F480813
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 786 | 341 | 780 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300059639|Ga0587062_002586|Ga0587062_002586_354_1595 |
| Length | 404 |
| Sequence | MRLISLPWLKPEKPAPIDVHVIWLPDGMSCDGDTVSVTAAEQPSIESLILGAIPGIPKVVLHNRVLAYEQGGEDFMSWLYKAEKGELTPFVLVIEGSIPNENIKKEGYWTGVGNHPDGQPITLNEWIDRLAPKAFAVIAAGTCAAYGGIHAMAGNPTGSMGLADYLGWNWKSWAGVPIINVPGCPIQPDNMTETLLYLLYQAAQMAPLIPLDDQLRPTWLFGKTVHEGCDRAGYYEQGDFAHEYGSPKCLVKLGCWGPVVNCNVTKRGWMRGIGGCPNVGGICIACTMPGFPDKFMPFMDEPPGARVSTVASETYGMVIRTLRAITNSSANREPKWRRKTNKLITGYEQASTWSIRRGGCEPRYRRPRKTPANNKCEDQDRGRQRPLLRARGLAETRPESGRVN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 2 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 3 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 4 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 5 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 6 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 114 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 195 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 226 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 341 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.05 |
| Metatranscriptomes | 25.19 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.73 |
| Rhizosphere | 90.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1004690 | 3300000546 | Bacteria | 1509 |
| 2 | JGI24737J22298_10006829 | 3300001990 | Bacteria | 3878 |
| 3 | JGI24743J22301_10001548 | 3300001991 | Bacteria | 3220 |
| 4 | Ga0058863_11857546 | 3300004799 | Bacteria | 7031 |
| 5 | Ga0058861_10099167 | 3300004800 | Bacteria | 4416 |
| 6 | Ga0058861_11965202 | 3300004800 | Bacteria | 3195 |
| 7 | Ga0058862_10084264 | 3300004803 | Bacteria | 5767 |
| 8 | Ga0058862_10155954 | 3300004803 | Bacteria | 2148 |
| 9 | Ga0058862_12892176 | 3300004803 | Bacteria | 5641 |
| 10 | Ga0065704_10098665 | 3300005289 | Bacteria | 2344 |
| 11 | Ga0065712_10076610 | 3300005290 | Bacteria | 3632 |
| 12 | Ga0065712_10080756 | 3300005290 | Bacteria | 3001 |
| 13 | Ga0065715_10098711 | 3300005293 | Bacteria | 3500 |
| 14 | Ga0065715_10111681 | 3300005293 | Bacteria | 2563 |
| 15 | Ga0065707_10099363 | 3300005295 | Bacteria | 3012 |
| 16 | Ga0070658_10002244 | 3300005327 | Bacteria | 16202 |
| 17 | Ga0070658_10040706 | 3300005327 | Bacteria | 3749 |
| 18 | Ga0070658_10050969 | 3300005327 | Bacteria | 3355 |
| 19 | Ga0070676_10006924 | 3300005328 | Bacteria | 6072 |
| 20 | Ga0070676_10020479 | 3300005328 | Bacteria | 3693 |
| 21 | Ga0070676_10080437 | 3300005328 | Bacteria | 1975 |
| 22 | Ga0070683_100003814 | 3300005329 | Bacteria | 12319 |
| 23 | Ga0070683_100028263 | 3300005329 | Bacteria | 5067 |
| 24 | Ga0070683_100090432 | 3300005329 | Bacteria | 2874 |
| 25 | Ga0070690_100039399 | 3300005330 | Bacteria | 2986 |
| 26 | Ga0070690_100050541 | 3300005330 | Bacteria | 2652 |
| 27 | Ga0070690_100067238 | 3300005330 | Bacteria | 2321 |
| 28 | Ga0070690_100081587 | 3300005330 | Bacteria | 2116 |
| 29 | Ga0070670_100007440 | 3300005331 | Bacteria | 9301 |
| 30 | Ga0070670_100234867 | 3300005331 | Bacteria | 1596 |
| 31 | Ga0070670_100304717 | 3300005331 | Bacteria | 1394 |
| 32 | Ga0070680_100006320 | 3300005336 | Bacteria | 8998 |
| 33 | Ga0070680_100020352 | 3300005336 | Bacteria | 5267 |
| 34 | Ga0070682_100025971 | 3300005337 | Bacteria | 3500 |
| 35 | Ga0068868_100006785 | 3300005338 | Bacteria | 8130 |
| 36 | Ga0068868_100097046 | 3300005338 | Bacteria | 2381 |
| 37 | Ga0068868_100139305 | 3300005338 | Bacteria | 1990 |
| 38 | Ga0070689_100042193 | 3300005340 | Bacteria | 3503 |
| 39 | Ga0070689_100059419 | 3300005340 | Bacteria | 2971 |
| 40 | Ga0070689_100084459 | 3300005340 | Bacteria | 2495 |
| 41 | Ga0070689_100158595 | 3300005340 | Bacteria | 1828 |
| 42 | Ga0070689_100189853 | 3300005340 | Bacteria | 1673 |
| 43 | Ga0070689_100262024 | 3300005340 | Bacteria | 1429 |
| 44 | Ga0070687_100009280 | 3300005343 | Bacteria | 4209 |
| 45 | Ga0070687_100027105 | 3300005343 | Bacteria | 2764 |
| 46 | Ga0070687_100122270 | 3300005343 | Bacteria | 1490 |
| 47 | Ga0070661_100003160 | 3300005344 | Bacteria | 11338 |
| 48 | Ga0070668_100122120 | 3300005347 | Bacteria | 2083 |
| 49 | Ga0070669_100093370 | 3300005353 | Bacteria | 2259 |
| 50 | Ga0070675_100034521 | 3300005354 | Bacteria | 4106 |
| 51 | Ga0070675_100049573 | 3300005354 | Bacteria | 3447 |
| 52 | Ga0070671_100001471 | 3300005355 | Bacteria | 17592 |
| 53 | Ga0070671_100057634 | 3300005355 | Bacteria | 3233 |
| 54 | Ga0070671_100071202 | 3300005355 | Bacteria | 2902 |
| 55 | Ga0070671_100072906 | 3300005355 | Bacteria | 2868 |
| 56 | Ga0070674_100011537 | 3300005356 | Bacteria | 5385 |
| 57 | Ga0070674_100036697 | 3300005356 | Bacteria | 3292 |
| 58 | Ga0070673_100011121 | 3300005364 | Bacteria | 6136 |
| 59 | Ga0070673_100042833 | 3300005364 | Bacteria | 3493 |
| 60 | Ga0070673_100050848 | 3300005364 | Bacteria | 3242 |
| 61 | Ga0070673_100086857 | 3300005364 | Bacteria | 2549 |
| 62 | Ga0070688_100093383 | 3300005365 | Bacteria | 1970 |
| 63 | Ga0070688_100152955 | 3300005365 | Bacteria | 1578 |
| 64 | Ga0070667_100006336 | 3300005367 | Bacteria | 9836 |
| 65 | Ga0070667_100013925 | 3300005367 | Bacteria | 6650 |
| 66 | Ga0070667_100022090 | 3300005367 | Bacteria | 5277 |
| 67 | Ga0070709_10014230 | 3300005434 | Bacteria | 4497 |
| 68 | Ga0070709_10028389 | 3300005434 | Bacteria | 3336 |
| 69 | Ga0070709_10151301 | 3300005434 | Bacteria | 1604 |
| 70 | Ga0070709_10214670 | 3300005434 | Bacteria | 1369 |
| 71 | Ga0070714_100054697 | 3300005435 | Bacteria | 3410 |
| 72 | Ga0070713_100010418 | 3300005436 | Bacteria | 6713 |
| 73 | Ga0070713_100024021 | 3300005436 | Bacteria | 4741 |
| 74 | Ga0070713_100187910 | 3300005436 | Bacteria | 1860 |
| 75 | Ga0070713_100196019 | 3300005436 | Bacteria | 1822 |
| 76 | Ga0070711_100001726 | 3300005439 | Bacteria | 12128 |
| 77 | Ga0070711_100012190 | 3300005439 | Bacteria | 5366 |
| 78 | Ga0070711_100014039 | 3300005439 | Bacteria | 5040 |
| 79 | Ga0070711_100351990 | 3300005439 | Bacteria | 1184 |
| 80 | Ga0070700_100124835 | 3300005441 | Bacteria | 1729 |
| 81 | Ga0070678_100009877 | 3300005456 | Bacteria | 5800 |
| 82 | Ga0070662_100003448 | 3300005457 | Bacteria | 9861 |
| 83 | Ga0070662_100010706 | 3300005457 | Bacteria | 6036 |
| 84 | Ga0070681_10000958 | 3300005458 | Bacteria | 24313 |
| 85 | Ga0070681_10051513 | 3300005458 | Bacteria | 4106 |
| 86 | Ga0070681_10070445 | 3300005458 | Bacteria | 3462 |
| 87 | Ga0070681_10435135 | 3300005458 | Bacteria | 1224 |
| 88 | Ga0068867_100002185 | 3300005459 | Bacteria | 13732 |
| 89 | Ga0068867_100019567 | 3300005459 | Bacteria | 4823 |
| 90 | Ga0068867_100036200 | 3300005459 | Bacteria | 3581 |
| 91 | Ga0070685_10009391 | 3300005466 | Bacteria | 5052 |
| 92 | Ga0070685_10033704 | 3300005466 | Bacteria | 2879 |
| 93 | Ga0070706_100069378 | 3300005467 | Bacteria | 3260 |
| 94 | Ga0070707_100031670 | 3300005468 | Bacteria | 5039 |
| 95 | Ga0070679_100002628 | 3300005530 | Bacteria | 16336 |
| 96 | Ga0070679_100077513 | 3300005530 | Bacteria | 3312 |
| 97 | Ga0070679_100092485 | 3300005530 | Bacteria | 3012 |
| 98 | Ga0070679_100137210 | 3300005530 | Bacteria | 2427 |
| 99 | Ga0070679_100238641 | 3300005530 | Bacteria | 1776 |
| 100 | Ga0070684_100023550 | 3300005535 | Bacteria | 5153 |
| 101 | Ga0070684_100094337 | 3300005535 | Bacteria | 2665 |
| 102 | Ga0070684_100264751 | 3300005535 | Bacteria | 1573 |
| 103 | Ga0068853_100022555 | 3300005539 | Bacteria | 5258 |
| 104 | Ga0070672_100030998 | 3300005543 | Bacteria | 4022 |
| 105 | Ga0070672_100038064 | 3300005543 | Bacteria | 3673 |
| 106 | Ga0070672_100132533 | 3300005543 | Bacteria | 2049 |
| 107 | Ga0070672_100289497 | 3300005543 | Bacteria | 1386 |
| 108 | Ga0070686_100014697 | 3300005544 | Bacteria | 4517 |
| 109 | Ga0070686_100042425 | 3300005544 | Bacteria | 2849 |
| 110 | Ga0070695_100045761 | 3300005545 | Bacteria | 2790 |
| 111 | Ga0070665_100000209 | 3300005548 | Bacteria | 101937 |
| 112 | Ga0070665_100016598 | 3300005548 | Bacteria | 7381 |
| 113 | Ga0070665_100032863 | 3300005548 | Bacteria | 5220 |
| 114 | Ga0070665_100068448 | 3300005548 | Bacteria | 3560 |
| 115 | Ga0070665_100070423 | 3300005548 | Bacteria | 3504 |
| 116 | Ga0070665_100088824 | 3300005548 | Bacteria | 3096 |
| 117 | Ga0070665_100109506 | 3300005548 | Bacteria | 2764 |
| 118 | Ga0070665_100203797 | 3300005548 | Bacteria | 1979 |
| 119 | Ga0070704_100040664 | 3300005549 | Bacteria | 3202 |
| 120 | Ga0068855_100100071 | 3300005563 | Bacteria | 3338 |
| 121 | Ga0068855_100341561 | 3300005563 | Bacteria | 1651 |
| 122 | Ga0070664_100059354 | 3300005564 | Bacteria | 3254 |
| 123 | Ga0068857_100113849 | 3300005577 | Bacteria | 2432 |
| 124 | Ga0068856_100067140 | 3300005614 | Bacteria | 3544 |
| 125 | Ga0070702_100019855 | 3300005615 | Bacteria | 3512 |
| 126 | Ga0068852_100218802 | 3300005616 | Bacteria | 1810 |
| 127 | Ga0068859_100012221 | 3300005617 | Bacteria | 8633 |
| 128 | Ga0068859_100072086 | 3300005617 | Bacteria | 3490 |
| 129 | Ga0068864_100019864 | 3300005618 | Bacteria | 5618 |
| 130 | Ga0068864_100127443 | 3300005618 | Bacteria | 2282 |
| 131 | Ga0068864_100142557 | 3300005618 | Bacteria | 2163 |
| 132 | Ga0068866_10026846 | 3300005718 | Bacteria | 2725 |
| 133 | Ga0068861_100157764 | 3300005719 | Bacteria | 1868 |
| 134 | Ga0068851_10011169 | 3300005834 | Bacteria | 4206 |
| 135 | Ga0068863_100054448 | 3300005841 | Bacteria | 3790 |
| 136 | Ga0068863_100196170 | 3300005841 | Bacteria | 1941 |
| 137 | Ga0068858_100113727 | 3300005842 | Bacteria | 2528 |
| 138 | Ga0068860_100032000 | 3300005843 | Bacteria | 5057 |
| 139 | Ga0068860_100096817 | 3300005843 | Bacteria | 2813 |
| 140 | Ga0068860_100269765 | 3300005843 | Bacteria | 1661 |
| 141 | Ga0068862_100031265 | 3300005844 | Bacteria | 4492 |
| 142 | Ga0068862_100213919 | 3300005844 | Bacteria | 1742 |
| 143 | Ga0081455_10191283 | 3300005937 | Bacteria | 1541 |
| 144 | Ga0081538_10003792 | 3300005981 | Bacteria | 14138 |
| 145 | Ga0081540_1015731 | 3300005983 | Bacteria | 4774 |
| 146 | Ga0081539_10000088 | 3300005985 | Bacteria | 212765 |
| 147 | Ga0081539_10010756 | 3300005985 | Bacteria | 7370 |
| 148 | Ga0081539_10014942 | 3300005985 | Bacteria | 5696 |
| 149 | Ga0070717_10001768 | 3300006028 | Bacteria | 15061 |
| 150 | Ga0075432_10074820 | 3300006058 | Bacteria | 1221 |
| 151 | Ga0070715_10016808 | 3300006163 | Bacteria | 2757 |
| 152 | Ga0070715_10037142 | 3300006163 | Bacteria | 2014 |
| 153 | Ga0070716_100027660 | 3300006173 | Bacteria | 3049 |
| 154 | Ga0070716_100128194 | 3300006173 | Bacteria | 1600 |
| 155 | Ga0070712_100000857 | 3300006175 | Bacteria | 18124 |
| 156 | Ga0070712_100002008 | 3300006175 | Bacteria | 12454 |
| 157 | Ga0070712_100005778 | 3300006175 | Bacteria | 7646 |
| 158 | Ga0070712_100032393 | 3300006175 | Bacteria | 3530 |
| 159 | Ga0070712_100311899 | 3300006175 | Bacteria | 1276 |
| 160 | Ga0097621_100002691 | 3300006237 | Bacteria | 12162 |
| 161 | Ga0097621_100096597 | 3300006237 | Bacteria | 2479 |
| 162 | Ga0097621_100105169 | 3300006237 | Bacteria | 2379 |
| 163 | Ga0097621_100253166 | 3300006237 | Bacteria | 1543 |
| 164 | Ga0097621_100273735 | 3300006237 | Bacteria | 1484 |
| 165 | Ga0097621_100285408 | 3300006237 | Bacteria | 1454 |
| 166 | Ga0068871_100000441 | 3300006358 | Bacteria | 28558 |
| 167 | Ga0075428_100035407 | 3300006844 | Bacteria | 5504 |
| 168 | Ga0075430_100004272 | 3300006846 | Bacteria | 12064 |
| 169 | Ga0075431_100000246 | 3300006847 | Bacteria | 41024 |
| 170 | Ga0075434_100268939 | 3300006871 | Bacteria | 1724 |
| 171 | Ga0075429_100012310 | 3300006880 | Bacteria | 7421 |
| 172 | Ga0068865_100050725 | 3300006881 | Bacteria | 2869 |
| 173 | Ga0097620_100012221 | 3300006931 | Bacteria | 8633 |
| 174 | Ga0097620_100072089 | 3300006931 | Bacteria | 3490 |
| 175 | Ga0075435_100204846 | 3300007076 | Bacteria | 1672 |
| 176 | Ga0105240_10003191 | 3300009093 | Bacteria | 25758 |
| 177 | Ga0105240_10008429 | 3300009093 | Bacteria | 14744 |
| 178 | Ga0105240_10112845 | 3300009093 | Bacteria | 3285 |
| 179 | Ga0105240_10114744 | 3300009093 | Bacteria | 3253 |
| 180 | Ga0105240_10225314 | 3300009093 | Bacteria | 2182 |
| 181 | Ga0111539_10282739 | 3300009094 | Bacteria | 1931 |
| 182 | Ga0105245_10108272 | 3300009098 | Bacteria | 2581 |
| 183 | Ga0105245_10484483 | 3300009098 | Bacteria | 1251 |
| 184 | Ga0105247_10016208 | 3300009101 | Bacteria | 4464 |
| 185 | Ga0105247_10048283 | 3300009101 | Bacteria | 2614 |
| 186 | Ga0114129_10071725 | 3300009147 | Bacteria | 4829 |
| 187 | Ga0114129_10146388 | 3300009147 | Bacteria | 3236 |
| 188 | Ga0105243_10001423 | 3300009148 | Bacteria | 21119 |
| 189 | Ga0105243_10265626 | 3300009148 | Bacteria | 1538 |
| 190 | Ga0105243_10442499 | 3300009148 | Bacteria | 1217 |
| 191 | Ga0105242_10014847 | 3300009176 | Bacteria | 6033 |
| 192 | Ga0105242_10487479 | 3300009176 | Bacteria | 1170 |
| 193 | Ga0105248_10076303 | 3300009177 | Bacteria | 3767 |
| 194 | Ga0105248_10157421 | 3300009177 | Bacteria | 2563 |
| 195 | Ga0105237_10015775 | 3300009545 | Bacteria | 7855 |
| 196 | Ga0105237_10219850 | 3300009545 | Bacteria | 1900 |
| 197 | Ga0105238_10103043 | 3300009551 | Bacteria | 2835 |
| 198 | Ga0105238_10196808 | 3300009551 | Bacteria | 1991 |
| 199 | Ga0105249_10020648 | 3300009553 | Bacteria | 5889 |
| 200 | Ga0105249_10237956 | 3300009553 | Bacteria | 1799 |
| 201 | Ga0105239_10349985 | 3300010375 | Bacteria | 1668 |
| 202 | Ga0105246_10126614 | 3300011119 | Bacteria | 1901 |
| 203 | Ga0157370_10294574 | 3300013104 | Bacteria | 1498 |
| 204 | Ga0157374_10002622 | 3300013296 | Bacteria | 15177 |
| 205 | Ga0157374_10039357 | 3300013296 | Bacteria | 4350 |
| 206 | Ga0157374_10079732 | 3300013296 | Bacteria | 3103 |
| 207 | Ga0157378_10005666 | 3300013297 | Bacteria | 10930 |
| 208 | Ga0157378_10017414 | 3300013297 | Bacteria | 6306 |
| 209 | Ga0157378_10090568 | 3300013297 | Bacteria | 2779 |
| 210 | Ga0163162_10007612 | 3300013306 | Bacteria | 10545 |
| 211 | Ga0163162_10017857 | 3300013306 | Bacteria | 6942 |
| 212 | Ga0163162_10077622 | 3300013306 | Bacteria | 3385 |
| 213 | Ga0157372_10085188 | 3300013307 | Bacteria | 3584 |
| 214 | Ga0157372_10236241 | 3300013307 | Bacteria | 2120 |
| 215 | Ga0157375_10000790 | 3300013308 | Bacteria | 27678 |
| 216 | Ga0163163_10037985 | 3300014325 | Bacteria | 4688 |
| 217 | Ga0157377_10019570 | 3300014745 | Bacteria | 3537 |
| 218 | Ga0197907_10306840 | 3300020069 | Bacteria | 2447 |
| 219 | Ga0197907_10822851 | 3300020069 | Bacteria | 1472 |
| 220 | Ga0197907_11228897 | 3300020069 | Bacteria | 5249 |
| 221 | Ga0206356_11137496 | 3300020070 | Bacteria | 1813 |
| 222 | Ga0206356_11667153 | 3300020070 | Bacteria | 5045 |
| 223 | Ga0206349_1310841 | 3300020075 | Bacteria | 1707 |
| 224 | Ga0206349_1374472 | 3300020075 | Bacteria | 2654 |
| 225 | Ga0206349_1892354 | 3300020075 | Bacteria | 4727 |
| 226 | Ga0206355_1362144 | 3300020076 | Bacteria | 2016 |
| 227 | Ga0206355_1376396 | 3300020076 | Bacteria | 4699 |
| 228 | Ga0206351_10102578 | 3300020077 | Bacteria | 2430 |
| 229 | Ga0206351_10762080 | 3300020077 | Bacteria | 2503 |
| 230 | Ga0206352_10063385 | 3300020078 | Bacteria | 1929 |
| 231 | Ga0206352_10114043 | 3300020078 | Bacteria | 2403 |
| 232 | Ga0206352_10477907 | 3300020078 | Bacteria | 2449 |
| 233 | Ga0206352_10958369 | 3300020078 | Bacteria | 1630 |
| 234 | Ga0206350_10064510 | 3300020080 | Bacteria | 1623 |
| 235 | Ga0206350_10198345 | 3300020080 | Bacteria | 1931 |
| 236 | Ga0206350_10605904 | 3300020080 | Bacteria | 1943 |
| 237 | Ga0206350_10848210 | 3300020080 | Bacteria | 5223 |
| 238 | Ga0206350_11394896 | 3300020080 | Bacteria | 2114 |
| 239 | Ga0206354_10172340 | 3300020081 | Bacteria | 4380 |
| 240 | Ga0206353_12033768 | 3300020082 | Bacteria | 1900 |
| 241 | Ga0213872_10005912 | 3300021361 | Bacteria | 6209 |
| 242 | Ga0213872_10006901 | 3300021361 | Bacteria | 5649 |
| 243 | Ga0213872_10025674 | 3300021361 | Bacteria | 2708 |
| 244 | Ga0213872_10029387 | 3300021361 | Bacteria | 2520 |
| 245 | Ga0213874_10001273 | 3300021377 | Bacteria | 5213 |
| 246 | Ga0213874_10001754 | 3300021377 | Bacteria | 4556 |
| 247 | Ga0213874_10053491 | 3300021377 | Bacteria | 1246 |
| 248 | Ga0213876_10000054 | 3300021384 | Bacteria | 136221 |
| 249 | Ga0213876_10005349 | 3300021384 | Bacteria | 7063 |
| 250 | Ga0213876_10006089 | 3300021384 | Bacteria | 6592 |
| 251 | Ga0213876_10032620 | 3300021384 | Bacteria | 2746 |
| 252 | Ga0213876_10064400 | 3300021384 | Bacteria | 1935 |
| 253 | Ga0224712_10003403 | 3300022467 | Bacteria | 4130 |
| 254 | Ga0224712_10040881 | 3300022467 | Bacteria | 1747 |
| 255 | Ga0228598_1000900 | 3300024227 | Bacteria | 6430 |
| 256 | Ga0207697_10006543 | 3300025315 | Bacteria | 5259 |
| 257 | Ga0207656_10007333 | 3300025321 | Bacteria | 4010 |
| 258 | Ga0207682_10039552 | 3300025893 | Bacteria | 1918 |
| 259 | Ga0207642_10024014 | 3300025899 | Bacteria | 2445 |
| 260 | Ga0207710_10013532 | 3300025900 | Bacteria | 3433 |
| 261 | Ga0207710_10126252 | 3300025900 | Bacteria | 1226 |
| 262 | Ga0207688_10010377 | 3300025901 | Bacteria | 5069 |
| 263 | Ga0207680_10003756 | 3300025903 | Bacteria | 7145 |
| 264 | Ga0207680_10029229 | 3300025903 | Bacteria | 3094 |
| 265 | Ga0207680_10131200 | 3300025903 | Bacteria | 1652 |
| 266 | Ga0207680_10142825 | 3300025903 | Bacteria | 1588 |
| 267 | Ga0207647_10002566 | 3300025904 | Bacteria | 13736 |
| 268 | Ga0207685_10007850 | 3300025905 | Bacteria | 3003 |
| 269 | Ga0207699_10011051 | 3300025906 | Bacteria | 4548 |
| 270 | Ga0207699_10011440 | 3300025906 | Bacteria | 4481 |
| 271 | Ga0207645_10003683 | 3300025907 | Bacteria | 11558 |
| 272 | Ga0207645_10029315 | 3300025907 | Bacteria | 3549 |
| 273 | Ga0207645_10065454 | 3300025907 | Bacteria | 2323 |
| 274 | Ga0207643_10015952 | 3300025908 | Bacteria | 4091 |
| 275 | Ga0207643_10159495 | 3300025908 | Bacteria | 1356 |
| 276 | Ga0207705_10022733 | 3300025909 | Bacteria | 4472 |
| 277 | Ga0207684_10074822 | 3300025910 | Bacteria | 2878 |
| 278 | Ga0207654_10003318 | 3300025911 | Bacteria | 8143 |
| 279 | Ga0207654_10014276 | 3300025911 | Bacteria | 4103 |
| 280 | Ga0207707_10002321 | 3300025912 | Bacteria | 17133 |
| 281 | Ga0207707_10007725 | 3300025912 | Bacteria | 9361 |
| 282 | Ga0207707_10070124 | 3300025912 | Bacteria | 3054 |
| 283 | Ga0207707_10081084 | 3300025912 | Bacteria | 2833 |
| 284 | Ga0207695_10020079 | 3300025913 | Bacteria | 7666 |
| 285 | Ga0207695_10023568 | 3300025913 | Bacteria | 6949 |
| 286 | Ga0207695_10180752 | 3300025913 | Bacteria | 2030 |
| 287 | Ga0207695_10209941 | 3300025913 | Bacteria | 1858 |
| 288 | Ga0207693_10000562 | 3300025915 | Bacteria | 33548 |
| 289 | Ga0207693_10001341 | 3300025915 | Bacteria | 21738 |
| 290 | Ga0207693_10010151 | 3300025915 | Bacteria | 7649 |
| 291 | Ga0207693_10023140 | 3300025915 | Bacteria | 4934 |
| 292 | Ga0207693_10072341 | 3300025915 | Bacteria | 2700 |
| 293 | Ga0207693_10105421 | 3300025915 | Bacteria | 2211 |
| 294 | Ga0207663_10002120 | 3300025916 | Bacteria | 9461 |
| 295 | Ga0207663_10026921 | 3300025916 | Bacteria | 3344 |
| 296 | Ga0207663_10170320 | 3300025916 | Bacteria | 1546 |
| 297 | Ga0207660_10001024 | 3300025917 | Bacteria | 18502 |
| 298 | Ga0207660_10190346 | 3300025917 | Bacteria | 1597 |
| 299 | Ga0207662_10015642 | 3300025918 | Bacteria | 4271 |
| 300 | Ga0207662_10084587 | 3300025918 | Bacteria | 1941 |
| 301 | Ga0207657_10004939 | 3300025919 | Bacteria | 14024 |
| 302 | Ga0207657_10059034 | 3300025919 | Bacteria | 3299 |
| 303 | Ga0207649_10012718 | 3300025920 | Bacteria | 4678 |
| 304 | Ga0207649_10168040 | 3300025920 | Bacteria | 1525 |
| 305 | Ga0207649_10174606 | 3300025920 | Bacteria | 1500 |
| 306 | Ga0207652_10005227 | 3300025921 | Bacteria | 10547 |
| 307 | Ga0207652_10076551 | 3300025921 | Bacteria | 2918 |
| 308 | Ga0207652_10102178 | 3300025921 | Bacteria | 2533 |
| 309 | Ga0207652_10304107 | 3300025921 | Bacteria | 1439 |
| 310 | Ga0207646_10030431 | 3300025922 | Bacteria | 4894 |
| 311 | Ga0207681_10005051 | 3300025923 | Bacteria | 8112 |
| 312 | Ga0207681_10013266 | 3300025923 | Bacteria | 5096 |
| 313 | Ga0207681_10024386 | 3300025923 | Bacteria | 3882 |
| 314 | Ga0207681_10041489 | 3300025923 | Bacteria | 3068 |
| 315 | Ga0207650_10022881 | 3300025925 | Bacteria | 4427 |
| 316 | Ga0207659_10040062 | 3300025926 | Bacteria | 3273 |
| 317 | Ga0207659_10049747 | 3300025926 | Bacteria | 2974 |
| 318 | Ga0207687_10003506 | 3300025927 | Bacteria | 10555 |
| 319 | Ga0207687_10062714 | 3300025927 | Bacteria | 2630 |
| 320 | Ga0207700_10000792 | 3300025928 | Bacteria | 18262 |
| 321 | Ga0207700_10012001 | 3300025928 | Bacteria | 5560 |
| 322 | Ga0207700_10033679 | 3300025928 | Bacteria | 3668 |
| 323 | Ga0207700_10055263 | 3300025928 | Bacteria | 2984 |
| 324 | Ga0207700_10074046 | 3300025928 | Bacteria | 2633 |
| 325 | Ga0207700_10259486 | 3300025928 | Bacteria | 1487 |
| 326 | Ga0207700_10263742 | 3300025928 | Bacteria | 1476 |
| 327 | Ga0207664_10073500 | 3300025929 | Bacteria | 2759 |
| 328 | Ga0207664_10094196 | 3300025929 | Bacteria | 2461 |
| 329 | Ga0207664_10115846 | 3300025929 | Bacteria | 2235 |
| 330 | Ga0207644_10004127 | 3300025931 | Bacteria | 9417 |
| 331 | Ga0207644_10076952 | 3300025931 | Bacteria | 2456 |
| 332 | Ga0207644_10171372 | 3300025931 | Bacteria | 1694 |
| 333 | Ga0207644_10224919 | 3300025931 | Bacteria | 1489 |
| 334 | Ga0207690_10150022 | 3300025932 | Bacteria | 1727 |
| 335 | Ga0207706_10000597 | 3300025933 | Bacteria | 38406 |
| 336 | Ga0207706_10004944 | 3300025933 | Bacteria | 12452 |
| 337 | Ga0207706_10169391 | 3300025933 | Bacteria | 1919 |
| 338 | Ga0207709_10001174 | 3300025935 | Bacteria | 18974 |
| 339 | Ga0207670_10041589 | 3300025936 | Bacteria | 3023 |
| 340 | Ga0207670_10225513 | 3300025936 | Bacteria | 1437 |
| 341 | Ga0207669_10075374 | 3300025937 | Bacteria | 2137 |
| 342 | Ga0207704_10011848 | 3300025938 | Bacteria | 4310 |
| 343 | Ga0207704_10015792 | 3300025938 | Bacteria | 3860 |
| 344 | Ga0207665_10012351 | 3300025939 | Bacteria | 5611 |
| 345 | Ga0207665_10032649 | 3300025939 | Bacteria | 3447 |
| 346 | Ga0207665_10038369 | 3300025939 | Bacteria | 3189 |
| 347 | Ga0207665_10176668 | 3300025939 | Bacteria | 1545 |
| 348 | Ga0207691_10020159 | 3300025940 | Bacteria | 6306 |
| 349 | Ga0207691_10053508 | 3300025940 | Bacteria | 3685 |
| 350 | Ga0207691_10085140 | 3300025940 | Bacteria | 2837 |
| 351 | Ga0207691_10090337 | 3300025940 | Bacteria | 2746 |
| 352 | Ga0207691_10280038 | 3300025940 | Bacteria | 1435 |
| 353 | Ga0207711_10001240 | 3300025941 | Bacteria | 24199 |
| 354 | Ga0207711_10286180 | 3300025941 | Bacteria | 1518 |
| 355 | Ga0207689_10024608 | 3300025942 | Bacteria | 5049 |
| 356 | Ga0207661_10173655 | 3300025944 | Bacteria | 1877 |
| 357 | Ga0207679_10026928 | 3300025945 | Bacteria | 3970 |
| 358 | Ga0207667_10003400 | 3300025949 | Bacteria | 19645 |
| 359 | Ga0207667_10065273 | 3300025949 | Bacteria | 3797 |
| 360 | Ga0207667_10363929 | 3300025949 | Bacteria | 1475 |
| 361 | Ga0207651_10014155 | 3300025960 | Bacteria | 4596 |
| 362 | Ga0207651_10018241 | 3300025960 | Bacteria | 4170 |
| 363 | Ga0207651_10019188 | 3300025960 | Bacteria | 4090 |
| 364 | Ga0207651_10075051 | 3300025960 | Bacteria | 2411 |
| 365 | Ga0207651_10287126 | 3300025960 | Bacteria | 1362 |
| 366 | Ga0207712_10005929 | 3300025961 | Bacteria | 7703 |
| 367 | Ga0207668_10019796 | 3300025972 | Bacteria | 4262 |
| 368 | Ga0207668_10223899 | 3300025972 | Bacteria | 1512 |
| 369 | Ga0207658_10005680 | 3300025986 | Bacteria | 8530 |
| 370 | Ga0207658_10168095 | 3300025986 | Bacteria | 1804 |
| 371 | Ga0207658_10251998 | 3300025986 | Bacteria | 1500 |
| 372 | Ga0207658_10279625 | 3300025986 | Bacteria | 1430 |
| 373 | Ga0207658_10300674 | 3300025986 | Bacteria | 1382 |
| 374 | Ga0207677_10004150 | 3300026023 | Bacteria | 7753 |
| 375 | Ga0207677_10007511 | 3300026023 | Bacteria | 6039 |
| 376 | Ga0207677_10019907 | 3300026023 | Bacteria | 4062 |
| 377 | Ga0207677_10088475 | 3300026023 | Bacteria | 2246 |
| 378 | Ga0207677_10213879 | 3300026023 | Bacteria | 1542 |
| 379 | Ga0207703_10080824 | 3300026035 | Bacteria | 2708 |
| 380 | Ga0207703_10247343 | 3300026035 | Bacteria | 1606 |
| 381 | Ga0207678_10002015 | 3300026067 | Bacteria | 18458 |
| 382 | Ga0207708_10001541 | 3300026075 | Bacteria | 17185 |
| 383 | Ga0207708_10052806 | 3300026075 | Bacteria | 3096 |
| 384 | Ga0207702_10050447 | 3300026078 | Bacteria | 3514 |
| 385 | Ga0207702_10086198 | 3300026078 | Bacteria | 2738 |
| 386 | Ga0207641_10068656 | 3300026088 | Bacteria | 3040 |
| 387 | Ga0207641_10189804 | 3300026088 | Bacteria | 1888 |
| 388 | Ga0207641_10206861 | 3300026088 | Bacteria | 1813 |
| 389 | Ga0207648_10027497 | 3300026089 | Bacteria | 5049 |
| 390 | Ga0207648_10036307 | 3300026089 | Bacteria | 4341 |
| 391 | Ga0207648_10329340 | 3300026089 | Bacteria | 1373 |
| 392 | Ga0207676_10013312 | 3300026095 | Bacteria | 5909 |
| 393 | Ga0207676_10199426 | 3300026095 | Bacteria | 1767 |
| 394 | Ga0207676_10422769 | 3300026095 | Bacteria | 1250 |
| 395 | Ga0207674_10024448 | 3300026116 | Bacteria | 6455 |
| 396 | Ga0207675_100014879 | 3300026118 | Bacteria | 7262 |
| 397 | Ga0207675_100104255 | 3300026118 | Bacteria | 2673 |
| 398 | Ga0207683_10010450 | 3300026121 | Bacteria | 7920 |
| 399 | Ga0207683_10044524 | 3300026121 | Bacteria | 3880 |
| 400 | Ga0207698_10066977 | 3300026142 | Bacteria | 2830 |
| 401 | Ga0207698_10134264 | 3300026142 | Bacteria | 2120 |
| 402 | Ga0268266_10002775 | 3300028379 | Bacteria | 18285 |
| 403 | Ga0268266_10003104 | 3300028379 | Bacteria | 16927 |
| 404 | Ga0268266_10010139 | 3300028379 | Bacteria | 8257 |
| 405 | Ga0268266_10044373 | 3300028379 | Bacteria | 3801 |
| 406 | Ga0268266_10044455 | 3300028379 | Bacteria | 3796 |
| 407 | Ga0268266_10048888 | 3300028379 | Bacteria | 3626 |
| 408 | Ga0268266_10139900 | 3300028379 | Bacteria | 2171 |
| 409 | Ga0268266_10214386 | 3300028379 | Bacteria | 1767 |
| 410 | Ga0268265_10112550 | 3300028380 | Bacteria | 2225 |
| 411 | Ga0268264_10040981 | 3300028381 | Bacteria | 3827 |
| 412 | Ga0268264_10083282 | 3300028381 | Bacteria | 2740 |
| 413 | Ga0268264_10276274 | 3300028381 | Bacteria | 1571 |
| 414 | Ga0265760_10007153 | 3300031090 | Bacteria | 3198 |
| 415 | Ga0307408_100025250 | 3300031548 | Bacteria | 4068 |
| 416 | Ga0307514_10139988 | 3300031649 | Bacteria | 1647 |
| 417 | Ga0307412_10165067 | 3300031911 | Bacteria | 1650 |
| 418 | Ga0307416_100044811 | 3300032002 | Bacteria | 3477 |
| 419 | Ga0373950_0000007 | 3300034818 | Bacteria | 392070 |
| 420 | Ga0373926_0011667 | 3300035083 | Bacteria | 2961 |
| 421 | Ga0373923_0059029 | 3300035111 | Bacteria | 1625 |
| 422 | Ga0373932_0039345 | 3300035112 | Bacteria | 1356 |
| 423 | Ga0373939_0022479 | 3300035114 | Bacteria | 1738 |
| 424 | Ga0373945_0015272 | 3300035116 | Bacteria | 2581 |
| 425 | Ga0373953_0093178 | 3300035117 | Bacteria | 1262 |
| 426 | Ga0373954_0075395 | 3300035118 | Bacteria | 1606 |
| 427 | Ga0373957_0009274 | 3300035120 | Bacteria | 3216 |
| 428 | Ga0373943_0014349 | 3300035170 | Bacteria | 3586 |
| 429 | Ga0373946_0036930 | 3300035171 | Bacteria | 1984 |
| 430 | Ga0373935_0019993 | 3300035692 | Bacteria | 4087 |
| 431 | Ga0373935_0032029 | 3300035692 | Bacteria | 3266 |
| 432 | Ga0373935_0033091 | 3300035692 | Bacteria | 3216 |
| 433 | Ga0373935_0041340 | 3300035692 | Bacteria | 2896 |
| 434 | Ga0373935_0212465 | 3300035692 | Bacteria | 1341 |
| 435 | Ga0373927_0001944 | 3300035695 | Bacteria | 15263 |
| 436 | Ga0373927_0007276 | 3300035695 | Bacteria | 7505 |
| 437 | Ga0373927_0094386 | 3300035695 | Bacteria | 1944 |
| 438 | Ga0373933_0071961 | 3300035724 | Bacteria | 2105 |
| 439 | Ga0373947_0004634 | 3300035725 | Bacteria | 8063 |
| 440 | Ga0373947_0036136 | 3300035725 | Bacteria | 2928 |
| 441 | Ga0373947_0065780 | 3300035725 | Bacteria | 2212 |
| 442 | Ga0373947_0134289 | 3300035725 | Bacteria | 1582 |
| 443 | Ga0373947_0189278 | 3300035725 | Bacteria | 1342 |
| 444 | Ga0373937_0214656 | 3300036401 | Bacteria | 1811 |
| 445 | Ga0373925_0021355 | 3300037068 | Bacteria | 4716 |
| 446 | Ga0373925_0035322 | 3300037068 | Bacteria | 3687 |
| 447 | Ga0373925_0056088 | 3300037068 | Bacteria | 2950 |
| 448 | Ga0373925_0069171 | 3300037068 | Bacteria | 2666 |
| 449 | Ga0373925_0112805 | 3300037068 | Bacteria | 2102 |
| 450 | Ga0373925_0169855 | 3300037068 | Bacteria | 1721 |
| 451 | Ga0395900_0169022 | 3300037418 | Bacteria | 2227 |
| 452 | Ga0395898_0026787 | 3300037466 | Bacteria | 5795 |
| 453 | Ga0395898_0224191 | 3300037466 | Bacteria | 1793 |
| 454 | Ga0395905_0213364 | 3300037471 | Bacteria | 1808 |
| 455 | Ga0436364_0197022 | 3300037853 | Bacteria | 80312 |
| 456 | Ga0436364_0691152 | 3300037853 | Bacteria | 1899 |
| 457 | Ga0436364_0758998 | 3300037853 | Bacteria | 29208 |
| 458 | Ga0436364_0824275 | 3300037853 | Bacteria | 2185 |
| 459 | Ga0436365_0085705 | 3300039437 | Bacteria | 122339 |
| 460 | Ga0436365_0872846 | 3300039437 | Bacteria | 18578 |
| 461 | Ga0436365_1172381 | 3300039437 | Bacteria | 6313 |
| 462 | Ga0436365_1311096 | 3300039437 | Bacteria | 2049 |
| 463 | Ga0436365_1825198 | 3300039437 | Bacteria | 1412 |
| 464 | Ga0436365_1910425 | 3300039437 | Bacteria | 4393 |
| 465 | Ga0436360_0022428 | 3300039438 | Bacteria | 7066 |
| 466 | Ga0436360_0614395 | 3300039438 | Bacteria | 1722 |
| 467 | Ga0436361_0029161 | 3300039447 | Bacteria | 3994 |
| 468 | Ga0436361_0169046 | 3300039447 | Bacteria | 26611 |
| 469 | Ga0436361_0234000 | 3300039447 | Bacteria | 5067 |
| 470 | Ga0436361_0421938 | 3300039447 | Bacteria | 11573 |
| 471 | Ga0436361_0562516 | 3300039447 | Bacteria | 6196 |
| 472 | Ga0436361_0729433 | 3300039447 | Bacteria | 3424 |
| 473 | Ga0436363_0411683 | 3300039450 | Bacteria | 1514 |
| 474 | Ga0436363_0764282 | 3300039450 | Bacteria | 987 |
| 475 | Ga0436363_1139504 | 3300039450 | Bacteria | 7698 |
| 476 | Ga0436363_1210094 | 3300039450 | Bacteria | 4092 |
| 477 | Ga0436363_1705626 | 3300039450 | Bacteria | 9003 |
| 478 | Ga0436362_0427516 | 3300039453 | Bacteria | 3271 |
| 479 | Ga0436362_1166284 | 3300039453 | Bacteria | 2708 |
| 480 | Ga0436362_1210598 | 3300039453 | Bacteria | 2946 |
| 481 | Ga0466969_0002682 | 3300044656 | Bacteria | 9513 |
| 482 | Ga0466966_0011342 | 3300044684 | Bacteria | 5910 |
| 483 | Ga0466961_0025893 | 3300044693 | Bacteria | 3771 |
| 484 | Ga0466961_0039498 | 3300044693 | Bacteria | 3025 |
| 485 | Ga0466963_0000160 | 3300044694 | Bacteria | 27157 |
| 486 | Ga0466963_0002410 | 3300044694 | Bacteria | 10462 |
| 487 | Ga0466963_0051846 | 3300044694 | Bacteria | 2721 |
| 488 | Ga0466971_0017781 | 3300044719 | Bacteria | 3149 |
| 489 | Ga0466968_0025059 | 3300044735 | Bacteria | 2441 |
| 490 | Ga0466957_0000828 | 3300044842 | Bacteria | 15799 |
| 491 | Ga0466957_0003254 | 3300044842 | Bacteria | 8890 |
| 492 | Ga0466960_0004308 | 3300044901 | Bacteria | 5548 |
| 493 | Ga0466959_0013891 | 3300045049 | Bacteria | 5846 |
| 494 | Ga0466959_0134247 | 3300045049 | Bacteria | 1753 |
| 495 | Ga0451576_0160954 | 3300045051 | Bacteria | 2343 |
| 496 | Ga0451576_0178703 | 3300045051 | Bacteria | 2216 |
| 497 | Ga0466958_0009345 | 3300045836 | Bacteria | 5463 |
| 498 | Ga0466958_0011726 | 3300045836 | Bacteria | 4946 |
| 499 | Ga0466958_0040318 | 3300045836 | Bacteria | 2807 |
| 500 | Ga0466967_0021082 | 3300045976 | Bacteria | 5281 |
| 501 | Ga0466967_0128385 | 3300045976 | Bacteria | 2350 |
| 502 | Ga0466967_0199175 | 3300045976 | Bacteria | 1896 |
| 503 | Ga0495629_0050230 | 3300046459 | Bacteria | 2921 |
| 504 | Ga0495653_0003430 | 3300046463 | Bacteria | 12747 |
| 505 | Ga0495580_0004707 | 3300046472 | Bacteria | 11443 |
| 506 | Ga0495580_0052089 | 3300046472 | Bacteria | 2892 |
| 507 | Ga0495582_0006536 | 3300046473 | Bacteria | 6470 |
| 508 | Ga0495582_0076021 | 3300046473 | Bacteria | 1861 |
| 509 | Ga0495582_0149342 | 3300046473 | Bacteria | 1326 |
| 510 | Ga0495664_0055757 | 3300046477 | Bacteria | 2351 |
| 511 | Ga0495664_0078175 | 3300046477 | Bacteria | 1982 |
| 512 | Ga0495608_0003788 | 3300046511 | Bacteria | 10864 |
| 513 | Ga0495608_0005638 | 3300046511 | Bacteria | 8937 |
| 514 | Ga0495630_0102751 | 3300046517 | Bacteria | 2162 |
| 515 | Ga0495652_0016044 | 3300046529 | Bacteria | 6702 |
| 516 | Ga0495665_0000696 | 3300046531 | Bacteria | 17287 |
| 517 | Ga0495598_0014625 | 3300046537 | Bacteria | 1966 |
| 518 | Ga0495645_0183413 | 3300046543 | Bacteria | 1432 |
| 519 | Ga0495657_0021903 | 3300046675 | Bacteria | 4582 |
| 520 | Ga0495623_0040587 | 3300046679 | Bacteria | 2971 |
| 521 | Ga0495646_0001675 | 3300046680 | Bacteria | 13261 |
| 522 | Ga0495658_0072778 | 3300046683 | Bacteria | 2000 |
| 523 | Ga0495613_0029946 | 3300046689 | Bacteria | 4044 |
| 524 | Ga0495624_0005371 | 3300046690 | Bacteria | 9243 |
| 525 | Ga0495604_0008626 | 3300047317 | Bacteria | 8057 |
| 526 | Ga0495604_0052018 | 3300047317 | Bacteria | 3173 |
| 527 | Ga0495604_0072115 | 3300047317 | Bacteria | 2611 |
| 528 | Ga0495674_0099487 | 3300047319 | Bacteria | 2475 |
| 529 | Ga0495674_0116027 | 3300047319 | Bacteria | 2265 |
| 530 | Ga0495674_0148153 | 3300047319 | Bacteria | 1969 |
| 531 | Ga0495675_0001996 | 3300047444 | Bacteria | 12190 |
| 532 | Ga0495675_0117099 | 3300047444 | Bacteria | 1661 |
| 533 | Ga0495684_0013604 | 3300047471 | Bacteria | 6266 |
| 534 | Ga0496100_0021627 | 3300048903 | Bacteria | 3878 |
| 535 | Ga0496100_0094832 | 3300048903 | Bacteria | 2044 |
| 536 | Ga0496101_0011418 | 3300048904 | Bacteria | 5892 |
| 537 | Ga0496101_0021283 | 3300048904 | Bacteria | 4455 |
| 538 | Ga0496101_0082938 | 3300048904 | Bacteria | 2372 |
| 539 | Ga0496101_0088043 | 3300048904 | Bacteria | 2306 |
| 540 | Ga0496102_0039941 | 3300048905 | Bacteria | 4242 |
| 541 | Ga0496102_0041673 | 3300048905 | Bacteria | 4159 |
| 542 | Ga0496102_0124838 | 3300048905 | Bacteria | 2405 |
| 543 | Ga0496102_0161856 | 3300048905 | Bacteria | 2105 |
| 544 | Ga0496102_0195652 | 3300048905 | Bacteria | 1905 |
| 545 | Ga0496102_0422311 | 3300048905 | Bacteria | 1252 |
| 546 | Ga0496103_0026769 | 3300048906 | Bacteria | 3490 |
| 547 | Ga0496103_0027895 | 3300048906 | Bacteria | 3425 |
| 548 | Ga0496103_0042908 | 3300048906 | Bacteria | 2784 |
| 549 | Ga0496104_0087329 | 3300048907 | Bacteria | 2978 |
| 550 | Ga0496105_0036358 | 3300048908 | Bacteria | 4057 |
| 551 | Ga0496105_0070802 | 3300048908 | Bacteria | 2883 |
| 552 | Ga0496106_0068836 | 3300048909 | Bacteria | 2700 |
| 553 | Ga0496106_0136207 | 3300048909 | Bacteria | 1929 |
| 554 | Ga0496106_0320962 | 3300048909 | Bacteria | 1243 |
| 555 | Ga0496107_0003168 | 3300048910 | Bacteria | 10935 |
| 556 | Ga0496107_0035325 | 3300048910 | Bacteria | 3584 |
| 557 | Ga0496107_0139628 | 3300048910 | Bacteria | 1791 |
| 558 | Ga0496108_0005312 | 3300048911 | Bacteria | 10400 |
| 559 | Ga0496108_0040535 | 3300048911 | Bacteria | 3882 |
| 560 | Ga0496108_0104006 | 3300048911 | Bacteria | 2423 |
| 561 | Ga0496109_0001856 | 3300048912 | Bacteria | 17498 |
| 562 | Ga0496109_0106734 | 3300048912 | Bacteria | 2601 |
| 563 | Ga0496110_0244341 | 3300048913 | Bacteria | 1633 |
| 564 | Ga0496111_0014249 | 3300048914 | Bacteria | 5426 |
| 565 | Ga0496112_0067200 | 3300048915 | Bacteria | 3538 |
| 566 | Ga0496112_0081474 | 3300048915 | Bacteria | 3200 |
| 567 | Ga0496113_0000866 | 3300048916 | Bacteria | 15852 |
| 568 | Ga0496113_0034018 | 3300048916 | Bacteria | 3715 |
| 569 | Ga0496113_0254545 | 3300048916 | Bacteria | 1402 |
| 570 | Ga0496114_0003270 | 3300048917 | Bacteria | 12439 |
| 571 | Ga0496114_0015215 | 3300048917 | Bacteria | 6185 |
| 572 | Ga0496114_0025070 | 3300048917 | Bacteria | 4872 |
| 573 | Ga0496114_0045754 | 3300048917 | Bacteria | 3637 |
| 574 | Ga0496115_0009585 | 3300048918 | Bacteria | 7198 |
| 575 | Ga0496115_0015552 | 3300048918 | Bacteria | 5774 |
| 576 | Ga0496115_0029894 | 3300048918 | Bacteria | 4283 |
| 577 | Ga0496115_0045984 | 3300048918 | Bacteria | 3486 |
| 578 | Ga0496115_0082131 | 3300048918 | Bacteria | 2625 |
| 579 | Ga0496126_0001095 | 3300048929 | Bacteria | 45505 |
| 580 | Ga0501031_0157419 | 3300049568 | Bacteria | 1485 |
| 581 | Ga0501033_0012940 | 3300049570 | Bacteria | 6363 |
| 582 | Ga0501036_0018906 | 3300049572 | Bacteria | 5781 |
| 583 | Ga0501043_0002651 | 3300049579 | Bacteria | 15047 |
| 584 | Ga0501046_0000674 | 3300049580 | Bacteria | 33097 |
| 585 | Ga0501047_0000007 | 3300049581 | Bacteria | 443240 |
| 586 | Ga0501047_0045873 | 3300049581 | Bacteria | 4225 |
| 587 | Ga0501048_0000594 | 3300049582 | Bacteria | 25663 |
| 588 | Ga0501067_0000673 | 3300049583 | Bacteria | 18404 |
| 589 | Ga0501067_0000749 | 3300049583 | Bacteria | 17471 |
| 590 | Ga0501068_0002714 | 3300049584 | Bacteria | 9386 |
| 591 | Ga0501070_0001351 | 3300049586 | Bacteria | 21962 |
| 592 | Ga0501072_0000092 | 3300049588 | Bacteria | 65691 |
| 593 | Ga0501073_0000791 | 3300049589 | Bacteria | 22521 |
| 594 | Ga0501073_0002367 | 3300049589 | Bacteria | 14118 |
| 595 | Ga0501073_0009175 | 3300049589 | Bacteria | 7297 |
| 596 | Ga0501074_0001634 | 3300049590 | Bacteria | 15199 |
| 597 | Ga0501079_0000314 | 3300049741 | Bacteria | 30320 |
| 598 | Ga0501080_0002951 | 3300049742 | Bacteria | 14958 |
| 599 | Ga0501080_0010312 | 3300049742 | Bacteria | 8543 |
| 600 | Ga0501083_0000473 | 3300049744 | Bacteria | 25817 |
| 601 | nmdc:mga09592_54206_c1 | 3300050508 | Bacteria | 3388 |
| 602 | nmdc:mga0qj67_373246_c1 | 3300050509 | Bacteria | 1152 |
| 603 | nmdc:mga0qj67_7359_c1 | 3300050509 | Bacteria | 8136 |
| 604 | nmdc:mga06r32_515_c1 | 3300050510 | Bacteria | 33313 |
| 605 | nmdc:mga08y16_234725_c1 | 3300050511 | Bacteria | 1897 |
| 606 | nmdc:mga0n895_213442_c1 | 3300050512 | Bacteria | 1960 |
| 607 | nmdc:mga0a205_11126_c1 | 3300050515 | Bacteria | 8280 |
| 608 | nmdc:mga0a205_13679_c1 | 3300050515 | Bacteria | 7561 |
| 609 | Ga0495601_0063469 | 3300053077 | Bacteria | 2348 |
| 610 | Ga0495612_0001054 | 3300053078 | Bacteria | 11276 |
| 611 | Ga0495655_0025219 | 3300053083 | Bacteria | 1389 |
| 612 | Ga0501084_0000043 | 3300054114 | Bacteria | 98202 |
| 613 | Ga0587084_003079 | 3300059477 | Bacteria | 1801 |
| 614 | Ga0587084_010182 | 3300059477 | Bacteria | 1228 |
| 615 | Ga0587093_000820 | 3300059478 | Bacteria | 2381 |
| 616 | Ga0587093_007427 | 3300059478 | Bacteria | 1222 |
| 617 | Ga0587066_000020 | 3300059490 | Bacteria | 7166 |
| 618 | Ga0587066_000073 | 3300059490 | Bacteria | 5305 |
| 619 | Ga0587066_000288 | 3300059490 | Bacteria | 3710 |
| 620 | Ga0587066_000516 | 3300059490 | Bacteria | 3193 |
| 621 | Ga0587066_002166 | 3300059490 | Bacteria | 2121 |
| 622 | Ga0587066_014775 | 3300059490 | Bacteria | 1205 |
| 623 | Ga0587070_000045 | 3300059491 | Bacteria | 6004 |
| 624 | Ga0587070_000977 | 3300059491 | Bacteria | 2739 |
| 625 | Ga0587070_003904 | 3300059491 | Bacteria | 1838 |
| 626 | Ga0587070_009408 | 3300059491 | Bacteria | 1411 |
| 627 | Ga0587070_015368 | 3300059491 | Bacteria | 1211 |
| 628 | Ga0587073_0000029 | 3300059492 | Bacteria | 7533 |
| 629 | Ga0587073_0000109 | 3300059492 | Bacteria | 5414 |
| 630 | Ga0587073_0000410 | 3300059492 | Bacteria | 3808 |
| 631 | Ga0587073_0003580 | 3300059492 | Bacteria | 2145 |
| 632 | Ga0587073_0005921 | 3300059492 | Bacteria | 1852 |
| 633 | Ga0587073_0011407 | 3300059492 | Bacteria | 1517 |
| 634 | Ga0587073_0023047 | 3300059492 | Bacteria | 1215 |
| 635 | Ga0587077_000377 | 3300059493 | Bacteria | 3637 |
| 636 | Ga0587077_000655 | 3300059493 | Bacteria | 3164 |
| 637 | Ga0587077_000661 | 3300059493 | Bacteria | 3159 |
| 638 | Ga0587077_001519 | 3300059493 | Bacteria | 2515 |
| 639 | Ga0587077_006973 | 3300059493 | Bacteria | 1625 |
| 640 | Ga0587080_000235 | 3300059503 | Bacteria | 4062 |
| 641 | Ga0587080_000651 | 3300059503 | Bacteria | 3185 |
| 642 | Ga0587080_002781 | 3300059503 | Bacteria | 2105 |
| 643 | Ga0587080_014401 | 3300059503 | Bacteria | 1223 |
| 644 | Ga0587082_000603 | 3300059504 | Bacteria | 3166 |
| 645 | Ga0587082_000731 | 3300059504 | Bacteria | 2989 |
| 646 | Ga0587082_003022 | 3300059504 | Bacteria | 1976 |
| 647 | Ga0587082_003836 | 3300059504 | Bacteria | 1839 |
| 648 | Ga0587083_0000084 | 3300059505 | Bacteria | 5422 |
| 649 | Ga0587083_0000297 | 3300059505 | Bacteria | 3985 |
| 650 | Ga0587083_0003110 | 3300059505 | Bacteria | 2162 |
| 651 | Ga0587083_0004447 | 3300059505 | Bacteria | 1949 |
| 652 | Ga0587083_0009119 | 3300059505 | Bacteria | 1573 |
| 653 | Ga0587083_0009389 | 3300059505 | Bacteria | 1558 |
| 654 | Ga0587083_0015312 | 3300059505 | Bacteria | 1336 |
| 655 | Ga0587085_000706 | 3300059506 | Bacteria | 2685 |
| 656 | Ga0587085_000714 | 3300059506 | Bacteria | 2680 |
| 657 | Ga0587085_003102 | 3300059506 | Bacteria | 1771 |
| 658 | Ga0587085_010730 | 3300059506 | Bacteria | 1222 |
| 659 | Ga0587085_011711 | 3300059506 | Bacteria | 1190 |
| 660 | Ga0587086_000022 | 3300059507 | Bacteria | 7151 |
| 661 | Ga0587086_000034 | 3300059507 | Bacteria | 6104 |
| 662 | Ga0587086_003625 | 3300059507 | Bacteria | 1565 |
| 663 | Ga0587086_003698 | 3300059507 | Bacteria | 1556 |
| 664 | Ga0587086_007937 | 3300059507 | Bacteria | 1228 |
| 665 | Ga0587088_000156 | 3300059508 | Bacteria | 4349 |
| 666 | Ga0587088_000561 | 3300059508 | Bacteria | 3171 |
| 667 | Ga0587088_002353 | 3300059508 | Bacteria | 2136 |
| 668 | Ga0587088_005009 | 3300059508 | Bacteria | 1717 |
| 669 | Ga0587088_011149 | 3300059508 | Bacteria | 1333 |
| 670 | Ga0587088_016115 | 3300059508 | Bacteria | 1187 |
| 671 | Ga0587089_001459 | 3300059509 | Bacteria | 2210 |
| 672 | Ga0587089_009294 | 3300059509 | Bacteria | 1203 |
| 673 | Ga0587090_000190 | 3300059510 | Bacteria | 4378 |
| 674 | Ga0587090_011939 | 3300059510 | Bacteria | 1230 |
| 675 | Ga0587090_014102 | 3300059510 | Bacteria | 1165 |
| 676 | Ga0587091_000183 | 3300059511 | Bacteria | 4304 |
| 677 | Ga0587091_000639 | 3300059511 | Bacteria | 3222 |
| 678 | Ga0587091_000747 | 3300059511 | Bacteria | 3081 |
| 679 | Ga0587091_005787 | 3300059511 | Bacteria | 1704 |
| 680 | Ga0587091_012923 | 3300059511 | Bacteria | 1331 |
| 681 | Ga0587091_018407 | 3300059511 | Bacteria | 1188 |
| 682 | Ga0587092_004210 | 3300059512 | Bacteria | 1698 |
| 683 | Ga0587092_004466 | 3300059512 | Bacteria | 1670 |
| 684 | Ga0587092_005729 | 3300059512 | Bacteria | 1547 |
| 685 | Ga0587092_011635 | 3300059512 | Bacteria | 1227 |
| 686 | Ga0587094_000025 | 3300059513 | Bacteria | 6565 |
| 687 | Ga0587094_001624 | 3300059513 | Bacteria | 2170 |
| 688 | Ga0587094_003161 | 3300059513 | Bacteria | 1770 |
| 689 | Ga0587094_003689 | 3300059513 | Bacteria | 1689 |
| 690 | Ga0587094_005848 | 3300059513 | Bacteria | 1454 |
| 691 | Ga0587094_011034 | 3300059513 | Bacteria | 1184 |
| 692 | Ga0587094_011040 | 3300059513 | Bacteria | 1183 |
| 693 | Ga0587095_000119 | 3300059514 | Bacteria | 3193 |
| 694 | Ga0587095_000124 | 3300059514 | Bacteria | 3162 |
| 695 | Ga0587095_000201 | 3300059514 | Bacteria | 2699 |
| 696 | Ga0587095_001789 | 3300059514 | Bacteria | 1374 |
| 697 | Ga0587098_006621 | 3300059604 | Bacteria | 1181 |
| 698 | Ga0587106_004307 | 3300059605 | Bacteria | 1557 |
| 699 | Ga0587106_006092 | 3300059605 | Bacteria | 1407 |
| 700 | Ga0587106_008923 | 3300059605 | Bacteria | 1262 |
| 701 | Ga0587099_002764 | 3300059622 | Bacteria | 1410 |
| 702 | Ga0587099_005034 | 3300059622 | Bacteria | 1173 |
| 703 | Ga0587101_000106 | 3300059623 | Bacteria | 4078 |
| 704 | Ga0587101_000381 | 3300059623 | Bacteria | 3029 |
| 705 | Ga0587101_001002 | 3300059623 | Bacteria | 2286 |
| 706 | Ga0587101_007780 | 3300059623 | Bacteria | 1276 |
| 707 | Ga0587113_000023 | 3300059625 | Bacteria | 4794 |
| 708 | Ga0587113_000044 | 3300059625 | Bacteria | 4053 |
| 709 | Ga0587115_000052 | 3300059626 | Bacteria | 5273 |
| 710 | Ga0587115_007280 | 3300059626 | Bacteria | 1303 |
| 711 | Ga0587117_005261 | 3300059627 | Bacteria | 1391 |
| 712 | Ga0587117_006832 | 3300059627 | Bacteria | 1288 |
| 713 | Ga0587128_000024 | 3300059630 | Bacteria | 6128 |
| 714 | Ga0587128_000027 | 3300059630 | Bacteria | 6002 |
| 715 | Ga0587128_000104 | 3300059630 | Bacteria | 4337 |
| 716 | Ga0587128_003890 | 3300059630 | Bacteria | 1697 |
| 717 | Ga0587128_012214 | 3300059630 | Bacteria | 1189 |
| 718 | Ga0587130_000226 | 3300059631 | Bacteria | 3162 |
| 719 | Ga0587062_002586 | 3300059639 | Bacteria | 1742 |
| 720 | Ga0587067_001783 | 3300059640 | Bacteria | 2416 |
| 721 | Ga0587067_005170 | 3300059640 | Bacteria | 1749 |
| 722 | Ga0587067_012981 | 3300059640 | Bacteria | 1310 |
| 723 | Ga0587067_016270 | 3300059640 | Bacteria | 1219 |
| 724 | Ga0587067_017032 | 3300059640 | Bacteria | 1201 |
| 725 | Ga0587068_015362 | 3300059641 | Bacteria | 1203 |
| 726 | Ga0587069_000417 | 3300059642 | Bacteria | 3162 |
| 727 | Ga0587069_001285 | 3300059642 | Bacteria | 2256 |
| 728 | Ga0587069_001611 | 3300059642 | Bacteria | 2126 |
| 729 | Ga0587069_005740 | 3300059642 | Bacteria | 1460 |
| 730 | Ga0587069_010545 | 3300059642 | Bacteria | 1217 |
| 731 | Ga0587069_012023 | 3300059642 | Bacteria | 1167 |
| 732 | Ga0587072_008887 | 3300059643 | Bacteria | 1598 |
| 733 | Ga0587072_014599 | 3300059643 | Bacteria | 1325 |
| 734 | Ga0587072_018846 | 3300059643 | Bacteria | 1203 |
| 735 | Ga0587075_000017 | 3300059644 | Bacteria | 7163 |
| 736 | Ga0587075_000918 | 3300059644 | Bacteria | 2651 |
| 737 | Ga0587075_001008 | 3300059644 | Bacteria | 2579 |
| 738 | Ga0587075_004239 | 3300059644 | Bacteria | 1654 |
| 739 | Ga0587075_010106 | 3300059644 | Bacteria | 1242 |
| 740 | Ga0587075_010404 | 3300059644 | Bacteria | 1230 |
| 741 | Ga0587076_000124 | 3300059645 | Bacteria | 4701 |
| 742 | Ga0587076_014372 | 3300059645 | Bacteria | 1217 |
| 743 | Ga0587078_000079 | 3300059646 | Bacteria | 4887 |
| 744 | Ga0587078_001339 | 3300059646 | Bacteria | 2168 |
| 745 | Ga0587078_001518 | 3300059646 | Bacteria | 2091 |
| 746 | Ga0587078_002012 | 3300059646 | Bacteria | 1921 |
| 747 | Ga0587078_002020 | 3300059646 | Bacteria | 1919 |
| 748 | Ga0587079_000044 | 3300059647 | Bacteria | 6539 |
| 749 | Ga0587079_002200 | 3300059647 | Bacteria | 2349 |
| 750 | Ga0587079_004527 | 3300059647 | Bacteria | 1902 |
| 751 | Ga0587079_005793 | 3300059647 | Bacteria | 1766 |
| 752 | Ga0587079_015373 | 3300059647 | Bacteria | 1299 |
| 753 | Ga0587079_022117 | 3300059647 | Bacteria | 1151 |
| 754 | Ga0587102_002049 | 3300059649 | Bacteria | 1512 |
| 755 | Ga0587102_004086 | 3300059649 | Bacteria | 1225 |
| 756 | Ga0587107_000025 | 3300059652 | Bacteria | 6084 |
| 757 | Ga0587107_000075 | 3300059652 | Bacteria | 4343 |
| 758 | Ga0587107_001007 | 3300059652 | Bacteria | 2137 |
| 759 | Ga0587107_004923 | 3300059652 | Bacteria | 1386 |
| 760 | Ga0587107_005751 | 3300059652 | Bacteria | 1327 |
| 761 | Ga0587107_007700 | 3300059652 | Bacteria | 1220 |
| 762 | Ga0587110_000038 | 3300059654 | Bacteria | 4526 |
| 763 | Ga0587110_000268 | 3300059654 | Bacteria | 2790 |
| 764 | Ga0587114_000076 | 3300059655 | Bacteria | 4317 |
| 765 | Ga0587114_000221 | 3300059655 | Bacteria | 3312 |
| 766 | Ga0587114_000297 | 3300059655 | Bacteria | 3054 |
| 767 | Ga0587120_000482 | 3300059659 | Bacteria | 2056 |
| 768 | Ga0587120_001930 | 3300059659 | Bacteria | 1356 |
| 769 | Ga0587060_000305 | 3300060243 | Bacteria | 2528 |
| 770 | Ga0587071_000130 | 3300060344 | Bacteria | 5535 |
| 771 | Ga0587071_000561 | 3300060344 | Bacteria | 3773 |
| 772 | Ga0587071_001290 | 3300060344 | Bacteria | 3063 |
| 773 | Ga0587071_001621 | 3300060344 | Bacteria | 2866 |
| 774 | Ga0587071_019345 | 3300060344 | Bacteria | 1232 |
| 775 | Ga0587071_019412 | 3300060344 | Bacteria | 1230 |
| 776 | Ga0587111_0014455 | 3300060346 | Bacteria | 1428 |
| 777 | Ga0587111_0014793 | 3300060346 | Bacteria | 1416 |
| 778 | Ga0587111_0023562 | 3300060346 | Bacteria | 1205 |
| 779 | Ga0501082_0000697 | 3300060353 | Bacteria | 29625 |
| 780 | Ga0466962_0023854 | 3300061719 | Bacteria | 2940 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_0764282 | Ga0436363_0764282_15_917 | 295 |
| 2 | 3300059477 | Ga0587084_003079 | Ga0587084_003079_430_1440 | 323 |
| 3 | 3300059511 | Ga0587091_005787 | Ga0587091_005787_326_1336 | 323 |
| 4 | 3300059623 | Ga0587101_001002 | Ga0587101_001002_824_1834 | 323 |
| 5 | 3300059640 | Ga0587067_001783 | Ga0587067_001783_1059_2069 | 323 |
| 6 | 3300059644 | Ga0587075_000918 | Ga0587075_000918_136_1146 | 323 |
| 7 | 3300034818 | Ga0373950_0000007 | Ga0373950_0000007_48379_49395 | 327 |
| 8 | 3300048905 | Ga0496102_0422311 | Ga0496102_0422311_152_1156 | 327 |
| 9 | 3300049570 | Ga0501033_0012940 | Ga0501033_0012940_154_1179 | 327 |
| 10 | 3300049583 | Ga0501067_0000749 | Ga0501067_0000749_8730_9746 | 327 |
| 11 | 3300049589 | Ga0501073_0002367 | Ga0501073_0002367_370_1386 | 327 |
| 12 | 3300005290 | Ga0065712_10076610 | Ga0065712_100766103 | 328 |
| 13 | 3300005293 | Ga0065715_10098711 | Ga0065715_100987112 | 328 |
| 14 | 3300005329 | Ga0070683_100003814 | Ga0070683_10000381414 | 328 |
| 15 | 3300005330 | Ga0070690_100039399 | Ga0070690_1000393993 | 328 |
| 16 | 3300005331 | Ga0070670_100234867 | Ga0070670_1002348672 | 328 |
| 17 | 3300005336 | Ga0070680_100020352 | Ga0070680_1000203522 | 328 |
| 18 | 3300005340 | Ga0070689_100042193 | Ga0070689_1000421932 | 328 |
| 19 | 3300005344 | Ga0070661_100003160 | Ga0070661_10000316014 | 328 |
| 20 | 3300005354 | Ga0070675_100049573 | Ga0070675_1000495734 | 328 |
| 21 | 3300005355 | Ga0070671_100072906 | Ga0070671_1000729063 | 328 |
| 22 | 3300005456 | Ga0070678_100009877 | Ga0070678_1000098775 | 328 |
| 23 | 3300005458 | Ga0070681_10051513 | Ga0070681_100515133 | 328 |
| 24 | 3300005530 | Ga0070679_100077513 | Ga0070679_1000775134 | 328 |
| 25 | 3300005535 | Ga0070684_100094337 | Ga0070684_1000943372 | 328 |
| 26 | 3300005548 | Ga0070665_100070423 | Ga0070665_1000704233 | 328 |
| 27 | 3300005614 | Ga0068856_100067140 | Ga0068856_1000671402 | 328 |
| 28 | 3300025912 | Ga0207707_10070124 | Ga0207707_100701243 | 328 |
| 29 | 3300025917 | Ga0207660_10190346 | Ga0207660_101903462 | 328 |
| 30 | 3300025920 | Ga0207649_10174606 | Ga0207649_101746062 | 328 |
| 31 | 3300025921 | Ga0207652_10102178 | Ga0207652_101021782 | 328 |
| 32 | 3300025928 | Ga0207700_10263742 | Ga0207700_102637421 | 328 |
| 33 | 3300026023 | Ga0207677_10019907 | Ga0207677_100199075 | 328 |
| 34 | 3300026078 | Ga0207702_10086198 | Ga0207702_100861982 | 328 |
| 35 | 3300028379 | Ga0268266_10010139 | Ga0268266_100101396 | 328 |
| 36 | 3300039438 | Ga0436360_0022428 | Ga0436360_0022428_3416_4414 | 328 |
| 37 | 3300039447 | Ga0436361_0029161 | Ga0436361_0029161_2628_3626 | 328 |
| 38 | 3300039447 | Ga0436361_0234000 | Ga0436361_0234000_3197_4195 | 328 |
| 39 | 3300039447 | Ga0436361_0562516 | Ga0436361_0562516_525_1523 | 328 |
| 40 | 3300039447 | Ga0436361_0729433 | Ga0436361_0729433_1281_2279 | 328 |
| 41 | 3300046459 | Ga0495629_0050230 | Ga0495629_0050230_1898_2902 | 328 |
| 42 | 3300005548 | Ga0070665_100068448 | Ga0070665_1000684483 | 334 |
| 43 | 3300006237 | Ga0097621_100105169 | Ga0097621_1001051692 | 334 |
| 44 | 3300006358 | Ga0068871_100000441 | Ga0068871_10000044115 | 334 |
| 45 | 3300009093 | Ga0105240_10112845 | Ga0105240_101128453 | 334 |
| 46 | 3300009098 | Ga0105245_10108272 | Ga0105245_101082721 | 334 |
| 47 | 3300009545 | Ga0105237_10015775 | Ga0105237_100157754 | 334 |
| 48 | 3300013297 | Ga0157378_10005666 | Ga0157378_100056666 | 334 |
| 49 | 3300013306 | Ga0163162_10017857 | Ga0163162_100178574 | 334 |
| 50 | 3300028379 | Ga0268266_10214386 | Ga0268266_102143861 | 334 |
| 51 | 3300035692 | Ga0373935_0041340 | Ga0373935_0041340_1591_2655 | 334 |
| 52 | 3300048903 | Ga0496100_0021627 | Ga0496100_0021627_2030_3094 | 334 |
| 53 | 3300048904 | Ga0496101_0011418 | Ga0496101_0011418_2332_3396 | 334 |
| 54 | 3300048907 | Ga0496104_0087329 | Ga0496104_0087329_98_1162 | 334 |
| 55 | 3300048908 | Ga0496105_0036358 | Ga0496105_0036358_1822_2886 | 334 |
| 56 | 3300048909 | Ga0496106_0320962 | Ga0496106_0320962_119_1183 | 334 |
| 57 | 3300048910 | Ga0496107_0035325 | Ga0496107_0035325_2171_3256 | 334 |
| 58 | 3300048915 | Ga0496112_0067200 | Ga0496112_0067200_1282_2367 | 334 |
| 59 | 3300048917 | Ga0496114_0003270 | Ga0496114_0003270_1912_2976 | 334 |
| 60 | 3300048918 | Ga0496115_0029894 | Ga0496115_0029894_1145_2209 | 334 |
| 61 | 3300024227 | Ga0228598_1000900 | Ga0228598_10009003 | 335 |
| 62 | 3300031090 | Ga0265760_10007153 | Ga0265760_100071533 | 335 |
| 63 | 3300059644 | Ga0587075_010106 | Ga0587075_010106_68_1150 | 335 |
| 64 | iso_pu_bacteria | 2884693830 | 2884703432 | 335 |
| 65 | iso_pu_bacteria | 2895442618 | 2895443543 | 335 |
| 66 | 3300039450 | Ga0436363_0411683 | Ga0436363_0411683_289_1317 | 336 |
| 67 | 3300039450 | Ga0436363_1705626 | Ga0436363_1705626_1702_2775 | 336 |
| 68 | 3300047319 | Ga0495674_0148153 | Ga0495674_0148153_291_1307 | 336 |
| 69 | 3300047444 | Ga0495675_0117099 | Ga0495675_0117099_622_1638 | 336 |
| 70 | 3300059604 | Ga0587098_006621 | Ga0587098_006621_111_1166 | 336 |
| 71 | 3300004799 | Ga0058863_11857546 | Ga0058863_1185754610 | 337 |
| 72 | 3300004800 | Ga0058861_10099167 | Ga0058861_100991671 | 337 |
| 73 | 3300004803 | Ga0058862_12892176 | Ga0058862_128921761 | 337 |
| 74 | 3300005336 | Ga0070680_100006320 | Ga0070680_1000063202 | 337 |
| 75 | 3300005337 | Ga0070682_100025971 | Ga0070682_1000259712 | 337 |
| 76 | 3300005458 | Ga0070681_10000958 | Ga0070681_100009589 | 337 |
| 77 | 3300005458 | Ga0070681_10435135 | Ga0070681_104351352 | 337 |
| 78 | 3300005530 | Ga0070679_100002628 | Ga0070679_1000026285 | 337 |
| 79 | 3300005548 | Ga0070665_100109506 | Ga0070665_1001095062 | 337 |
| 80 | 3300005563 | Ga0068855_100341561 | Ga0068855_1003415612 | 337 |
| 81 | 3300006844 | Ga0075428_100035407 | Ga0075428_1000354072 | 337 |
| 82 | 3300006846 | Ga0075430_100004272 | Ga0075430_1000042725 | 337 |
| 83 | 3300006847 | Ga0075431_100000246 | Ga0075431_10000024632 | 337 |
| 84 | 3300006880 | Ga0075429_100012310 | Ga0075429_1000123103 | 337 |
| 85 | 3300009093 | Ga0105240_10225314 | Ga0105240_102253142 | 337 |
| 86 | 3300009551 | Ga0105238_10196808 | Ga0105238_101968081 | 337 |
| 87 | 3300013104 | Ga0157370_10294574 | Ga0157370_102945741 | 337 |
| 88 | 3300013307 | Ga0157372_10236241 | Ga0157372_102362412 | 337 |
| 89 | 3300020069 | Ga0197907_11228897 | Ga0197907_112288971 | 337 |
| 90 | 3300020070 | Ga0206356_11667153 | Ga0206356_116671531 | 337 |
| 91 | 3300020075 | Ga0206349_1892354 | Ga0206349_18923546 | 337 |
| 92 | 3300020076 | Ga0206355_1376396 | Ga0206355_13763961 | 337 |
| 93 | 3300020077 | Ga0206351_10762080 | Ga0206351_107620801 | 337 |
| 94 | 3300020078 | Ga0206352_10063385 | Ga0206352_100633851 | 337 |
| 95 | 3300020080 | Ga0206350_10848210 | Ga0206350_108482101 | 337 |
| 96 | 3300021377 | Ga0213874_10053491 | Ga0213874_100534912 | 337 |
| 97 | 3300022467 | Ga0224712_10003403 | Ga0224712_100034031 | 337 |
| 98 | 3300025912 | Ga0207707_10002321 | Ga0207707_1000232113 | 337 |
| 99 | 3300025917 | Ga0207660_10001024 | Ga0207660_1000102415 | 337 |
| 100 | 3300025921 | Ga0207652_10005227 | Ga0207652_1000522711 | 337 |
| 101 | 3300025949 | Ga0207667_10065273 | Ga0207667_100652732 | 337 |
| 102 | 3300028379 | Ga0268266_10048888 | Ga0268266_100488883 | 337 |
| 103 | 3300044693 | Ga0466961_0039498 | Ga0466961_0039498_1986_3002 | 337 |
| 104 | 3300044694 | Ga0466963_0000160 | Ga0466963_0000160_25695_26777 | 337 |
| 105 | 3300044901 | Ga0466960_0004308 | Ga0466960_0004308_1585_2670 | 337 |
| 106 | 3300050508 | nmdc:mga09592_54206_c1 | nmdc:mga09592_54206_c1_906_1955 | 337 |
| 107 | 3300050509 | nmdc:mga0qj67_7359_c1 | nmdc:mga0qj67_7359_c1_3692_4741 | 337 |
| 108 | 3300050510 | nmdc:mga06r32_515_c1 | nmdc:mga06r32_515_c1_1740_2789 | 337 |
| 109 | 3300059478 | Ga0587093_000820 | Ga0587093_000820_95_1177 | 337 |
| 110 | 3300059490 | Ga0587066_000073 | Ga0587066_000073_4178_5260 | 337 |
| 111 | 3300059490 | Ga0587066_000516 | Ga0587066_000516_53_1135 | 337 |
| 112 | 3300059491 | Ga0587070_000977 | Ga0587070_000977_95_1177 | 337 |
| 113 | 3300059492 | Ga0587073_0000109 | Ga0587073_0000109_81_1163 | 337 |
| 114 | 3300059492 | Ga0587073_0000410 | Ga0587073_0000410_2636_3718 | 337 |
| 115 | 3300059493 | Ga0587077_001519 | Ga0587077_001519_172_1254 | 337 |
| 116 | 3300059503 | Ga0587080_000235 | Ga0587080_000235_95_1177 | 337 |
| 117 | 3300059504 | Ga0587082_000731 | Ga0587082_000731_1862_2944 | 337 |
| 118 | 3300059504 | Ga0587082_003836 | Ga0587082_003836_95_1177 | 337 |
| 119 | 3300059505 | Ga0587083_0000084 | Ga0587083_0000084_162_1244 | 337 |
| 120 | 3300059505 | Ga0587083_0000297 | Ga0587083_0000297_96_1178 | 337 |
| 121 | 3300059506 | Ga0587085_000706 | Ga0587085_000706_1558_2640 | 337 |
| 122 | 3300059507 | Ga0587086_003698 | Ga0587086_003698_95_1177 | 337 |
| 123 | 3300059508 | Ga0587088_000156 | Ga0587088_000156_3170_4252 | 337 |
| 124 | 3300059510 | Ga0587090_000190 | Ga0587090_000190_95_1177 | 337 |
| 125 | 3300059511 | Ga0587091_000183 | Ga0587091_000183_3170_4252 | 337 |
| 126 | 3300059511 | Ga0587091_018407 | Ga0587091_018407_89_1171 | 337 |
| 127 | 3300059512 | Ga0587092_005729 | Ga0587092_005729_91_1173 | 337 |
| 128 | 3300059513 | Ga0587094_003689 | Ga0587094_003689_96_1178 | 337 |
| 129 | 3300059513 | Ga0587094_011034 | Ga0587094_011034_14_1096 | 337 |
| 130 | 3300059514 | Ga0587095_000119 | Ga0587095_000119_53_1135 | 337 |
| 131 | 3300059514 | Ga0587095_000201 | Ga0587095_000201_86_1168 | 337 |
| 132 | 3300059605 | Ga0587106_004307 | Ga0587106_004307_95_1177 | 337 |
| 133 | 3300059605 | Ga0587106_008923 | Ga0587106_008923_93_1175 | 337 |
| 134 | 3300059623 | Ga0587101_000106 | Ga0587101_000106_96_1178 | 337 |
| 135 | 3300059625 | Ga0587113_000023 | Ga0587113_000023_97_1179 | 337 |
| 136 | 3300059625 | Ga0587113_000044 | Ga0587113_000044_2873_3955 | 337 |
| 137 | 3300059630 | Ga0587128_000024 | Ga0587128_000024_4956_6038 | 337 |
| 138 | 3300059630 | Ga0587128_000104 | Ga0587128_000104_98_1180 | 337 |
| 139 | 3300059640 | Ga0587067_005170 | Ga0587067_005170_96_1178 | 337 |
| 140 | 3300059642 | Ga0587069_012023 | Ga0587069_012023_14_1096 | 337 |
| 141 | 3300059643 | Ga0587072_008887 | Ga0587072_008887_95_1177 | 337 |
| 142 | 3300059644 | Ga0587075_001008 | Ga0587075_001008_1452_2534 | 337 |
| 143 | 3300059644 | Ga0587075_004239 | Ga0587075_004239_95_1177 | 337 |
| 144 | 3300059646 | Ga0587078_002020 | Ga0587078_002020_92_1174 | 337 |
| 145 | 3300059647 | Ga0587079_015373 | Ga0587079_015373_95_1177 | 337 |
| 146 | 3300059652 | Ga0587107_000025 | Ga0587107_000025_70_1152 | 337 |
| 147 | 3300059652 | Ga0587107_000075 | Ga0587107_000075_3170_4252 | 337 |
| 148 | 3300059654 | Ga0587110_000268 | Ga0587110_000268_95_1177 | 337 |
| 149 | 3300059655 | Ga0587114_000076 | Ga0587114_000076_96_1178 | 337 |
| 150 | 3300059655 | Ga0587114_000297 | Ga0587114_000297_93_1175 | 337 |
| 151 | 3300059659 | Ga0587120_000482 | Ga0587120_000482_87_1169 | 337 |
| 152 | 3300060344 | Ga0587071_000130 | Ga0587071_000130_4242_5324 | 337 |
| 153 | 3300060344 | Ga0587071_000561 | Ga0587071_000561_95_1177 | 337 |
| 154 | 3300061719 | Ga0466962_0023854 | Ga0466962_0023854_1390_2406 | 337 |
| 155 | 3300021384 | Ga0213876_10000054 | Ga0213876_1000005429 | 338 |
| 156 | 3300039437 | Ga0436365_0085705 | Ga0436365_0085705_102883_103926 | 338 |
| 157 | 3300045051 | Ga0451576_0160954 | Ga0451576_0160954_119_1150 | 338 |
| 158 | 3300005548 | Ga0070665_100088824 | Ga0070665_1000888242 | 339 |
| 159 | 3300028379 | Ga0268266_10044455 | Ga0268266_100444552 | 339 |
| 160 | 3300059646 | Ga0587078_002012 | Ga0587078_002012_745_1776 | 339 |
| 161 | 3300005328 | Ga0070676_10080437 | Ga0070676_100804372 | 340 |
| 162 | 3300005330 | Ga0070690_100050541 | Ga0070690_1000505411 | 340 |
| 163 | 3300005330 | Ga0070690_100067238 | Ga0070690_1000672382 | 340 |
| 164 | 3300005340 | Ga0070689_100059419 | Ga0070689_1000594192 | 340 |
| 165 | 3300005340 | Ga0070689_100084459 | Ga0070689_1000844592 | 340 |
| 166 | 3300005340 | Ga0070689_100189853 | Ga0070689_1001898532 | 340 |
| 167 | 3300005343 | Ga0070687_100009280 | Ga0070687_1000092802 | 340 |
| 168 | 3300005343 | Ga0070687_100122270 | Ga0070687_1001222702 | 340 |
| 169 | 3300005355 | Ga0070671_100057634 | Ga0070671_1000576341 | 340 |
| 170 | 3300005364 | Ga0070673_100050848 | Ga0070673_1000508482 | 340 |
| 171 | 3300005365 | Ga0070688_100152955 | Ga0070688_1001529552 | 340 |
| 172 | 3300005459 | Ga0068867_100019567 | Ga0068867_1000195672 | 340 |
| 173 | 3300005466 | Ga0070685_10009391 | Ga0070685_100093912 | 340 |
| 174 | 3300005466 | Ga0070685_10033704 | Ga0070685_100337042 | 340 |
| 175 | 3300005543 | Ga0070672_100038064 | Ga0070672_1000380642 | 340 |
| 176 | 3300005543 | Ga0070672_100289497 | Ga0070672_1002894971 | 340 |
| 177 | 3300005841 | Ga0068863_100054448 | Ga0068863_1000544482 | 340 |
| 178 | 3300006237 | Ga0097621_100253166 | Ga0097621_1002531661 | 340 |
| 179 | 3300009148 | Ga0105243_10265626 | Ga0105243_102656262 | 340 |
| 180 | 3300025903 | Ga0207680_10131200 | Ga0207680_101312002 | 340 |
| 181 | 3300025918 | Ga0207662_10015642 | Ga0207662_100156423 | 340 |
| 182 | 3300025918 | Ga0207662_10084587 | Ga0207662_100845872 | 340 |
| 183 | 3300025923 | Ga0207681_10005051 | Ga0207681_100050518 | 340 |
| 184 | 3300025931 | Ga0207644_10076952 | Ga0207644_100769522 | 340 |
| 185 | 3300025933 | Ga0207706_10169391 | Ga0207706_101693912 | 340 |
| 186 | 3300025936 | Ga0207670_10041589 | Ga0207670_100415892 | 340 |
| 187 | 3300025940 | Ga0207691_10090337 | Ga0207691_100903372 | 340 |
| 188 | 3300025940 | Ga0207691_10280038 | Ga0207691_102800382 | 340 |
| 189 | 3300025960 | Ga0207651_10018241 | Ga0207651_100182414 | 340 |
| 190 | 3300025972 | Ga0207668_10223899 | Ga0207668_102238991 | 340 |
| 191 | 3300025986 | Ga0207658_10300674 | Ga0207658_103006742 | 340 |
| 192 | 3300026035 | Ga0207703_10247343 | Ga0207703_102473431 | 340 |
| 193 | 3300026075 | Ga0207708_10001541 | Ga0207708_1000154116 | 340 |
| 194 | 3300026089 | Ga0207648_10027497 | Ga0207648_100274974 | 340 |
| 195 | 3300026118 | Ga0207675_100014879 | Ga0207675_1000148795 | 340 |
| 196 | 3300039447 | Ga0436361_0421938 | Ga0436361_0421938_6714_7748 | 340 |
| 197 | 3300039453 | Ga0436362_1210598 | Ga0436362_1210598_670_1710 | 340 |
| 198 | 3300048917 | Ga0496114_0015215 | Ga0496114_0015215_3825_4862 | 340 |
| 199 | 3300049583 | Ga0501067_0000673 | Ga0501067_0000673_1966_3003 | 340 |
| 200 | 3300049589 | Ga0501073_0009175 | Ga0501073_0009175_397_1434 | 340 |
| 201 | iso_pu_bacteria | 2990088156 | 2990091891 | 340 |
| 202 | iso_pu_bacteria | 8056667051 | 8056668532 | 340 |
| 203 | 3300035114 | Ga0373939_0022479 | Ga0373939_0022479_392_1489 | 341 |
| 204 | 3300035171 | Ga0373946_0036930 | Ga0373946_0036930_619_1674 | 341 |
| 205 | 3300035725 | Ga0373947_0065780 | Ga0373947_0065780_65_1120 | 341 |
| 206 | 3300037068 | Ga0373925_0035322 | Ga0373925_0035322_1986_3041 | 341 |
| 207 | 3300044842 | Ga0466957_0003254 | Ga0466957_0003254_3979_5016 | 341 |
| 208 | 3300045836 | Ga0466958_0009345 | Ga0466958_0009345_4027_5064 | 341 |
| 209 | 3300059490 | Ga0587066_002166 | Ga0587066_002166_556_1593 | 341 |
| 210 | 3300059492 | Ga0587073_0003580 | Ga0587073_0003580_556_1593 | 341 |
| 211 | 3300059493 | Ga0587077_000377 | Ga0587077_000377_2057_3094 | 341 |
| 212 | 3300059503 | Ga0587080_002781 | Ga0587080_002781_553_1590 | 341 |
| 213 | 3300059508 | Ga0587088_002353 | Ga0587088_002353_549_1586 | 341 |
| 214 | 3300059513 | Ga0587094_005848 | Ga0587094_005848_397_1434 | 341 |
| 215 | 3300059623 | Ga0587101_000381 | Ga0587101_000381_1438_2475 | 341 |
| 216 | 3300059630 | Ga0587128_003890 | Ga0587128_003890_556_1593 | 341 |
| 217 | 3300059642 | Ga0587069_001611 | Ga0587069_001611_539_1576 | 341 |
| 218 | 3300059647 | Ga0587079_002200 | Ga0587079_002200_556_1593 | 341 |
| 219 | 3300059652 | Ga0587107_001007 | Ga0587107_001007_556_1593 | 341 |
| 220 | 3300060344 | Ga0587071_001290 | Ga0587071_001290_551_1588 | 341 |
| 221 | 3300005985 | Ga0081539_10014942 | Ga0081539_100149424 | 342 |
| 222 | 3300021384 | Ga0213876_10064400 | Ga0213876_100644002 | 342 |
| 223 | 3300039437 | Ga0436365_1311096 | Ga0436365_1311096_308_1354 | 342 |
| 224 | 3300039437 | Ga0436365_1825198 | Ga0436365_1825198_18_1061 | 342 |
| 225 | 3300044656 | Ga0466969_0002682 | Ga0466969_0002682_5116_6234 | 342 |
| 226 | 3300044684 | Ga0466966_0011342 | Ga0466966_0011342_4826_5890 | 342 |
| 227 | 3300044693 | Ga0466961_0025893 | Ga0466961_0025893_547_1665 | 342 |
| 228 | 3300044694 | Ga0466963_0002410 | Ga0466963_0002410_9311_10357 | 342 |
| 229 | 3300044719 | Ga0466971_0017781 | Ga0466971_0017781_1271_2317 | 342 |
| 230 | 3300044735 | Ga0466968_0025059 | Ga0466968_0025059_710_1756 | 342 |
| 231 | 3300044842 | Ga0466957_0000828 | Ga0466957_0000828_12030_13076 | 342 |
| 232 | 3300045836 | Ga0466958_0011726 | Ga0466958_0011726_1486_2532 | 342 |
| 233 | 3300045976 | Ga0466967_0021082 | Ga0466967_0021082_1776_2822 | 342 |
| 234 | 3300059640 | Ga0587067_012981 | Ga0587067_012981_138_1196 | 342 |
| 235 | 3300001990 | JGI24737J22298_10006829 | JGI24737J22298_100068292 | 343 |
| 236 | 3300001991 | JGI24743J22301_10001548 | JGI24743J22301_100015482 | 343 |
| 237 | 3300005329 | Ga0070683_100028263 | Ga0070683_1000282636 | 343 |
| 238 | 3300005338 | Ga0068868_100139305 | Ga0068868_1001393053 | 343 |
| 239 | 3300005365 | Ga0070688_100093383 | Ga0070688_1000933833 | 343 |
| 240 | 3300005441 | Ga0070700_100124835 | Ga0070700_1001248351 | 343 |
| 241 | 3300005535 | Ga0070684_100023550 | Ga0070684_1000235503 | 343 |
| 242 | 3300005543 | Ga0070672_100132533 | Ga0070672_1001325332 | 343 |
| 243 | 3300005544 | Ga0070686_100042425 | Ga0070686_1000424251 | 343 |
| 244 | 3300005549 | Ga0070704_100040664 | Ga0070704_1000406642 | 343 |
| 245 | 3300005577 | Ga0068857_100113849 | Ga0068857_1001138493 | 343 |
| 246 | 3300005615 | Ga0070702_100019855 | Ga0070702_1000198552 | 343 |
| 247 | 3300005616 | Ga0068852_100218802 | Ga0068852_1002188022 | 343 |
| 248 | 3300005617 | Ga0068859_100072086 | Ga0068859_1000720863 | 343 |
| 249 | 3300005618 | Ga0068864_100019864 | Ga0068864_1000198642 | 343 |
| 250 | 3300005719 | Ga0068861_100157764 | Ga0068861_1001577642 | 343 |
| 251 | 3300005843 | Ga0068860_100269765 | Ga0068860_1002697652 | 343 |
| 252 | 3300005844 | Ga0068862_100213919 | Ga0068862_1002139192 | 343 |
| 253 | 3300005981 | Ga0081538_10003792 | Ga0081538_100037929 | 343 |
| 254 | 3300005985 | Ga0081539_10010756 | Ga0081539_1001075611 | 343 |
| 255 | 3300006058 | Ga0075432_10074820 | Ga0075432_100748201 | 343 |
| 256 | 3300006931 | Ga0097620_100072089 | Ga0097620_1000720893 | 343 |
| 257 | 3300009098 | Ga0105245_10484483 | Ga0105245_104844832 | 343 |
| 258 | 3300009101 | Ga0105247_10016208 | Ga0105247_100162082 | 343 |
| 259 | 3300009148 | Ga0105243_10442499 | Ga0105243_104424991 | 343 |
| 260 | 3300009176 | Ga0105242_10487479 | Ga0105242_104874791 | 343 |
| 261 | 3300009177 | Ga0105248_10157421 | Ga0105248_101574212 | 343 |
| 262 | 3300009545 | Ga0105237_10219850 | Ga0105237_102198502 | 343 |
| 263 | 3300009553 | Ga0105249_10237956 | Ga0105249_102379563 | 343 |
| 264 | 3300011119 | Ga0105246_10126614 | Ga0105246_101266142 | 343 |
| 265 | 3300013296 | Ga0157374_10079732 | Ga0157374_100797322 | 343 |
| 266 | 3300025900 | Ga0207710_10013532 | Ga0207710_100135322 | 343 |
| 267 | 3300025901 | Ga0207688_10010377 | Ga0207688_100103774 | 343 |
| 268 | 3300025903 | Ga0207680_10142825 | Ga0207680_101428252 | 343 |
| 269 | 3300025907 | Ga0207645_10065454 | Ga0207645_100654543 | 343 |
| 270 | 3300025908 | Ga0207643_10015952 | Ga0207643_100159522 | 343 |
| 271 | 3300025919 | Ga0207657_10059034 | Ga0207657_100590342 | 343 |
| 272 | 3300025920 | Ga0207649_10168040 | Ga0207649_101680402 | 343 |
| 273 | 3300025927 | Ga0207687_10062714 | Ga0207687_100627141 | 343 |
| 274 | 3300025932 | Ga0207690_10150022 | Ga0207690_101500222 | 343 |
| 275 | 3300025940 | Ga0207691_10053508 | Ga0207691_100535082 | 343 |
| 276 | 3300025941 | Ga0207711_10286180 | Ga0207711_102861802 | 343 |
| 277 | 3300025942 | Ga0207689_10024608 | Ga0207689_100246084 | 343 |
| 278 | 3300025944 | Ga0207661_10173655 | Ga0207661_101736552 | 343 |
| 279 | 3300026023 | Ga0207677_10088475 | Ga0207677_100884752 | 343 |
| 280 | 3300026075 | Ga0207708_10052806 | Ga0207708_100528063 | 343 |
| 281 | 3300026088 | Ga0207641_10068656 | Ga0207641_100686562 | 343 |
| 282 | 3300028381 | Ga0268264_10276274 | Ga0268264_102762742 | 343 |
| 283 | 3300031649 | Ga0307514_10139988 | Ga0307514_101399881 | 343 |
| 284 | 3300036401 | Ga0373937_0214656 | Ga0373937_0214656_767_1801 | 343 |
| 285 | 3300037466 | Ga0395898_0224191 | Ga0395898_0224191_160_1209 | 343 |
| 286 | 3300039453 | Ga0436362_0427516 | Ga0436362_0427516_251_1300 | 343 |
| 287 | 3300045976 | Ga0466967_0128385 | Ga0466967_0128385_87_1136 | 343 |
| 288 | 3300047317 | Ga0495604_0052018 | Ga0495604_0052018_1994_3067 | 343 |
| 289 | 3300048904 | Ga0496101_0082938 | Ga0496101_0082938_618_1667 | 343 |
| 290 | 3300048905 | Ga0496102_0124838 | Ga0496102_0124838_695_1759 | 343 |
| 291 | 3300048911 | Ga0496108_0040535 | Ga0496108_0040535_2361_3425 | 343 |
| 292 | 3300048913 | Ga0496110_0244341 | Ga0496110_0244341_159_1223 | 343 |
| 293 | 3300048916 | Ga0496113_0034018 | Ga0496113_0034018_1308_2372 | 343 |
| 294 | 3300048918 | Ga0496115_0045984 | Ga0496115_0045984_1660_2709 | 343 |
| 295 | 3300050511 | nmdc:mga08y16_234725_c1 | nmdc:mga08y16_234725_c1_188_1252 | 343 |
| 296 | 3300050515 | nmdc:mga0a205_11126_c1 | nmdc:mga0a205_11126_c1_2450_3490 | 343 |
| 297 | 3300050515 | nmdc:mga0a205_13679_c1 | nmdc:mga0a205_13679_c1_3422_4486 | 343 |
| 298 | 3300053083 | Ga0495655_0025219 | Ga0495655_0025219_194_1243 | 343 |
| 299 | 3300005985 | Ga0081539_10000088 | Ga0081539_10000088229 | 344 |
| 300 | 3300021377 | Ga0213874_10001273 | Ga0213874_100012733 | 344 |
| 301 | 3300021384 | Ga0213876_10005349 | Ga0213876_100053493 | 344 |
| 302 | 3300021384 | Ga0213876_10032620 | Ga0213876_100326203 | 344 |
| 303 | 3300025949 | Ga0207667_10363929 | Ga0207667_103639292 | 344 |
| 304 | 3300026142 | Ga0207698_10134264 | Ga0207698_101342642 | 344 |
| 305 | 3300031911 | Ga0307412_10165067 | Ga0307412_101650673 | 344 |
| 306 | 3300037853 | Ga0436364_0758998 | Ga0436364_0758998_9811_10863 | 344 |
| 307 | 3300039437 | Ga0436365_0872846 | Ga0436365_0872846_7362_8414 | 344 |
| 308 | 3300039437 | Ga0436365_1172381 | Ga0436365_1172381_599_1651 | 344 |
| 309 | 3300039450 | Ga0436363_1210094 | Ga0436363_1210094_1961_3013 | 344 |
| 310 | 3300039453 | Ga0436362_1166284 | Ga0436362_1166284_1505_2557 | 344 |
| 311 | 3300044694 | Ga0466963_0051846 | Ga0466963_0051846_1445_2497 | 344 |
| 312 | 3300045049 | Ga0466959_0134247 | Ga0466959_0134247_635_1687 | 344 |
| 313 | 3300045836 | Ga0466958_0040318 | Ga0466958_0040318_922_1974 | 344 |
| 314 | 3300004800 | Ga0058861_11965202 | Ga0058861_119652021 | 345 |
| 315 | 3300004803 | Ga0058862_10084264 | Ga0058862_100842641 | 345 |
| 316 | 3300025923 | Ga0207681_10024386 | Ga0207681_100243863 | 345 |
| 317 | 3300025986 | Ga0207658_10279625 | Ga0207658_102796252 | 345 |
| 318 | 3300049568 | Ga0501031_0157419 | Ga0501031_0157419_28_1107 | 345 |
| 319 | 3300059511 | Ga0587091_000639 | Ga0587091_000639_13_1077 | 345 |
| 320 | 3300004803 | Ga0058862_10155954 | Ga0058862_101559542 | 346 |
| 321 | 3300021377 | Ga0213874_10001754 | Ga0213874_100017546 | 346 |
| 322 | 3300025893 | Ga0207682_10039552 | Ga0207682_100395522 | 346 |
| 323 | 3300039437 | Ga0436365_1910425 | Ga0436365_1910425_1864_2922 | 346 |
| 324 | 3300039450 | Ga0436363_1139504 | Ga0436363_1139504_5944_7002 | 346 |
| 325 | 3300005293 | Ga0065715_10111681 | Ga0065715_101116812 | 347 |
| 326 | 3300005328 | Ga0070676_10020479 | Ga0070676_100204793 | 347 |
| 327 | 3300005331 | Ga0070670_100304717 | Ga0070670_1003047171 | 347 |
| 328 | 3300005338 | Ga0068868_100006785 | Ga0068868_1000067854 | 347 |
| 329 | 3300005340 | Ga0070689_100262024 | Ga0070689_1002620241 | 347 |
| 330 | 3300005367 | Ga0070667_100006336 | Ga0070667_1000063366 | 347 |
| 331 | 3300005457 | Ga0070662_100003448 | Ga0070662_1000034487 | 347 |
| 332 | 3300005458 | Ga0070681_10070445 | Ga0070681_100704453 | 347 |
| 333 | 3300005459 | Ga0068867_100036200 | Ga0068867_1000362001 | 347 |
| 334 | 3300005530 | Ga0070679_100092485 | Ga0070679_1000924852 | 347 |
| 335 | 3300005530 | Ga0070679_100238641 | Ga0070679_1002386411 | 347 |
| 336 | 3300005539 | Ga0068853_100022555 | Ga0068853_1000225554 | 347 |
| 337 | 3300005544 | Ga0070686_100014697 | Ga0070686_1000146973 | 347 |
| 338 | 3300005545 | Ga0070695_100045761 | Ga0070695_1000457612 | 347 |
| 339 | 3300005548 | Ga0070665_100032863 | Ga0070665_1000328632 | 347 |
| 340 | 3300005564 | Ga0070664_100059354 | Ga0070664_1000593543 | 347 |
| 341 | 3300005617 | Ga0068859_100012221 | Ga0068859_1000122215 | 347 |
| 342 | 3300005618 | Ga0068864_100127443 | Ga0068864_1001274432 | 347 |
| 343 | 3300005718 | Ga0068866_10026846 | Ga0068866_100268463 | 347 |
| 344 | 3300005834 | Ga0068851_10011169 | Ga0068851_100111693 | 347 |
| 345 | 3300005843 | Ga0068860_100032000 | Ga0068860_1000320004 | 347 |
| 346 | 3300005844 | Ga0068862_100031265 | Ga0068862_1000312653 | 347 |
| 347 | 3300005937 | Ga0081455_10191283 | Ga0081455_101912832 | 347 |
| 348 | 3300006871 | Ga0075434_100268939 | Ga0075434_1002689392 | 347 |
| 349 | 3300006931 | Ga0097620_100012221 | Ga0097620_1000122215 | 347 |
| 350 | 3300007076 | Ga0075435_100204846 | Ga0075435_1002048461 | 347 |
| 351 | 3300009101 | Ga0105247_10048283 | Ga0105247_100482831 | 347 |
| 352 | 3300009147 | Ga0114129_10071725 | Ga0114129_100717252 | 347 |
| 353 | 3300009177 | Ga0105248_10076303 | Ga0105248_100763032 | 347 |
| 354 | 3300009551 | Ga0105238_10103043 | Ga0105238_101030433 | 347 |
| 355 | 3300009553 | Ga0105249_10020648 | Ga0105249_100206484 | 347 |
| 356 | 3300013296 | Ga0157374_10002622 | Ga0157374_1000262214 | 347 |
| 357 | 3300013306 | Ga0163162_10007612 | Ga0163162_100076123 | 347 |
| 358 | 3300013307 | Ga0157372_10085188 | Ga0157372_100851882 | 347 |
| 359 | 3300014325 | Ga0163163_10037985 | Ga0163163_100379853 | 347 |
| 360 | 3300020078 | Ga0206352_10958369 | Ga0206352_109583692 | 347 |
| 361 | 3300020080 | Ga0206350_10064510 | Ga0206350_100645102 | 347 |
| 362 | 3300025321 | Ga0207656_10007333 | Ga0207656_100073332 | 347 |
| 363 | 3300025899 | Ga0207642_10024014 | Ga0207642_100240143 | 347 |
| 364 | 3300025900 | Ga0207710_10126252 | Ga0207710_101262521 | 347 |
| 365 | 3300025907 | Ga0207645_10029315 | Ga0207645_100293152 | 347 |
| 366 | 3300025908 | Ga0207643_10159495 | Ga0207643_101594951 | 347 |
| 367 | 3300025911 | Ga0207654_10003318 | Ga0207654_100033185 | 347 |
| 368 | 3300025911 | Ga0207654_10014276 | Ga0207654_100142763 | 347 |
| 369 | 3300025912 | Ga0207707_10081084 | Ga0207707_100810843 | 347 |
| 370 | 3300025913 | Ga0207695_10020079 | Ga0207695_100200795 | 347 |
| 371 | 3300025919 | Ga0207657_10004939 | Ga0207657_1000493913 | 347 |
| 372 | 3300025920 | Ga0207649_10012718 | Ga0207649_100127183 | 347 |
| 373 | 3300025921 | Ga0207652_10076551 | Ga0207652_100765513 | 347 |
| 374 | 3300025927 | Ga0207687_10003506 | Ga0207687_100035067 | 347 |
| 375 | 3300025928 | Ga0207700_10055263 | Ga0207700_100552632 | 347 |
| 376 | 3300025933 | Ga0207706_10000597 | Ga0207706_100005977 | 347 |
| 377 | 3300025936 | Ga0207670_10225513 | Ga0207670_102255132 | 347 |
| 378 | 3300025938 | Ga0207704_10011848 | Ga0207704_100118482 | 347 |
| 379 | 3300025941 | Ga0207711_10001240 | Ga0207711_1000124013 | 347 |
| 380 | 3300025945 | Ga0207679_10026928 | Ga0207679_100269282 | 347 |
| 381 | 3300025949 | Ga0207667_10003400 | Ga0207667_1000340010 | 347 |
| 382 | 3300025961 | Ga0207712_10005929 | Ga0207712_100059292 | 347 |
| 383 | 3300025972 | Ga0207668_10019796 | Ga0207668_100197962 | 347 |
| 384 | 3300025986 | Ga0207658_10005680 | Ga0207658_100056803 | 347 |
| 385 | 3300026023 | Ga0207677_10004150 | Ga0207677_100041504 | 347 |
| 386 | 3300026067 | Ga0207678_10002015 | Ga0207678_100020152 | 347 |
| 387 | 3300026089 | Ga0207648_10036307 | Ga0207648_100363072 | 347 |
| 388 | 3300026095 | Ga0207676_10199426 | Ga0207676_101994262 | 347 |
| 389 | 3300026116 | Ga0207674_10024448 | Ga0207674_100244484 | 347 |
| 390 | 3300026118 | Ga0207675_100104255 | Ga0207675_1001042551 | 347 |
| 391 | 3300026121 | Ga0207683_10044524 | Ga0207683_100445243 | 347 |
| 392 | 3300028379 | Ga0268266_10139900 | Ga0268266_101399002 | 347 |
| 393 | 3300028380 | Ga0268265_10112550 | Ga0268265_101125502 | 347 |
| 394 | 3300028381 | Ga0268264_10040981 | Ga0268264_100409813 | 347 |
| 395 | 3300035112 | Ga0373932_0039345 | Ga0373932_0039345_242_1306 | 347 |
| 396 | 3300035118 | Ga0373954_0075395 | Ga0373954_0075395_477_1562 | 347 |
| 397 | 3300035120 | Ga0373957_0009274 | Ga0373957_0009274_1858_2943 | 347 |
| 398 | 3300035724 | Ga0373933_0071961 | Ga0373933_0071961_158_1243 | 347 |
| 399 | 3300046472 | Ga0495580_0052089 | Ga0495580_0052089_1786_2850 | 347 |
| 400 | 3300048905 | Ga0496102_0195652 | Ga0496102_0195652_751_1815 | 347 |
| 401 | 3300048906 | Ga0496103_0042908 | Ga0496103_0042908_156_1220 | 347 |
| 402 | 3300048909 | Ga0496106_0136207 | Ga0496106_0136207_231_1295 | 347 |
| 403 | 3300050509 | nmdc:mga0qj67_373246_c1 | nmdc:mga0qj67_373246_c1_34_1104 | 347 |
| 404 | 3300050512 | nmdc:mga0n895_213442_c1 | nmdc:mga0n895_213442_c1_583_1647 | 347 |
| 405 | iso_pu_bacteria | 2622736626 | 2623589808 | 347 |
| 406 | iso_pu_bacteria | 2858902515 | 2858908162 | 347 |
| 407 | 3300005290 | Ga0065712_10080756 | Ga0065712_100807562 | 348 |
| 408 | 3300005355 | Ga0070671_100071202 | Ga0070671_1000712024 | 348 |
| 409 | 3300005364 | Ga0070673_100086857 | Ga0070673_1000868571 | 348 |
| 410 | 3300005434 | Ga0070709_10214670 | Ga0070709_102146701 | 348 |
| 411 | 3300005436 | Ga0070713_100187910 | Ga0070713_1001879102 | 348 |
| 412 | 3300005983 | Ga0081540_1015731 | Ga0081540_10157315 | 348 |
| 413 | 3300009093 | Ga0105240_10003191 | Ga0105240_1000319113 | 348 |
| 414 | 3300009094 | Ga0111539_10282739 | Ga0111539_102827391 | 348 |
| 415 | 3300009147 | Ga0114129_10146388 | Ga0114129_101463883 | 348 |
| 416 | 3300013296 | Ga0157374_10039357 | Ga0157374_100393574 | 348 |
| 417 | 3300021361 | Ga0213872_10005912 | Ga0213872_100059125 | 348 |
| 418 | 3300025913 | Ga0207695_10023568 | Ga0207695_100235684 | 348 |
| 419 | 3300025928 | Ga0207700_10259486 | Ga0207700_102594862 | 348 |
| 420 | 3300025960 | Ga0207651_10075051 | Ga0207651_100750512 | 348 |
| 421 | 3300035692 | Ga0373935_0032029 | Ga0373935_0032029_1191_2312 | 348 |
| 422 | 3300035695 | Ga0373927_0001944 | Ga0373927_0001944_12517_13638 | 348 |
| 423 | 3300035695 | Ga0373927_0094386 | Ga0373927_0094386_368_1495 | 348 |
| 424 | 3300035725 | Ga0373947_0036136 | Ga0373947_0036136_631_1752 | 348 |
| 425 | 3300037068 | Ga0373925_0056088 | Ga0373925_0056088_159_1280 | 348 |
| 426 | 3300037853 | Ga0436364_0691152 | Ga0436364_0691152_434_1495 | 348 |
| 427 | 3300039438 | Ga0436360_0614395 | Ga0436360_0614395_153_1214 | 348 |
| 428 | 3300039447 | Ga0436361_0169046 | Ga0436361_0169046_14122_15183 | 348 |
| 429 | 3300045051 | Ga0451576_0178703 | Ga0451576_0178703_233_1369 | 348 |
| 430 | 3300048916 | Ga0496113_0254545 | Ga0496113_0254545_235_1305 | 348 |
| 431 | 3300049581 | Ga0501047_0045873 | Ga0501047_0045873_2339_3418 | 348 |
| 432 | 3300049742 | Ga0501080_0002951 | Ga0501080_0002951_10969_12057 | 348 |
| 433 | 3300005295 | Ga0065707_10099363 | Ga0065707_100993632 | 349 |
| 434 | 3300005328 | Ga0070676_10006924 | Ga0070676_100069242 | 349 |
| 435 | 3300005330 | Ga0070690_100081587 | Ga0070690_1000815873 | 349 |
| 436 | 3300005331 | Ga0070670_100007440 | Ga0070670_1000074406 | 349 |
| 437 | 3300005338 | Ga0068868_100097046 | Ga0068868_1000970462 | 349 |
| 438 | 3300005343 | Ga0070687_100027105 | Ga0070687_1000271052 | 349 |
| 439 | 3300005347 | Ga0070668_100122120 | Ga0070668_1001221201 | 349 |
| 440 | 3300005353 | Ga0070669_100093370 | Ga0070669_1000933701 | 349 |
| 441 | 3300005354 | Ga0070675_100034521 | Ga0070675_1000345213 | 349 |
| 442 | 3300005355 | Ga0070671_100001471 | Ga0070671_10000147120 | 349 |
| 443 | 3300005356 | Ga0070674_100011537 | Ga0070674_1000115375 | 349 |
| 444 | 3300005356 | Ga0070674_100036697 | Ga0070674_1000366972 | 349 |
| 445 | 3300005364 | Ga0070673_100042833 | Ga0070673_1000428333 | 349 |
| 446 | 3300005367 | Ga0070667_100013925 | Ga0070667_1000139256 | 349 |
| 447 | 3300005367 | Ga0070667_100022090 | Ga0070667_1000220903 | 349 |
| 448 | 3300005434 | Ga0070709_10028389 | Ga0070709_100283894 | 349 |
| 449 | 3300005436 | Ga0070713_100196019 | Ga0070713_1001960192 | 349 |
| 450 | 3300005457 | Ga0070662_100010706 | Ga0070662_1000107066 | 349 |
| 451 | 3300005543 | Ga0070672_100030998 | Ga0070672_1000309984 | 349 |
| 452 | 3300005548 | Ga0070665_100016598 | Ga0070665_10001659812 | 349 |
| 453 | 3300005548 | Ga0070665_100203797 | Ga0070665_1002037973 | 349 |
| 454 | 3300005618 | Ga0068864_100142557 | Ga0068864_1001425572 | 349 |
| 455 | 3300005841 | Ga0068863_100196170 | Ga0068863_1001961702 | 349 |
| 456 | 3300005842 | Ga0068858_100113727 | Ga0068858_1001137273 | 349 |
| 457 | 3300006173 | Ga0070716_100128194 | Ga0070716_1001281943 | 349 |
| 458 | 3300006175 | Ga0070712_100311899 | Ga0070712_1003118991 | 349 |
| 459 | 3300006237 | Ga0097621_100002691 | Ga0097621_1000026912 | 349 |
| 460 | 3300006237 | Ga0097621_100096597 | Ga0097621_1000965974 | 349 |
| 461 | 3300006881 | Ga0068865_100050725 | Ga0068865_1000507252 | 349 |
| 462 | 3300013297 | Ga0157378_10017414 | Ga0157378_100174144 | 349 |
| 463 | 3300013297 | Ga0157378_10090568 | Ga0157378_100905682 | 349 |
| 464 | 3300013306 | Ga0163162_10077622 | Ga0163162_100776222 | 349 |
| 465 | 3300013308 | Ga0157375_10000790 | Ga0157375_1000079025 | 349 |
| 466 | 3300014745 | Ga0157377_10019570 | Ga0157377_100195702 | 349 |
| 467 | 3300025315 | Ga0207697_10006543 | Ga0207697_100065434 | 349 |
| 468 | 3300025903 | Ga0207680_10003756 | Ga0207680_100037566 | 349 |
| 469 | 3300025903 | Ga0207680_10029229 | Ga0207680_100292293 | 349 |
| 470 | 3300025906 | Ga0207699_10011051 | Ga0207699_100110514 | 349 |
| 471 | 3300025907 | Ga0207645_10003683 | Ga0207645_1000368311 | 349 |
| 472 | 3300025915 | Ga0207693_10023140 | Ga0207693_100231406 | 349 |
| 473 | 3300025915 | Ga0207693_10072341 | Ga0207693_100723411 | 349 |
| 474 | 3300025923 | Ga0207681_10013266 | Ga0207681_100132666 | 349 |
| 475 | 3300025923 | Ga0207681_10041489 | Ga0207681_100414894 | 349 |
| 476 | 3300025925 | Ga0207650_10022881 | Ga0207650_100228812 | 349 |
| 477 | 3300025926 | Ga0207659_10040062 | Ga0207659_100400623 | 349 |
| 478 | 3300025926 | Ga0207659_10049747 | Ga0207659_100497472 | 349 |
| 479 | 3300025928 | Ga0207700_10033679 | Ga0207700_100336792 | 349 |
| 480 | 3300025931 | Ga0207644_10004127 | Ga0207644_1000412711 | 349 |
| 481 | 3300025931 | Ga0207644_10171372 | Ga0207644_101713723 | 349 |
| 482 | 3300025933 | Ga0207706_10004944 | Ga0207706_100049447 | 349 |
| 483 | 3300025937 | Ga0207669_10075374 | Ga0207669_100753741 | 349 |
| 484 | 3300025938 | Ga0207704_10015792 | Ga0207704_100157922 | 349 |
| 485 | 3300025939 | Ga0207665_10032649 | Ga0207665_100326492 | 349 |
| 486 | 3300025939 | Ga0207665_10176668 | Ga0207665_101766683 | 349 |
| 487 | 3300025940 | Ga0207691_10020159 | Ga0207691_100201595 | 349 |
| 488 | 3300025940 | Ga0207691_10085140 | Ga0207691_100851402 | 349 |
| 489 | 3300025960 | Ga0207651_10014155 | Ga0207651_100141552 | 349 |
| 490 | 3300025960 | Ga0207651_10287126 | Ga0207651_102871261 | 349 |
| 491 | 3300025986 | Ga0207658_10168095 | Ga0207658_101680952 | 349 |
| 492 | 3300025986 | Ga0207658_10251998 | Ga0207658_102519982 | 349 |
| 493 | 3300026023 | Ga0207677_10007511 | Ga0207677_100075114 | 349 |
| 494 | 3300026023 | Ga0207677_10213879 | Ga0207677_102138791 | 349 |
| 495 | 3300026035 | Ga0207703_10080824 | Ga0207703_100808242 | 349 |
| 496 | 3300026088 | Ga0207641_10206861 | Ga0207641_102068612 | 349 |
| 497 | 3300026095 | Ga0207676_10422769 | Ga0207676_104227691 | 349 |
| 498 | 3300026121 | Ga0207683_10010450 | Ga0207683_100104508 | 349 |
| 499 | 3300028379 | Ga0268266_10002775 | Ga0268266_100027757 | 349 |
| 500 | 3300028379 | Ga0268266_10044373 | Ga0268266_100443731 | 349 |
| 501 | 3300035692 | Ga0373935_0212465 | Ga0373935_0212465_86_1150 | 349 |
| 502 | 3300035725 | Ga0373947_0189278 | Ga0373947_0189278_179_1243 | 349 |
| 503 | 3300037068 | Ga0373925_0021355 | Ga0373925_0021355_2090_3154 | 349 |
| 504 | 3300037068 | Ga0373925_0112805 | Ga0373925_0112805_901_1965 | 349 |
| 505 | 3300046537 | Ga0495598_0014625 | Ga0495598_0014625_330_1394 | 349 |
| 506 | 3300046683 | Ga0495658_0072778 | Ga0495658_0072778_410_1474 | 349 |
| 507 | 3300048903 | Ga0496100_0094832 | Ga0496100_0094832_759_1823 | 349 |
| 508 | 3300048904 | Ga0496101_0021283 | Ga0496101_0021283_2927_3991 | 349 |
| 509 | 3300048905 | Ga0496102_0039941 | Ga0496102_0039941_1591_2655 | 349 |
| 510 | 3300048906 | Ga0496103_0026769 | Ga0496103_0026769_1696_2760 | 349 |
| 511 | 3300048909 | Ga0496106_0068836 | Ga0496106_0068836_199_1263 | 349 |
| 512 | 3300048910 | Ga0496107_0003168 | Ga0496107_0003168_4633_5697 | 349 |
| 513 | 3300048911 | Ga0496108_0104006 | Ga0496108_0104006_1085_2149 | 349 |
| 514 | 3300048912 | Ga0496109_0106734 | Ga0496109_0106734_1436_2500 | 349 |
| 515 | 3300048917 | Ga0496114_0025070 | Ga0496114_0025070_2660_3724 | 349 |
| 516 | 3300048917 | Ga0496114_0045754 | Ga0496114_0045754_1643_2707 | 349 |
| 517 | 3300048918 | Ga0496115_0015552 | Ga0496115_0015552_3651_4715 | 349 |
| 518 | 3300048929 | Ga0496126_0001095 | Ga0496126_0001095_37118_38170 | 349 |
| 519 | 3300005327 | Ga0070658_10002244 | Ga0070658_100022446 | 350 |
| 520 | 3300005436 | Ga0070713_100010418 | Ga0070713_1000104183 | 350 |
| 521 | 3300005467 | Ga0070706_100069378 | Ga0070706_1000693784 | 350 |
| 522 | 3300005468 | Ga0070707_100031670 | Ga0070707_1000316705 | 350 |
| 523 | 3300005563 | Ga0068855_100100071 | Ga0068855_1001000713 | 350 |
| 524 | 3300021361 | Ga0213872_10006901 | Ga0213872_100069015 | 350 |
| 525 | 3300021361 | Ga0213872_10025674 | Ga0213872_100256742 | 350 |
| 526 | 3300021361 | Ga0213872_10029387 | Ga0213872_100293871 | 350 |
| 527 | 3300021384 | Ga0213876_10006089 | Ga0213876_100060893 | 350 |
| 528 | 3300025910 | Ga0207684_10074822 | Ga0207684_100748222 | 350 |
| 529 | 3300025922 | Ga0207646_10030431 | Ga0207646_100304315 | 350 |
| 530 | 3300025928 | Ga0207700_10012001 | Ga0207700_100120014 | 350 |
| 531 | 3300025929 | Ga0207664_10115846 | Ga0207664_101158462 | 350 |
| 532 | 3300045049 | Ga0466959_0013891 | Ga0466959_0013891_919_2010 | 350 |
| 533 | 3300045976 | Ga0466967_0199175 | Ga0466967_0199175_372_1463 | 350 |
| 534 | 3300059490 | Ga0587066_000288 | Ga0587066_000288_1550_2641 | 350 |
| 535 | 3300059491 | Ga0587070_009408 | Ga0587070_009408_245_1336 | 350 |
| 536 | 3300059492 | Ga0587073_0011407 | Ga0587073_0011407_366_1457 | 350 |
| 537 | 3300059493 | Ga0587077_006973 | Ga0587077_006973_469_1560 | 350 |
| 538 | 3300059505 | Ga0587083_0009119 | Ga0587083_0009119_31_1122 | 350 |
| 539 | 3300059506 | Ga0587085_000714 | Ga0587085_000714_653_1744 | 350 |
| 540 | 3300059507 | Ga0587086_000022 | Ga0587086_000022_3055_4146 | 350 |
| 541 | 3300059508 | Ga0587088_011149 | Ga0587088_011149_190_1281 | 350 |
| 542 | 3300059509 | Ga0587089_001459 | Ga0587089_001459_50_1132 | 350 |
| 543 | 3300059512 | Ga0587092_004210 | Ga0587092_004210_561_1652 | 350 |
| 544 | 3300059513 | Ga0587094_001624 | Ga0587094_001624_245_1336 | 350 |
| 545 | 3300059514 | Ga0587095_001789 | Ga0587095_001789_17_1108 | 350 |
| 546 | 3300059605 | Ga0587106_006092 | Ga0587106_006092_256_1347 | 350 |
| 547 | 3300059622 | Ga0587099_005034 | Ga0587099_005034_24_1115 | 350 |
| 548 | 3300059626 | Ga0587115_007280 | Ga0587115_007280_17_1108 | 350 |
| 549 | 3300059627 | Ga0587117_005261 | Ga0587117_005261_249_1340 | 350 |
| 550 | 3300059639 | Ga0587062_002586 | Ga0587062_002586_354_1595 | 350 |
| 551 | 3300059642 | Ga0587069_005740 | Ga0587069_005740_358_1449 | 350 |
| 552 | 3300059643 | Ga0587072_014599 | Ga0587072_014599_169_1260 | 350 |
| 553 | 3300059645 | Ga0587076_000124 | Ga0587076_000124_3437_4528 | 350 |
| 554 | 3300059646 | Ga0587078_001339 | Ga0587078_001339_1002_2093 | 350 |
| 555 | 3300059647 | Ga0587079_004527 | Ga0587079_004527_508_1599 | 350 |
| 556 | 3300059649 | Ga0587102_002049 | Ga0587102_002049_349_1440 | 350 |
| 557 | 3300059652 | Ga0587107_005751 | Ga0587107_005751_186_1277 | 350 |
| 558 | 3300059654 | Ga0587110_000038 | Ga0587110_000038_2998_4089 | 350 |
| 559 | 3300060243 | Ga0587060_000305 | Ga0587060_000305_299_1390 | 350 |
| 560 | 3300060344 | Ga0587071_001621 | Ga0587071_001621_430_1521 | 350 |
| 561 | 3300060346 | Ga0587111_0014793 | Ga0587111_0014793_165_1256 | 350 |
| 562 | 3300005548 | Ga0070665_100000209 | Ga0070665_10000020954 | 351 |
| 563 | 3300025916 | Ga0207663_10170320 | Ga0207663_101703201 | 351 |
| 564 | 3300025931 | Ga0207644_10224919 | Ga0207644_102249191 | 351 |
| 565 | 3300026088 | Ga0207641_10189804 | Ga0207641_101898042 | 351 |
| 566 | 3300026095 | Ga0207676_10013312 | Ga0207676_100133123 | 351 |
| 567 | 3300026142 | Ga0207698_10066977 | Ga0207698_100669771 | 351 |
| 568 | 3300028379 | Ga0268266_10003104 | Ga0268266_1000310417 | 351 |
| 569 | 3300031548 | Ga0307408_100025250 | Ga0307408_1000252501 | 351 |
| 570 | 3300032002 | Ga0307416_100044811 | Ga0307416_1000448111 | 351 |
| 571 | 3300037853 | Ga0436364_0197022 | Ga0436364_0197022_50532_51590 | 351 |
| 572 | 3300037853 | Ga0436364_0824275 | Ga0436364_0824275_94_1152 | 351 |
| 573 | 3300048904 | Ga0496101_0088043 | Ga0496101_0088043_907_1965 | 351 |
| 574 | 3300048905 | Ga0496102_0041673 | Ga0496102_0041673_1655_2713 | 351 |
| 575 | 3300048906 | Ga0496103_0027895 | Ga0496103_0027895_1571_2629 | 351 |
| 576 | 3300048910 | Ga0496107_0139628 | Ga0496107_0139628_721_1779 | 351 |
| 577 | 3300048912 | Ga0496109_0001856 | Ga0496109_0001856_3135_4193 | 351 |
| 578 | 3300048914 | Ga0496111_0014249 | Ga0496111_0014249_1352_2410 | 351 |
| 579 | 3300048915 | Ga0496112_0081474 | Ga0496112_0081474_1324_2382 | 351 |
| 580 | 3300048916 | Ga0496113_0000866 | Ga0496113_0000866_7539_8597 | 351 |
| 581 | 3300049572 | Ga0501036_0018906 | Ga0501036_0018906_3477_4571 | 351 |
| 582 | 3300049579 | Ga0501043_0002651 | Ga0501043_0002651_1339_2433 | 351 |
| 583 | 3300049580 | Ga0501046_0000674 | Ga0501046_0000674_21612_22706 | 351 |
| 584 | 3300049581 | Ga0501047_0000007 | Ga0501047_0000007_420294_421388 | 351 |
| 585 | 3300049582 | Ga0501048_0000594 | Ga0501048_0000594_15404_16498 | 351 |
| 586 | 3300049584 | Ga0501068_0002714 | Ga0501068_0002714_517_1611 | 351 |
| 587 | 3300049586 | Ga0501070_0001351 | Ga0501070_0001351_9377_10471 | 351 |
| 588 | 3300049588 | Ga0501072_0000092 | Ga0501072_0000092_15430_16524 | 351 |
| 589 | 3300049589 | Ga0501073_0000791 | Ga0501073_0000791_11620_12714 | 351 |
| 590 | 3300049590 | Ga0501074_0001634 | Ga0501074_0001634_9952_11046 | 351 |
| 591 | 3300049741 | Ga0501079_0000314 | Ga0501079_0000314_2942_4036 | 351 |
| 592 | 3300049742 | Ga0501080_0010312 | Ga0501080_0010312_5075_6169 | 351 |
| 593 | 3300049744 | Ga0501083_0000473 | Ga0501083_0000473_11648_12742 | 351 |
| 594 | 3300053077 | Ga0495601_0063469 | Ga0495601_0063469_1057_2181 | 351 |
| 595 | 3300054114 | Ga0501084_0000043 | Ga0501084_0000043_21842_22936 | 351 |
| 596 | 3300059493 | Ga0587077_000661 | Ga0587077_000661_1976_3034 | 351 |
| 597 | 3300059505 | Ga0587083_0009389 | Ga0587083_0009389_113_1171 | 351 |
| 598 | 3300060353 | Ga0501082_0000697 | Ga0501082_0000697_26157_27251 | 351 |
| 599 | 3300005289 | Ga0065704_10098665 | Ga0065704_100986652 | 352 |
| 600 | 3300005329 | Ga0070683_100090432 | Ga0070683_1000904322 | 352 |
| 601 | 3300005434 | Ga0070709_10014230 | Ga0070709_100142302 | 352 |
| 602 | 3300005435 | Ga0070714_100054697 | Ga0070714_1000546972 | 352 |
| 603 | 3300005436 | Ga0070713_100024021 | Ga0070713_1000240213 | 352 |
| 604 | 3300005535 | Ga0070684_100264751 | Ga0070684_1002647512 | 352 |
| 605 | 3300006237 | Ga0097621_100285408 | Ga0097621_1002854082 | 352 |
| 606 | 3300025906 | Ga0207699_10011440 | Ga0207699_100114403 | 352 |
| 607 | 3300025913 | Ga0207695_10180752 | Ga0207695_101807522 | 352 |
| 608 | 3300025929 | Ga0207664_10094196 | Ga0207664_100941962 | 352 |
| 609 | 3300035117 | Ga0373953_0093178 | Ga0373953_0093178_26_1090 | 352 |
| 610 | 3300046472 | Ga0495580_0004707 | Ga0495580_0004707_6699_7763 | 352 |
| 611 | 3300047317 | Ga0495604_0072115 | Ga0495604_0072115_1063_2127 | 352 |
| 612 | 3300059491 | Ga0587070_003904 | Ga0587070_003904_685_1782 | 352 |
| 613 | 3300059506 | Ga0587085_003102 | Ga0587085_003102_49_1146 | 352 |
| 614 | 3300059507 | Ga0587086_003625 | Ga0587086_003625_405_1502 | 352 |
| 615 | 3300059508 | Ga0587088_005009 | Ga0587088_005009_558_1655 | 352 |
| 616 | 3300059511 | Ga0587091_012923 | Ga0587091_012923_178_1275 | 352 |
| 617 | 3300059642 | Ga0587069_001285 | Ga0587069_001285_522_1619 | 352 |
| 618 | 3300059646 | Ga0587078_001518 | Ga0587078_001518_834_1931 | 352 |
| 619 | 3300060346 | Ga0587111_0014455 | Ga0587111_0014455_62_1159 | 352 |
| 620 | 3300000546 | LJNas_1004690 | LJNas_10046902 | 353 |
| 621 | 3300005327 | Ga0070658_10040706 | Ga0070658_100407062 | 353 |
| 622 | 3300005327 | Ga0070658_10050969 | Ga0070658_100509691 | 353 |
| 623 | 3300005340 | Ga0070689_100158595 | Ga0070689_1001585952 | 353 |
| 624 | 3300005364 | Ga0070673_100011121 | Ga0070673_1000111215 | 353 |
| 625 | 3300005434 | Ga0070709_10151301 | Ga0070709_101513011 | 353 |
| 626 | 3300005439 | Ga0070711_100001726 | Ga0070711_1000017265 | 353 |
| 627 | 3300005439 | Ga0070711_100012190 | Ga0070711_1000121904 | 353 |
| 628 | 3300005439 | Ga0070711_100014039 | Ga0070711_1000140393 | 353 |
| 629 | 3300005439 | Ga0070711_100351990 | Ga0070711_1003519901 | 353 |
| 630 | 3300005459 | Ga0068867_100002185 | Ga0068867_10000218519 | 353 |
| 631 | 3300005530 | Ga0070679_100137210 | Ga0070679_1001372102 | 353 |
| 632 | 3300005843 | Ga0068860_100096817 | Ga0068860_1000968172 | 353 |
| 633 | 3300006028 | Ga0070717_10001768 | Ga0070717_100017682 | 353 |
