:mga0rr50_27857_c1 | nmdc:mga0rr50_27857_c1_2397_3389 | 326 |
| 719 | 3300050516 | nmdc:mga0sz30_20733_c1 | nmdc:mga0sz30_20733_c1_787_1773 | 326 |
| 720 | 3300053077 | Ga0495601_0097002 | Ga0495601_0097002_572_1558 | 326 |
| 721 | 3300053079 | Ga0500610_0063990 | Ga0500610_0063990_152_1138 | 326 |
| 722 | 3300053080 | Ga0500635_0016901 | Ga0500635_0016901_190_1182 | 326 |
| 723 | 3300053085 | Ga0495619_0191674 | Ga0495619_0191674_317_1303 | 326 |
| 724 | 3300053086 | Ga0500578_0045489 | Ga0500578_0045489_1368_2354 | 326 |
| 725 | 3300053087 | Ga0500643_000267 | Ga0500643_000267_9125_10111 | 326 |
| 726 | 3300053087 | Ga0500643_041816 | Ga0500643_041816_14_1006 | 326 |
| 727 | 3300053093 | Ga0500651_0060147 | Ga0500651_0060147_470_1456 | 326 |
| 728 | 3300053094 | Ga0500566_0000185 | Ga0500566_0000185_2726_3712 | 326 |
| 729 | 3300053094 | Ga0500566_0001146 | Ga0500566_0001146_3246_4238 | 326 |
| 730 | 3300053094 | Ga0500566_0001213 | Ga0500566_0001213_12951_13943 | 326 |
| 731 | 3300053095 | Ga0500640_040072 | Ga0500640_040072_332_1324 | 326 |
| 732 | 3300053103 | Ga0500555_026660 | Ga0500555_026660_128_1120 | 326 |
| 733 | 3300053108 | Ga0500562_001577 | Ga0500562_001577_1381_2367 | 326 |
| 734 | 3300053111 | Ga0500572_000384 | Ga0500572_000384_13640_14629 | 326 |
| 735 | 3300053111 | Ga0500572_008551 | Ga0500572_008551_986_1978 | 326 |
| 736 | 3300053118 | Ga0500594_0032137 | Ga0500594_0032137_86_1078 | 326 |
| 737 | 3300053119 | Ga0500595_003818 | Ga0500595_003818_1734_2726 | 326 |
| 738 | 3300053121 | Ga0500607_115620 | Ga0500607_115620_221_1207 | 326 |
| 739 | 3300053123 | Ga0500614_001219 | Ga0500614_001219_1133_2125 | 326 |
| 740 | 3300053130 | Ga0500642_0066734 | Ga0500642_0066734_352_1338 | 326 |
| 741 | 3300053131 | Ga0500652_041981 | Ga0500652_041981_828_1808 | 326 |
| 742 | 3300053134 | Ga0500658_0043983 | Ga0500658_0043983_590_1576 | 326 |
| 743 | 3300053136 | Ga0500559_0000863 | Ga0500559_0000863_2371_3360 | 326 |
| 744 | 3300053136 | Ga0500559_0102704 | Ga0500559_0102704_191_1183 | 326 |
| 745 | 3300053138 | Ga0500564_055337 | Ga0500564_055337_201_1187 | 326 |
| 746 | 3300053146 | Ga0500588_0009279 | Ga0500588_0009279_615_1601 | 326 |
| 747 | 3300053148 | Ga0500590_133198 | Ga0500590_133198_95_1087 | 326 |
| 748 | 3300053150 | Ga0500603_002337 | Ga0500603_002337_1138_2130 | 326 |
| 749 | 3300053150 | Ga0500603_031697 | Ga0500603_031697_220_1212 | 326 |
| 750 | 3300053153 | Ga0500616_0000166 | Ga0500616_0000166_77982_79019 | 326 |
| 751 | 3300053159 | Ga0500630_013860 | Ga0500630_013860_104_1096 | 326 |
| 752 | 3300053161 | Ga0500634_0052688 | Ga0500634_0052688_954_1946 | 326 |
| 753 | 3300053162 | Ga0500638_001014 | Ga0500638_001014_5008_6000 | 326 |
| 754 | 3300053163 | Ga0500639_000010 | Ga0500639_000010_1249_2241 | 326 |
| 755 | 3300053177 | Ga0500636_0001916 | Ga0500636_0001916_8026_9012 | 326 |
| 756 | 3300053178 | Ga0500637_0000121 | Ga0500637_0000121_15276_16268 | 326 |
| 757 | 3300053178 | Ga0500637_0027260 | Ga0500637_0027260_1700_2692 | 326 |
| 758 | 3300053727 | Ga0500611_014364 | Ga0500611_014364_367_1359 | 326 |
| 759 | 3300053735 | Ga0500596_002495 | Ga0500596_002495_1628_2620 | 326 |
| 760 | 3300053735 | Ga0500596_004734 | Ga0500596_004734_1404_2393 | 326 |
| 761 | 3300053736 | Ga0500599_000459 | Ga0500599_000459_2741_3721 | 326 |
| 762 | 3300054114 | Ga0501084_0003972 | Ga0501084_0003972_3352_4341 | 326 |
| 763 | 3300055283 | Ga0500661_000452 | Ga0500661_000452_2914_3906 | 326 |
| 764 | 3300060353 | Ga0501082_0025989 | Ga0501082_0025989_694_1683 | 326 |
| 765 | iso_pu_bacteria | 2824679649 | 2824682888 | 326 |
| 766 | iso_pu_bacteria | 2824732956 | 2824740348 | 326 |
| 767 | iso_pu_bacteria | 2842038055 | 2842042707 | 326 |
| 768 | iso_pu_bacteria | 2842045827 | 2842050750 | 326 |
| 769 | iso_pu_bacteria | 2908775508 | 2908781596 | 326 |
| 770 | iso_pu_bacteria | 2922393267 | 2922393567 | 326 |
| 771 | 3300001979 | JGI24740J21852_10002709 | JGI24740J21852_100027094 | 328 |
| 772 | 3300001990 | JGI24737J22298_10019055 | JGI24737J22298_100190552 | 328 |
| 773 | 3300005434 | Ga0070709_10225001 | Ga0070709_102250011 | 328 |
| 774 | 3300005435 | Ga0070714_100088352 | Ga0070714_1000883522 | 328 |
| 775 | 3300005436 | Ga0070713_100022889 | Ga0070713_1000228891 | 328 |
| 776 | 3300005437 | Ga0070710_10042841 | Ga0070710_100428412 | 328 |
| 777 | 3300005439 | Ga0070711_100002216 | Ga0070711_1000022164 | 328 |
| 778 | 3300005458 | Ga0070681_10109974 | Ga0070681_101099742 | 328 |
| 779 | 3300005983 | Ga0081540_1023138 | Ga0081540_10231383 | 328 |
| 780 | 3300006173 | Ga0070716_100126542 | Ga0070716_1001265421 | 328 |
| 781 | 3300013105 | Ga0157369_10549082 | Ga0157369_105490821 | 328 |
| 782 | 3300025898 | Ga0207692_10009587 | Ga0207692_100095874 | 328 |
| 783 | 3300025906 | Ga0207699_10314054 | Ga0207699_103140541 | 328 |
| 784 | 3300025915 | Ga0207693_10018488 | Ga0207693_100184884 | 328 |
| 785 | 3300025916 | Ga0207663_10021194 | Ga0207663_100211942 | 328 |
| 786 | 3300025920 | Ga0207649_10091445 | Ga0207649_100914452 | 328 |
| 787 | 3300025928 | Ga0207700_10242324 | Ga0207700_102423242 | 328 |
| 788 | 3300025939 | Ga0207665_10208097 | Ga0207665_102080971 | 328 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5d8d-assembly3.cif.gz_F | crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii | 0.8656 | 2 | 322 |
| 8evx-assembly1.cif.gz_B | ddla from pseudomonas aeruginosa pao1 in complex with adp and phosphorylated d-cycloserine | 0.8631 | 1 | 325 |
| 4zqi-assembly1.cif.gz_B | crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis | 0.8592 | 2 | 322 |
| 4egj-assembly6.cif.gz_D-2 | crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans | 0.8575 | 2 | 322 |
| 3r5x-assembly1.cif.gz_B | crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp | 0.8565 | 1 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP31_235_360_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9153 | 198 | 316 | 3.30.470.20 |
| 2i8cA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.912 | 111 | 327 | 3.30.470.20 |
| 5bpfD02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9092 | 111 | 322 | 3.30.470.20 |
| 1ehiB02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9021 | 195 | 327 | 3.30.470.20 |
| 2yzgC02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.8996 | 113 | 322 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A401TUI9-F1-model_v4 | D-alanine--D-alanine ligase N-terminal domain-containing protein | 0.9786 | 1 | 183 |
GO:0005524
GO:0008716 |
| AF-A0A401TUI9-F1-model_v4 | D-alanine--D-alanine ligase N-terminal domain-containing protein | 0.9682 | 1 | 183 |
GO:0005524
GO:0008716 |
| AF-A0A059X5R8-F1-model_v4 | D-ala D-ala ligase C-terminus | 0.9668 | 43 | 327 |
GO:0005524
GO:0008716 GO:0046872 GO:0071555 |
| AF-A0A0F2PWU2-F1-model_v4 | D-alanine--D-alanine ligase (EC 6.3.2.4) | 0.9642 | 1 | 325 |
GO:0005524
GO:0008360 GO:0008716 GO:0009252 GO:0046872 GO:0071555 |
| AF-A0A534YM77-F1-model_v4 | D-alanine--D-alanine ligase | 0.9555 | 2 | 277 |
GO:0005524
GO:0008716 GO:0046872 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar