F480813

General Info

Members Datasets Scaffolds Average Seq Length
786 341 780 352

Family's Representative Sequence

Representative Sequence 3300059639|Ga0587062_002586|Ga0587062_002586_354_1595
Length 404
Sequence MRLISLPWLKPEKPAPIDVHVIWLPDGMSCDGDTVSVTAAEQPSIESLILGAIPGIPKVVLHNRVLAYEQGGEDFMSWLYKAEKGELTPFVLVIEGSIPNENIKKEGYWTGVGNHPDGQPITLNEWIDRLAPKAFAVIAAGTCAAYGGIHAMAGNPTGSMGLADYLGWNWKSWAGVPIINVPGCPIQPDNMTETLLYLLYQAAQMAPLIPLDDQLRPTWLFGKTVHEGCDRAGYYEQGDFAHEYGSPKCLVKLGCWGPVVNCNVTKRGWMRGIGGCPNVGGICIACTMPGFPDKFMPFMDEPPGARVSTVASETYGMVIRTLRAITNSSANREPKWRRKTNKLITGYEQASTWSIRRGGCEPRYRRPRKTPANNKCEDQDRGRQRPLLRARGLAETRPESGRVN

Samples

Sample ID Description Type Environment
1 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
2 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
3 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
4 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
5 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
6 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
114 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
341 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.05
Metatranscriptomes 25.19
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.73
Rhizosphere 90.71
Stem 0
Stem Tuber 0
Unclassified 3.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1004690 3300000546 Bacteria 1509
2 JGI24737J22298_10006829 3300001990 Bacteria 3878
3 JGI24743J22301_10001548 3300001991 Bacteria 3220
4 Ga0058863_11857546 3300004799 Bacteria 7031
5 Ga0058861_10099167 3300004800 Bacteria 4416
6 Ga0058861_11965202 3300004800 Bacteria 3195
7 Ga0058862_10084264 3300004803 Bacteria 5767
8 Ga0058862_10155954 3300004803 Bacteria 2148
9 Ga0058862_12892176 3300004803 Bacteria 5641
10 Ga0065704_10098665 3300005289 Bacteria 2344
11 Ga0065712_10076610 3300005290 Bacteria 3632
12 Ga0065712_10080756 3300005290 Bacteria 3001
13 Ga0065715_10098711 3300005293 Bacteria 3500
14 Ga0065715_10111681 3300005293 Bacteria 2563
15 Ga0065707_10099363 3300005295 Bacteria 3012
16 Ga0070658_10002244 3300005327 Bacteria 16202
17 Ga0070658_10040706 3300005327 Bacteria 3749
18 Ga0070658_10050969 3300005327 Bacteria 3355
19 Ga0070676_10006924 3300005328 Bacteria 6072
20 Ga0070676_10020479 3300005328 Bacteria 3693
21 Ga0070676_10080437 3300005328 Bacteria 1975
22 Ga0070683_100003814 3300005329 Bacteria 12319
23 Ga0070683_100028263 3300005329 Bacteria 5067
24 Ga0070683_100090432 3300005329 Bacteria 2874
25 Ga0070690_100039399 3300005330 Bacteria 2986
26 Ga0070690_100050541 3300005330 Bacteria 2652
27 Ga0070690_100067238 3300005330 Bacteria 2321
28 Ga0070690_100081587 3300005330 Bacteria 2116
29 Ga0070670_100007440 3300005331 Bacteria 9301
30 Ga0070670_100234867 3300005331 Bacteria 1596
31 Ga0070670_100304717 3300005331 Bacteria 1394
32 Ga0070680_100006320 3300005336 Bacteria 8998
33 Ga0070680_100020352 3300005336 Bacteria 5267
34 Ga0070682_100025971 3300005337 Bacteria 3500
35 Ga0068868_100006785 3300005338 Bacteria 8130
36 Ga0068868_100097046 3300005338 Bacteria 2381
37 Ga0068868_100139305 3300005338 Bacteria 1990
38 Ga0070689_100042193 3300005340 Bacteria 3503
39 Ga0070689_100059419 3300005340 Bacteria 2971
40 Ga0070689_100084459 3300005340 Bacteria 2495
41 Ga0070689_100158595 3300005340 Bacteria 1828
42 Ga0070689_100189853 3300005340 Bacteria 1673
43 Ga0070689_100262024 3300005340 Bacteria 1429
44 Ga0070687_100009280 3300005343 Bacteria 4209
45 Ga0070687_100027105 3300005343 Bacteria 2764
46 Ga0070687_100122270 3300005343 Bacteria 1490
47 Ga0070661_100003160 3300005344 Bacteria 11338
48 Ga0070668_100122120 3300005347 Bacteria 2083
49 Ga0070669_100093370 3300005353 Bacteria 2259
50 Ga0070675_100034521 3300005354 Bacteria 4106
51 Ga0070675_100049573 3300005354 Bacteria 3447
52 Ga0070671_100001471 3300005355 Bacteria 17592
53 Ga0070671_100057634 3300005355 Bacteria 3233
54 Ga0070671_100071202 3300005355 Bacteria 2902
55 Ga0070671_100072906 3300005355 Bacteria 2868
56 Ga0070674_100011537 3300005356 Bacteria 5385
57 Ga0070674_100036697 3300005356 Bacteria 3292
58 Ga0070673_100011121 3300005364 Bacteria 6136
59 Ga0070673_100042833 3300005364 Bacteria 3493
60 Ga0070673_100050848 3300005364 Bacteria 3242
61 Ga0070673_100086857 3300005364 Bacteria 2549
62 Ga0070688_100093383 3300005365 Bacteria 1970
63 Ga0070688_100152955 3300005365 Bacteria 1578
64 Ga0070667_100006336 3300005367 Bacteria 9836
65 Ga0070667_100013925 3300005367 Bacteria 6650
66 Ga0070667_100022090 3300005367 Bacteria 5277
67 Ga0070709_10014230 3300005434 Bacteria 4497
68 Ga0070709_10028389 3300005434 Bacteria 3336
69 Ga0070709_10151301 3300005434 Bacteria 1604
70 Ga0070709_10214670 3300005434 Bacteria 1369
71 Ga0070714_100054697 3300005435 Bacteria 3410
72 Ga0070713_100010418 3300005436 Bacteria 6713
73 Ga0070713_100024021 3300005436 Bacteria 4741
74 Ga0070713_100187910 3300005436 Bacteria 1860
75 Ga0070713_100196019 3300005436 Bacteria 1822
76 Ga0070711_100001726 3300005439 Bacteria 12128
77 Ga0070711_100012190 3300005439 Bacteria 5366
78 Ga0070711_100014039 3300005439 Bacteria 5040
79 Ga0070711_100351990 3300005439 Bacteria 1184
80 Ga0070700_100124835 3300005441 Bacteria 1729
81 Ga0070678_100009877 3300005456 Bacteria 5800
82 Ga0070662_100003448 3300005457 Bacteria 9861
83 Ga0070662_100010706 3300005457 Bacteria 6036
84 Ga0070681_10000958 3300005458 Bacteria 24313
85 Ga0070681_10051513 3300005458 Bacteria 4106
86 Ga0070681_10070445 3300005458 Bacteria 3462
87 Ga0070681_10435135 3300005458 Bacteria 1224
88 Ga0068867_100002185 3300005459 Bacteria 13732
89 Ga0068867_100019567 3300005459 Bacteria 4823
90 Ga0068867_100036200 3300005459 Bacteria 3581
91 Ga0070685_10009391 3300005466 Bacteria 5052
92 Ga0070685_10033704 3300005466 Bacteria 2879
93 Ga0070706_100069378 3300005467 Bacteria 3260
94 Ga0070707_100031670 3300005468 Bacteria 5039
95 Ga0070679_100002628 3300005530 Bacteria 16336
96 Ga0070679_100077513 3300005530 Bacteria 3312
97 Ga0070679_100092485 3300005530 Bacteria 3012
98 Ga0070679_100137210 3300005530 Bacteria 2427
99 Ga0070679_100238641 3300005530 Bacteria 1776
100 Ga0070684_100023550 3300005535 Bacteria 5153
101 Ga0070684_100094337 3300005535 Bacteria 2665
102 Ga0070684_100264751 3300005535 Bacteria 1573
103 Ga0068853_100022555 3300005539 Bacteria 5258
104 Ga0070672_100030998 3300005543 Bacteria 4022
105 Ga0070672_100038064 3300005543 Bacteria 3673
106 Ga0070672_100132533 3300005543 Bacteria 2049
107 Ga0070672_100289497 3300005543 Bacteria 1386
108 Ga0070686_100014697 3300005544 Bacteria 4517
109 Ga0070686_100042425 3300005544 Bacteria 2849
110 Ga0070695_100045761 3300005545 Bacteria 2790
111 Ga0070665_100000209 3300005548 Bacteria 101937
112 Ga0070665_100016598 3300005548 Bacteria 7381
113 Ga0070665_100032863 3300005548 Bacteria 5220
114 Ga0070665_100068448 3300005548 Bacteria 3560
115 Ga0070665_100070423 3300005548 Bacteria 3504
116 Ga0070665_100088824 3300005548 Bacteria 3096
117 Ga0070665_100109506 3300005548 Bacteria 2764
118 Ga0070665_100203797 3300005548 Bacteria 1979
119 Ga0070704_100040664 3300005549 Bacteria 3202
120 Ga0068855_100100071 3300005563 Bacteria 3338
121 Ga0068855_100341561 3300005563 Bacteria 1651
122 Ga0070664_100059354 3300005564 Bacteria 3254
123 Ga0068857_100113849 3300005577 Bacteria 2432
124 Ga0068856_100067140 3300005614 Bacteria 3544
125 Ga0070702_100019855 3300005615 Bacteria 3512
126 Ga0068852_100218802 3300005616 Bacteria 1810
127 Ga0068859_100012221 3300005617 Bacteria 8633
128 Ga0068859_100072086 3300005617 Bacteria 3490
129 Ga0068864_100019864 3300005618 Bacteria 5618
130 Ga0068864_100127443 3300005618 Bacteria 2282
131 Ga0068864_100142557 3300005618 Bacteria 2163
132 Ga0068866_10026846 3300005718 Bacteria 2725
133 Ga0068861_100157764 3300005719 Bacteria 1868
134 Ga0068851_10011169 3300005834 Bacteria 4206
135 Ga0068863_100054448 3300005841 Bacteria 3790
136 Ga0068863_100196170 3300005841 Bacteria 1941
137 Ga0068858_100113727 3300005842 Bacteria 2528
138 Ga0068860_100032000 3300005843 Bacteria 5057
139 Ga0068860_100096817 3300005843 Bacteria 2813
140 Ga0068860_100269765 3300005843 Bacteria 1661
141 Ga0068862_100031265 3300005844 Bacteria 4492
142 Ga0068862_100213919 3300005844 Bacteria 1742
143 Ga0081455_10191283 3300005937 Bacteria 1541
144 Ga0081538_10003792 3300005981 Bacteria 14138
145 Ga0081540_1015731 3300005983 Bacteria 4774
146 Ga0081539_10000088 3300005985 Bacteria 212765
147 Ga0081539_10010756 3300005985 Bacteria 7370
148 Ga0081539_10014942 3300005985 Bacteria 5696
149 Ga0070717_10001768 3300006028 Bacteria 15061
150 Ga0075432_10074820 3300006058 Bacteria 1221
151 Ga0070715_10016808 3300006163 Bacteria 2757
152 Ga0070715_10037142 3300006163 Bacteria 2014
153 Ga0070716_100027660 3300006173 Bacteria 3049
154 Ga0070716_100128194 3300006173 Bacteria 1600
155 Ga0070712_100000857 3300006175 Bacteria 18124
156 Ga0070712_100002008 3300006175 Bacteria 12454
157 Ga0070712_100005778 3300006175 Bacteria 7646
158 Ga0070712_100032393 3300006175 Bacteria 3530
159 Ga0070712_100311899 3300006175 Bacteria 1276
160 Ga0097621_100002691 3300006237 Bacteria 12162
161 Ga0097621_100096597 3300006237 Bacteria 2479
162 Ga0097621_100105169 3300006237 Bacteria 2379
163 Ga0097621_100253166 3300006237 Bacteria 1543
164 Ga0097621_100273735 3300006237 Bacteria 1484
165 Ga0097621_100285408 3300006237 Bacteria 1454
166 Ga0068871_100000441 3300006358 Bacteria 28558
167 Ga0075428_100035407 3300006844 Bacteria 5504
168 Ga0075430_100004272 3300006846 Bacteria 12064
169 Ga0075431_100000246 3300006847 Bacteria 41024
170 Ga0075434_100268939 3300006871 Bacteria 1724
171 Ga0075429_100012310 3300006880 Bacteria 7421
172 Ga0068865_100050725 3300006881 Bacteria 2869
173 Ga0097620_100012221 3300006931 Bacteria 8633
174 Ga0097620_100072089 3300006931 Bacteria 3490
175 Ga0075435_100204846 3300007076 Bacteria 1672
176 Ga0105240_10003191 3300009093 Bacteria 25758
177 Ga0105240_10008429 3300009093 Bacteria 14744
178 Ga0105240_10112845 3300009093 Bacteria 3285
179 Ga0105240_10114744 3300009093 Bacteria 3253
180 Ga0105240_10225314 3300009093 Bacteria 2182
181 Ga0111539_10282739 3300009094 Bacteria 1931
182 Ga0105245_10108272 3300009098 Bacteria 2581
183 Ga0105245_10484483 3300009098 Bacteria 1251
184 Ga0105247_10016208 3300009101 Bacteria 4464
185 Ga0105247_10048283 3300009101 Bacteria 2614
186 Ga0114129_10071725 3300009147 Bacteria 4829
187 Ga0114129_10146388 3300009147 Bacteria 3236
188 Ga0105243_10001423 3300009148 Bacteria 21119
189 Ga0105243_10265626 3300009148 Bacteria 1538
190 Ga0105243_10442499 3300009148 Bacteria 1217
191 Ga0105242_10014847 3300009176 Bacteria 6033
192 Ga0105242_10487479 3300009176 Bacteria 1170
193 Ga0105248_10076303 3300009177 Bacteria 3767
194 Ga0105248_10157421 3300009177 Bacteria 2563
195 Ga0105237_10015775 3300009545 Bacteria 7855
196 Ga0105237_10219850 3300009545 Bacteria 1900
197 Ga0105238_10103043 3300009551 Bacteria 2835
198 Ga0105238_10196808 3300009551 Bacteria 1991
199 Ga0105249_10020648 3300009553 Bacteria 5889
200 Ga0105249_10237956 3300009553 Bacteria 1799
201 Ga0105239_10349985 3300010375 Bacteria 1668
202 Ga0105246_10126614 3300011119 Bacteria 1901
203 Ga0157370_10294574 3300013104 Bacteria 1498
204 Ga0157374_10002622 3300013296 Bacteria 15177
205 Ga0157374_10039357 3300013296 Bacteria 4350
206 Ga0157374_10079732 3300013296 Bacteria 3103
207 Ga0157378_10005666 3300013297 Bacteria 10930
208 Ga0157378_10017414 3300013297 Bacteria 6306
209 Ga0157378_10090568 3300013297 Bacteria 2779
210 Ga0163162_10007612 3300013306 Bacteria 10545
211 Ga0163162_10017857 3300013306 Bacteria 6942
212 Ga0163162_10077622 3300013306 Bacteria 3385
213 Ga0157372_10085188 3300013307 Bacteria 3584
214 Ga0157372_10236241 3300013307 Bacteria 2120
215 Ga0157375_10000790 3300013308 Bacteria 27678
216 Ga0163163_10037985 3300014325 Bacteria 4688
217 Ga0157377_10019570 3300014745 Bacteria 3537
218 Ga0197907_10306840 3300020069 Bacteria 2447
219 Ga0197907_10822851 3300020069 Bacteria 1472
220 Ga0197907_11228897 3300020069 Bacteria 5249
221 Ga0206356_11137496 3300020070 Bacteria 1813
222 Ga0206356_11667153 3300020070 Bacteria 5045
223 Ga0206349_1310841 3300020075 Bacteria 1707
224 Ga0206349_1374472 3300020075 Bacteria 2654
225 Ga0206349_1892354 3300020075 Bacteria 4727
226 Ga0206355_1362144 3300020076 Bacteria 2016
227 Ga0206355_1376396 3300020076 Bacteria 4699
228 Ga0206351_10102578 3300020077 Bacteria 2430
229 Ga0206351_10762080 3300020077 Bacteria 2503
230 Ga0206352_10063385 3300020078 Bacteria 1929
231 Ga0206352_10114043 3300020078 Bacteria 2403
232 Ga0206352_10477907 3300020078 Bacteria 2449
233 Ga0206352_10958369 3300020078 Bacteria 1630
234 Ga0206350_10064510 3300020080 Bacteria 1623
235 Ga0206350_10198345 3300020080 Bacteria 1931
236 Ga0206350_10605904 3300020080 Bacteria 1943
237 Ga0206350_10848210 3300020080 Bacteria 5223
238 Ga0206350_11394896 3300020080 Bacteria 2114
239 Ga0206354_10172340 3300020081 Bacteria 4380
240 Ga0206353_12033768 3300020082 Bacteria 1900
241 Ga0213872_10005912 3300021361 Bacteria 6209
242 Ga0213872_10006901 3300021361 Bacteria 5649
243 Ga0213872_10025674 3300021361 Bacteria 2708
244 Ga0213872_10029387 3300021361 Bacteria 2520
245 Ga0213874_10001273 3300021377 Bacteria 5213
246 Ga0213874_10001754 3300021377 Bacteria 4556
247 Ga0213874_10053491 3300021377 Bacteria 1246
248 Ga0213876_10000054 3300021384 Bacteria 136221
249 Ga0213876_10005349 3300021384 Bacteria 7063
250 Ga0213876_10006089 3300021384 Bacteria 6592
251 Ga0213876_10032620 3300021384 Bacteria 2746
252 Ga0213876_10064400 3300021384 Bacteria 1935
253 Ga0224712_10003403 3300022467 Bacteria 4130
254 Ga0224712_10040881 3300022467 Bacteria 1747
255 Ga0228598_1000900 3300024227 Bacteria 6430
256 Ga0207697_10006543 3300025315 Bacteria 5259
257 Ga0207656_10007333 3300025321 Bacteria 4010
258 Ga0207682_10039552 3300025893 Bacteria 1918
259 Ga0207642_10024014 3300025899 Bacteria 2445
260 Ga0207710_10013532 3300025900 Bacteria 3433
261 Ga0207710_10126252 3300025900 Bacteria 1226
262 Ga0207688_10010377 3300025901 Bacteria 5069
263 Ga0207680_10003756 3300025903 Bacteria 7145
264 Ga0207680_10029229 3300025903 Bacteria 3094
265 Ga0207680_10131200 3300025903 Bacteria 1652
266 Ga0207680_10142825 3300025903 Bacteria 1588
267 Ga0207647_10002566 3300025904 Bacteria 13736
268 Ga0207685_10007850 3300025905 Bacteria 3003
269 Ga0207699_10011051 3300025906 Bacteria 4548
270 Ga0207699_10011440 3300025906 Bacteria 4481
271 Ga0207645_10003683 3300025907 Bacteria 11558
272 Ga0207645_10029315 3300025907 Bacteria 3549
273 Ga0207645_10065454 3300025907 Bacteria 2323
274 Ga0207643_10015952 3300025908 Bacteria 4091
275 Ga0207643_10159495 3300025908 Bacteria 1356
276 Ga0207705_10022733 3300025909 Bacteria 4472
277 Ga0207684_10074822 3300025910 Bacteria 2878
278 Ga0207654_10003318 3300025911 Bacteria 8143
279 Ga0207654_10014276 3300025911 Bacteria 4103
280 Ga0207707_10002321 3300025912 Bacteria 17133
281 Ga0207707_10007725 3300025912 Bacteria 9361
282 Ga0207707_10070124 3300025912 Bacteria 3054
283 Ga0207707_10081084 3300025912 Bacteria 2833
284 Ga0207695_10020079 3300025913 Bacteria 7666
285 Ga0207695_10023568 3300025913 Bacteria 6949
286 Ga0207695_10180752 3300025913 Bacteria 2030
287 Ga0207695_10209941 3300025913 Bacteria 1858
288 Ga0207693_10000562 3300025915 Bacteria 33548
289 Ga0207693_10001341 3300025915 Bacteria 21738
290 Ga0207693_10010151 3300025915 Bacteria 7649
291 Ga0207693_10023140 3300025915 Bacteria 4934
292 Ga0207693_10072341 3300025915 Bacteria 2700
293 Ga0207693_10105421 3300025915 Bacteria 2211
294 Ga0207663_10002120 3300025916 Bacteria 9461
295 Ga0207663_10026921 3300025916 Bacteria 3344
296 Ga0207663_10170320 3300025916 Bacteria 1546
297 Ga0207660_10001024 3300025917 Bacteria 18502
298 Ga0207660_10190346 3300025917 Bacteria 1597
299 Ga0207662_10015642 3300025918 Bacteria 4271
300 Ga0207662_10084587 3300025918 Bacteria 1941
301 Ga0207657_10004939 3300025919 Bacteria 14024
302 Ga0207657_10059034 3300025919 Bacteria 3299
303 Ga0207649_10012718 3300025920 Bacteria 4678
304 Ga0207649_10168040 3300025920 Bacteria 1525
305 Ga0207649_10174606 3300025920 Bacteria 1500
306 Ga0207652_10005227 3300025921 Bacteria 10547
307 Ga0207652_10076551 3300025921 Bacteria 2918
308 Ga0207652_10102178 3300025921 Bacteria 2533
309 Ga0207652_10304107 3300025921 Bacteria 1439
310 Ga0207646_10030431 3300025922 Bacteria 4894
311 Ga0207681_10005051 3300025923 Bacteria 8112
312 Ga0207681_10013266 3300025923 Bacteria 5096
313 Ga0207681_10024386 3300025923 Bacteria 3882
314 Ga0207681_10041489 3300025923 Bacteria 3068
315 Ga0207650_10022881 3300025925 Bacteria 4427
316 Ga0207659_10040062 3300025926 Bacteria 3273
317 Ga0207659_10049747 3300025926 Bacteria 2974
318 Ga0207687_10003506 3300025927 Bacteria 10555
319 Ga0207687_10062714 3300025927 Bacteria 2630
320 Ga0207700_10000792 3300025928 Bacteria 18262
321 Ga0207700_10012001 3300025928 Bacteria 5560
322 Ga0207700_10033679 3300025928 Bacteria 3668
323 Ga0207700_10055263 3300025928 Bacteria 2984
324 Ga0207700_10074046 3300025928 Bacteria 2633
325 Ga0207700_10259486 3300025928 Bacteria 1487
326 Ga0207700_10263742 3300025928 Bacteria 1476
327 Ga0207664_10073500 3300025929 Bacteria 2759
328 Ga0207664_10094196 3300025929 Bacteria 2461
329 Ga0207664_10115846 3300025929 Bacteria 2235
330 Ga0207644_10004127 3300025931 Bacteria 9417
331 Ga0207644_10076952 3300025931 Bacteria 2456
332 Ga0207644_10171372 3300025931 Bacteria 1694
333 Ga0207644_10224919 3300025931 Bacteria 1489
334 Ga0207690_10150022 3300025932 Bacteria 1727
335 Ga0207706_10000597 3300025933 Bacteria 38406
336 Ga0207706_10004944 3300025933 Bacteria 12452
337 Ga0207706_10169391 3300025933 Bacteria 1919
338 Ga0207709_10001174 3300025935 Bacteria 18974
339 Ga0207670_10041589 3300025936 Bacteria 3023
340 Ga0207670_10225513 3300025936 Bacteria 1437
341 Ga0207669_10075374 3300025937 Bacteria 2137
342 Ga0207704_10011848 3300025938 Bacteria 4310
343 Ga0207704_10015792 3300025938 Bacteria 3860
344 Ga0207665_10012351 3300025939 Bacteria 5611
345 Ga0207665_10032649 3300025939 Bacteria 3447
346 Ga0207665_10038369 3300025939 Bacteria 3189
347 Ga0207665_10176668 3300025939 Bacteria 1545
348 Ga0207691_10020159 3300025940 Bacteria 6306
349 Ga0207691_10053508 3300025940 Bacteria 3685
350 Ga0207691_10085140 3300025940 Bacteria 2837
351 Ga0207691_10090337 3300025940 Bacteria 2746
352 Ga0207691_10280038 3300025940 Bacteria 1435
353 Ga0207711_10001240 3300025941 Bacteria 24199
354 Ga0207711_10286180 3300025941 Bacteria 1518
355 Ga0207689_10024608 3300025942 Bacteria 5049
356 Ga0207661_10173655 3300025944 Bacteria 1877
357 Ga0207679_10026928 3300025945 Bacteria 3970
358 Ga0207667_10003400 3300025949 Bacteria 19645
359 Ga0207667_10065273 3300025949 Bacteria 3797
360 Ga0207667_10363929 3300025949 Bacteria 1475
361 Ga0207651_10014155 3300025960 Bacteria 4596
362 Ga0207651_10018241 3300025960 Bacteria 4170
363 Ga0207651_10019188 3300025960 Bacteria 4090
364 Ga0207651_10075051 3300025960 Bacteria 2411
365 Ga0207651_10287126 3300025960 Bacteria 1362
366 Ga0207712_10005929 3300025961 Bacteria 7703
367 Ga0207668_10019796 3300025972 Bacteria 4262
368 Ga0207668_10223899 3300025972 Bacteria 1512
369 Ga0207658_10005680 3300025986 Bacteria 8530
370 Ga0207658_10168095 3300025986 Bacteria 1804
371 Ga0207658_10251998 3300025986 Bacteria 1500
372 Ga0207658_10279625 3300025986 Bacteria 1430
373 Ga0207658_10300674 3300025986 Bacteria 1382
374 Ga0207677_10004150 3300026023 Bacteria 7753
375 Ga0207677_10007511 3300026023 Bacteria 6039
376 Ga0207677_10019907 3300026023 Bacteria 4062
377 Ga0207677_10088475 3300026023 Bacteria 2246
378 Ga0207677_10213879 3300026023 Bacteria 1542
379 Ga0207703_10080824 3300026035 Bacteria 2708
380 Ga0207703_10247343 3300026035 Bacteria 1606
381 Ga0207678_10002015 3300026067 Bacteria 18458
382 Ga0207708_10001541 3300026075 Bacteria 17185
383 Ga0207708_10052806 3300026075 Bacteria 3096
384 Ga0207702_10050447 3300026078 Bacteria 3514
385 Ga0207702_10086198 3300026078 Bacteria 2738
386 Ga0207641_10068656 3300026088 Bacteria 3040
387 Ga0207641_10189804 3300026088 Bacteria 1888
388 Ga0207641_10206861 3300026088 Bacteria 1813
389 Ga0207648_10027497 3300026089 Bacteria 5049
390 Ga0207648_10036307 3300026089 Bacteria 4341
391 Ga0207648_10329340 3300026089 Bacteria 1373
392 Ga0207676_10013312 3300026095 Bacteria 5909
393 Ga0207676_10199426 3300026095 Bacteria 1767
394 Ga0207676_10422769 3300026095 Bacteria 1250
395 Ga0207674_10024448 3300026116 Bacteria 6455
396 Ga0207675_100014879 3300026118 Bacteria 7262
397 Ga0207675_100104255 3300026118 Bacteria 2673
398 Ga0207683_10010450 3300026121 Bacteria 7920
399 Ga0207683_10044524 3300026121 Bacteria 3880
400 Ga0207698_10066977 3300026142 Bacteria 2830
401 Ga0207698_10134264 3300026142 Bacteria 2120
402 Ga0268266_10002775 3300028379 Bacteria 18285
403 Ga0268266_10003104 3300028379 Bacteria 16927
404 Ga0268266_10010139 3300028379 Bacteria 8257
405 Ga0268266_10044373 3300028379 Bacteria 3801
406 Ga0268266_10044455 3300028379 Bacteria 3796
407 Ga0268266_10048888 3300028379 Bacteria 3626
408 Ga0268266_10139900 3300028379 Bacteria 2171
409 Ga0268266_10214386 3300028379 Bacteria 1767
410 Ga0268265_10112550 3300028380 Bacteria 2225
411 Ga0268264_10040981 3300028381 Bacteria 3827
412 Ga0268264_10083282 3300028381 Bacteria 2740
413 Ga0268264_10276274 3300028381 Bacteria 1571
414 Ga0265760_10007153 3300031090 Bacteria 3198
415 Ga0307408_100025250 3300031548 Bacteria 4068
416 Ga0307514_10139988 3300031649 Bacteria 1647
417 Ga0307412_10165067 3300031911 Bacteria 1650
418 Ga0307416_100044811 3300032002 Bacteria 3477
419 Ga0373950_0000007 3300034818 Bacteria 392070
420 Ga0373926_0011667 3300035083 Bacteria 2961
421 Ga0373923_0059029 3300035111 Bacteria 1625
422 Ga0373932_0039345 3300035112 Bacteria 1356
423 Ga0373939_0022479 3300035114 Bacteria 1738
424 Ga0373945_0015272 3300035116 Bacteria 2581
425 Ga0373953_0093178 3300035117 Bacteria 1262
426 Ga0373954_0075395 3300035118 Bacteria 1606
427 Ga0373957_0009274 3300035120 Bacteria 3216
428 Ga0373943_0014349 3300035170 Bacteria 3586
429 Ga0373946_0036930 3300035171 Bacteria 1984
430 Ga0373935_0019993 3300035692 Bacteria 4087
431 Ga0373935_0032029 3300035692 Bacteria 3266
432 Ga0373935_0033091 3300035692 Bacteria 3216
433 Ga0373935_0041340 3300035692 Bacteria 2896
434 Ga0373935_0212465 3300035692 Bacteria 1341
435 Ga0373927_0001944 3300035695 Bacteria 15263
436 Ga0373927_0007276 3300035695 Bacteria 7505
437 Ga0373927_0094386 3300035695 Bacteria 1944
438 Ga0373933_0071961 3300035724 Bacteria 2105
439 Ga0373947_0004634 3300035725 Bacteria 8063
440 Ga0373947_0036136 3300035725 Bacteria 2928
441 Ga0373947_0065780 3300035725 Bacteria 2212
442 Ga0373947_0134289 3300035725 Bacteria 1582
443 Ga0373947_0189278 3300035725 Bacteria 1342
444 Ga0373937_0214656 3300036401 Bacteria 1811
445 Ga0373925_0021355 3300037068 Bacteria 4716
446 Ga0373925_0035322 3300037068 Bacteria 3687
447 Ga0373925_0056088 3300037068 Bacteria 2950
448 Ga0373925_0069171 3300037068 Bacteria 2666
449 Ga0373925_0112805 3300037068 Bacteria 2102
450 Ga0373925_0169855 3300037068 Bacteria 1721
451 Ga0395900_0169022 3300037418 Bacteria 2227
452 Ga0395898_0026787 3300037466 Bacteria 5795
453 Ga0395898_0224191 3300037466 Bacteria 1793
454 Ga0395905_0213364 3300037471 Bacteria 1808
455 Ga0436364_0197022 3300037853 Bacteria 80312
456 Ga0436364_0691152 3300037853 Bacteria 1899
457 Ga0436364_0758998 3300037853 Bacteria 29208
458 Ga0436364_0824275 3300037853 Bacteria 2185
459 Ga0436365_0085705 3300039437 Bacteria 122339
460 Ga0436365_0872846 3300039437 Bacteria 18578
461 Ga0436365_1172381 3300039437 Bacteria 6313
462 Ga0436365_1311096 3300039437 Bacteria 2049
463 Ga0436365_1825198 3300039437 Bacteria 1412
464 Ga0436365_1910425 3300039437 Bacteria 4393
465 Ga0436360_0022428 3300039438 Bacteria 7066
466 Ga0436360_0614395 3300039438 Bacteria 1722
467 Ga0436361_0029161 3300039447 Bacteria 3994
468 Ga0436361_0169046 3300039447 Bacteria 26611
469 Ga0436361_0234000 3300039447 Bacteria 5067
470 Ga0436361_0421938 3300039447 Bacteria 11573
471 Ga0436361_0562516 3300039447 Bacteria 6196
472 Ga0436361_0729433 3300039447 Bacteria 3424
473 Ga0436363_0411683 3300039450 Bacteria 1514
474 Ga0436363_0764282 3300039450 Bacteria 987
475 Ga0436363_1139504 3300039450 Bacteria 7698
476 Ga0436363_1210094 3300039450 Bacteria 4092
477 Ga0436363_1705626 3300039450 Bacteria 9003
478 Ga0436362_0427516 3300039453 Bacteria 3271
479 Ga0436362_1166284 3300039453 Bacteria 2708
480 Ga0436362_1210598 3300039453 Bacteria 2946
481 Ga0466969_0002682 3300044656 Bacteria 9513
482 Ga0466966_0011342 3300044684 Bacteria 5910
483 Ga0466961_0025893 3300044693 Bacteria 3771
484 Ga0466961_0039498 3300044693 Bacteria 3025
485 Ga0466963_0000160 3300044694 Bacteria 27157
486 Ga0466963_0002410 3300044694 Bacteria 10462
487 Ga0466963_0051846 3300044694 Bacteria 2721
488 Ga0466971_0017781 3300044719 Bacteria 3149
489 Ga0466968_0025059 3300044735 Bacteria 2441
490 Ga0466957_0000828 3300044842 Bacteria 15799
491 Ga0466957_0003254 3300044842 Bacteria 8890
492 Ga0466960_0004308 3300044901 Bacteria 5548
493 Ga0466959_0013891 3300045049 Bacteria 5846
494 Ga0466959_0134247 3300045049 Bacteria 1753
495 Ga0451576_0160954 3300045051 Bacteria 2343
496 Ga0451576_0178703 3300045051 Bacteria 2216
497 Ga0466958_0009345 3300045836 Bacteria 5463
498 Ga0466958_0011726 3300045836 Bacteria 4946
499 Ga0466958_0040318 3300045836 Bacteria 2807
500 Ga0466967_0021082 3300045976 Bacteria 5281
501 Ga0466967_0128385 3300045976 Bacteria 2350
502 Ga0466967_0199175 3300045976 Bacteria 1896
503 Ga0495629_0050230 3300046459 Bacteria 2921
504 Ga0495653_0003430 3300046463 Bacteria 12747
505 Ga0495580_0004707 3300046472 Bacteria 11443
506 Ga0495580_0052089 3300046472 Bacteria 2892
507 Ga0495582_0006536 3300046473 Bacteria 6470
508 Ga0495582_0076021 3300046473 Bacteria 1861
509 Ga0495582_0149342 3300046473 Bacteria 1326
510 Ga0495664_0055757 3300046477 Bacteria 2351
511 Ga0495664_0078175 3300046477 Bacteria 1982
512 Ga0495608_0003788 3300046511 Bacteria 10864
513 Ga0495608_0005638 3300046511 Bacteria 8937
514 Ga0495630_0102751 3300046517 Bacteria 2162
515 Ga0495652_0016044 3300046529 Bacteria 6702
516 Ga0495665_0000696 3300046531 Bacteria 17287
517 Ga0495598_0014625 3300046537 Bacteria 1966
518 Ga0495645_0183413 3300046543 Bacteria 1432
519 Ga0495657_0021903 3300046675 Bacteria 4582
520 Ga0495623_0040587 3300046679 Bacteria 2971
521 Ga0495646_0001675 3300046680 Bacteria 13261
522 Ga0495658_0072778 3300046683 Bacteria 2000
523 Ga0495613_0029946 3300046689 Bacteria 4044
524 Ga0495624_0005371 3300046690 Bacteria 9243
525 Ga0495604_0008626 3300047317 Bacteria 8057
526 Ga0495604_0052018 3300047317 Bacteria 3173
527 Ga0495604_0072115 3300047317 Bacteria 2611
528 Ga0495674_0099487 3300047319 Bacteria 2475
529 Ga0495674_0116027 3300047319 Bacteria 2265
530 Ga0495674_0148153 3300047319 Bacteria 1969
531 Ga0495675_0001996 3300047444 Bacteria 12190
532 Ga0495675_0117099 3300047444 Bacteria 1661
533 Ga0495684_0013604 3300047471 Bacteria 6266
534 Ga0496100_0021627 3300048903 Bacteria 3878
535 Ga0496100_0094832 3300048903 Bacteria 2044
536 Ga0496101_0011418 3300048904 Bacteria 5892
537 Ga0496101_0021283 3300048904 Bacteria 4455
538 Ga0496101_0082938 3300048904 Bacteria 2372
539 Ga0496101_0088043 3300048904 Bacteria 2306
540 Ga0496102_0039941 3300048905 Bacteria 4242
541 Ga0496102_0041673 3300048905 Bacteria 4159
542 Ga0496102_0124838 3300048905 Bacteria 2405
543 Ga0496102_0161856 3300048905 Bacteria 2105
544 Ga0496102_0195652 3300048905 Bacteria 1905
545 Ga0496102_0422311 3300048905 Bacteria 1252
546 Ga0496103_0026769 3300048906 Bacteria 3490
547 Ga0496103_0027895 3300048906 Bacteria 3425
548 Ga0496103_0042908 3300048906 Bacteria 2784
549 Ga0496104_0087329 3300048907 Bacteria 2978
550 Ga0496105_0036358 3300048908 Bacteria 4057
551 Ga0496105_0070802 3300048908 Bacteria 2883
552 Ga0496106_0068836 3300048909 Bacteria 2700
553 Ga0496106_0136207 3300048909 Bacteria 1929
554 Ga0496106_0320962 3300048909 Bacteria 1243
555 Ga0496107_0003168 3300048910 Bacteria 10935
556 Ga0496107_0035325 3300048910 Bacteria 3584
557 Ga0496107_0139628 3300048910 Bacteria 1791
558 Ga0496108_0005312 3300048911 Bacteria 10400
559 Ga0496108_0040535 3300048911 Bacteria 3882
560 Ga0496108_0104006 3300048911 Bacteria 2423
561 Ga0496109_0001856 3300048912 Bacteria 17498
562 Ga0496109_0106734 3300048912 Bacteria 2601
563 Ga0496110_0244341 3300048913 Bacteria 1633
564 Ga0496111_0014249 3300048914 Bacteria 5426
565 Ga0496112_0067200 3300048915 Bacteria 3538
566 Ga0496112_0081474 3300048915 Bacteria 3200
567 Ga0496113_0000866 3300048916 Bacteria 15852
568 Ga0496113_0034018 3300048916 Bacteria 3715
569 Ga0496113_0254545 3300048916 Bacteria 1402
570 Ga0496114_0003270 3300048917 Bacteria 12439
571 Ga0496114_0015215 3300048917 Bacteria 6185
572 Ga0496114_0025070 3300048917 Bacteria 4872
573 Ga0496114_0045754 3300048917 Bacteria 3637
574 Ga0496115_0009585 3300048918 Bacteria 7198
575 Ga0496115_0015552 3300048918 Bacteria 5774
576 Ga0496115_0029894 3300048918 Bacteria 4283
577 Ga0496115_0045984 3300048918 Bacteria 3486
578 Ga0496115_0082131 3300048918 Bacteria 2625
579 Ga0496126_0001095 3300048929 Bacteria 45505
580 Ga0501031_0157419 3300049568 Bacteria 1485
581 Ga0501033_0012940 3300049570 Bacteria 6363
582 Ga0501036_0018906 3300049572 Bacteria 5781
583 Ga0501043_0002651 3300049579 Bacteria 15047
584 Ga0501046_0000674 3300049580 Bacteria 33097
585 Ga0501047_0000007 3300049581 Bacteria 443240
586 Ga0501047_0045873 3300049581 Bacteria 4225
587 Ga0501048_0000594 3300049582 Bacteria 25663
588 Ga0501067_0000673 3300049583 Bacteria 18404
589 Ga0501067_0000749 3300049583 Bacteria 17471
590 Ga0501068_0002714 3300049584 Bacteria 9386
591 Ga0501070_0001351 3300049586 Bacteria 21962
592 Ga0501072_0000092 3300049588 Bacteria 65691
593 Ga0501073_0000791 3300049589 Bacteria 22521
594 Ga0501073_0002367 3300049589 Bacteria 14118
595 Ga0501073_0009175 3300049589 Bacteria 7297
596 Ga0501074_0001634 3300049590 Bacteria 15199
597 Ga0501079_0000314 3300049741 Bacteria 30320
598 Ga0501080_0002951 3300049742 Bacteria 14958
599 Ga0501080_0010312 3300049742 Bacteria 8543
600 Ga0501083_0000473 3300049744 Bacteria 25817
601 nmdc:mga09592_54206_c1 3300050508 Bacteria 3388
602 nmdc:mga0qj67_373246_c1 3300050509 Bacteria 1152
603 nmdc:mga0qj67_7359_c1 3300050509 Bacteria 8136
604 nmdc:mga06r32_515_c1 3300050510 Bacteria 33313
605 nmdc:mga08y16_234725_c1 3300050511 Bacteria 1897
606 nmdc:mga0n895_213442_c1 3300050512 Bacteria 1960
607 nmdc:mga0a205_11126_c1 3300050515 Bacteria 8280
608 nmdc:mga0a205_13679_c1 3300050515 Bacteria 7561
609 Ga0495601_0063469 3300053077 Bacteria 2348
610 Ga0495612_0001054 3300053078 Bacteria 11276
611 Ga0495655_0025219 3300053083 Bacteria 1389
612 Ga0501084_0000043 3300054114 Bacteria 98202
613 Ga0587084_003079 3300059477 Bacteria 1801
614 Ga0587084_010182 3300059477 Bacteria 1228
615 Ga0587093_000820 3300059478 Bacteria 2381
616 Ga0587093_007427 3300059478 Bacteria 1222
617 Ga0587066_000020 3300059490 Bacteria 7166
618 Ga0587066_000073 3300059490 Bacteria 5305
619 Ga0587066_000288 3300059490 Bacteria 3710
620 Ga0587066_000516 3300059490 Bacteria 3193
621 Ga0587066_002166 3300059490 Bacteria 2121
622 Ga0587066_014775 3300059490 Bacteria 1205
623 Ga0587070_000045 3300059491 Bacteria 6004
624 Ga0587070_000977 3300059491 Bacteria 2739
625 Ga0587070_003904 3300059491 Bacteria 1838
626 Ga0587070_009408 3300059491 Bacteria 1411
627 Ga0587070_015368 3300059491 Bacteria 1211
628 Ga0587073_0000029 3300059492 Bacteria 7533
629 Ga0587073_0000109 3300059492 Bacteria 5414
630 Ga0587073_0000410 3300059492 Bacteria 3808
631 Ga0587073_0003580 3300059492 Bacteria 2145
632 Ga0587073_0005921 3300059492 Bacteria 1852
633 Ga0587073_0011407 3300059492 Bacteria 1517
634 Ga0587073_0023047 3300059492 Bacteria 1215
635 Ga0587077_000377 3300059493 Bacteria 3637
636 Ga0587077_000655 3300059493 Bacteria 3164
637 Ga0587077_000661 3300059493 Bacteria 3159
638 Ga0587077_001519 3300059493 Bacteria 2515
639 Ga0587077_006973 3300059493 Bacteria 1625
640 Ga0587080_000235 3300059503 Bacteria 4062
641 Ga0587080_000651 3300059503 Bacteria 3185
642 Ga0587080_002781 3300059503 Bacteria 2105
643 Ga0587080_014401 3300059503 Bacteria 1223
644 Ga0587082_000603 3300059504 Bacteria 3166
645 Ga0587082_000731 3300059504 Bacteria 2989
646 Ga0587082_003022 3300059504 Bacteria 1976
647 Ga0587082_003836 3300059504 Bacteria 1839
648 Ga0587083_0000084 3300059505 Bacteria 5422
649 Ga0587083_0000297 3300059505 Bacteria 3985
650 Ga0587083_0003110 3300059505 Bacteria 2162
651 Ga0587083_0004447 3300059505 Bacteria 1949
652 Ga0587083_0009119 3300059505 Bacteria 1573
653 Ga0587083_0009389 3300059505 Bacteria 1558
654 Ga0587083_0015312 3300059505 Bacteria 1336
655 Ga0587085_000706 3300059506 Bacteria 2685
656 Ga0587085_000714 3300059506 Bacteria 2680
657 Ga0587085_003102 3300059506 Bacteria 1771
658 Ga0587085_010730 3300059506 Bacteria 1222
659 Ga0587085_011711 3300059506 Bacteria 1190
660 Ga0587086_000022 3300059507 Bacteria 7151
661 Ga0587086_000034 3300059507 Bacteria 6104
662 Ga0587086_003625 3300059507 Bacteria 1565
663 Ga0587086_003698 3300059507 Bacteria 1556
664 Ga0587086_007937 3300059507 Bacteria 1228
665 Ga0587088_000156 3300059508 Bacteria 4349
666 Ga0587088_000561 3300059508 Bacteria 3171
667 Ga0587088_002353 3300059508 Bacteria 2136
668 Ga0587088_005009 3300059508 Bacteria 1717
669 Ga0587088_011149 3300059508 Bacteria 1333
670 Ga0587088_016115 3300059508 Bacteria 1187
671 Ga0587089_001459 3300059509 Bacteria 2210
672 Ga0587089_009294 3300059509 Bacteria 1203
673 Ga0587090_000190 3300059510 Bacteria 4378
674 Ga0587090_011939 3300059510 Bacteria 1230
675 Ga0587090_014102 3300059510 Bacteria 1165
676 Ga0587091_000183 3300059511 Bacteria 4304
677 Ga0587091_000639 3300059511 Bacteria 3222
678 Ga0587091_000747 3300059511 Bacteria 3081
679 Ga0587091_005787 3300059511 Bacteria 1704
680 Ga0587091_012923 3300059511 Bacteria 1331
681 Ga0587091_018407 3300059511 Bacteria 1188
682 Ga0587092_004210 3300059512 Bacteria 1698
683 Ga0587092_004466 3300059512 Bacteria 1670
684 Ga0587092_005729 3300059512 Bacteria 1547
685 Ga0587092_011635 3300059512 Bacteria 1227
686 Ga0587094_000025 3300059513 Bacteria 6565
687 Ga0587094_001624 3300059513 Bacteria 2170
688 Ga0587094_003161 3300059513 Bacteria 1770
689 Ga0587094_003689 3300059513 Bacteria 1689
690 Ga0587094_005848 3300059513 Bacteria 1454
691 Ga0587094_011034 3300059513 Bacteria 1184
692 Ga0587094_011040 3300059513 Bacteria 1183
693 Ga0587095_000119 3300059514 Bacteria 3193
694 Ga0587095_000124 3300059514 Bacteria 3162
695 Ga0587095_000201 3300059514 Bacteria 2699
696 Ga0587095_001789 3300059514 Bacteria 1374
697 Ga0587098_006621 3300059604 Bacteria 1181
698 Ga0587106_004307 3300059605 Bacteria 1557
699 Ga0587106_006092 3300059605 Bacteria 1407
700 Ga0587106_008923 3300059605 Bacteria 1262
701 Ga0587099_002764 3300059622 Bacteria 1410
702 Ga0587099_005034 3300059622 Bacteria 1173
703 Ga0587101_000106 3300059623 Bacteria 4078
704 Ga0587101_000381 3300059623 Bacteria 3029
705 Ga0587101_001002 3300059623 Bacteria 2286
706 Ga0587101_007780 3300059623 Bacteria 1276
707 Ga0587113_000023 3300059625 Bacteria 4794
708 Ga0587113_000044 3300059625 Bacteria 4053
709 Ga0587115_000052 3300059626 Bacteria 5273
710 Ga0587115_007280 3300059626 Bacteria 1303
711 Ga0587117_005261 3300059627 Bacteria 1391
712 Ga0587117_006832 3300059627 Bacteria 1288
713 Ga0587128_000024 3300059630 Bacteria 6128
714 Ga0587128_000027 3300059630 Bacteria 6002
715 Ga0587128_000104 3300059630 Bacteria 4337
716 Ga0587128_003890 3300059630 Bacteria 1697
717 Ga0587128_012214 3300059630 Bacteria 1189
718 Ga0587130_000226 3300059631 Bacteria 3162
719 Ga0587062_002586 3300059639 Bacteria 1742
720 Ga0587067_001783 3300059640 Bacteria 2416
721 Ga0587067_005170 3300059640 Bacteria 1749
722 Ga0587067_012981 3300059640 Bacteria 1310
723 Ga0587067_016270 3300059640 Bacteria 1219
724 Ga0587067_017032 3300059640 Bacteria 1201
725 Ga0587068_015362 3300059641 Bacteria 1203
726 Ga0587069_000417 3300059642 Bacteria 3162
727 Ga0587069_001285 3300059642 Bacteria 2256
728 Ga0587069_001611 3300059642 Bacteria 2126
729 Ga0587069_005740 3300059642 Bacteria 1460
730 Ga0587069_010545 3300059642 Bacteria 1217
731 Ga0587069_012023 3300059642 Bacteria 1167
732 Ga0587072_008887 3300059643 Bacteria 1598
733 Ga0587072_014599 3300059643 Bacteria 1325
734 Ga0587072_018846 3300059643 Bacteria 1203
735 Ga0587075_000017 3300059644 Bacteria 7163
736 Ga0587075_000918 3300059644 Bacteria 2651
737 Ga0587075_001008 3300059644 Bacteria 2579
738 Ga0587075_004239 3300059644 Bacteria 1654
739 Ga0587075_010106 3300059644 Bacteria 1242
740 Ga0587075_010404 3300059644 Bacteria 1230
741 Ga0587076_000124 3300059645 Bacteria 4701
742 Ga0587076_014372 3300059645 Bacteria 1217
743 Ga0587078_000079 3300059646 Bacteria 4887
744 Ga0587078_001339 3300059646 Bacteria 2168
745 Ga0587078_001518 3300059646 Bacteria 2091
746 Ga0587078_002012 3300059646 Bacteria 1921
747 Ga0587078_002020 3300059646 Bacteria 1919
748 Ga0587079_000044 3300059647 Bacteria 6539
749 Ga0587079_002200 3300059647 Bacteria 2349
750 Ga0587079_004527 3300059647 Bacteria 1902
751 Ga0587079_005793 3300059647 Bacteria 1766
752 Ga0587079_015373 3300059647 Bacteria 1299
753 Ga0587079_022117 3300059647 Bacteria 1151
754 Ga0587102_002049 3300059649 Bacteria 1512
755 Ga0587102_004086 3300059649 Bacteria 1225
756 Ga0587107_000025 3300059652 Bacteria 6084
757 Ga0587107_000075 3300059652 Bacteria 4343
758 Ga0587107_001007 3300059652 Bacteria 2137
759 Ga0587107_004923 3300059652 Bacteria 1386
760 Ga0587107_005751 3300059652 Bacteria 1327
761 Ga0587107_007700 3300059652 Bacteria 1220
762 Ga0587110_000038 3300059654 Bacteria 4526
763 Ga0587110_000268 3300059654 Bacteria 2790
764 Ga0587114_000076 3300059655 Bacteria 4317
765 Ga0587114_000221 3300059655 Bacteria 3312
766 Ga0587114_000297 3300059655 Bacteria 3054
767 Ga0587120_000482 3300059659 Bacteria 2056
768 Ga0587120_001930 3300059659 Bacteria 1356
769 Ga0587060_000305 3300060243 Bacteria 2528
770 Ga0587071_000130 3300060344 Bacteria 5535
771 Ga0587071_000561 3300060344 Bacteria 3773
772 Ga0587071_001290 3300060344 Bacteria 3063
773 Ga0587071_001621 3300060344 Bacteria 2866
774 Ga0587071_019345 3300060344 Bacteria 1232
775 Ga0587071_019412 3300060344 Bacteria 1230
776 Ga0587111_0014455 3300060346 Bacteria 1428
777 Ga0587111_0014793 3300060346 Bacteria 1416
778 Ga0587111_0023562 3300060346 Bacteria 1205
779 Ga0501082_0000697 3300060353 Bacteria 29625
780 Ga0466962_0023854 3300061719 Bacteria 2940

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0764282 Ga0436363_0764282_15_917 295
2 3300059477 Ga0587084_003079 Ga0587084_003079_430_1440 323
3 3300059511 Ga0587091_005787 Ga0587091_005787_326_1336 323
4 3300059623 Ga0587101_001002 Ga0587101_001002_824_1834 323
5 3300059640 Ga0587067_001783 Ga0587067_001783_1059_2069 323
6 3300059644 Ga0587075_000918 Ga0587075_000918_136_1146 323
7 3300034818 Ga0373950_0000007 Ga0373950_0000007_48379_49395 327
8 3300048905 Ga0496102_0422311 Ga0496102_0422311_152_1156 327
9 3300049570 Ga0501033_0012940 Ga0501033_0012940_154_1179 327
10 3300049583 Ga0501067_0000749 Ga0501067_0000749_8730_9746 327
11 3300049589 Ga0501073_0002367 Ga0501073_0002367_370_1386 327
12 3300005290 Ga0065712_10076610 Ga0065712_100766103 328
13 3300005293 Ga0065715_10098711 Ga0065715_100987112 328
14 3300005329 Ga0070683_100003814 Ga0070683_10000381414 328
15 3300005330 Ga0070690_100039399 Ga0070690_1000393993 328
16 3300005331 Ga0070670_100234867 Ga0070670_1002348672 328
17 3300005336 Ga0070680_100020352 Ga0070680_1000203522 328
18 3300005340 Ga0070689_100042193 Ga0070689_1000421932 328
19 3300005344 Ga0070661_100003160 Ga0070661_10000316014 328
20 3300005354 Ga0070675_100049573 Ga0070675_1000495734 328
21 3300005355 Ga0070671_100072906 Ga0070671_1000729063 328
22 3300005456 Ga0070678_100009877 Ga0070678_1000098775 328
23 3300005458 Ga0070681_10051513 Ga0070681_100515133 328
24 3300005530 Ga0070679_100077513 Ga0070679_1000775134 328
25 3300005535 Ga0070684_100094337 Ga0070684_1000943372 328
26 3300005548 Ga0070665_100070423 Ga0070665_1000704233 328
27 3300005614 Ga0068856_100067140 Ga0068856_1000671402 328
28 3300025912 Ga0207707_10070124 Ga0207707_100701243 328
29 3300025917 Ga0207660_10190346 Ga0207660_101903462 328
30 3300025920 Ga0207649_10174606 Ga0207649_101746062 328
31 3300025921 Ga0207652_10102178 Ga0207652_101021782 328
32 3300025928 Ga0207700_10263742 Ga0207700_102637421 328
33 3300026023 Ga0207677_10019907 Ga0207677_100199075 328
34 3300026078 Ga0207702_10086198 Ga0207702_100861982 328
35 3300028379 Ga0268266_10010139 Ga0268266_100101396 328
36 3300039438 Ga0436360_0022428 Ga0436360_0022428_3416_4414 328
37 3300039447 Ga0436361_0029161 Ga0436361_0029161_2628_3626 328
38 3300039447 Ga0436361_0234000 Ga0436361_0234000_3197_4195 328
39 3300039447 Ga0436361_0562516 Ga0436361_0562516_525_1523 328
40 3300039447 Ga0436361_0729433 Ga0436361_0729433_1281_2279 328
41 3300046459 Ga0495629_0050230 Ga0495629_0050230_1898_2902 328
42 3300005548 Ga0070665_100068448 Ga0070665_1000684483 334
43 3300006237 Ga0097621_100105169 Ga0097621_1001051692 334
44 3300006358 Ga0068871_100000441 Ga0068871_10000044115 334
45 3300009093 Ga0105240_10112845 Ga0105240_101128453 334
46 3300009098 Ga0105245_10108272 Ga0105245_101082721 334
47 3300009545 Ga0105237_10015775 Ga0105237_100157754 334
48 3300013297 Ga0157378_10005666 Ga0157378_100056666 334
49 3300013306 Ga0163162_10017857 Ga0163162_100178574 334
50 3300028379 Ga0268266_10214386 Ga0268266_102143861 334
51 3300035692 Ga0373935_0041340 Ga0373935_0041340_1591_2655 334
52 3300048903 Ga0496100_0021627 Ga0496100_0021627_2030_3094 334
53 3300048904 Ga0496101_0011418 Ga0496101_0011418_2332_3396 334
54 3300048907 Ga0496104_0087329 Ga0496104_0087329_98_1162 334
55 3300048908 Ga0496105_0036358 Ga0496105_0036358_1822_2886 334
56 3300048909 Ga0496106_0320962 Ga0496106_0320962_119_1183 334
57 3300048910 Ga0496107_0035325 Ga0496107_0035325_2171_3256 334
58 3300048915 Ga0496112_0067200 Ga0496112_0067200_1282_2367 334
59 3300048917 Ga0496114_0003270 Ga0496114_0003270_1912_2976 334
60 3300048918 Ga0496115_0029894 Ga0496115_0029894_1145_2209 334
61 3300024227 Ga0228598_1000900 Ga0228598_10009003 335
62 3300031090 Ga0265760_10007153 Ga0265760_100071533 335
63 3300059644 Ga0587075_010106 Ga0587075_010106_68_1150 335
64 iso_pu_bacteria 2884693830 2884703432 335
65 iso_pu_bacteria 2895442618 2895443543 335
66 3300039450 Ga0436363_0411683 Ga0436363_0411683_289_1317 336
67 3300039450 Ga0436363_1705626 Ga0436363_1705626_1702_2775 336
68 3300047319 Ga0495674_0148153 Ga0495674_0148153_291_1307 336
69 3300047444 Ga0495675_0117099 Ga0495675_0117099_622_1638 336
70 3300059604 Ga0587098_006621 Ga0587098_006621_111_1166 336
71 3300004799 Ga0058863_11857546 Ga0058863_1185754610 337
72 3300004800 Ga0058861_10099167 Ga0058861_100991671 337
73 3300004803 Ga0058862_12892176 Ga0058862_128921761 337
74 3300005336 Ga0070680_100006320 Ga0070680_1000063202 337
75 3300005337 Ga0070682_100025971 Ga0070682_1000259712 337
76 3300005458 Ga0070681_10000958 Ga0070681_100009589 337
77 3300005458 Ga0070681_10435135 Ga0070681_104351352 337
78 3300005530 Ga0070679_100002628 Ga0070679_1000026285 337
79 3300005548 Ga0070665_100109506 Ga0070665_1001095062 337
80 3300005563 Ga0068855_100341561 Ga0068855_1003415612 337
81 3300006844 Ga0075428_100035407 Ga0075428_1000354072 337
82 3300006846 Ga0075430_100004272 Ga0075430_1000042725 337
83 3300006847 Ga0075431_100000246 Ga0075431_10000024632 337
84 3300006880 Ga0075429_100012310 Ga0075429_1000123103 337
85 3300009093 Ga0105240_10225314 Ga0105240_102253142 337
86 3300009551 Ga0105238_10196808 Ga0105238_101968081 337
87 3300013104 Ga0157370_10294574 Ga0157370_102945741 337
88 3300013307 Ga0157372_10236241 Ga0157372_102362412 337
89 3300020069 Ga0197907_11228897 Ga0197907_112288971 337
90 3300020070 Ga0206356_11667153 Ga0206356_116671531 337
91 3300020075 Ga0206349_1892354 Ga0206349_18923546 337
92 3300020076 Ga0206355_1376396 Ga0206355_13763961 337
93 3300020077 Ga0206351_10762080 Ga0206351_107620801 337
94 3300020078 Ga0206352_10063385 Ga0206352_100633851 337
95 3300020080 Ga0206350_10848210 Ga0206350_108482101 337
96 3300021377 Ga0213874_10053491 Ga0213874_100534912 337
97 3300022467 Ga0224712_10003403 Ga0224712_100034031 337
98 3300025912 Ga0207707_10002321 Ga0207707_1000232113 337
99 3300025917 Ga0207660_10001024 Ga0207660_1000102415 337
100 3300025921 Ga0207652_10005227 Ga0207652_1000522711 337
101 3300025949 Ga0207667_10065273 Ga0207667_100652732 337
102 3300028379 Ga0268266_10048888 Ga0268266_100488883 337
103 3300044693 Ga0466961_0039498 Ga0466961_0039498_1986_3002 337
104 3300044694 Ga0466963_0000160 Ga0466963_0000160_25695_26777 337
105 3300044901 Ga0466960_0004308 Ga0466960_0004308_1585_2670 337
106 3300050508 nmdc:mga09592_54206_c1 nmdc:mga09592_54206_c1_906_1955 337
107 3300050509 nmdc:mga0qj67_7359_c1 nmdc:mga0qj67_7359_c1_3692_4741 337
108 3300050510 nmdc:mga06r32_515_c1 nmdc:mga06r32_515_c1_1740_2789 337
109 3300059478 Ga0587093_000820 Ga0587093_000820_95_1177 337
110 3300059490 Ga0587066_000073 Ga0587066_000073_4178_5260 337
111 3300059490 Ga0587066_000516 Ga0587066_000516_53_1135 337
112 3300059491 Ga0587070_000977 Ga0587070_000977_95_1177 337
113 3300059492 Ga0587073_0000109 Ga0587073_0000109_81_1163 337
114 3300059492 Ga0587073_0000410 Ga0587073_0000410_2636_3718 337
115 3300059493 Ga0587077_001519 Ga0587077_001519_172_1254 337
116 3300059503 Ga0587080_000235 Ga0587080_000235_95_1177 337
117 3300059504 Ga0587082_000731 Ga0587082_000731_1862_2944 337
118 3300059504 Ga0587082_003836 Ga0587082_003836_95_1177 337
119 3300059505 Ga0587083_0000084 Ga0587083_0000084_162_1244 337
120 3300059505 Ga0587083_0000297 Ga0587083_0000297_96_1178 337
121 3300059506 Ga0587085_000706 Ga0587085_000706_1558_2640 337
122 3300059507 Ga0587086_003698 Ga0587086_003698_95_1177 337
123 3300059508 Ga0587088_000156 Ga0587088_000156_3170_4252 337
124 3300059510 Ga0587090_000190 Ga0587090_000190_95_1177 337
125 3300059511 Ga0587091_000183 Ga0587091_000183_3170_4252 337
126 3300059511 Ga0587091_018407 Ga0587091_018407_89_1171 337
127 3300059512 Ga0587092_005729 Ga0587092_005729_91_1173 337
128 3300059513 Ga0587094_003689 Ga0587094_003689_96_1178 337
129 3300059513 Ga0587094_011034 Ga0587094_011034_14_1096 337
130 3300059514 Ga0587095_000119 Ga0587095_000119_53_1135 337
131 3300059514 Ga0587095_000201 Ga0587095_000201_86_1168 337
132 3300059605 Ga0587106_004307 Ga0587106_004307_95_1177 337
133 3300059605 Ga0587106_008923 Ga0587106_008923_93_1175 337
134 3300059623 Ga0587101_000106 Ga0587101_000106_96_1178 337
135 3300059625 Ga0587113_000023 Ga0587113_000023_97_1179 337
136 3300059625 Ga0587113_000044 Ga0587113_000044_2873_3955 337
137 3300059630 Ga0587128_000024 Ga0587128_000024_4956_6038 337
138 3300059630 Ga0587128_000104 Ga0587128_000104_98_1180 337
139 3300059640 Ga0587067_005170 Ga0587067_005170_96_1178 337
140 3300059642 Ga0587069_012023 Ga0587069_012023_14_1096 337
141 3300059643 Ga0587072_008887 Ga0587072_008887_95_1177 337
142 3300059644 Ga0587075_001008 Ga0587075_001008_1452_2534 337
143 3300059644 Ga0587075_004239 Ga0587075_004239_95_1177 337
144 3300059646 Ga0587078_002020 Ga0587078_002020_92_1174 337
145 3300059647 Ga0587079_015373 Ga0587079_015373_95_1177 337
146 3300059652 Ga0587107_000025 Ga0587107_000025_70_1152 337
147 3300059652 Ga0587107_000075 Ga0587107_000075_3170_4252 337
148 3300059654 Ga0587110_000268 Ga0587110_000268_95_1177 337
149 3300059655 Ga0587114_000076 Ga0587114_000076_96_1178 337
150 3300059655 Ga0587114_000297 Ga0587114_000297_93_1175 337
151 3300059659 Ga0587120_000482 Ga0587120_000482_87_1169 337
152 3300060344 Ga0587071_000130 Ga0587071_000130_4242_5324 337
153 3300060344 Ga0587071_000561 Ga0587071_000561_95_1177 337
154 3300061719 Ga0466962_0023854 Ga0466962_0023854_1390_2406 337
155 3300021384 Ga0213876_10000054 Ga0213876_1000005429 338
156 3300039437 Ga0436365_0085705 Ga0436365_0085705_102883_103926 338
157 3300045051 Ga0451576_0160954 Ga0451576_0160954_119_1150 338
158 3300005548 Ga0070665_100088824 Ga0070665_1000888242 339
159 3300028379 Ga0268266_10044455 Ga0268266_100444552 339
160 3300059646 Ga0587078_002012 Ga0587078_002012_745_1776 339
161 3300005328 Ga0070676_10080437 Ga0070676_100804372 340
162 3300005330 Ga0070690_100050541 Ga0070690_1000505411 340
163 3300005330 Ga0070690_100067238 Ga0070690_1000672382 340
164 3300005340 Ga0070689_100059419 Ga0070689_1000594192 340
165 3300005340 Ga0070689_100084459 Ga0070689_1000844592 340
166 3300005340 Ga0070689_100189853 Ga0070689_1001898532 340
167 3300005343 Ga0070687_100009280 Ga0070687_1000092802 340
168 3300005343 Ga0070687_100122270 Ga0070687_1001222702 340
169 3300005355 Ga0070671_100057634 Ga0070671_1000576341 340
170 3300005364 Ga0070673_100050848 Ga0070673_1000508482 340
171 3300005365 Ga0070688_100152955 Ga0070688_1001529552 340
172 3300005459 Ga0068867_100019567 Ga0068867_1000195672 340
173 3300005466 Ga0070685_10009391 Ga0070685_100093912 340
174 3300005466 Ga0070685_10033704 Ga0070685_100337042 340
175 3300005543 Ga0070672_100038064 Ga0070672_1000380642 340
176 3300005543 Ga0070672_100289497 Ga0070672_1002894971 340
177 3300005841 Ga0068863_100054448 Ga0068863_1000544482 340
178 3300006237 Ga0097621_100253166 Ga0097621_1002531661 340
179 3300009148 Ga0105243_10265626 Ga0105243_102656262 340
180 3300025903 Ga0207680_10131200 Ga0207680_101312002 340
181 3300025918 Ga0207662_10015642 Ga0207662_100156423 340
182 3300025918 Ga0207662_10084587 Ga0207662_100845872 340
183 3300025923 Ga0207681_10005051 Ga0207681_100050518 340
184 3300025931 Ga0207644_10076952 Ga0207644_100769522 340
185 3300025933 Ga0207706_10169391 Ga0207706_101693912 340
186 3300025936 Ga0207670_10041589 Ga0207670_100415892 340
187 3300025940 Ga0207691_10090337 Ga0207691_100903372 340
188 3300025940 Ga0207691_10280038 Ga0207691_102800382 340
189 3300025960 Ga0207651_10018241 Ga0207651_100182414 340
190 3300025972 Ga0207668_10223899 Ga0207668_102238991 340
191 3300025986 Ga0207658_10300674 Ga0207658_103006742 340
192 3300026035 Ga0207703_10247343 Ga0207703_102473431 340
193 3300026075 Ga0207708_10001541 Ga0207708_1000154116 340
194 3300026089 Ga0207648_10027497 Ga0207648_100274974 340
195 3300026118 Ga0207675_100014879 Ga0207675_1000148795 340
196 3300039447 Ga0436361_0421938 Ga0436361_0421938_6714_7748 340
197 3300039453 Ga0436362_1210598 Ga0436362_1210598_670_1710 340
198 3300048917 Ga0496114_0015215 Ga0496114_0015215_3825_4862 340
199 3300049583 Ga0501067_0000673 Ga0501067_0000673_1966_3003 340
200 3300049589 Ga0501073_0009175 Ga0501073_0009175_397_1434 340
201 iso_pu_bacteria 2990088156 2990091891 340
202 iso_pu_bacteria 8056667051 8056668532 340
203 3300035114 Ga0373939_0022479 Ga0373939_0022479_392_1489 341
204 3300035171 Ga0373946_0036930 Ga0373946_0036930_619_1674 341
205 3300035725 Ga0373947_0065780 Ga0373947_0065780_65_1120 341
206 3300037068 Ga0373925_0035322 Ga0373925_0035322_1986_3041 341
207 3300044842 Ga0466957_0003254 Ga0466957_0003254_3979_5016 341
208 3300045836 Ga0466958_0009345 Ga0466958_0009345_4027_5064 341
209 3300059490 Ga0587066_002166 Ga0587066_002166_556_1593 341
210 3300059492 Ga0587073_0003580 Ga0587073_0003580_556_1593 341
211 3300059493 Ga0587077_000377 Ga0587077_000377_2057_3094 341
212 3300059503 Ga0587080_002781 Ga0587080_002781_553_1590 341
213 3300059508 Ga0587088_002353 Ga0587088_002353_549_1586 341
214 3300059513 Ga0587094_005848 Ga0587094_005848_397_1434 341
215 3300059623 Ga0587101_000381 Ga0587101_000381_1438_2475 341
216 3300059630 Ga0587128_003890 Ga0587128_003890_556_1593 341
217 3300059642 Ga0587069_001611 Ga0587069_001611_539_1576 341
218 3300059647 Ga0587079_002200 Ga0587079_002200_556_1593 341
219 3300059652 Ga0587107_001007 Ga0587107_001007_556_1593 341
220 3300060344 Ga0587071_001290 Ga0587071_001290_551_1588 341
221 3300005985 Ga0081539_10014942 Ga0081539_100149424 342
222 3300021384 Ga0213876_10064400 Ga0213876_100644002 342
223 3300039437 Ga0436365_1311096 Ga0436365_1311096_308_1354 342
224 3300039437 Ga0436365_1825198 Ga0436365_1825198_18_1061 342
225 3300044656 Ga0466969_0002682 Ga0466969_0002682_5116_6234 342
226 3300044684 Ga0466966_0011342 Ga0466966_0011342_4826_5890 342
227 3300044693 Ga0466961_0025893 Ga0466961_0025893_547_1665 342
228 3300044694 Ga0466963_0002410 Ga0466963_0002410_9311_10357 342
229 3300044719 Ga0466971_0017781 Ga0466971_0017781_1271_2317 342
230 3300044735 Ga0466968_0025059 Ga0466968_0025059_710_1756 342
231 3300044842 Ga0466957_0000828 Ga0466957_0000828_12030_13076 342
232 3300045836 Ga0466958_0011726 Ga0466958_0011726_1486_2532 342
233 3300045976 Ga0466967_0021082 Ga0466967_0021082_1776_2822 342
234 3300059640 Ga0587067_012981 Ga0587067_012981_138_1196 342
235 3300001990 JGI24737J22298_10006829 JGI24737J22298_100068292 343
236 3300001991 JGI24743J22301_10001548 JGI24743J22301_100015482 343
237 3300005329 Ga0070683_100028263 Ga0070683_1000282636 343
238 3300005338 Ga0068868_100139305 Ga0068868_1001393053 343
239 3300005365 Ga0070688_100093383 Ga0070688_1000933833 343
240 3300005441 Ga0070700_100124835 Ga0070700_1001248351 343
241 3300005535 Ga0070684_100023550 Ga0070684_1000235503 343
242 3300005543 Ga0070672_100132533 Ga0070672_1001325332 343
243 3300005544 Ga0070686_100042425 Ga0070686_1000424251 343
244 3300005549 Ga0070704_100040664 Ga0070704_1000406642 343
245 3300005577 Ga0068857_100113849 Ga0068857_1001138493 343
246 3300005615 Ga0070702_100019855 Ga0070702_1000198552 343
247 3300005616 Ga0068852_100218802 Ga0068852_1002188022 343
248 3300005617 Ga0068859_100072086 Ga0068859_1000720863 343
249 3300005618 Ga0068864_100019864 Ga0068864_1000198642 343
250 3300005719 Ga0068861_100157764 Ga0068861_1001577642 343
251 3300005843 Ga0068860_100269765 Ga0068860_1002697652 343
252 3300005844 Ga0068862_100213919 Ga0068862_1002139192 343
253 3300005981 Ga0081538_10003792 Ga0081538_100037929 343
254 3300005985 Ga0081539_10010756 Ga0081539_1001075611 343
255 3300006058 Ga0075432_10074820 Ga0075432_100748201 343
256 3300006931 Ga0097620_100072089 Ga0097620_1000720893 343
257 3300009098 Ga0105245_10484483 Ga0105245_104844832 343
258 3300009101 Ga0105247_10016208 Ga0105247_100162082 343
259 3300009148 Ga0105243_10442499 Ga0105243_104424991 343
260 3300009176 Ga0105242_10487479 Ga0105242_104874791 343
261 3300009177 Ga0105248_10157421 Ga0105248_101574212 343
262 3300009545 Ga0105237_10219850 Ga0105237_102198502 343
263 3300009553 Ga0105249_10237956 Ga0105249_102379563 343
264 3300011119 Ga0105246_10126614 Ga0105246_101266142 343
265 3300013296 Ga0157374_10079732 Ga0157374_100797322 343
266 3300025900 Ga0207710_10013532 Ga0207710_100135322 343
267 3300025901 Ga0207688_10010377 Ga0207688_100103774 343
268 3300025903 Ga0207680_10142825 Ga0207680_101428252 343
269 3300025907 Ga0207645_10065454 Ga0207645_100654543 343
270 3300025908 Ga0207643_10015952 Ga0207643_100159522 343
271 3300025919 Ga0207657_10059034 Ga0207657_100590342 343
272 3300025920 Ga0207649_10168040 Ga0207649_101680402 343
273 3300025927 Ga0207687_10062714 Ga0207687_100627141 343
274 3300025932 Ga0207690_10150022 Ga0207690_101500222 343
275 3300025940 Ga0207691_10053508 Ga0207691_100535082 343
276 3300025941 Ga0207711_10286180 Ga0207711_102861802 343
277 3300025942 Ga0207689_10024608 Ga0207689_100246084 343
278 3300025944 Ga0207661_10173655 Ga0207661_101736552 343
279 3300026023 Ga0207677_10088475 Ga0207677_100884752 343
280 3300026075 Ga0207708_10052806 Ga0207708_100528063 343
281 3300026088 Ga0207641_10068656 Ga0207641_100686562 343
282 3300028381 Ga0268264_10276274 Ga0268264_102762742 343
283 3300031649 Ga0307514_10139988 Ga0307514_101399881 343
284 3300036401 Ga0373937_0214656 Ga0373937_0214656_767_1801 343
285 3300037466 Ga0395898_0224191 Ga0395898_0224191_160_1209 343
286 3300039453 Ga0436362_0427516 Ga0436362_0427516_251_1300 343
287 3300045976 Ga0466967_0128385 Ga0466967_0128385_87_1136 343
288 3300047317 Ga0495604_0052018 Ga0495604_0052018_1994_3067 343
289 3300048904 Ga0496101_0082938 Ga0496101_0082938_618_1667 343
290 3300048905 Ga0496102_0124838 Ga0496102_0124838_695_1759 343
291 3300048911 Ga0496108_0040535 Ga0496108_0040535_2361_3425 343
292 3300048913 Ga0496110_0244341 Ga0496110_0244341_159_1223 343
293 3300048916 Ga0496113_0034018 Ga0496113_0034018_1308_2372 343
294 3300048918 Ga0496115_0045984 Ga0496115_0045984_1660_2709 343
295 3300050511 nmdc:mga08y16_234725_c1 nmdc:mga08y16_234725_c1_188_1252 343
296 3300050515 nmdc:mga0a205_11126_c1 nmdc:mga0a205_11126_c1_2450_3490 343
297 3300050515 nmdc:mga0a205_13679_c1 nmdc:mga0a205_13679_c1_3422_4486 343
298 3300053083 Ga0495655_0025219 Ga0495655_0025219_194_1243 343
299 3300005985 Ga0081539_10000088 Ga0081539_10000088229 344
300 3300021377 Ga0213874_10001273 Ga0213874_100012733 344
301 3300021384 Ga0213876_10005349 Ga0213876_100053493 344
302 3300021384 Ga0213876_10032620 Ga0213876_100326203 344
303 3300025949 Ga0207667_10363929 Ga0207667_103639292 344
304 3300026142 Ga0207698_10134264 Ga0207698_101342642 344
305 3300031911 Ga0307412_10165067 Ga0307412_101650673 344
306 3300037853 Ga0436364_0758998 Ga0436364_0758998_9811_10863 344
307 3300039437 Ga0436365_0872846 Ga0436365_0872846_7362_8414 344
308 3300039437 Ga0436365_1172381 Ga0436365_1172381_599_1651 344
309 3300039450 Ga0436363_1210094 Ga0436363_1210094_1961_3013 344
310 3300039453 Ga0436362_1166284 Ga0436362_1166284_1505_2557 344
311 3300044694 Ga0466963_0051846 Ga0466963_0051846_1445_2497 344
312 3300045049 Ga0466959_0134247 Ga0466959_0134247_635_1687 344
313 3300045836 Ga0466958_0040318 Ga0466958_0040318_922_1974 344
314 3300004800 Ga0058861_11965202 Ga0058861_119652021 345
315 3300004803 Ga0058862_10084264 Ga0058862_100842641 345
316 3300025923 Ga0207681_10024386 Ga0207681_100243863 345
317 3300025986 Ga0207658_10279625 Ga0207658_102796252 345
318 3300049568 Ga0501031_0157419 Ga0501031_0157419_28_1107 345
319 3300059511 Ga0587091_000639 Ga0587091_000639_13_1077 345
320 3300004803 Ga0058862_10155954 Ga0058862_101559542 346
321 3300021377 Ga0213874_10001754 Ga0213874_100017546 346
322 3300025893 Ga0207682_10039552 Ga0207682_100395522 346
323 3300039437 Ga0436365_1910425 Ga0436365_1910425_1864_2922 346
324 3300039450 Ga0436363_1139504 Ga0436363_1139504_5944_7002 346
325 3300005293 Ga0065715_10111681 Ga0065715_101116812 347
326 3300005328 Ga0070676_10020479 Ga0070676_100204793 347
327 3300005331 Ga0070670_100304717 Ga0070670_1003047171 347
328 3300005338 Ga0068868_100006785 Ga0068868_1000067854 347
329 3300005340 Ga0070689_100262024 Ga0070689_1002620241 347
330 3300005367 Ga0070667_100006336 Ga0070667_1000063366 347
331 3300005457 Ga0070662_100003448 Ga0070662_1000034487 347
332 3300005458 Ga0070681_10070445 Ga0070681_100704453 347
333 3300005459 Ga0068867_100036200 Ga0068867_1000362001 347
334 3300005530 Ga0070679_100092485 Ga0070679_1000924852 347
335 3300005530 Ga0070679_100238641 Ga0070679_1002386411 347
336 3300005539 Ga0068853_100022555 Ga0068853_1000225554 347
337 3300005544 Ga0070686_100014697 Ga0070686_1000146973 347
338 3300005545 Ga0070695_100045761 Ga0070695_1000457612 347
339 3300005548 Ga0070665_100032863 Ga0070665_1000328632 347
340 3300005564 Ga0070664_100059354 Ga0070664_1000593543 347
341 3300005617 Ga0068859_100012221 Ga0068859_1000122215 347
342 3300005618 Ga0068864_100127443 Ga0068864_1001274432 347
343 3300005718 Ga0068866_10026846 Ga0068866_100268463 347
344 3300005834 Ga0068851_10011169 Ga0068851_100111693 347
345 3300005843 Ga0068860_100032000 Ga0068860_1000320004 347
346 3300005844 Ga0068862_100031265 Ga0068862_1000312653 347
347 3300005937 Ga0081455_10191283 Ga0081455_101912832 347
348 3300006871 Ga0075434_100268939 Ga0075434_1002689392 347
349 3300006931 Ga0097620_100012221 Ga0097620_1000122215 347
350 3300007076 Ga0075435_100204846 Ga0075435_1002048461 347
351 3300009101 Ga0105247_10048283 Ga0105247_100482831 347
352 3300009147 Ga0114129_10071725 Ga0114129_100717252 347
353 3300009177 Ga0105248_10076303 Ga0105248_100763032 347
354 3300009551 Ga0105238_10103043 Ga0105238_101030433 347
355 3300009553 Ga0105249_10020648 Ga0105249_100206484 347
356 3300013296 Ga0157374_10002622 Ga0157374_1000262214 347
357 3300013306 Ga0163162_10007612 Ga0163162_100076123 347
358 3300013307 Ga0157372_10085188 Ga0157372_100851882 347
359 3300014325 Ga0163163_10037985 Ga0163163_100379853 347
360 3300020078 Ga0206352_10958369 Ga0206352_109583692 347
361 3300020080 Ga0206350_10064510 Ga0206350_100645102 347
362 3300025321 Ga0207656_10007333 Ga0207656_100073332 347
363 3300025899 Ga0207642_10024014 Ga0207642_100240143 347
364 3300025900 Ga0207710_10126252 Ga0207710_101262521 347
365 3300025907 Ga0207645_10029315 Ga0207645_100293152 347
366 3300025908 Ga0207643_10159495 Ga0207643_101594951 347
367 3300025911 Ga0207654_10003318 Ga0207654_100033185 347
368 3300025911 Ga0207654_10014276 Ga0207654_100142763 347
369 3300025912 Ga0207707_10081084 Ga0207707_100810843 347
370 3300025913 Ga0207695_10020079 Ga0207695_100200795 347
371 3300025919 Ga0207657_10004939 Ga0207657_1000493913 347
372 3300025920 Ga0207649_10012718 Ga0207649_100127183 347
373 3300025921 Ga0207652_10076551 Ga0207652_100765513 347
374 3300025927 Ga0207687_10003506 Ga0207687_100035067 347
375 3300025928 Ga0207700_10055263 Ga0207700_100552632 347
376 3300025933 Ga0207706_10000597 Ga0207706_100005977 347
377 3300025936 Ga0207670_10225513 Ga0207670_102255132 347
378 3300025938 Ga0207704_10011848 Ga0207704_100118482 347
379 3300025941 Ga0207711_10001240 Ga0207711_1000124013 347
380 3300025945 Ga0207679_10026928 Ga0207679_100269282 347
381 3300025949 Ga0207667_10003400 Ga0207667_1000340010 347
382 3300025961 Ga0207712_10005929 Ga0207712_100059292 347
383 3300025972 Ga0207668_10019796 Ga0207668_100197962 347
384 3300025986 Ga0207658_10005680 Ga0207658_100056803 347
385 3300026023 Ga0207677_10004150 Ga0207677_100041504 347
386 3300026067 Ga0207678_10002015 Ga0207678_100020152 347
387 3300026089 Ga0207648_10036307 Ga0207648_100363072 347
388 3300026095 Ga0207676_10199426 Ga0207676_101994262 347
389 3300026116 Ga0207674_10024448 Ga0207674_100244484 347
390 3300026118 Ga0207675_100104255 Ga0207675_1001042551 347
391 3300026121 Ga0207683_10044524 Ga0207683_100445243 347
392 3300028379 Ga0268266_10139900 Ga0268266_101399002 347
393 3300028380 Ga0268265_10112550 Ga0268265_101125502 347
394 3300028381 Ga0268264_10040981 Ga0268264_100409813 347
395 3300035112 Ga0373932_0039345 Ga0373932_0039345_242_1306 347
396 3300035118 Ga0373954_0075395 Ga0373954_0075395_477_1562 347
397 3300035120 Ga0373957_0009274 Ga0373957_0009274_1858_2943 347
398 3300035724 Ga0373933_0071961 Ga0373933_0071961_158_1243 347
399 3300046472 Ga0495580_0052089 Ga0495580_0052089_1786_2850 347
400 3300048905 Ga0496102_0195652 Ga0496102_0195652_751_1815 347
401 3300048906 Ga0496103_0042908 Ga0496103_0042908_156_1220 347
402 3300048909 Ga0496106_0136207 Ga0496106_0136207_231_1295 347
403 3300050509 nmdc:mga0qj67_373246_c1 nmdc:mga0qj67_373246_c1_34_1104 347
404 3300050512 nmdc:mga0n895_213442_c1 nmdc:mga0n895_213442_c1_583_1647 347
405 iso_pu_bacteria 2622736626 2623589808 347
406 iso_pu_bacteria 2858902515 2858908162 347
407 3300005290 Ga0065712_10080756 Ga0065712_100807562 348
408 3300005355 Ga0070671_100071202 Ga0070671_1000712024 348
409 3300005364 Ga0070673_100086857 Ga0070673_1000868571 348
410 3300005434 Ga0070709_10214670 Ga0070709_102146701 348
411 3300005436 Ga0070713_100187910 Ga0070713_1001879102 348
412 3300005983 Ga0081540_1015731 Ga0081540_10157315 348
413 3300009093 Ga0105240_10003191 Ga0105240_1000319113 348
414 3300009094 Ga0111539_10282739 Ga0111539_102827391 348
415 3300009147 Ga0114129_10146388 Ga0114129_101463883 348
416 3300013296 Ga0157374_10039357 Ga0157374_100393574 348
417 3300021361 Ga0213872_10005912 Ga0213872_100059125 348
418 3300025913 Ga0207695_10023568 Ga0207695_100235684 348
419 3300025928 Ga0207700_10259486 Ga0207700_102594862 348
420 3300025960 Ga0207651_10075051 Ga0207651_100750512 348
421 3300035692 Ga0373935_0032029 Ga0373935_0032029_1191_2312 348
422 3300035695 Ga0373927_0001944 Ga0373927_0001944_12517_13638 348
423 3300035695 Ga0373927_0094386 Ga0373927_0094386_368_1495 348
424 3300035725 Ga0373947_0036136 Ga0373947_0036136_631_1752 348
425 3300037068 Ga0373925_0056088 Ga0373925_0056088_159_1280 348
426 3300037853 Ga0436364_0691152 Ga0436364_0691152_434_1495 348
427 3300039438 Ga0436360_0614395 Ga0436360_0614395_153_1214 348
428 3300039447 Ga0436361_0169046 Ga0436361_0169046_14122_15183 348
429 3300045051 Ga0451576_0178703 Ga0451576_0178703_233_1369 348
430 3300048916 Ga0496113_0254545 Ga0496113_0254545_235_1305 348
431 3300049581 Ga0501047_0045873 Ga0501047_0045873_2339_3418 348
432 3300049742 Ga0501080_0002951 Ga0501080_0002951_10969_12057 348
433 3300005295 Ga0065707_10099363 Ga0065707_100993632 349
434 3300005328 Ga0070676_10006924 Ga0070676_100069242 349
435 3300005330 Ga0070690_100081587 Ga0070690_1000815873 349
436 3300005331 Ga0070670_100007440 Ga0070670_1000074406 349
437 3300005338 Ga0068868_100097046 Ga0068868_1000970462 349
438 3300005343 Ga0070687_100027105 Ga0070687_1000271052 349
439 3300005347 Ga0070668_100122120 Ga0070668_1001221201 349
440 3300005353 Ga0070669_100093370 Ga0070669_1000933701 349
441 3300005354 Ga0070675_100034521 Ga0070675_1000345213 349
442 3300005355 Ga0070671_100001471 Ga0070671_10000147120 349
443 3300005356 Ga0070674_100011537 Ga0070674_1000115375 349
444 3300005356 Ga0070674_100036697 Ga0070674_1000366972 349
445 3300005364 Ga0070673_100042833 Ga0070673_1000428333 349
446 3300005367 Ga0070667_100013925 Ga0070667_1000139256 349
447 3300005367 Ga0070667_100022090 Ga0070667_1000220903 349
448 3300005434 Ga0070709_10028389 Ga0070709_100283894 349
449 3300005436 Ga0070713_100196019 Ga0070713_1001960192 349
450 3300005457 Ga0070662_100010706 Ga0070662_1000107066 349
451 3300005543 Ga0070672_100030998 Ga0070672_1000309984 349
452 3300005548 Ga0070665_100016598 Ga0070665_10001659812 349
453 3300005548 Ga0070665_100203797 Ga0070665_1002037973 349
454 3300005618 Ga0068864_100142557 Ga0068864_1001425572 349
455 3300005841 Ga0068863_100196170 Ga0068863_1001961702 349
456 3300005842 Ga0068858_100113727 Ga0068858_1001137273 349
457 3300006173 Ga0070716_100128194 Ga0070716_1001281943 349
458 3300006175 Ga0070712_100311899 Ga0070712_1003118991 349
459 3300006237 Ga0097621_100002691 Ga0097621_1000026912 349
460 3300006237 Ga0097621_100096597 Ga0097621_1000965974 349
461 3300006881 Ga0068865_100050725 Ga0068865_1000507252 349
462 3300013297 Ga0157378_10017414 Ga0157378_100174144 349
463 3300013297 Ga0157378_10090568 Ga0157378_100905682 349
464 3300013306 Ga0163162_10077622 Ga0163162_100776222 349
465 3300013308 Ga0157375_10000790 Ga0157375_1000079025 349
466 3300014745 Ga0157377_10019570 Ga0157377_100195702 349
467 3300025315 Ga0207697_10006543 Ga0207697_100065434 349
468 3300025903 Ga0207680_10003756 Ga0207680_100037566 349
469 3300025903 Ga0207680_10029229 Ga0207680_100292293 349
470 3300025906 Ga0207699_10011051 Ga0207699_100110514 349
471 3300025907 Ga0207645_10003683 Ga0207645_1000368311 349
472 3300025915 Ga0207693_10023140 Ga0207693_100231406 349
473 3300025915 Ga0207693_10072341 Ga0207693_100723411 349
474 3300025923 Ga0207681_10013266 Ga0207681_100132666 349
475 3300025923 Ga0207681_10041489 Ga0207681_100414894 349
476 3300025925 Ga0207650_10022881 Ga0207650_100228812 349
477 3300025926 Ga0207659_10040062 Ga0207659_100400623 349
478 3300025926 Ga0207659_10049747 Ga0207659_100497472 349
479 3300025928 Ga0207700_10033679 Ga0207700_100336792 349
480 3300025931 Ga0207644_10004127 Ga0207644_1000412711 349
481 3300025931 Ga0207644_10171372 Ga0207644_101713723 349
482 3300025933 Ga0207706_10004944 Ga0207706_100049447 349
483 3300025937 Ga0207669_10075374 Ga0207669_100753741 349
484 3300025938 Ga0207704_10015792 Ga0207704_100157922 349
485 3300025939 Ga0207665_10032649 Ga0207665_100326492 349
486 3300025939 Ga0207665_10176668 Ga0207665_101766683 349
487 3300025940 Ga0207691_10020159 Ga0207691_100201595 349
488 3300025940 Ga0207691_10085140 Ga0207691_100851402 349
489 3300025960 Ga0207651_10014155 Ga0207651_100141552 349
490 3300025960 Ga0207651_10287126 Ga0207651_102871261 349
491 3300025986 Ga0207658_10168095 Ga0207658_101680952 349
492 3300025986 Ga0207658_10251998 Ga0207658_102519982 349
493 3300026023 Ga0207677_10007511 Ga0207677_100075114 349
494 3300026023 Ga0207677_10213879 Ga0207677_102138791 349
495 3300026035 Ga0207703_10080824 Ga0207703_100808242 349
496 3300026088 Ga0207641_10206861 Ga0207641_102068612 349
497 3300026095 Ga0207676_10422769 Ga0207676_104227691 349
498 3300026121 Ga0207683_10010450 Ga0207683_100104508 349
499 3300028379 Ga0268266_10002775 Ga0268266_100027757 349
500 3300028379 Ga0268266_10044373 Ga0268266_100443731 349
501 3300035692 Ga0373935_0212465 Ga0373935_0212465_86_1150 349
502 3300035725 Ga0373947_0189278 Ga0373947_0189278_179_1243 349
503 3300037068 Ga0373925_0021355 Ga0373925_0021355_2090_3154 349
504 3300037068 Ga0373925_0112805 Ga0373925_0112805_901_1965 349
505 3300046537 Ga0495598_0014625 Ga0495598_0014625_330_1394 349
506 3300046683 Ga0495658_0072778 Ga0495658_0072778_410_1474 349
507 3300048903 Ga0496100_0094832 Ga0496100_0094832_759_1823 349
508 3300048904 Ga0496101_0021283 Ga0496101_0021283_2927_3991 349
509 3300048905 Ga0496102_0039941 Ga0496102_0039941_1591_2655 349
510 3300048906 Ga0496103_0026769 Ga0496103_0026769_1696_2760 349
511 3300048909 Ga0496106_0068836 Ga0496106_0068836_199_1263 349
512 3300048910 Ga0496107_0003168 Ga0496107_0003168_4633_5697 349
513 3300048911 Ga0496108_0104006 Ga0496108_0104006_1085_2149 349
514 3300048912 Ga0496109_0106734 Ga0496109_0106734_1436_2500 349
515 3300048917 Ga0496114_0025070 Ga0496114_0025070_2660_3724 349
516 3300048917 Ga0496114_0045754 Ga0496114_0045754_1643_2707 349
517 3300048918 Ga0496115_0015552 Ga0496115_0015552_3651_4715 349
518 3300048929 Ga0496126_0001095 Ga0496126_0001095_37118_38170 349
519 3300005327 Ga0070658_10002244 Ga0070658_100022446 350
520 3300005436 Ga0070713_100010418 Ga0070713_1000104183 350
521 3300005467 Ga0070706_100069378 Ga0070706_1000693784 350
522 3300005468 Ga0070707_100031670 Ga0070707_1000316705 350
523 3300005563 Ga0068855_100100071 Ga0068855_1001000713 350
524 3300021361 Ga0213872_10006901 Ga0213872_100069015 350
525 3300021361 Ga0213872_10025674 Ga0213872_100256742 350
526 3300021361 Ga0213872_10029387 Ga0213872_100293871 350
527 3300021384 Ga0213876_10006089 Ga0213876_100060893 350
528 3300025910 Ga0207684_10074822 Ga0207684_100748222 350
529 3300025922 Ga0207646_10030431 Ga0207646_100304315 350
530 3300025928 Ga0207700_10012001 Ga0207700_100120014 350
531 3300025929 Ga0207664_10115846 Ga0207664_101158462 350
532 3300045049 Ga0466959_0013891 Ga0466959_0013891_919_2010 350
533 3300045976 Ga0466967_0199175 Ga0466967_0199175_372_1463 350
534 3300059490 Ga0587066_000288 Ga0587066_000288_1550_2641 350
535 3300059491 Ga0587070_009408 Ga0587070_009408_245_1336 350
536 3300059492 Ga0587073_0011407 Ga0587073_0011407_366_1457 350
537 3300059493 Ga0587077_006973 Ga0587077_006973_469_1560 350
538 3300059505 Ga0587083_0009119 Ga0587083_0009119_31_1122 350
539 3300059506 Ga0587085_000714 Ga0587085_000714_653_1744 350
540 3300059507 Ga0587086_000022 Ga0587086_000022_3055_4146 350
541 3300059508 Ga0587088_011149 Ga0587088_011149_190_1281 350
542 3300059509 Ga0587089_001459 Ga0587089_001459_50_1132 350
543 3300059512 Ga0587092_004210 Ga0587092_004210_561_1652 350
544 3300059513 Ga0587094_001624 Ga0587094_001624_245_1336 350
545 3300059514 Ga0587095_001789 Ga0587095_001789_17_1108 350
546 3300059605 Ga0587106_006092 Ga0587106_006092_256_1347 350
547 3300059622 Ga0587099_005034 Ga0587099_005034_24_1115 350
548 3300059626 Ga0587115_007280 Ga0587115_007280_17_1108 350
549 3300059627 Ga0587117_005261 Ga0587117_005261_249_1340 350
550 3300059639 Ga0587062_002586 Ga0587062_002586_354_1595 350
551 3300059642 Ga0587069_005740 Ga0587069_005740_358_1449 350
552 3300059643 Ga0587072_014599 Ga0587072_014599_169_1260 350
553 3300059645 Ga0587076_000124 Ga0587076_000124_3437_4528 350
554 3300059646 Ga0587078_001339 Ga0587078_001339_1002_2093 350
555 3300059647 Ga0587079_004527 Ga0587079_004527_508_1599 350
556 3300059649 Ga0587102_002049 Ga0587102_002049_349_1440 350
557 3300059652 Ga0587107_005751 Ga0587107_005751_186_1277 350
558 3300059654 Ga0587110_000038 Ga0587110_000038_2998_4089 350
559 3300060243 Ga0587060_000305 Ga0587060_000305_299_1390 350
560 3300060344 Ga0587071_001621 Ga0587071_001621_430_1521 350
561 3300060346 Ga0587111_0014793 Ga0587111_0014793_165_1256 350
562 3300005548 Ga0070665_100000209 Ga0070665_10000020954 351
563 3300025916 Ga0207663_10170320 Ga0207663_101703201 351
564 3300025931 Ga0207644_10224919 Ga0207644_102249191 351
565 3300026088 Ga0207641_10189804 Ga0207641_101898042 351
566 3300026095 Ga0207676_10013312 Ga0207676_100133123 351
567 3300026142 Ga0207698_10066977 Ga0207698_100669771 351
568 3300028379 Ga0268266_10003104 Ga0268266_1000310417 351
569 3300031548 Ga0307408_100025250 Ga0307408_1000252501 351
570 3300032002 Ga0307416_100044811 Ga0307416_1000448111 351
571 3300037853 Ga0436364_0197022 Ga0436364_0197022_50532_51590 351
572 3300037853 Ga0436364_0824275 Ga0436364_0824275_94_1152 351
573 3300048904 Ga0496101_0088043 Ga0496101_0088043_907_1965 351
574 3300048905 Ga0496102_0041673 Ga0496102_0041673_1655_2713 351
575 3300048906 Ga0496103_0027895 Ga0496103_0027895_1571_2629 351
576 3300048910 Ga0496107_0139628 Ga0496107_0139628_721_1779 351
577 3300048912 Ga0496109_0001856 Ga0496109_0001856_3135_4193 351
578 3300048914 Ga0496111_0014249 Ga0496111_0014249_1352_2410 351
579 3300048915 Ga0496112_0081474 Ga0496112_0081474_1324_2382 351
580 3300048916 Ga0496113_0000866 Ga0496113_0000866_7539_8597 351
581 3300049572 Ga0501036_0018906 Ga0501036_0018906_3477_4571 351
582 3300049579 Ga0501043_0002651 Ga0501043_0002651_1339_2433 351
583 3300049580 Ga0501046_0000674 Ga0501046_0000674_21612_22706 351
584 3300049581 Ga0501047_0000007 Ga0501047_0000007_420294_421388 351
585 3300049582 Ga0501048_0000594 Ga0501048_0000594_15404_16498 351
586 3300049584 Ga0501068_0002714 Ga0501068_0002714_517_1611 351
587 3300049586 Ga0501070_0001351 Ga0501070_0001351_9377_10471 351
588 3300049588 Ga0501072_0000092 Ga0501072_0000092_15430_16524 351
589 3300049589 Ga0501073_0000791 Ga0501073_0000791_11620_12714 351
590 3300049590 Ga0501074_0001634 Ga0501074_0001634_9952_11046 351
591 3300049741 Ga0501079_0000314 Ga0501079_0000314_2942_4036 351
592 3300049742 Ga0501080_0010312 Ga0501080_0010312_5075_6169 351
593 3300049744 Ga0501083_0000473 Ga0501083_0000473_11648_12742 351
594 3300053077 Ga0495601_0063469 Ga0495601_0063469_1057_2181 351
595 3300054114 Ga0501084_0000043 Ga0501084_0000043_21842_22936 351
596 3300059493 Ga0587077_000661 Ga0587077_000661_1976_3034 351
597 3300059505 Ga0587083_0009389 Ga0587083_0009389_113_1171 351
598 3300060353 Ga0501082_0000697 Ga0501082_0000697_26157_27251 351
599 3300005289 Ga0065704_10098665 Ga0065704_100986652 352
600 3300005329 Ga0070683_100090432 Ga0070683_1000904322 352
601 3300005434 Ga0070709_10014230 Ga0070709_100142302 352
602 3300005435 Ga0070714_100054697 Ga0070714_1000546972 352
603 3300005436 Ga0070713_100024021 Ga0070713_1000240213 352
604 3300005535 Ga0070684_100264751 Ga0070684_1002647512 352
605 3300006237 Ga0097621_100285408 Ga0097621_1002854082 352
606 3300025906 Ga0207699_10011440 Ga0207699_100114403 352
607 3300025913 Ga0207695_10180752 Ga0207695_101807522 352
608 3300025929 Ga0207664_10094196 Ga0207664_100941962 352
609 3300035117 Ga0373953_0093178 Ga0373953_0093178_26_1090 352
610 3300046472 Ga0495580_0004707 Ga0495580_0004707_6699_7763 352
611 3300047317 Ga0495604_0072115 Ga0495604_0072115_1063_2127 352
612 3300059491 Ga0587070_003904 Ga0587070_003904_685_1782 352
613 3300059506 Ga0587085_003102 Ga0587085_003102_49_1146 352
614 3300059507 Ga0587086_003625 Ga0587086_003625_405_1502 352
615 3300059508 Ga0587088_005009 Ga0587088_005009_558_1655 352
616 3300059511 Ga0587091_012923 Ga0587091_012923_178_1275 352
617 3300059642 Ga0587069_001285 Ga0587069_001285_522_1619 352
618 3300059646 Ga0587078_001518 Ga0587078_001518_834_1931 352
619 3300060346 Ga0587111_0014455 Ga0587111_0014455_62_1159 352
620 3300000546 LJNas_1004690 LJNas_10046902 353
621 3300005327 Ga0070658_10040706 Ga0070658_100407062 353
622 3300005327 Ga0070658_10050969 Ga0070658_100509691 353
623 3300005340 Ga0070689_100158595 Ga0070689_1001585952 353
624 3300005364 Ga0070673_100011121 Ga0070673_1000111215 353
625 3300005434 Ga0070709_10151301 Ga0070709_101513011 353
626 3300005439 Ga0070711_100001726 Ga0070711_1000017265 353
627 3300005439 Ga0070711_100012190 Ga0070711_1000121904 353
628 3300005439 Ga0070711_100014039 Ga0070711_1000140393 353
629 3300005439 Ga0070711_100351990 Ga0070711_1003519901 353
630 3300005459 Ga0068867_100002185 Ga0068867_10000218519 353
631 3300005530 Ga0070679_100137210 Ga0070679_1001372102 353
632 3300005843 Ga0068860_100096817 Ga0068860_1000968172 353
633 3300006028 Ga0070717_10001768 Ga0070717_100017682 353
634 3300006163 Ga0070715_10016808 Ga0070715_100168082 353
635 3300006163 Ga0070715_10037142 Ga0070715_100371421 353
636 3300006173 Ga0070716_100027660 Ga0070716_1000276602 353
637 3300006175 Ga0070712_100000857 Ga0070712_10000085712 353
638 3300006175 Ga0070712_100002008 Ga0070712_1000020081 353
639 3300006175 Ga0070712_100005778 Ga0070712_1000057782 353
640 3300006175 Ga0070712_100032393 Ga0070712_1000323932 353
641 3300006237 Ga0097621_100273735 Ga0097621_1002737352 353
642 3300009093 Ga0105240_10008429 Ga0105240_100084294 353
643 3300009093 Ga0105240_10114744 Ga0105240_101147444 353
644 3300009148 Ga0105243_10001423 Ga0105243_1000142319 353
645 3300009176 Ga0105242_10014847 Ga0105242_100148472 353
646 3300010375 Ga0105239_10349985 Ga0105239_103499851 353
647 3300020069 Ga0197907_10306840 Ga0197907_103068402 353
648 3300020069 Ga0197907_10822851 Ga0197907_108228512 353
649 3300020070 Ga0206356_11137496 Ga0206356_111374962 353
650 3300020075 Ga0206349_1310841 Ga0206349_13108412 353
651 3300020075 Ga0206349_1374472 Ga0206349_13744722 353
652 3300020076 Ga0206355_1362144 Ga0206355_13621442 353
653 3300020077 Ga0206351_10102578 Ga0206351_101025782 353
654 3300020078 Ga0206352_10114043 Ga0206352_101140432 353
655 3300020078 Ga0206352_10477907 Ga0206352_104779072 353
656 3300020080 Ga0206350_10198345 Ga0206350_101983452 353
657 3300020080 Ga0206350_10605904 Ga0206350_106059041 353
658 3300020080 Ga0206350_11394896 Ga0206350_113948962 353
659 3300020081 Ga0206354_10172340 Ga0206354_101723402 353
660 3300020082 Ga0206353_12033768 Ga0206353_120337682 353
661 3300022467 Ga0224712_10040881 Ga0224712_100408812 353
662 3300025904 Ga0207647_10002566 Ga0207647_100025663 353
663 3300025905 Ga0207685_10007850 Ga0207685_100078502 353
664 3300025909 Ga0207705_10022733 Ga0207705_100227332 353
665 3300025912 Ga0207707_10007725 Ga0207707_100077258 353
666 3300025913 Ga0207695_10209941 Ga0207695_102099412 353
667 3300025915 Ga0207693_10000562 Ga0207693_1000056212 353
668 3300025915 Ga0207693_10001341 Ga0207693_100013415 353
669 3300025915 Ga0207693_10010151 Ga0207693_100101512 353
670 3300025915 Ga0207693_10105421 Ga0207693_101054212 353
671 3300025916 Ga0207663_10002120 Ga0207663_100021207 353
672 3300025916 Ga0207663_10026921 Ga0207663_100269213 353
673 3300025921 Ga0207652_10304107 Ga0207652_103041071 353
674 3300025928 Ga0207700_10000792 Ga0207700_100007922 353
675 3300025928 Ga0207700_10074046 Ga0207700_100740461 353
676 3300025929 Ga0207664_10073500 Ga0207664_100735002 353
677 3300025935 Ga0207709_10001174 Ga0207709_100011743 353
678 3300025939 Ga0207665_10012351 Ga0207665_100123512 353
679 3300025939 Ga0207665_10038369 Ga0207665_100383693 353
680 3300025960 Ga0207651_10019188 Ga0207651_100191883 353
681 3300026078 Ga0207702_10050447 Ga0207702_100504471 353
682 3300026089 Ga0207648_10329340 Ga0207648_103293402 353
683 3300028381 Ga0268264_10083282 Ga0268264_100832822 353
684 3300035083 Ga0373926_0011667 Ga0373926_0011667_911_1975 353
685 3300035111 Ga0373923_0059029 Ga0373923_0059029_175_1239 353
686 3300035116 Ga0373945_0015272 Ga0373945_0015272_467_1531 353
687 3300035170 Ga0373943_0014349 Ga0373943_0014349_85_1149 353
688 3300035692 Ga0373935_0019993 Ga0373935_0019993_1149_2213 353
689 3300035692 Ga0373935_0033091 Ga0373935_0033091_1198_2262 353
690 3300035695 Ga0373927_0007276 Ga0373927_0007276_5223_6287 353
691 3300035725 Ga0373947_0004634 Ga0373947_0004634_4064_5128 353
692 3300035725 Ga0373947_0134289 Ga0373947_0134289_128_1192 353
693 3300037068 Ga0373925_0069171 Ga0373925_0069171_759_1823 353
694 3300037068 Ga0373925_0169855 Ga0373925_0169855_312_1376 353
695 3300037418 Ga0395900_0169022 Ga0395900_0169022_196_1287 353
696 3300037466 Ga0395898_0026787 Ga0395898_0026787_2854_3954 353
697 3300037471 Ga0395905_0213364 Ga0395905_0213364_504_1568 353
698 3300046463 Ga0495653_0003430 Ga0495653_0003430_3942_5006 353
699 3300046473 Ga0495582_0006536 Ga0495582_0006536_1220_2284 353
700 3300046473 Ga0495582_0076021 Ga0495582_0076021_97_1167 353
701 3300046473 Ga0495582_0149342 Ga0495582_0149342_38_1102 353
702 3300046477 Ga0495664_0055757 Ga0495664_0055757_32_1096 353
703 3300046477 Ga0495664_0078175 Ga0495664_0078175_654_1718 353
704 3300046511 Ga0495608_0003788 Ga0495608_0003788_4532_5635 353
705 3300046511 Ga0495608_0005638 Ga0495608_0005638_5391_6455 353
706 3300046517 Ga0495630_0102751 Ga0495630_0102751_260_1324 353
707 3300046529 Ga0495652_0016044 Ga0495652_0016044_1125_2189 353
708 3300046531 Ga0495665_0000696 Ga0495665_0000696_4299_5363 353
709 3300046543 Ga0495645_0183413 Ga0495645_0183413_196_1263 353
710 3300046675 Ga0495657_0021903 Ga0495657_0021903_2853_3917 353
711 3300046679 Ga0495623_0040587 Ga0495623_0040587_1876_2940 353
712 3300046680 Ga0495646_0001675 Ga0495646_0001675_5995_7059 353
713 3300046689 Ga0495613_0029946 Ga0495613_0029946_1071_2135 353
714 3300046690 Ga0495624_0005371 Ga0495624_0005371_182_1246 353
715 3300047317 Ga0495604_0008626 Ga0495604_0008626_5201_6265 353
716 3300047319 Ga0495674_0099487 Ga0495674_0099487_1401_2465 353
717 3300047319 Ga0495674_0116027 Ga0495674_0116027_558_1622 353
718 3300047444 Ga0495675_0001996 Ga0495675_0001996_3875_4939 353
719 3300047471 Ga0495684_0013604 Ga0495684_0013604_967_2031 353
720 3300048905 Ga0496102_0161856 Ga0496102_0161856_503_1567 353
721 3300048908 Ga0496105_0070802 Ga0496105_0070802_1210_2274 353
722 3300048911 Ga0496108_0005312 Ga0496108_0005312_3114_4178 353
723 3300048918 Ga0496115_0009585 Ga0496115_0009585_5326_6390 353
724 3300048918 Ga0496115_0082131 Ga0496115_0082131_1135_2235 353
725 3300053078 Ga0495612_0001054 Ga0495612_0001054_8293_9357 353
726 3300059477 Ga0587084_010182 Ga0587084_010182_65_1165 353
727 3300059478 Ga0587093_007427 Ga0587093_007427_59_1159 353
728 3300059490 Ga0587066_000020 Ga0587066_000020_72_1172 353
729 3300059490 Ga0587066_014775 Ga0587066_014775_37_1137 353
730 3300059491 Ga0587070_000045 Ga0587070_000045_66_1166 353
731 3300059491 Ga0587070_015368 Ga0587070_015368_62_1162 353
732 3300059492 Ga0587073_0000029 Ga0587073_0000029_206_1306 353
733 3300059492 Ga0587073_0005921 Ga0587073_0005921_166_1263 353
734 3300059492 Ga0587073_0023047 Ga0587073_0023047_64_1164 353
735 3300059493 Ga0587077_000655 Ga0587077_000655_66_1166 353
736 3300059503 Ga0587080_000651 Ga0587080_000651_1916_3016 353
737 3300059503 Ga0587080_014401 Ga0587080_014401_62_1162 353
738 3300059504 Ga0587082_000603 Ga0587082_000603_66_1166 353
739 3300059504 Ga0587082_003022 Ga0587082_003022_62_1162 353
740 3300059505 Ga0587083_0003110 Ga0587083_0003110_196_1293 353
741 3300059505 Ga0587083_0004447 Ga0587083_0004447_69_1169 353
742 3300059505 Ga0587083_0015312 Ga0587083_0015312_63_1163 353
743 3300059506 Ga0587085_010730 Ga0587085_010730_38_1138 353
744 3300059506 Ga0587085_011711 Ga0587085_011711_37_1137 353
745 3300059507 Ga0587086_000034 Ga0587086_000034_4941_6041 353
746 3300059507 Ga0587086_007937 Ga0587086_007937_62_1162 353
747 3300059508 Ga0587088_000561 Ga0587088_000561_72_1172 353
748 3300059508 Ga0587088_016115 Ga0587088_016115_19_1119 353
749 3300059509 Ga0587089_009294 Ga0587089_009294_66_1166 353
750 3300059510 Ga0587090_011939 Ga0587090_011939_63_1163 353
751 3300059510 Ga0587090_014102 Ga0587090_014102_37_1137 353
752 3300059511 Ga0587091_000747 Ga0587091_000747_66_1166 353
753 3300059512 Ga0587092_004466 Ga0587092_004466_163_1260 353
754 3300059512 Ga0587092_011635 Ga0587092_011635_65_1165 353
755 3300059513 Ga0587094_000025 Ga0587094_000025_62_1162 353
756 3300059513 Ga0587094_003161 Ga0587094_003161_509_1606 353
757 3300059513 Ga0587094_011040 Ga0587094_011040_51_1151 353
758 3300059514 Ga0587095_000124 Ga0587095_000124_1999_3099 353
759 3300059622 Ga0587099_002764 Ga0587099_002764_248_1348 353
760 3300059623 Ga0587101_007780 Ga0587101_007780_66_1166 353
761 3300059626 Ga0587115_000052 Ga0587115_000052_116_1216 353
762 3300059627 Ga0587117_006832 Ga0587117_006832_125_1225 353
763 3300059630 Ga0587128_000027 Ga0587128_000027_4831_5931 353
764 3300059630 Ga0587128_012214 Ga0587128_012214_60_1160 353
765 3300059631 Ga0587130_000226 Ga0587130_000226_1999_3099 353
766 3300059640 Ga0587067_016270 Ga0587067_016270_67_1167 353
767 3300059640 Ga0587067_017032 Ga0587067_017032_38_1138 353
768 3300059641 Ga0587068_015362 Ga0587068_015362_66_1166 353
769 3300059642 Ga0587069_000417 Ga0587069_000417_1999_3099 353
770 3300059642 Ga0587069_010545 Ga0587069_010545_51_1151 353
771 3300059643 Ga0587072_018846 Ga0587072_018846_66_1166 353
772 3300059644 Ga0587075_000017 Ga0587075_000017_66_1166 353
773 3300059644 Ga0587075_010404 Ga0587075_010404_67_1167 353
774 3300059645 Ga0587076_014372 Ga0587076_014372_59_1159 353
775 3300059646 Ga0587078_000079 Ga0587078_000079_3722_4822 353
776 3300059647 Ga0587079_000044 Ga0587079_000044_41_1141 353
777 3300059647 Ga0587079_005793 Ga0587079_005793_166_1263 353
778 3300059647 Ga0587079_022117 Ga0587079_022117_19_1119 353
779 3300059649 Ga0587102_004086 Ga0587102_004086_62_1162 353
780 3300059652 Ga0587107_004923 Ga0587107_004923_108_1208 353
781 3300059652 Ga0587107_007700 Ga0587107_007700_57_1157 353
782 3300059655 Ga0587114_000221 Ga0587114_000221_1999_3099 353
783 3300059659 Ga0587120_001930 Ga0587120_001930_193_1293 353
784 3300060344 Ga0587071_019345 Ga0587071_019345_69_1169 353
785 3300060344 Ga0587071_019412 Ga0587071_019412_66_1166 353
786 3300060346 Ga0587111_0023562 Ga0587111_0023562_66_1166 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14720

NiFe_hyd_SSU_C

NiFe/NiFeSe hydrogenase small subunit C-terminal

221

299

0.98

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

30

198

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fpi-assembly1.cif.gz_S structure of fully reduced hydrogenase (hyd-1) variant e28q 0.7713 19 275
4ucw-assembly1.cif.gz_A structure of the t18v small subunit mutant of d. fructosovorans nife- hydrogenase 0.7674 17 273
1cc1-assembly1.cif.gz_S crystal structure of a reduced, active form of the ni-fe-se hydrogenase from desulfomicrobium baculatum 0.752 22 294
7vxq-assembly1.cif.gz_B the carbon monoxide complex of [nife]-hydrogenase (hyb-type) from citrobacter sp. s-77 0.7504 15 265
4ucx-assembly3.cif.gz_C structure of the t18g small subunit mutant of d. fructosovorans nife- hydrogenase 0.7468 20 291
ID Description Score Start End Superfamily
1cc1S01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.8695 22 219 3.40.50.700
5xvbS01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.8551 15 221 3.40.50.700
1cc1S01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.8402 22 219 3.40.50.700
5xvbS01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.8374 15 221 3.40.50.700
2frvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.8329 17 220 3.40.50.700
ID Description Score Start End GO Terms
AF-A0A2V6IZK7-F1-model_v4 Hydrogenase expression protein HypE 0.978 15 183 GO:0008901
GO:0009055
GO:0009061
GO:0009375
GO:0016020
GO:0044569
GO:0051536
AF-A0A7G1IIE2-F1-model_v4 NADH:ubiquinone oxidoreductase-like 20kDa subunit domain-containing protein 0.9769 93 220 GO:0008901
GO:0009055
GO:0009061
GO:0009375
GO:0016020
GO:0044569
GO:0051536
AF-A0A535R529-F1-model_v4 Hydrogenase expression protein HypE 0.9755 18 175 GO:0008901
GO:0009055
GO:0009061
GO:0009375
GO:0016020
GO:0044569
GO:0051536
AF-A0A7W1MXN0-F1-model_v4 Hydrogenase expression protein HypE 0.9612 14 209 GO:0008901
GO:0009055
GO:0009061
GO:0009375
GO:0016020
GO:0044569
GO:0051536
AF-A0A7V9QYQ5-F1-model_v4 Hydrogenase expression protein HypE 0.9599 19 161 GO:0008901
GO:0009055
GO:0009061
GO:0009375
GO:0016020
GO:0044569
GO:0051536

Feature Viewer

pLDDT pTM Quality
69.8 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map