| 634 | 3300006163 | Ga0070715_10016808 | Ga0070715_100168082 | 353 |
| 635 | 3300006163 | Ga0070715_10037142 | Ga0070715_100371421 | 353 |
| 636 | 3300006173 | Ga0070716_100027660 | Ga0070716_1000276602 | 353 |
| 637 | 3300006175 | Ga0070712_100000857 | Ga0070712_10000085712 | 353 |
| 638 | 3300006175 | Ga0070712_100002008 | Ga0070712_1000020081 | 353 |
| 639 | 3300006175 | Ga0070712_100005778 | Ga0070712_1000057782 | 353 |
| 640 | 3300006175 | Ga0070712_100032393 | Ga0070712_1000323932 | 353 |
| 641 | 3300006237 | Ga0097621_100273735 | Ga0097621_1002737352 | 353 |
| 642 | 3300009093 | Ga0105240_10008429 | Ga0105240_100084294 | 353 |
| 643 | 3300009093 | Ga0105240_10114744 | Ga0105240_101147444 | 353 |
| 644 | 3300009148 | Ga0105243_10001423 | Ga0105243_1000142319 | 353 |
| 645 | 3300009176 | Ga0105242_10014847 | Ga0105242_100148472 | 353 |
| 646 | 3300010375 | Ga0105239_10349985 | Ga0105239_103499851 | 353 |
| 647 | 3300020069 | Ga0197907_10306840 | Ga0197907_103068402 | 353 |
| 648 | 3300020069 | Ga0197907_10822851 | Ga0197907_108228512 | 353 |
| 649 | 3300020070 | Ga0206356_11137496 | Ga0206356_111374962 | 353 |
| 650 | 3300020075 | Ga0206349_1310841 | Ga0206349_13108412 | 353 |
| 651 | 3300020075 | Ga0206349_1374472 | Ga0206349_13744722 | 353 |
| 652 | 3300020076 | Ga0206355_1362144 | Ga0206355_13621442 | 353 |
| 653 | 3300020077 | Ga0206351_10102578 | Ga0206351_101025782 | 353 |
| 654 | 3300020078 | Ga0206352_10114043 | Ga0206352_101140432 | 353 |
| 655 | 3300020078 | Ga0206352_10477907 | Ga0206352_104779072 | 353 |
| 656 | 3300020080 | Ga0206350_10198345 | Ga0206350_101983452 | 353 |
| 657 | 3300020080 | Ga0206350_10605904 | Ga0206350_106059041 | 353 |
| 658 | 3300020080 | Ga0206350_11394896 | Ga0206350_113948962 | 353 |
| 659 | 3300020081 | Ga0206354_10172340 | Ga0206354_101723402 | 353 |
| 660 | 3300020082 | Ga0206353_12033768 | Ga0206353_120337682 | 353 |
| 661 | 3300022467 | Ga0224712_10040881 | Ga0224712_100408812 | 353 |
| 662 | 3300025904 | Ga0207647_10002566 | Ga0207647_100025663 | 353 |
| 663 | 3300025905 | Ga0207685_10007850 | Ga0207685_100078502 | 353 |
| 664 | 3300025909 | Ga0207705_10022733 | Ga0207705_100227332 | 353 |
| 665 | 3300025912 | Ga0207707_10007725 | Ga0207707_100077258 | 353 |
| 666 | 3300025913 | Ga0207695_10209941 | Ga0207695_102099412 | 353 |
| 667 | 3300025915 | Ga0207693_10000562 | Ga0207693_1000056212 | 353 |
| 668 | 3300025915 | Ga0207693_10001341 | Ga0207693_100013415 | 353 |
| 669 | 3300025915 | Ga0207693_10010151 | Ga0207693_100101512 | 353 |
| 670 | 3300025915 | Ga0207693_10105421 | Ga0207693_101054212 | 353 |
| 671 | 3300025916 | Ga0207663_10002120 | Ga0207663_100021207 | 353 |
| 672 | 3300025916 | Ga0207663_10026921 | Ga0207663_100269213 | 353 |
| 673 | 3300025921 | Ga0207652_10304107 | Ga0207652_103041071 | 353 |
| 674 | 3300025928 | Ga0207700_10000792 | Ga0207700_100007922 | 353 |
| 675 | 3300025928 | Ga0207700_10074046 | Ga0207700_100740461 | 353 |
| 676 | 3300025929 | Ga0207664_10073500 | Ga0207664_100735002 | 353 |
| 677 | 3300025935 | Ga0207709_10001174 | Ga0207709_100011743 | 353 |
| 678 | 3300025939 | Ga0207665_10012351 | Ga0207665_100123512 | 353 |
| 679 | 3300025939 | Ga0207665_10038369 | Ga0207665_100383693 | 353 |
| 680 | 3300025960 | Ga0207651_10019188 | Ga0207651_100191883 | 353 |
| 681 | 3300026078 | Ga0207702_10050447 | Ga0207702_100504471 | 353 |
| 682 | 3300026089 | Ga0207648_10329340 | Ga0207648_103293402 | 353 |
| 683 | 3300028381 | Ga0268264_10083282 | Ga0268264_100832822 | 353 |
| 684 | 3300035083 | Ga0373926_0011667 | Ga0373926_0011667_911_1975 | 353 |
| 685 | 3300035111 | Ga0373923_0059029 | Ga0373923_0059029_175_1239 | 353 |
| 686 | 3300035116 | Ga0373945_0015272 | Ga0373945_0015272_467_1531 | 353 |
| 687 | 3300035170 | Ga0373943_0014349 | Ga0373943_0014349_85_1149 | 353 |
| 688 | 3300035692 | Ga0373935_0019993 | Ga0373935_0019993_1149_2213 | 353 |
| 689 | 3300035692 | Ga0373935_0033091 | Ga0373935_0033091_1198_2262 | 353 |
| 690 | 3300035695 | Ga0373927_0007276 | Ga0373927_0007276_5223_6287 | 353 |
| 691 | 3300035725 | Ga0373947_0004634 | Ga0373947_0004634_4064_5128 | 353 |
| 692 | 3300035725 | Ga0373947_0134289 | Ga0373947_0134289_128_1192 | 353 |
| 693 | 3300037068 | Ga0373925_0069171 | Ga0373925_0069171_759_1823 | 353 |
| 694 | 3300037068 | Ga0373925_0169855 | Ga0373925_0169855_312_1376 | 353 |
| 695 | 3300037418 | Ga0395900_0169022 | Ga0395900_0169022_196_1287 | 353 |
| 696 | 3300037466 | Ga0395898_0026787 | Ga0395898_0026787_2854_3954 | 353 |
| 697 | 3300037471 | Ga0395905_0213364 | Ga0395905_0213364_504_1568 | 353 |
| 698 | 3300046463 | Ga0495653_0003430 | Ga0495653_0003430_3942_5006 | 353 |
| 699 | 3300046473 | Ga0495582_0006536 | Ga0495582_0006536_1220_2284 | 353 |
| 700 | 3300046473 | Ga0495582_0076021 | Ga0495582_0076021_97_1167 | 353 |
| 701 | 3300046473 | Ga0495582_0149342 | Ga0495582_0149342_38_1102 | 353 |
| 702 | 3300046477 | Ga0495664_0055757 | Ga0495664_0055757_32_1096 | 353 |
| 703 | 3300046477 | Ga0495664_0078175 | Ga0495664_0078175_654_1718 | 353 |
| 704 | 3300046511 | Ga0495608_0003788 | Ga0495608_0003788_4532_5635 | 353 |
| 705 | 3300046511 | Ga0495608_0005638 | Ga0495608_0005638_5391_6455 | 353 |
| 706 | 3300046517 | Ga0495630_0102751 | Ga0495630_0102751_260_1324 | 353 |
| 707 | 3300046529 | Ga0495652_0016044 | Ga0495652_0016044_1125_2189 | 353 |
| 708 | 3300046531 | Ga0495665_0000696 | Ga0495665_0000696_4299_5363 | 353 |
| 709 | 3300046543 | Ga0495645_0183413 | Ga0495645_0183413_196_1263 | 353 |
| 710 | 3300046675 | Ga0495657_0021903 | Ga0495657_0021903_2853_3917 | 353 |
| 711 | 3300046679 | Ga0495623_0040587 | Ga0495623_0040587_1876_2940 | 353 |
| 712 | 3300046680 | Ga0495646_0001675 | Ga0495646_0001675_5995_7059 | 353 |
| 713 | 3300046689 | Ga0495613_0029946 | Ga0495613_0029946_1071_2135 | 353 |
| 714 | 3300046690 | Ga0495624_0005371 | Ga0495624_0005371_182_1246 | 353 |
| 715 | 3300047317 | Ga0495604_0008626 | Ga0495604_0008626_5201_6265 | 353 |
| 716 | 3300047319 | Ga0495674_0099487 | Ga0495674_0099487_1401_2465 | 353 |
| 717 | 3300047319 | Ga0495674_0116027 | Ga0495674_0116027_558_1622 | 353 |
| 718 | 3300047444 | Ga0495675_0001996 | Ga0495675_0001996_3875_4939 | 353 |
| 719 | 3300047471 | Ga0495684_0013604 | Ga0495684_0013604_967_2031 | 353 |
| 720 | 3300048905 | Ga0496102_0161856 | Ga0496102_0161856_503_1567 | 353 |
| 721 | 3300048908 | Ga0496105_0070802 | Ga0496105_0070802_1210_2274 | 353 |
| 722 | 3300048911 | Ga0496108_0005312 | Ga0496108_0005312_3114_4178 | 353 |
| 723 | 3300048918 | Ga0496115_0009585 | Ga0496115_0009585_5326_6390 | 353 |
| 724 | 3300048918 | Ga0496115_0082131 | Ga0496115_0082131_1135_2235 | 353 |
| 725 | 3300053078 | Ga0495612_0001054 | Ga0495612_0001054_8293_9357 | 353 |
| 726 | 3300059477 | Ga0587084_010182 | Ga0587084_010182_65_1165 | 353 |
| 727 | 3300059478 | Ga0587093_007427 | Ga0587093_007427_59_1159 | 353 |
| 728 | 3300059490 | Ga0587066_000020 | Ga0587066_000020_72_1172 | 353 |
| 729 | 3300059490 | Ga0587066_014775 | Ga0587066_014775_37_1137 | 353 |
| 730 | 3300059491 | Ga0587070_000045 | Ga0587070_000045_66_1166 | 353 |
| 731 | 3300059491 | Ga0587070_015368 | Ga0587070_015368_62_1162 | 353 |
| 732 | 3300059492 | Ga0587073_0000029 | Ga0587073_0000029_206_1306 | 353 |
| 733 | 3300059492 | Ga0587073_0005921 | Ga0587073_0005921_166_1263 | 353 |
| 734 | 3300059492 | Ga0587073_0023047 | Ga0587073_0023047_64_1164 | 353 |
| 735 | 3300059493 | Ga0587077_000655 | Ga0587077_000655_66_1166 | 353 |
| 736 | 3300059503 | Ga0587080_000651 | Ga0587080_000651_1916_3016 | 353 |
| 737 | 3300059503 | Ga0587080_014401 | Ga0587080_014401_62_1162 | 353 |
| 738 | 3300059504 | Ga0587082_000603 | Ga0587082_000603_66_1166 | 353 |
| 739 | 3300059504 | Ga0587082_003022 | Ga0587082_003022_62_1162 | 353 |
| 740 | 3300059505 | Ga0587083_0003110 | Ga0587083_0003110_196_1293 | 353 |
| 741 | 3300059505 | Ga0587083_0004447 | Ga0587083_0004447_69_1169 | 353 |
| 742 | 3300059505 | Ga0587083_0015312 | Ga0587083_0015312_63_1163 | 353 |
| 743 | 3300059506 | Ga0587085_010730 | Ga0587085_010730_38_1138 | 353 |
| 744 | 3300059506 | Ga0587085_011711 | Ga0587085_011711_37_1137 | 353 |
| 745 | 3300059507 | Ga0587086_000034 | Ga0587086_000034_4941_6041 | 353 |
| 746 | 3300059507 | Ga0587086_007937 | Ga0587086_007937_62_1162 | 353 |
| 747 | 3300059508 | Ga0587088_000561 | Ga0587088_000561_72_1172 | 353 |
| 748 | 3300059508 | Ga0587088_016115 | Ga0587088_016115_19_1119 | 353 |
| 749 | 3300059509 | Ga0587089_009294 | Ga0587089_009294_66_1166 | 353 |
| 750 | 3300059510 | Ga0587090_011939 | Ga0587090_011939_63_1163 | 353 |
| 751 | 3300059510 | Ga0587090_014102 | Ga0587090_014102_37_1137 | 353 |
| 752 | 3300059511 | Ga0587091_000747 | Ga0587091_000747_66_1166 | 353 |
| 753 | 3300059512 | Ga0587092_004466 | Ga0587092_004466_163_1260 | 353 |
| 754 | 3300059512 | Ga0587092_011635 | Ga0587092_011635_65_1165 | 353 |
| 755 | 3300059513 | Ga0587094_000025 | Ga0587094_000025_62_1162 | 353 |
| 756 | 3300059513 | Ga0587094_003161 | Ga0587094_003161_509_1606 | 353 |
| 757 | 3300059513 | Ga0587094_011040 | Ga0587094_011040_51_1151 | 353 |
| 758 | 3300059514 | Ga0587095_000124 | Ga0587095_000124_1999_3099 | 353 |
| 759 | 3300059622 | Ga0587099_002764 | Ga0587099_002764_248_1348 | 353 |
| 760 | 3300059623 | Ga0587101_007780 | Ga0587101_007780_66_1166 | 353 |
| 761 | 3300059626 | Ga0587115_000052 | Ga0587115_000052_116_1216 | 353 |
| 762 | 3300059627 | Ga0587117_006832 | Ga0587117_006832_125_1225 | 353 |
| 763 | 3300059630 | Ga0587128_000027 | Ga0587128_000027_4831_5931 | 353 |
| 764 | 3300059630 | Ga0587128_012214 | Ga0587128_012214_60_1160 | 353 |
| 765 | 3300059631 | Ga0587130_000226 | Ga0587130_000226_1999_3099 | 353 |
| 766 | 3300059640 | Ga0587067_016270 | Ga0587067_016270_67_1167 | 353 |
| 767 | 3300059640 | Ga0587067_017032 | Ga0587067_017032_38_1138 | 353 |
| 768 | 3300059641 | Ga0587068_015362 | Ga0587068_015362_66_1166 | 353 |
| 769 | 3300059642 | Ga0587069_000417 | Ga0587069_000417_1999_3099 | 353 |
| 770 | 3300059642 | Ga0587069_010545 | Ga0587069_010545_51_1151 | 353 |
| 771 | 3300059643 | Ga0587072_018846 | Ga0587072_018846_66_1166 | 353 |
| 772 | 3300059644 | Ga0587075_000017 | Ga0587075_000017_66_1166 | 353 |
| 773 | 3300059644 | Ga0587075_010404 | Ga0587075_010404_67_1167 | 353 |
| 774 | 3300059645 | Ga0587076_014372 | Ga0587076_014372_59_1159 | 353 |
| 775 | 3300059646 | Ga0587078_000079 | Ga0587078_000079_3722_4822 | 353 |
| 776 | 3300059647 | Ga0587079_000044 | Ga0587079_000044_41_1141 | 353 |
| 777 | 3300059647 | Ga0587079_005793 | Ga0587079_005793_166_1263 | 353 |
| 778 | 3300059647 | Ga0587079_022117 | Ga0587079_022117_19_1119 | 353 |
| 779 | 3300059649 | Ga0587102_004086 | Ga0587102_004086_62_1162 | 353 |
| 780 | 3300059652 | Ga0587107_004923 | Ga0587107_004923_108_1208 | 353 |
| 781 | 3300059652 | Ga0587107_007700 | Ga0587107_007700_57_1157 | 353 |
| 782 | 3300059655 | Ga0587114_000221 | Ga0587114_000221_1999_3099 | 353 |
| 783 | 3300059659 | Ga0587120_001930 | Ga0587120_001930_193_1293 | 353 |
| 784 | 3300060344 | Ga0587071_019345 | Ga0587071_019345_69_1169 | 353 |
| 785 | 3300060344 | Ga0587071_019412 | Ga0587071_019412_66_1166 | 353 |
| 786 | 3300060346 | Ga0587111_0023562 | Ga0587111_0023562_66_1166 | 353 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fpi-assembly1.cif.gz_S | structure of fully reduced hydrogenase (hyd-1) variant e28q | 0.7713 | 19 | 275 |
| 4ucw-assembly1.cif.gz_A | structure of the t18v small subunit mutant of d. fructosovorans nife- hydrogenase | 0.7674 | 17 | 273 |
| 1cc1-assembly1.cif.gz_S | crystal structure of a reduced, active form of the ni-fe-se hydrogenase from desulfomicrobium baculatum | 0.752 | 22 | 294 |
| 7vxq-assembly1.cif.gz_B | the carbon monoxide complex of [nife]-hydrogenase (hyb-type) from citrobacter sp. s-77 | 0.7504 | 15 | 265 |
| 4ucx-assembly3.cif.gz_C | structure of the t18g small subunit mutant of d. fructosovorans nife- hydrogenase | 0.7468 | 20 | 291 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1cc1S01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.8695 | 22 | 219 | 3.40.50.700 |
| 5xvbS01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.8551 | 15 | 221 | 3.40.50.700 |
| 1cc1S01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.8402 | 22 | 219 | 3.40.50.700 |
| 5xvbS01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.8374 | 15 | 221 | 3.40.50.700 |
| 2frvA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.8329 | 17 | 220 | 3.40.50.700 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6IZK7-F1-model_v4 | Hydrogenase expression protein HypE | 0.978 | 15 | 183 |
GO:0008901
GO:0009055 GO:0009061 GO:0009375 GO:0016020 GO:0044569 GO:0051536 |
| AF-A0A7G1IIE2-F1-model_v4 | NADH:ubiquinone oxidoreductase-like 20kDa subunit domain-containing protein | 0.9769 | 93 | 220 |
GO:0008901
GO:0009055 GO:0009061 GO:0009375 GO:0016020 GO:0044569 GO:0051536 |
| AF-A0A535R529-F1-model_v4 | Hydrogenase expression protein HypE | 0.9755 | 18 | 175 |
GO:0008901
GO:0009055 GO:0009061 GO:0009375 GO:0016020 GO:0044569 GO:0051536 |
| AF-A0A7W1MXN0-F1-model_v4 | Hydrogenase expression protein HypE | 0.9612 | 14 | 209 |
GO:0008901
GO:0009055 GO:0009061 GO:0009375 GO:0016020 GO:0044569 GO:0051536 |
| AF-A0A7V9QYQ5-F1-model_v4 | Hydrogenase expression protein HypE | 0.9599 | 19 | 161 |
GO:0008901
GO:0009055 GO:0009061 GO:0009375 GO:0016020 GO:0044569 GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar