F480801

General Info

Members Datasets Scaffolds Average Seq Length
786 412 1568 301

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0000775|Ga0495638_0000775_7645_8637
Length 330
Sequence MRFRSVTAGIPPCYADRHTLKAKDVRMTELRFDGRVAVITGAGRGLGRAYALLLAAKGAKVVVNDPGSSMKGGDADIGVAEEVVQEIKAAGGEAVASTASVATPEGGAAIIQTAIDAYGKIDILVHNAGNVRGAPLKDMTQEDFDSVLDVHLRGAFHVVRPAYALMCKAGYGRIVLTSSIGGLYGSRNQANYAVSKAGAFALSHVAAIEGAEFGVKSNAIVPAAVTRMADGIDTSIYPPMEPDLVAPSVAWLAHESCSITGELLVSIAGRVAKAYIAETKGVYQPSWTIDEVAERMGEISDRTDPVVFEPVPSGHAEHIGYSFGMTKGQG

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
169 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
213 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
214 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
215 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
216 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
217 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
218 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
219 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
220 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
221 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
222 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
223 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
224 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
225 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
226 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
291 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
320 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
355 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
356 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
371 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
374 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
375 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
376 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
377 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
378 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
379 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
382 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
385 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
386 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
387 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
388 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
389 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
390 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
393 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
394 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
395 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
396 2643221692 Nocardia sp. Root136 Isolate Unclassified
397 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
398 2671180195 Frankia sp. CcI49 Isolate Nodule
399 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
400 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
401 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
402 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
403 2773857922 Frankia sp. CcI49 Isolate Nodule
404 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
405 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
406 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
407 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
408 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
409 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
410 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
411 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
412 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.43
Nodule 0.64
Rhizoplane 5.85
Rhizosphere 75.32
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0000775 3300046460 Bacteria 33734
2 JGI24745J21846_1001412 3300002073 Bacteria 2326
3 JGI24749J21850_1002547 3300002076 Bacteria 2560
4 JGI24744J21845_10000388 3300002077 Bacteria 7557
5 JGI24034J26672_10017432 3300002239 Bacteria 1111
6 JGI25165J46597_1000024 3300003214 Bacteria 335150
7 JGI25407J50210_10017581 3300003373 Bacteria 1856
8 JGI25407J50210_10030076 3300003373 Bacteria 1408
9 Ga0070683_100070955 3300005329 Bacteria 3250
10 Ga0070683_100672564 3300005329 Bacteria 991
11 Ga0070690_100024987 3300005330 Bacteria 3677
12 Ga0068869_100030091 3300005334 Bacteria 3809
13 Ga0070680_100169392 3300005336 Bacteria 1837
14 Ga0070682_100009064 3300005337 Bacteria 5625
15 Ga0070682_100024879 3300005337 Bacteria 3568
16 Ga0068868_100001850 3300005338 Bacteria 14534
17 Ga0068868_100015262 3300005338 Bacteria 5678
18 Ga0070660_100035739 3300005339 Bacteria 3761
19 Ga0070689_100000990 3300005340 Bacteria 17780
20 Ga0070689_100487393 3300005340 Bacteria 1054
21 Ga0070691_10005641 3300005341 Bacteria 5705
22 Ga0070668_100001103 3300005347 Bacteria 19039
23 Ga0070668_100004737 3300005347 Bacteria 10089
24 Ga0070668_100212198 3300005347 Bacteria 1593
25 Ga0070671_100015300 3300005355 Bacteria 6196
26 Ga0070671_100028284 3300005355 Bacteria 4616
27 Ga0070674_100111349 3300005356 Bacteria 2010
28 Ga0070673_100389363 3300005364 Bacteria 1244
29 Ga0070688_100197711 3300005365 Bacteria 1405
30 Ga0070667_100000699 3300005367 Bacteria 32344
31 Ga0070667_100157359 3300005367 Bacteria 1999
32 Ga0070667_100227583 3300005367 Bacteria 1662
33 Ga0070709_10004382 3300005434 Bacteria 7609
34 Ga0070714_100013621 3300005435 Bacteria 6520
35 Ga0070714_100208772 3300005435 Bacteria 1789
36 Ga0070714_100243514 3300005435 Bacteria 1660
37 Ga0070714_100249980 3300005435 Bacteria 1639
38 Ga0070713_100010613 3300005436 Bacteria 6663
39 Ga0070713_100121413 3300005436 Bacteria 2292
40 Ga0070713_100233315 3300005436 Bacteria 1673
41 Ga0070713_100474028 3300005436 Bacteria 1178
42 Ga0070710_10000303 3300005437 Bacteria 23421
43 Ga0070710_10003969 3300005437 Bacteria 7011
44 Ga0070710_10013073 3300005437 Bacteria 4144
45 Ga0070710_10148982 3300005437 Bacteria 1441
46 Ga0070701_10000604 3300005438 Bacteria 12533
47 Ga0070701_10080809 3300005438 Bacteria 1759
48 Ga0070711_100000758 3300005439 Bacteria 16795
49 Ga0070711_100001858 3300005439 Bacteria 11794
50 Ga0070711_100045409 3300005439 Bacteria 2988
51 Ga0070705_100001345 3300005440 Bacteria 13120
52 Ga0070700_100073058 3300005441 Bacteria 2195
53 Ga0070694_100003810 3300005444 Bacteria 9002
54 Ga0070663_100011629 3300005455 Bacteria 5532
55 Ga0070678_100194116 3300005456 Bacteria 1671
56 Ga0070662_100104769 3300005457 Bacteria 2146
57 Ga0068867_100079357 3300005459 Bacteria 2470
58 Ga0068867_100096676 3300005459 Bacteria 2249
59 Ga0068853_100001940 3300005539 Bacteria 15256
60 Ga0068853_100160279 3300005539 Bacteria 2030
61 Ga0068853_100461263 3300005539 Bacteria 1196
62 Ga0070696_100002906 3300005546 Bacteria 11389
63 Ga0070696_100020555 3300005546 Bacteria 4473
64 Ga0070693_100025400 3300005547 Bacteria 3188
65 Ga0070665_100004827 3300005548 Bacteria 14004
66 Ga0070665_100024605 3300005548 Bacteria 6068
67 Ga0070704_100001663 3300005549 Bacteria 12052
68 Ga0070704_100008698 3300005549 Bacteria 6105
69 Ga0068855_100086420 3300005563 Bacteria 3627
70 Ga0068854_100000552 3300005578 Bacteria 22587
71 Ga0070702_100000276 3300005615 Bacteria 17521
72 Ga0070702_100008985 3300005615 Bacteria 4868
73 Ga0070702_100271338 3300005615 Bacteria 1160
74 Ga0068852_100039656 3300005616 Bacteria 3967
75 Ga0068859_100002195 3300005617 Bacteria 19815
76 Ga0068859_100005251 3300005617 Bacteria 13164
77 Ga0068864_100072594 3300005618 Bacteria 3000
78 Ga0068866_10033042 3300005718 Bacteria 2506
79 Ga0068866_10037343 3300005718 Bacteria 2385
80 Ga0068866_10043683 3300005718 Bacteria 2238
81 Ga0068861_100001676 3300005719 Bacteria 14192
82 Ga0068861_100009533 3300005719 Bacteria 6708
83 Ga0068870_10113045 3300005840 Bacteria 1553
84 Ga0068863_100000469 3300005841 Bacteria 41274
85 Ga0068863_100038037 3300005841 Bacteria 4579
86 Ga0068858_100002942 3300005842 Bacteria 17128
87 Ga0068860_100000144 3300005843 Bacteria 116029
88 Ga0068860_100000694 3300005843 Bacteria 38692
89 Ga0068862_100000140 3300005844 Bacteria 81819
90 Ga0068862_100018065 3300005844 Bacteria 5874
91 Ga0081455_10011017 3300005937 Bacteria 9109
92 Ga0081455_10012394 3300005937 Bacteria 8508
93 Ga0081538_10001445 3300005981 Bacteria 24416
94 Ga0081538_10003887 3300005981 Bacteria 13950
95 Ga0081538_10029641 3300005981 Bacteria 3733
96 Ga0081538_10051699 3300005981 Bacteria 2464
97 Ga0081539_10014020 3300005985 Bacteria 5970
98 Ga0070717_10069846 3300006028 Bacteria 2926
99 Ga0075365_10057326 3300006038 Bacteria 2591
100 Ga0075365_10065754 3300006038 Bacteria 2431
101 Ga0075365_10104979 3300006038 Bacteria 1938
102 Ga0075365_10250416 3300006038 Bacteria 1245
103 Ga0075365_10298764 3300006038 Bacteria 1133
104 Ga0075368_10001040 3300006042 Bacteria 8693
105 Ga0075363_100000321 3300006048 Bacteria 14279
106 Ga0075363_100003739 3300006048 Bacteria 6549
107 Ga0075363_100014978 3300006048 Bacteria 3802
108 Ga0075363_100095855 3300006048 Bacteria 1638
109 Ga0075363_100137180 3300006048 Bacteria 1375
110 Ga0075364_10000297 3300006051 Bacteria 24128
111 Ga0075364_10005588 3300006051 Bacteria 7327
112 Ga0075364_10020746 3300006051 Bacteria 4135
113 Ga0075364_10027777 3300006051 Bacteria 3617
114 Ga0075364_10046793 3300006051 Bacteria 2817
115 Ga0075364_10074836 3300006051 Bacteria 2233
116 Ga0075432_10022267 3300006058 Bacteria 2167
117 Ga0070715_10065109 3300006163 Bacteria 1612
118 Ga0070716_100010458 3300006173 Bacteria 4653
119 Ga0070716_100015123 3300006173 Bacteria 3959
120 Ga0070716_100169125 3300006173 Bacteria 1425
121 Ga0070712_100000640 3300006175 Bacteria 20589
122 Ga0070712_100000757 3300006175 Bacteria 19007
123 Ga0070712_100010959 3300006175 Bacteria 5735
124 Ga0070712_100252342 3300006175 Bacteria 1410
125 Ga0075367_10015571 3300006178 Bacteria 4139
126 Ga0075369_10004887 3300006186 Bacteria 4989
127 Ga0075369_10108701 3300006186 Bacteria 1249
128 Ga0097621_100145902 3300006237 Bacteria 2026
129 Ga0075370_10000407 3300006353 Bacteria 15914
130 Ga0075370_10003962 3300006353 Bacteria 7113
131 Ga0075370_10005700 3300006353 Bacteria 6214
132 Ga0075370_10055487 3300006353 Bacteria 2251
133 Ga0068871_100038447 3300006358 Bacteria 3823
134 Ga0068871_100112976 3300006358 Bacteria 2287
135 Ga0075428_100001529 3300006844 Bacteria 24749
136 Ga0075428_100223847 3300006844 Bacteria 2031
137 Ga0075428_100424553 3300006844 Bacteria 1424
138 Ga0075430_100001536 3300006846 Bacteria 18850
139 Ga0075430_100046101 3300006846 Bacteria 3681
140 Ga0075430_100052139 3300006846 Bacteria 3446
141 Ga0075430_100073113 3300006846 Bacteria 2875
142 Ga0075430_100081259 3300006846 Bacteria 2715
143 Ga0075431_100049663 3300006847 Bacteria 4325
144 Ga0075431_100065755 3300006847 Bacteria 3744
145 Ga0075431_100126453 3300006847 Bacteria 2637
146 Ga0075431_100212617 3300006847 Bacteria 1975
147 Ga0075433_10079531 3300006852 Bacteria 2889
148 Ga0075434_100027539 3300006871 Bacteria 5582
149 Ga0075429_100022852 3300006880 Bacteria 5423
150 Ga0068865_100000497 3300006881 Bacteria 22023
151 Ga0068865_100085920 3300006881 Bacteria 2270
152 Ga0097620_100002195 3300006931 Bacteria 19815
153 Ga0097620_100005251 3300006931 Bacteria 13164
154 Ga0079104_1008904 3300006946 Bacteria 3449
155 Ga0075435_100440880 3300007076 Bacteria 1123
156 Ga0099795_10007303 3300007788 Bacteria 3076
157 Ga0105250_10007369 3300009092 Bacteria 4730
158 Ga0105240_10074231 3300009093 Bacteria 4198
159 Ga0111539_10025135 3300009094 Bacteria 7301
160 Ga0111539_10639336 3300009094 Bacteria 1239
161 Ga0105245_10020509 3300009098 Bacteria 5797
162 Ga0105245_10044553 3300009098 Bacteria 3960
163 Ga0105247_10000028 3300009101 Bacteria 201372
164 Ga0105247_10000541 3300009101 Bacteria 30700
165 Ga0105247_10184761 3300009101 Bacteria 1393
166 Ga0114129_10017983 3300009147 Bacteria 10065
167 Ga0114129_10128290 3300009147 Bacteria 3485
168 Ga0105243_10001274 3300009148 Bacteria 22612
169 Ga0105243_10093396 3300009148 Bacteria 2483
170 Ga0105243_10370659 3300009148 Bacteria 1321
171 Ga0105241_10031041 3300009174 Bacteria 3997
172 Ga0105241_10139286 3300009174 Bacteria 1974
173 Ga0105242_10000572 3300009176 Bacteria 29126
174 Ga0105242_10089702 3300009176 Bacteria 2585
175 Ga0105248_10000966 3300009177 Bacteria 32038
176 Ga0105248_10003057 3300009177 Bacteria 18555
177 Ga0105237_10003423 3300009545 Bacteria 18857
178 Ga0105237_10003478 3300009545 Bacteria 18674
179 Ga0105238_10376307 3300009551 Bacteria 1411
180 Ga0105249_10000013 3300009553 Bacteria 283609
181 Ga0105249_10005122 3300009553 Bacteria 11299
182 Ga0105249_10005554 3300009553 Bacteria 10900
183 Ga0105249_10286599 3300009553 Bacteria 1647
184 Ga0105030_104331 3300009987 Bacteria 1208
185 Ga0105239_10029208 3300010375 Bacteria 6062
186 Ga0105239_10033556 3300010375 Bacteria 5635
187 Ga0105239_10037557 3300010375 Bacteria 5307
188 Ga0105239_10130934 3300010375 Bacteria 2790
189 Ga0105239_10136112 3300010375 Bacteria 2735
190 Ga0105246_10060840 3300011119 Bacteria 2625
191 Ga0157369_10147178 3300013105 Bacteria 2490
192 Ga0157369_10418033 3300013105 Bacteria 1390
193 Ga0157378_10005513 3300013297 Bacteria 11089
194 Ga0157378_10443942 3300013297 Bacteria 1286
195 Ga0163162_10010009 3300013306 Bacteria 9221
196 Ga0163162_10211941 3300013306 Bacteria 2067
197 Ga0157372_10487872 3300013307 Bacteria 1437
198 Ga0157372_10727272 3300013307 Bacteria 1154
199 Ga0157375_10004501 3300013308 Bacteria 12117
200 Ga0163163_10077510 3300014325 Bacteria 3319
201 Ga0157380_10020137 3300014326 Bacteria 4983
202 Ga0157379_10032076 3300014968 Bacteria 4681
203 Ga0157379_10058333 3300014968 Bacteria 3451
204 Ga0157376_10010413 3300014969 Bacteria 6802
205 Ga0163161_10001874 3300017792 Bacteria 15351
206 Ga0213876_10002241 3300021384 Bacteria 11412
207 Ga0213876_10014394 3300021384 Bacteria 4191
208 Ga0213876_10103812 3300021384 Bacteria 1507
209 Ga0213876_10108339 3300021384 Bacteria 1474
210 Ga0213875_10052660 3300021388 Bacteria 1906
211 Ga0209026_1008149 3300025250 Bacteria 2231
212 Ga0209233_1000084 3300025261 Bacteria 335222
213 Ga0209051_1000011 3300025303 Bacteria 610828
214 Ga0209051_1011917 3300025303 Bacteria 4248
215 Ga0209051_1032325 3300025303 Bacteria 1999
216 Ga0207696_1016373 3300025711 Bacteria 2481
217 Ga0207653_10049845 3300025885 Bacteria 1391
218 Ga0207692_10002979 3300025898 Bacteria 6561
219 Ga0207692_10004482 3300025898 Bacteria 5534
220 Ga0207642_10004927 3300025899 Bacteria 4327
221 Ga0207642_10047842 3300025899 Bacteria 1914
222 Ga0207710_10000034 3300025900 Bacteria 256915
223 Ga0207688_10000299 3300025901 Bacteria 22710
224 Ga0207688_10060341 3300025901 Bacteria 2136
225 Ga0207647_10033578 3300025904 Bacteria 3285
226 Ga0207699_10002506 3300025906 Bacteria 8670
227 Ga0207671_10006692 3300025914 Bacteria 10209
228 Ga0207671_10039864 3300025914 Bacteria 3478
229 Ga0207693_10000174 3300025915 Bacteria 58853
230 Ga0207693_10006579 3300025915 Bacteria 9620
231 Ga0207693_10284229 3300025915 Bacteria 1296
232 Ga0207663_10001086 3300025916 Bacteria 12487
233 Ga0207663_10001237 3300025916 Bacteria 11785
234 Ga0207663_10001545 3300025916 Bacteria 10772
235 Ga0207660_10141917 3300025917 Bacteria 1837
236 Ga0207662_10300741 3300025918 Bacteria 1066
237 Ga0207657_10203569 3300025919 Bacteria 1591
238 Ga0207681_10003783 3300025923 Bacteria 9392
239 Ga0207694_10291295 3300025924 Bacteria 1343
240 Ga0207700_10014963 3300025928 Bacteria 5101
241 Ga0207700_10017525 3300025928 Bacteria 4787
242 Ga0207700_10060965 3300025928 Bacteria 2859
243 Ga0207700_10402150 3300025928 Bacteria 1200
244 Ga0207664_10073478 3300025929 Bacteria 2759
245 Ga0207664_10093392 3300025929 Bacteria 2471
246 Ga0207664_10122093 3300025929 Bacteria 2182
247 Ga0207644_10049053 3300025931 Bacteria 3021
248 Ga0207706_10005203 3300025933 Bacteria 12138
249 Ga0207706_10026827 3300025933 Bacteria 5156
250 Ga0207706_10196493 3300025933 Bacteria 1769
251 Ga0207686_10002261 3300025934 Bacteria 10567
252 Ga0207686_10074728 3300025934 Bacteria 2191
253 Ga0207686_10080528 3300025934 Bacteria 2123
254 Ga0207709_10072720 3300025935 Bacteria 2188
255 Ga0207709_10260454 3300025935 Bacteria 1271
256 Ga0207670_10010851 3300025936 Bacteria 5257
257 Ga0207669_10000561 3300025937 Bacteria 16244
258 Ga0207704_10000200 3300025938 Bacteria 30767
259 Ga0207704_10020444 3300025938 Bacteria 3502
260 Ga0207665_10003763 3300025939 Bacteria 10135
261 Ga0207665_10012661 3300025939 Bacteria 5546
262 Ga0207665_10078172 3300025939 Bacteria 2272
263 Ga0207665_10203203 3300025939 Bacteria 1444
264 Ga0207711_10000232 3300025941 Bacteria 59593
265 Ga0207689_10007640 3300025942 Bacteria 9467
266 Ga0207661_10046003 3300025944 Bacteria 3459
267 Ga0207667_10074699 3300025949 Bacteria 3520
268 Ga0207651_10309376 3300025960 Bacteria 1317
269 Ga0207651_10365695 3300025960 Bacteria 1219
270 Ga0207712_10000018 3300025961 Bacteria 317921
271 Ga0207712_10104097 3300025961 Bacteria 2116
272 Ga0207712_10303086 3300025961 Bacteria 1312
273 Ga0207712_10309285 3300025961 Bacteria 1300
274 Ga0207668_10003874 3300025972 Bacteria 8817
275 Ga0207668_10005637 3300025972 Bacteria 7374
276 Ga0207640_10002035 3300025981 Bacteria 10930
277 Ga0207658_10000410 3300025986 Bacteria 40700
278 Ga0207658_10125324 3300025986 Bacteria 2054
279 Ga0207658_10202252 3300025986 Bacteria 1659
280 Ga0207658_10281144 3300025986 Bacteria 1426
281 Ga0207677_10003505 3300026023 Bacteria 8319
282 Ga0207677_10187349 3300026023 Bacteria 1633
283 Ga0207703_10009678 3300026035 Bacteria 7565
284 Ga0207639_10004661 3300026041 Bacteria 9232
285 Ga0207639_10098886 3300026041 Bacteria 2353
286 Ga0207678_10019290 3300026067 Bacteria 5989
287 Ga0207708_10022631 3300026075 Bacteria 4746
288 Ga0207702_10176975 3300026078 Bacteria 1961
289 Ga0207641_10000803 3300026088 Bacteria 33579
290 Ga0207641_10048431 3300026088 Bacteria 3587
291 Ga0207648_10014029 3300026089 Bacteria 7422
292 Ga0207676_10060185 3300026095 Bacteria 3003
293 Ga0207676_10297022 3300026095 Bacteria 1473
294 Ga0207675_100000185 3300026118 Bacteria 56425
295 Ga0207675_100001287 3300026118 Bacteria 25128
296 Ga0207675_100140571 3300026118 Bacteria 2293
297 Ga0207683_10000357 3300026121 Bacteria 41951
298 Ga0207683_10472153 3300026121 Bacteria 1157
299 Ga0207698_10080233 3300026142 Bacteria 2628
300 Ga0209813_10000031 3300027866 Bacteria 65084
301 Ga0207428_10022421 3300027907 Bacteria 5330
302 Ga0207428_10207103 3300027907 Bacteria 1475
303 Ga0268266_10003124 3300028379 Bacteria 16848
304 Ga0268266_10022778 3300028379 Bacteria 5333
305 Ga0268266_10141044 3300028379 Bacteria 2163
306 Ga0268265_10000037 3300028380 Bacteria 202579
307 Ga0268264_10000005 3300028381 Bacteria 934972
308 Ga0268264_10001293 3300028381 Bacteria 23636
309 Ga0268264_10446582 3300028381 Bacteria 1252
310 Ga0265334_10000075 3300028573 Bacteria 72027
311 Ga0265334_10000193 3300028573 Bacteria 35275
312 Ga0265334_10001158 3300028573 Bacteria 12904
313 Ga0265334_10009352 3300028573 Bacteria 4145
314 Ga0307517_10091210 3300028786 Bacteria 2491
315 Ga0307515_10012587 3300028794 Bacteria 15903
316 Ga0307515_10016532 3300028794 Bacteria 13499
317 Ga0307511_10000581 3300030521 Bacteria 39122
318 Ga0307511_10002326 3300030521 Bacteria 19866
319 Ga0307511_10002988 3300030521 Bacteria 17500
320 Ga0307512_10027527 3300030522 Bacteria 4998
321 Ga0265327_10000807 3300031251 Bacteria 47731
322 Ga0307513_10009547 3300031456 Bacteria 12265
323 Ga0307509_10000224 3300031507 Bacteria 91320
324 Ga0307509_10030753 3300031507 Bacteria 5936
325 Ga0307509_10224785 3300031507 Bacteria 1686
326 Ga0307408_100112593 3300031548 Bacteria 2093
327 Ga0307508_10000103 3300031616 Bacteria 100310
328 Ga0307508_10063006 3300031616 Bacteria 3272
329 Ga0307508_10114700 3300031616 Bacteria 2295
330 Ga0307516_10000051 3300031730 Bacteria 129126
331 Ga0307516_10000258 3300031730 Bacteria 67844
332 Ga0307405_10025120 3300031731 Bacteria 3415
333 Ga0307405_10045280 3300031731 Bacteria 2695
334 Ga0307405_10067920 3300031731 Bacteria 2279
335 Ga0307413_10002266 3300031824 Bacteria 7774
336 Ga0307410_10022401 3300031852 Bacteria 3904
337 Ga0307410_10157489 3300031852 Bacteria 1698
338 Ga0307410_10203995 3300031852 Bacteria 1511
339 Ga0307406_10063781 3300031901 Bacteria 2388
340 Ga0307407_10016725 3300031903 Bacteria 3659
341 Ga0307409_100016461 3300031995 Bacteria 4892
342 Ga0307409_100071916 3300031995 Bacteria 2752
343 Ga0307409_100079000 3300031995 Bacteria 2649
344 Ga0307409_100477117 3300031995 Bacteria 1209
345 Ga0307416_100027493 3300032002 Bacteria 4214
346 Ga0307416_100132293 3300032002 Bacteria 2248
347 Ga0307416_100198427 3300032002 Bacteria 1901
348 Ga0307416_100821138 3300032002 Bacteria 1026
349 Ga0307414_10040109 3300032004 Bacteria 3160
350 Ga0307414_10053646 3300032004 Bacteria 2813
351 Ga0307411_10393284 3300032005 Bacteria 1144
352 Ga0307415_100013932 3300032126 Bacteria 4709
353 Ga0307415_100056074 3300032126 Bacteria 2699
354 Ga0307415_100076020 3300032126 Bacteria 2379
355 Ga0307415_100128383 3300032126 Bacteria 1914
356 Ga0307510_10000001 3300033180 Bacteria 1172244
357 Ga0307510_10101190 3300033180 Bacteria 2671
358 Ga0373926_0005714 3300035083 Bacteria 4107
359 Ga0373934_0028423 3300035086 Bacteria 2179
360 Ga0373944_0036540 3300035089 Bacteria 1501
361 Ga0373923_0027818 3300035111 Bacteria 2258
362 Ga0373936_0003620 3300035113 Bacteria 5806
363 Ga0373936_0005462 3300035113 Bacteria 4797
364 Ga0373936_0010337 3300035113 Bacteria 3521
365 Ga0373945_0006922 3300035116 Bacteria 3666
366 Ga0373953_0048224 3300035117 Bacteria 1715
367 Ga0373954_0015296 3300035118 Bacteria 3430
368 Ga0373957_0014130 3300035120 Bacteria 2723
369 Ga0373943_0001507 3300035170 Bacteria 10536
370 Ga0373946_0001034 3300035171 Bacteria 9562
371 Ga0373955_0005601 3300035172 Bacteria 5648
372 Ga0373935_0006951 3300035692 Bacteria 6754
373 Ga0373935_0075816 3300035692 Bacteria 2176
374 Ga0373935_0253028 3300035692 Bacteria 1233
375 Ga0373927_0014309 3300035695 Bacteria 5255
376 Ga0373927_0038144 3300035695 Bacteria 3120
377 Ga0373933_0008729 3300035724 Bacteria 5526
378 Ga0373947_0006673 3300035725 Bacteria 6696
379 Ga0373947_0033577 3300035725 Bacteria 3030
380 Ga0373937_0017639 3300036401 Bacteria 6367
381 Ga0373937_0032306 3300036401 Bacteria 4747
382 Ga0316584_0045765 3300036712 Bacteria 3267
383 Ga0373925_0006370 3300037068 Bacteria 8688
384 Ga0373925_0078035 3300037068 Bacteria 2514
385 Ga0436364_0984234 3300037853 Bacteria 13443
386 Ga0436364_1438140 3300037853 Bacteria 4562
387 Ga0436365_0212885 3300039437 Bacteria 3352
388 Ga0436365_0410802 3300039437 Bacteria 48863
389 Ga0436365_0726786 3300039437 Bacteria 10852
390 Ga0436365_1477449 3300039437 Bacteria 88029
391 Ga0436365_1693378 3300039437 Bacteria 1690
392 Ga0436363_0408098 3300039450 Bacteria 1459
393 Ga0439461_0015613 3300041410 Bacteria 1457
394 Ga0439465_0005822 3300041413 Bacteria 3924
395 Ga0439465_0005949 3300041413 Bacteria 3877
396 Ga0451853_1131694 3300041512 Bacteria 4056
397 Ga0451853_2943021 3300041512 Bacteria 2913
398 Ga0439442_003007 3300042002 Bacteria 3328
399 Ga0439445_0042743 3300042004 Bacteria 1208
400 Ga0439448_0004154 3300042005 Bacteria 4077
401 Ga0439450_001271 3300042008 Bacteria 3653
402 Ga0439450_038192 3300042008 Bacteria 1106
403 Ga0439463_000852 3300042016 Bacteria 8363
404 Ga0439463_021693 3300042016 Bacteria 1604
405 Ga0439463_029549 3300042016 Bacteria 1380
406 Ga0450914_003138 3300042118 Bacteria 1247
407 Ga0450888_007760 3300042126 Bacteria 1196
408 Ga0439434_0055438 3300042435 Bacteria 1234
409 Ga0439444_0004976 3300042437 Bacteria 1954
410 Ga0439444_0018329 3300042437 Bacteria 1211
411 Ga0439459_0014612 3300042438 Bacteria 1429
412 Ga0439464_0002820 3300042439 Bacteria 4316
413 Ga0439464_0008310 3300042439 Bacteria 2721
414 Ga0439460_0000953 3300042461 Bacteria 6634
415 Ga0439460_0002502 3300042461 Bacteria 4436
416 Ga0439460_0055097 3300042461 Bacteria 1201
417 Ga0450916_008220 3300042530 Bacteria 1266
418 Ga0450893_0014806 3300042532 Bacteria 1311
419 Ga0439440_0000037 3300042993 Bacteria 16781
420 Ga0439440_0000441 3300042993 Bacteria 6953
421 Ga0466972_0008307 3300044658 Bacteria 5205
422 Ga0466972_0079530 3300044658 Bacteria 1561
423 Ga0466972_0083063 3300044658 Bacteria 1524
424 Ga0466966_0009711 3300044684 Bacteria 6373
425 Ga0466966_0018319 3300044684 Bacteria 4619
426 Ga0466966_0027970 3300044684 Bacteria 3674
427 Ga0466961_0185953 3300044693 Bacteria 1289
428 Ga0466963_0047710 3300044694 Bacteria 2828
429 Ga0466963_0105814 3300044694 Bacteria 1929
430 Ga0466971_0008341 3300044719 Bacteria 4520
431 Ga0466968_0014692 3300044735 Bacteria 3097
432 Ga0466970_0003754 3300044765 Bacteria 7428
433 Ga0466957_0023261 3300044842 Bacteria 3662
434 Ga0466957_0028546 3300044842 Bacteria 3323
435 Ga0466957_0041787 3300044842 Bacteria 2772
436 Ga0466960_0000612 3300044901 Bacteria 12306
437 Ga0466960_0072672 3300044901 Bacteria 1715
438 Ga0466960_0165858 3300044901 Bacteria 1189
439 Ga0466959_0016504 3300045049 Bacteria 5396
440 Ga0466959_0093172 3300045049 Bacteria 2162
441 Ga0466958_0003750 3300045836 Bacteria 7933
442 Ga0466958_0017277 3300045836 Bacteria 4167
443 Ga0466958_0212938 3300045836 Bacteria 1232
444 Ga0466958_0273319 3300045836 Bacteria 1082
445 Ga0466967_0011389 3300045976 Bacteria 6733
446 Ga0466967_0245160 3300045976 Bacteria 1710
447 Ga0495617_040105 3300046452 Bacteria 1566
448 Ga0495592_0003854 3300046454 Bacteria 10849
449 Ga0495603_0000392 3300046455 Bacteria 24038
450 Ga0495629_0034799 3300046459 Bacteria 3561
451 Ga0495629_0038620 3300046459 Bacteria 3362
452 Ga0495638_0000021 3300046460 Bacteria 365602
453 Ga0495638_0000079 3300046460 Bacteria 157488
454 Ga0495638_0005327 3300046460 Bacteria 9593
455 Ga0495638_0005468 3300046460 Bacteria 9448
456 Ga0495638_0018901 3300046460 Bacteria 4567
457 Ga0495638_0031186 3300046460 Bacteria 3427
458 Ga0495641_0009377 3300046461 Bacteria 5819
459 Ga0495651_0014564 3300046462 Bacteria 6080
460 Ga0495651_0015630 3300046462 Bacteria 5875
461 Ga0495651_0129317 3300046462 Bacteria 1845
462 Ga0495653_0004186 3300046463 Bacteria 11679
463 Ga0495653_0023998 3300046463 Bacteria 4920
464 Ga0495653_0035051 3300046463 Bacteria 3962
465 Ga0495580_0030202 3300046472 Bacteria 3926
466 Ga0495582_0252989 3300046473 Bacteria 1010
467 Ga0495662_0004442 3300046476 Bacteria 7041
468 Ga0495662_0083527 3300046476 Bacteria 1554
469 Ga0495664_0002155 3300046477 Bacteria 10540
470 Ga0495664_0013119 3300046477 Bacteria 4700
471 Ga0495664_0047266 3300046477 Bacteria 2553
472 Ga0495585_0014006 3300046492 Bacteria 4683
473 Ga0495594_0000346 3300046499 Bacteria 23164
474 Ga0495607_0067515 3300046501 Bacteria 2009
475 Ga0495583_0000184 3300046506 Bacteria 105978
476 Ga0495583_0051232 3300046506 Bacteria 1883
477 Ga0495606_0113458 3300046507 Bacteria 1631
478 Ga0495608_0015802 3300046511 Bacteria 5224
479 Ga0495618_0018796 3300046514 Bacteria 4246
480 Ga0495628_0054358 3300046516 Bacteria 3157
481 Ga0495630_0040134 3300046517 Bacteria 3497
482 Ga0495632_0001605 3300046519 Bacteria 18623
483 Ga0495643_0016815 3300046522 Bacteria 4292
484 Ga0495648_0000026 3300046524 Bacteria 232162
485 Ga0495648_0023997 3300046524 Bacteria 4164
486 Ga0495648_0247641 3300046524 Bacteria 862
487 Ga0495666_0002366 3300046526 Bacteria 9404
488 Ga0495666_0003503 3300046526 Bacteria 7922
489 Ga0495652_0012509 3300046529 Bacteria 7652
490 Ga0495652_0022354 3300046529 Bacteria 5611
491 Ga0495652_0028240 3300046529 Bacteria 4938
492 Ga0495652_0364300 3300046529 Bacteria 1032
493 Ga0495665_0011775 3300046531 Bacteria 4740
494 Ga0495665_0018212 3300046531 Bacteria 3774
495 Ga0495640_0018082 3300046533 Bacteria 5237
496 Ga0495640_0027658 3300046533 Bacteria 4088
497 Ga0495640_0096987 3300046533 Bacteria 1939
498 Ga0495587_0022420 3300046536 Bacteria 3889
499 Ga0495587_0058150 3300046536 Bacteria 2272
500 Ga0495609_0018375 3300046538 Bacteria 3239
501 Ga0495645_0034489 3300046543 Bacteria 3691
502 Ga0495645_0043580 3300046543 Bacteria 3273
503 Ga0495622_0004494 3300046557 Bacteria 6465
504 Ga0495633_0006794 3300046558 Bacteria 6710
505 Ga0495633_0043976 3300046558 Bacteria 2117
506 Ga0495667_0010740 3300046559 Bacteria 6193
507 Ga0495667_0019830 3300046559 Bacteria 4537
508 Ga0495656_0041264 3300046615 Bacteria 1927
509 Ga0495634_0006670 3300046642 Bacteria 8750
510 Ga0495634_0104855 3300046642 Bacteria 1823
511 Ga0495634_0225790 3300046642 Bacteria 1154
512 Ga0495625_0000011 3300046660 Bacteria 377120
513 Ga0495625_0001593 3300046660 Bacteria 26884
514 Ga0495625_0008126 3300046660 Bacteria 8994
515 Ga0495625_0039288 3300046660 Bacteria 3457
516 Ga0495625_0132897 3300046660 Bacteria 1684
517 Ga0495635_0005201 3300046663 Bacteria 9054
518 Ga0495635_0204813 3300046663 Bacteria 1337
519 Ga0495659_0191081 3300046664 Bacteria 837
520 Ga0495657_0011856 3300046675 Bacteria 6498
521 Ga0495657_0013868 3300046675 Bacteria 5930
522 Ga0495657_0019531 3300046675 Bacteria 4887
523 Ga0495657_0033543 3300046675 Bacteria 3573
524 Ga0495623_0177115 3300046679 Bacteria 1241
525 Ga0495646_0009404 3300046680 Bacteria 6201
526 Ga0495658_0054062 3300046683 Bacteria 2283
527 Ga0495613_0012121 3300046689 Bacteria 6407
528 Ga0495624_0015301 3300046690 Bacteria 5185
529 Ga0495624_0015855 3300046690 Bacteria 5074
530 Ga0495671_0000050 3300046692 Bacteria 141936
531 Ga0495671_0080865 3300046692 Bacteria 1592
532 Ga0495600_0036643 3300046809 Bacteria 3188
533 Ga0495600_0039021 3300046809 Bacteria 3092
534 Ga0495600_0077588 3300046809 Bacteria 2169
535 Ga0495600_0172084 3300046809 Bacteria 1397
536 Ga0495660_0018669 3300046810 Bacteria 3984
537 Ga0495581_0035429 3300047315 Bacteria 2888
538 Ga0495581_0075068 3300047315 Bacteria 1956
539 Ga0495604_0002831 3300047317 Bacteria 13916
540 Ga0495604_0130485 3300047317 Bacteria 1807
541 Ga0495674_0006275 3300047319 Bacteria 11404
542 Ga0495674_0080999 3300047319 Bacteria 2785
543 Ga0495676_0010110 3300047321 Bacteria 8568
544 Ga0495676_0118520 3300047321 Bacteria 1930
545 Ga0495680_0003542 3300047322 Bacteria 15306
546 Ga0495680_0011457 3300047322 Bacteria 7850
547 Ga0495680_0014734 3300047322 Bacteria 6759
548 Ga0495683_0010205 3300047323 Bacteria 4974
549 Ga0495687_014854 3300047443 Bacteria 3981
550 Ga0495685_006268 3300047447 Bacteria 3888
551 Ga0495673_0000125 3300047469 Bacteria 141937
552 Ga0495684_0002173 3300047471 Bacteria 15710
553 Ga0495686_0009503 3300047472 Bacteria 6995
554 Ga0495593_0012198 3300047673 Bacteria 4914
555 Ga0495593_0020523 3300047673 Bacteria 3701
556 Ga0495593_0039902 3300047673 Bacteria 2529
557 Ga0495614_0017221 3300048089 Bacteria 3140
558 Ga0496100_0008048 3300048903 Bacteria 5858
559 Ga0496100_0050621 3300048903 Bacteria 2692
560 Ga0496101_0002045 3300048904 Bacteria 12278
561 Ga0496101_0007472 3300048904 Bacteria 7084
562 Ga0496101_0019226 3300048904 Bacteria 4661
563 Ga0496101_0068535 3300048904 Bacteria 2594
564 Ga0496101_0168607 3300048904 Bacteria 1682
565 Ga0496101_0295040 3300048904 Bacteria 1269
566 Ga0496102_0000063 3300048905 Bacteria 164782
567 Ga0496102_0001430 3300048905 Bacteria 21187
568 Ga0496102_0023055 3300048905 Bacteria 5524
569 Ga0496102_0176816 3300048905 Bacteria 2010
570 Ga0496102_0207940 3300048905 Bacteria 1845
571 Ga0496102_0249487 3300048905 Bacteria 1673
572 Ga0496103_0000406 3300048906 Bacteria 38170
573 Ga0496103_0000570 3300048906 Bacteria 29250
574 Ga0496103_0093776 3300048906 Bacteria 1896
575 Ga0496104_0002288 3300048907 Bacteria 16519
576 Ga0496104_0122396 3300048907 Bacteria 2497
577 Ga0496105_0000512 3300048908 Bacteria 25585
578 Ga0496105_0006219 3300048908 Bacteria 9160
579 Ga0496106_0000351 3300048909 Bacteria 32650
580 Ga0496106_0026480 3300048909 Bacteria 4318
581 Ga0496106_0058887 3300048909 Bacteria 2909
582 Ga0496106_0094859 3300048909 Bacteria 2307
583 Ga0496107_0000393 3300048910 Bacteria 23705
584 Ga0496107_0001217 3300048910 Bacteria 15690
585 Ga0496107_0136936 3300048910 Bacteria 1809
586 Ga0496109_0006671 3300048912 Bacteria 9718
587 Ga0496109_0319613 3300048912 Bacteria 1465
588 Ga0496110_0053099 3300048913 Bacteria 3562
589 Ga0496110_0092740 3300048913 Bacteria 2703
590 Ga0496111_0158447 3300048914 Bacteria 1680
591 Ga0496111_0226975 3300048914 Bacteria 1387
592 Ga0496112_0003599 3300048915 Bacteria 12891
593 Ga0496112_0047174 3300048915 Bacteria 4226
594 Ga0496112_0100130 3300048915 Bacteria 2868
595 Ga0496112_0243169 3300048915 Bacteria 1752
596 Ga0496113_0012719 3300048916 Bacteria 5667
597 Ga0496113_0033021 3300048916 Bacteria 3765
598 Ga0496113_0099908 3300048916 Bacteria 2248
599 Ga0496114_0002370 3300048917 Bacteria 14347
600 Ga0496114_0002795 3300048917 Bacteria 13366
601 Ga0496115_0005530 3300048918 Bacteria 9195
602 Ga0496115_0008396 3300048918 Bacteria 7643
603 Ga0496115_0350522 3300048918 Bacteria 1204
604 Ga0496116_0011287 3300048919 Bacteria 7413
605 Ga0496117_0001553 3300048920 Bacteria 32609
606 Ga0496117_0015708 3300048920 Bacteria 6430
607 Ga0496118_0000029 3300048921 Bacteria 340978
608 Ga0496118_0000317 3300048921 Bacteria 83419
609 Ga0496119_0008540 3300048922 Bacteria 8981
610 Ga0496121_0002697 3300048924 Bacteria 26534
611 Ga0496122_0048738 3300048925 Bacteria 3252
612 Ga0496123_0024912 3300048926 Bacteria 4528
613 Ga0496124_0017236 3300048927 Bacteria 6814
614 Ga0496124_0139110 3300048927 Bacteria 1918
615 Ga0496125_0040930 3300048928 Bacteria 3967
616 Ga0496125_0095084 3300048928 Bacteria 2218
617 Ga0496125_0107114 3300048928 Bacteria 2038
618 Ga0496126_0001315 3300048929 Bacteria 39505
619 Ga0496126_0014514 3300048929 Bacteria 7959
620 Ga0496126_0296844 3300048929 Bacteria 1334
621 Ga0495682_0121143 3300049460 Unclassified 937
622 Ga0501032_0003722 3300049569 Bacteria 11566
623 Ga0501032_0008315 3300049569 Bacteria 7561
624 Ga0501033_0089945 3300049570 Bacteria 2246
625 Ga0501033_0112606 3300049570 Bacteria 1979
626 Ga0501034_0005720 3300049571 Bacteria 13516
627 Ga0501034_0008339 3300049571 Bacteria 10963
628 Ga0501034_0067252 3300049571 Bacteria 3597
629 Ga0501034_0320663 3300049571 Bacteria 1483
630 Ga0501036_0006431 3300049572 Bacteria 9541
631 Ga0501036_0159647 3300049572 Bacteria 1901
632 Ga0501037_0000189 3300049573 Bacteria 57204
633 Ga0501037_0036110 3300049573 Bacteria 3643
634 Ga0501037_0129072 3300049573 Bacteria 1813
635 Ga0501038_0002485 3300049574 Bacteria 17146
636 Ga0501038_0007058 3300049574 Bacteria 10370
637 Ga0501039_0002659 3300049575 Bacteria 13346
638 Ga0501039_0011442 3300049575 Bacteria 6755
639 Ga0501040_0000331 3300049576 Bacteria 27776
640 Ga0501041_0003611 3300049577 Bacteria 8898
641 Ga0501042_0002613 3300049578 Bacteria 11075
642 Ga0501042_0347473 3300049578 Bacteria 1073
643 Ga0501043_0001090 3300049579 Bacteria 23858
644 Ga0501043_0057468 3300049579 Bacteria 3055
645 Ga0501046_0001177 3300049580 Bacteria 25444
646 Ga0501046_0005853 3300049580 Bacteria 10961
647 Ga0501046_0183468 3300049580 Bacteria 1564
648 Ga0501047_0006822 3300049581 Bacteria 10730
649 Ga0501047_0008100 3300049581 Bacteria 9915
650 Ga0501047_0027247 3300049581 Bacteria 5504
651 Ga0501047_0082967 3300049581 Bacteria 3081
652 Ga0501047_0082975 3300049581 Bacteria 3081
653 Ga0501047_0215472 3300049581 Bacteria 1777
654 Ga0501048_0008211 3300049582 Bacteria 7897
655 Ga0501048_0017851 3300049582 Bacteria 5221
656 Ga0501048_0134647 3300049582 Bacteria 1746
657 Ga0501069_0025159 3300049585 Bacteria 3252
658 Ga0501069_0034010 3300049585 Bacteria 2808
659 Ga0501070_0000361 3300049586 Bacteria 41441
660 Ga0501070_0004366 3300049586 Bacteria 12150
661 Ga0501070_0129503 3300049586 Bacteria 2085
662 Ga0501071_0006825 3300049587 Bacteria 7435
663 Ga0501072_0004629 3300049588 Bacteria 10477
664 Ga0501072_0025522 3300049588 Bacteria 4603
665 Ga0501073_0018775 3300049589 Bacteria 4999
666 Ga0501073_0021304 3300049589 Bacteria 4673
667 Ga0501074_0072649 3300049590 Bacteria 2471
668 Ga0501075_0011434 3300049591 Bacteria 6282
669 Ga0501075_0057870 3300049591 Bacteria 2919
670 Ga0501076_0001263 3300049592 Bacteria 16853
671 Ga0501076_0484527 3300049592 Bacteria 1019
672 Ga0501077_0004397 3300049593 Bacteria 8546
673 Ga0501077_0039900 3300049593 Bacteria 2991
674 Ga0501079_0000481 3300049741 Bacteria 26354
675 Ga0501080_0019989 3300049742 Bacteria 6199
676 Ga0501080_0069900 3300049742 Bacteria 3266
677 Ga0501080_0082072 3300049742 Bacteria 2995
678 Ga0501080_0206090 3300049742 Bacteria 1803
679 Ga0501081_0005255 3300049743 Bacteria 8344
680 Ga0501083_0085609 3300049744 Bacteria 2085
681 Ga0501035_0000284 3300049822 Bacteria 60210
682 Ga0501035_0004044 3300049822 Bacteria 13970
683 Ga0501035_0030520 3300049822 Bacteria 4912
684 Ga0501044_0000153 3300049823 Bacteria 85673
685 Ga0501044_0003328 3300049823 Bacteria 18110
686 Ga0501044_0003620 3300049823 Bacteria 17384
687 Ga0501044_0024603 3300049823 Bacteria 6390
688 Ga0501044_0062314 3300049823 Bacteria 3812
689 Ga0501044_0187373 3300049823 Bacteria 2033
690 Ga0501045_0000904 3300049824 Bacteria 19317
691 nmdc:mga03683_15288_c1 3300050489 Bacteria 2861
692 nmdc:mga03n38_1366_c1 3300050490 Bacteria 6918
693 nmdc:mga03n38_183484_c1 3300050490 Bacteria 1073
694 nmdc:mga03n38_22747_c1 3300050490 Bacteria 2541
695 nmdc:mga03n38_2864_c1 3300050490 Bacteria 5430
696 nmdc:mga03n38_34179_c1 3300050490 Bacteria 2169
697 nmdc:mga03n38_4825_c1 3300050490 Bacteria 4517
698 nmdc:mga03n38_8309_c1 3300050490 Bacteria 3718
699 nmdc:mga00v17_114496_c1 3300050491 Bacteria 1713
700 nmdc:mga00v17_163671_c1 3300050491 Bacteria 1433
701 nmdc:mga00v17_18012_c1 3300050491 Bacteria 4008
702 nmdc:mga00v17_4827_c1 3300050491 Bacteria 7061
703 nmdc:mga00v17_67615_c1 3300050491 Bacteria 2208
704 nmdc:mga00v17_8580_c1 3300050491 Bacteria 5502
705 nmdc:mga00v17_9246_c1 3300050491 Bacteria 5326
706 nmdc:mga0yw44_210719_c1 3300050492 Bacteria 1285
707 nmdc:mga0yw44_292944_c1 3300050492 Bacteria 1089
708 nmdc:mga0yw44_65620_c1 3300050492 Bacteria 2238
709 nmdc:mga0k408_106089_c1 3300050493 Bacteria 1659
710 nmdc:mga06z11_81191_c1 3300050494 Bacteria 1740
711 nmdc:mga06z11_81_c1 3300050494 Bacteria 40390
712 nmdc:mga04h51_54_c1 3300050495 Bacteria 36697
713 nmdc:mga07m45_150165_c1 3300050496 Bacteria 1351
714 nmdc:mga07m45_19834_c1 3300050496 Bacteria 3646
715 nmdc:mga07m45_2671_c1 3300050496 Bacteria 8407
716 nmdc:mga07m45_29680_c1 3300050496 Bacteria 3026
717 nmdc:mga05p37_16804_c1 3300050507 Bacteria 8821
718 nmdc:mga05p37_235288_c1 3300050507 Bacteria 2205
719 nmdc:mga05p37_97574_c1 3300050507 Bacteria 3620
720 nmdc:mga09592_73064_c1 3300050508 Bacteria 2914
721 nmdc:mga0qj67_123782_c1 3300050509 Bacteria 2092
722 nmdc:mga0qj67_173329_c1 3300050509 Bacteria 1752
723 nmdc:mga0qj67_18555_c1 3300050509 Bacteria 5302
724 nmdc:mga06r32_236381_c1 3300050510 Bacteria 1815
725 nmdc:mga06r32_7625_c1 3300050510 Bacteria 9733
726 nmdc:mga06r32_91777_c1 3300050510 Bacteria 2968
727 nmdc:mga08y16_314953_c1 3300050511 Bacteria 1611
728 nmdc:mga08y16_533776_c1 3300050511 Bacteria 1189
729 nmdc:mga08y16_5935_c1 3300050511 Bacteria 12801
730 nmdc:mga0a205_31201_c1 3300050515 Bacteria 5105
731 nmdc:mga0sz30_5025_c1 3300050516 Bacteria 4831
732 nmdc:mga0sz30_56405_c1 3300050516 Bacteria 1250
733 Ga0500610_0032756 3300053079 Bacteria 2648
734 Ga0500635_0002450 3300053080 Bacteria 4604
735 Ga0495619_0117517 3300053085 Bacteria 1821
736 Ga0500643_002385 3300053087 Bacteria 9773
737 Ga0500583_0010443 3300053092 Bacteria 3446
738 Ga0500556_0114634 3300053104 Bacteria 1047
739 Ga0500617_010689 3300053124 Bacteria 3806
740 Ga0500652_001260 3300053131 Bacteria 8043
741 Ga0500652_003647 3300053131 Bacteria 4684
742 Ga0500658_0075215 3300053134 Bacteria 1433
743 Ga0500559_0055994 3300053136 Bacteria 1750
744 Ga0500559_0101153 3300053136 Bacteria 1328
745 Ga0500568_0033142 3300053139 Bacteria 2121
746 Ga0500573_0117703 3300053140 Bacteria 1482
747 Ga0500588_0037754 3300053146 Bacteria 1436
748 Ga0500616_0040955 3300053153 Bacteria 2488
749 Ga0500616_0047237 3300053153 Bacteria 2286
750 Ga0500622_0002503 3300053156 Bacteria 13207
751 Ga0500622_0003142 3300053156 Bacteria 11320
752 Ga0500624_000066 3300053157 Bacteria 62660
753 Ga0500624_000126 3300053157 Bacteria 34188
754 Ga0500627_0051440 3300053158 Bacteria 1797
755 Ga0500637_0112814 3300053178 Bacteria 1576
756 Ga0500645_000006 3300053730 Bacteria 276677
757 Ga0501084_0017581 3300054114 Bacteria 5947
758 Ga0501084_0031720 3300054114 Bacteria 4418
759 Ga0590075_003606 3300059424 Bacteria 3675
760 Ga0501082_0002940 3300060353 Bacteria 14868
761 Ga0501082_0048956 3300060353 Bacteria 3644
762 Ga0501082_0050005 3300060353 Bacteria 3605
763 Ga0466962_0037484 3300061719 Bacteria 2321
764 Ga0530510_0001185 3300061734 Bacteria 17329
765 Ga0530510_0001961 3300061734 Bacteria 14092
766 2512646146 2512564014 Bacteria 4639632
767 2616693620 2616644814 Bacteria 11555299
768 2644511706 2643221692 Bacteria 7282860
769 2644635428 2643221715 Bacteria 6671032
770 2671833288 2671180195 Bacteria 9757215
771 2686539398 2684623035 Bacteria 8032739
772 2689993777 2687453743 Bacteria 8361025
773 2738886897 2738541308 Bacteria 7020677
774 2744958788 2744054611 Bacteria 5611514
775 2774851444 2773857922 Bacteria 9757215
776 2842139660 2842134933 Bacteria 5847019
777 2895887679 2895880812 Bacteria 11255272
778 2902804574 2902799365 Bacteria 5419524
779 2902813362 2902810491 Bacteria 6794147
780 2919713020 2919709256 Bacteria 4318106
781 2919713600 2919713450 Bacteria 7431245
782 2929217669 2929212328 Bacteria 7708288
783 2939587900 2939582691 Bacteria 7088898
784 3003006721 3002998708 Bacteria 11715108
785 Ga0495638_0000775
786 JGI24745J21846_1001412
787 JGI24749J21850_1002547
788 JGI24744J21845_10000388
789 JGI24034J26672_10017432
790 JGI25165J46597_1000024
791 JGI25407J50210_10017581
792 JGI25407J50210_10030076
793 Ga0070683_100070955
794 Ga0070683_100672564
795 Ga0070690_100024987
796 Ga0068869_100030091
797 Ga0070680_100169392
798 Ga0070682_100009064
799 Ga0070682_100024879
800 Ga0068868_100001850
801 Ga0068868_100015262
802 Ga0070660_100035739
803 Ga0070689_100000990
804 Ga0070689_100487393
805 Ga0070691_10005641
806 Ga0070668_100001103
807 Ga0070668_100004737
808 Ga0070668_100212198
809 Ga0070671_100015300
810 Ga0070671_100028284
811 Ga0070674_100111349
812 Ga0070673_100389363
813 Ga0070688_100197711
814 Ga0070667_100000699
815 Ga0070667_100157359
816 Ga0070667_100227583
817 Ga0070709_10004382
818 Ga0070714_100013621
819 Ga0070714_100208772
820 Ga0070714_100243514
821 Ga0070714_100249980
822 Ga0070713_100010613
823 Ga0070713_100121413
824 Ga0070713_100233315
825 Ga0070713_100474028
826 Ga0070710_10000303
827 Ga0070710_10003969
828 Ga0070710_10013073
829 Ga0070710_10148982
830 Ga0070701_10000604
831 Ga0070701_10080809
832 Ga0070711_100000758
833 Ga0070711_100001858
834 Ga0070711_100045409
835 Ga0070705_100001345
836 Ga0070700_100073058
837 Ga0070694_100003810
838 Ga0070663_100011629
839 Ga0070678_100194116
840 Ga0070662_100104769
841 Ga0068867_100079357
842 Ga0068867_100096676
843 Ga0068853_100001940
844 Ga0068853_100160279
845 Ga0068853_100461263
846 Ga0070696_100002906
847 Ga0070696_100020555
848 Ga0070693_100025400
849 Ga0070665_100004827
850 Ga0070665_100024605
851 Ga0070704_100001663
852 Ga0070704_100008698
853 Ga0068855_100086420
854 Ga0068854_100000552
855 Ga0070702_100000276
856 Ga0070702_100008985
857 Ga0070702_100271338
858 Ga0068852_100039656
859 Ga0068859_100002195
860 Ga0068859_100005251
861 Ga0068864_100072594
862 Ga0068866_10033042
863 Ga0068866_10037343
864 Ga0068866_10043683
865 Ga0068861_100001676
866 Ga0068861_100009533
867 Ga0068870_10113045
868 Ga0068863_100000469
869 Ga0068863_100038037
870 Ga0068858_100002942
871 Ga0068860_100000144
872 Ga0068860_100000694
873 Ga0068862_100000140
874 Ga0068862_100018065
875 Ga0081455_10011017
876 Ga0081455_10012394
877 Ga0081538_10001445
878 Ga0081538_10003887
879 Ga0081538_10029641
880 Ga0081538_10051699
881 Ga0081539_10014020
882 Ga0070717_10069846
883 Ga0075365_10057326
884 Ga0075365_10065754
885 Ga0075365_10104979
886 Ga0075365_10250416
887 Ga0075365_10298764
888 Ga0075368_10001040
889 Ga0075363_100000321
890 Ga0075363_100003739
891 Ga0075363_100014978
892 Ga0075363_100095855
893 Ga0075363_100137180
894 Ga0075364_10000297
895 Ga0075364_10005588
896 Ga0075364_10020746
897 Ga0075364_10027777
898 Ga0075364_10046793
899 Ga0075364_10074836
900 Ga0075432_10022267
901 Ga0070715_10065109
902 Ga0070716_100010458
903 Ga0070716_100015123
904 Ga0070716_100169125
905 Ga0070712_100000640
906 Ga0070712_100000757
907 Ga0070712_100010959
908 Ga0070712_100252342
909 Ga0075367_10015571
910 Ga0075369_10004887
911 Ga0075369_10108701
912 Ga0097621_100145902
913 Ga0075370_10000407
914 Ga0075370_10003962
915 Ga0075370_10005700
916 Ga0075370_10055487
917 Ga0068871_100038447
918 Ga0068871_100112976
919 Ga0075428_100001529
920 Ga0075428_100223847
921 Ga0075428_100424553
922 Ga0075430_100001536
923 Ga0075430_100046101
924 Ga0075430_100052139
925 Ga0075430_100073113
926 Ga0075430_100081259
927 Ga0075431_100049663
928 Ga0075431_100065755
929 Ga0075431_100126453
930 Ga0075431_100212617
931 Ga0075433_10079531
932 Ga0075434_100027539
933 Ga0075429_100022852
934 Ga0068865_100000497
935 Ga0068865_100085920
936 Ga0097620_100002195
937 Ga0097620_100005251
938 Ga0079104_1008904
939 Ga0075435_100440880
940 Ga0099795_10007303
941 Ga0105250_10007369
942 Ga0105240_10074231
943 Ga0111539_10025135
944 Ga0111539_10639336
945 Ga0105245_10020509
946 Ga0105245_10044553
947 Ga0105247_10000028
948 Ga0105247_10000541
949 Ga0105247_10184761
950 Ga0114129_10017983
951 Ga0114129_10128290
952 Ga0105243_10001274
953 Ga0105243_10093396
954 Ga0105243_10370659
955 Ga0105241_10031041
956 Ga0105241_10139286
957 Ga0105242_10000572
958 Ga0105242_10089702
959 Ga0105248_10000966
960 Ga0105248_10003057
961 Ga0105237_10003423
962 Ga0105237_10003478
963 Ga0105238_10376307
964 Ga0105249_10000013
965 Ga0105249_10005122
966 Ga0105249_10005554
967 Ga0105249_10286599
968 Ga0105030_104331
969 Ga0105239_10029208
970 Ga0105239_10033556
971 Ga0105239_10037557
972 Ga0105239_10130934
973 Ga0105239_10136112
974 Ga0105246_10060840
975 Ga0157369_10147178
976 Ga0157369_10418033
977 Ga0157378_10005513
978 Ga0157378_10443942
979 Ga0163162_10010009
980 Ga0163162_10211941
981 Ga0157372_10487872
982 Ga0157372_10727272
983 Ga0157375_10004501
984 Ga0163163_10077510
985 Ga0157380_10020137
986 Ga0157379_10032076
987 Ga0157379_10058333
988 Ga0157376_10010413
989 Ga0163161_10001874
990 Ga0213876_10002241
991 Ga0213876_10014394
992 Ga0213876_10103812
993 Ga0213876_10108339
994 Ga0213875_10052660
995 Ga0209026_1008149
996 Ga0209233_1000084
997 Ga0209051_1000011
998 Ga0209051_1011917
999 Ga0209051_1032325
1000 Ga0207696_1016373
1001 Ga0207653_10049845
1002 Ga0207692_10002979
1003 Ga0207692_10004482
1004 Ga0207642_10004927
1005 Ga0207642_10047842
1006 Ga0207710_10000034
1007 Ga0207688_10000299
1008 Ga0207688_10060341
1009 Ga0207647_10033578
1010 Ga0207699_10002506
1011 Ga0207671_10006692
1012 Ga0207671_10039864
1013 Ga0207693_10000174
1014 Ga0207693_10006579
1015 Ga0207693_10284229
1016 Ga0207663_10001086
1017 Ga0207663_10001237
1018 Ga0207663_10001545
1019 Ga0207660_10141917
1020 Ga0207662_10300741
1021 Ga0207657_10203569
1022 Ga0207681_10003783
1023 Ga0207694_10291295
1024 Ga0207700_10014963
1025 Ga0207700_10017525
1026 Ga0207700_10060965
1027 Ga0207700_10402150
1028 Ga0207664_10073478
1029 Ga0207664_10093392
1030 Ga0207664_10122093
1031 Ga0207644_10049053
1032 Ga0207706_10005203
1033 Ga0207706_10026827
1034 Ga0207706_10196493
1035 Ga0207686_10002261
1036 Ga0207686_10074728
1037 Ga0207686_10080528
1038 Ga0207709_10072720
1039 Ga0207709_10260454
1040 Ga0207670_10010851
1041 Ga0207669_10000561
1042 Ga0207704_10000200
1043 Ga0207704_10020444
1044 Ga0207665_10003763
1045 Ga0207665_10012661
1046 Ga0207665_10078172
1047 Ga0207665_10203203
1048 Ga0207711_10000232
1049 Ga0207689_10007640
1050 Ga0207661_10046003
1051 Ga0207667_10074699
1052 Ga0207651_10309376
1053 Ga0207651_10365695
1054 Ga0207712_10000018
1055 Ga0207712_10104097
1056 Ga0207712_10303086
1057 Ga0207712_10309285
1058 Ga0207668_10003874
1059 Ga0207668_10005637
1060 Ga0207640_10002035
1061 Ga0207658_10000410
1062 Ga0207658_10125324
1063 Ga0207658_10202252
1064 Ga0207658_10281144
1065 Ga0207677_10003505
1066 Ga0207677_10187349
1067 Ga0207703_10009678
1068 Ga0207639_10004661
1069 Ga0207639_10098886
1070 Ga0207678_10019290
1071 Ga0207708_10022631
1072 Ga0207702_10176975
1073 Ga0207641_10000803
1074 Ga0207641_10048431
1075 Ga0207648_10014029
1076 Ga0207676_10060185
1077 Ga0207676_10297022
1078 Ga0207675_100000185
1079 Ga0207675_100001287
1080 Ga0207675_100140571
1081 Ga0207683_10000357
1082 Ga0207683_10472153
1083 Ga0207698_10080233
1084 Ga0209813_10000031
1085 Ga0207428_10022421
1086 Ga0207428_10207103
1087 Ga0268266_10003124
1088 Ga0268266_10022778
1089 Ga0268266_10141044
1090 Ga0268265_10000037
1091 Ga0268264_10000005
1092 Ga0268264_10001293
1093 Ga0268264_10446582
1094 Ga0265334_10000075
1095 Ga0265334_10000193
1096 Ga0265334_10001158
1097 Ga0265334_10009352
1098 Ga0307517_10091210
1099 Ga0307515_10012587
1100 Ga0307515_10016532
1101 Ga0307511_10000581
1102 Ga0307511_10002326
1103 Ga0307511_10002988
1104 Ga0307512_10027527
1105 Ga0265327_10000807
1106 Ga0307513_10009547
1107 Ga0307509_10000224
1108 Ga0307509_10030753
1109 Ga0307509_10224785
1110 Ga0307408_100112593
1111 Ga0307508_10000103
1112 Ga0307508_10063006
1113 Ga0307508_10114700
1114 Ga0307516_10000051
1115 Ga0307516_10000258
1116 Ga0307405_10025120
1117 Ga0307405_10045280
1118 Ga0307405_10067920
1119 Ga0307413_10002266
1120 Ga0307410_10022401
1121 Ga0307410_10157489
1122 Ga0307410_10203995
1123 Ga0307406_10063781
1124 Ga0307407_10016725
1125 Ga0307409_100016461
1126 Ga0307409_100071916
1127 Ga0307409_100079000
1128 Ga0307409_100477117
1129 Ga0307416_100027493
1130 Ga0307416_100132293
1131 Ga0307416_100198427
1132 Ga0307416_100821138
1133 Ga0307414_10040109
1134 Ga0307414_10053646
1135 Ga0307411_10393284
1136 Ga0307415_100013932
1137 Ga0307415_100056074
1138 Ga0307415_100076020
1139 Ga0307415_100128383
1140 Ga0307510_10000001
1141 Ga0307510_10101190
1142 Ga0373926_0005714
1143 Ga0373934_0028423
1144 Ga0373944_0036540
1145 Ga0373923_0027818
1146 Ga0373936_0003620
1147 Ga0373936_0005462
1148 Ga0373936_0010337
1149 Ga0373945_0006922
1150 Ga0373953_0048224
1151 Ga0373954_0015296
1152 Ga0373957_0014130
1153 Ga0373943_0001507
1154 Ga0373946_0001034
1155 Ga0373955_0005601
1156 Ga0373935_0006951
1157 Ga0373935_0075816
1158 Ga0373935_0253028
1159 Ga0373927_0014309
1160 Ga0373927_0038144
1161 Ga0373933_0008729
1162 Ga0373947_0006673
1163 Ga0373947_0033577
1164 Ga0373937_0017639
1165 Ga0373937_0032306
1166 Ga0316584_0045765
1167 Ga0373925_0006370
1168 Ga0373925_0078035
1169 Ga0436364_0984234
1170 Ga0436364_1438140
1171 Ga0436365_0212885
1172 Ga0436365_0410802
1173 Ga0436365_0726786
1174 Ga0436365_1477449
1175 Ga0436365_1693378
1176 Ga0436363_0408098
1177 Ga0439461_0015613
1178 Ga0439465_0005822
1179 Ga0439465_0005949
1180 Ga0451853_1131694
1181 Ga0451853_2943021
1182 Ga0439442_003007
1183 Ga0439445_0042743
1184 Ga0439448_0004154
1185 Ga0439450_001271
1186 Ga0439450_038192
1187 Ga0439463_000852
1188 Ga0439463_021693
1189 Ga0439463_029549
1190 Ga0450914_003138
1191 Ga0450888_007760
1192 Ga0439434_0055438
1193 Ga0439444_0004976
1194 Ga0439444_0018329
1195 Ga0439459_0014612
1196 Ga0439464_0002820
1197 Ga0439464_0008310
1198 Ga0439460_0000953
1199 Ga0439460_0002502
1200 Ga0439460_0055097
1201 Ga0450916_008220
1202 Ga0450893_0014806
1203 Ga0439440_0000037
1204 Ga0439440_0000441
1205 Ga0466972_0008307
1206 Ga0466972_0079530
1207 Ga0466972_0083063
1208 Ga0466966_0009711
1209 Ga0466966_0018319
1210 Ga0466966_0027970
1211 Ga0466961_0185953
1212 Ga0466963_0047710
1213 Ga0466963_0105814
1214 Ga0466971_0008341
1215 Ga0466968_0014692
1216 Ga0466970_0003754
1217 Ga0466957_0023261
1218 Ga0466957_0028546
1219 Ga0466957_0041787
1220 Ga0466960_0000612
1221 Ga0466960_0072672
1222 Ga0466960_0165858
1223 Ga0466959_0016504
1224 Ga0466959_0093172
1225 Ga0466958_0003750
1226 Ga0466958_0017277
1227 Ga0466958_0212938
1228 Ga0466958_0273319
1229 Ga0466967_0011389
1230 Ga0466967_0245160
1231 Ga0495617_040105
1232 Ga0495592_0003854
1233 Ga0495603_0000392
1234 Ga0495629_0034799
1235 Ga0495629_0038620
1236 Ga0495638_0000021
1237 Ga0495638_0000079
1238 Ga0495638_0005327
1239 Ga0495638_0005468
1240 Ga0495638_0018901
1241 Ga0495638_0031186
1242 Ga0495641_0009377
1243 Ga0495651_0014564
1244 Ga0495651_0015630
1245 Ga0495651_0129317
1246 Ga0495653_0004186
1247 Ga0495653_0023998
1248 Ga0495653_0035051
1249 Ga0495580_0030202
1250 Ga0495582_0252989
1251 Ga0495662_0004442
1252 Ga0495662_0083527
1253 Ga0495664_0002155
1254 Ga0495664_0013119
1255 Ga0495664_0047266
1256 Ga0495585_0014006
1257 Ga0495594_0000346
1258 Ga0495607_0067515
1259 Ga0495583_0000184
1260 Ga0495583_0051232
1261 Ga0495606_0113458
1262 Ga0495608_0015802
1263 Ga0495618_0018796
1264 Ga0495628_0054358
1265 Ga0495630_0040134
1266 Ga0495632_0001605
1267 Ga0495643_0016815
1268 Ga0495648_0000026
1269 Ga0495648_0023997
1270 Ga0495648_0247641
1271 Ga0495666_0002366
1272 Ga0495666_0003503
1273 Ga0495652_0012509
1274 Ga0495652_0022354
1275 Ga0495652_0028240
1276 Ga0495652_0364300
1277 Ga0495665_0011775
1278 Ga0495665_0018212
1279 Ga0495640_0018082
1280 Ga0495640_0027658
1281 Ga0495640_0096987
1282 Ga0495587_0022420
1283 Ga0495587_0058150
1284 Ga0495609_0018375
1285 Ga0495645_0034489
1286 Ga0495645_0043580
1287 Ga0495622_0004494
1288 Ga0495633_0006794
1289 Ga0495633_0043976
1290 Ga0495667_0010740
1291 Ga0495667_0019830
1292 Ga0495656_0041264
1293 Ga0495634_0006670
1294 Ga0495634_0104855
1295 Ga0495634_0225790
1296 Ga0495625_0000011
1297 Ga0495625_0001593
1298 Ga0495625_0008126
1299 Ga0495625_0039288
1300 Ga0495625_0132897
1301 Ga0495635_0005201
1302 Ga0495635_0204813
1303 Ga0495659_0191081
1304 Ga0495657_0011856
1305 Ga0495657_0013868
1306 Ga0495657_0019531
1307 Ga0495657_0033543
1308 Ga0495623_0177115
1309 Ga0495646_0009404
1310 Ga0495658_0054062
1311 Ga0495613_0012121
1312 Ga0495624_0015301
1313 Ga0495624_0015855
1314 Ga0495671_0000050
1315 Ga0495671_0080865
1316 Ga0495600_0036643
1317 Ga0495600_0039021
1318 Ga0495600_0077588
1319 Ga0495600_0172084
1320 Ga0495660_0018669
1321 Ga0495581_0035429
1322 Ga0495581_0075068
1323 Ga0495604_0002831
1324 Ga0495604_0130485
1325 Ga0495674_0006275
1326 Ga0495674_0080999
1327 Ga0495676_0010110
1328 Ga0495676_0118520
1329 Ga0495680_0003542
1330 Ga0495680_0011457
1331 Ga0495680_0014734
1332 Ga0495683_0010205
1333 Ga0495687_014854
1334 Ga0495685_006268
1335 Ga0495673_0000125
1336 Ga0495684_0002173
1337 Ga0495686_0009503
1338 Ga0495593_0012198
1339 Ga0495593_0020523
1340 Ga0495593_0039902
1341 Ga0495614_0017221
1342 Ga0496100_0008048
1343 Ga0496100_0050621
1344 Ga0496101_0002045
1345 Ga0496101_0007472
1346 Ga0496101_0019226
1347 Ga0496101_0068535
1348 Ga0496101_0168607
1349 Ga0496101_0295040
1350 Ga0496102_0000063
1351 Ga0496102_0001430
1352 Ga0496102_0023055
1353 Ga0496102_0176816
1354 Ga0496102_0207940
1355 Ga0496102_0249487
1356 Ga0496103_0000406
1357 Ga0496103_0000570
1358 Ga0496103_0093776
1359 Ga0496104_0002288
1360 Ga0496104_0122396
1361 Ga0496105_0000512
1362 Ga0496105_0006219
1363 Ga0496106_0000351
1364 Ga0496106_0026480
1365 Ga0496106_0058887
1366 Ga0496106_0094859
1367 Ga0496107_0000393
1368 Ga0496107_0001217
1369 Ga0496107_0136936
1370 Ga0496109_0006671
1371 Ga0496109_0319613
1372 Ga0496110_0053099
1373 Ga0496110_0092740
1374 Ga0496111_0158447
1375 Ga0496111_0226975
1376 Ga0496112_0003599
1377 Ga0496112_0047174
1378 Ga0496112_0100130
1379 Ga0496112_0243169
1380 Ga0496113_0012719
1381 Ga0496113_0033021
1382 Ga0496113_0099908
1383 Ga0496114_0002370
1384 Ga0496114_0002795
1385 Ga0496115_0005530
1386 Ga0496115_0008396
1387 Ga0496115_0350522
1388 Ga0496116_0011287
1389 Ga0496117_0001553
1390 Ga0496117_0015708
1391 Ga0496118_0000029
1392 Ga0496118_0000317
1393 Ga0496119_0008540
1394 Ga0496121_0002697
1395 Ga0496122_0048738
1396 Ga0496123_0024912
1397 Ga0496124_0017236
1398 Ga0496124_0139110
1399 Ga0496125_0040930
1400 Ga0496125_0095084
1401 Ga0496125_0107114
1402 Ga0496126_0001315
1403 Ga0496126_0014514
1404 Ga0496126_0296844
1405 Ga0495682_0121143
1406 Ga0501032_0003722
1407 Ga0501032_0008315
1408 Ga0501033_0089945
1409 Ga0501033_0112606
1410 Ga0501034_0005720
1411 Ga0501034_0008339
1412 Ga0501034_0067252
1413 Ga0501034_0320663
1414 Ga0501036_0006431
1415 Ga0501036_0159647
1416 Ga0501037_0000189
1417 Ga0501037_0036110
1418 Ga0501037_0129072
1419 Ga0501038_0002485
1420 Ga0501038_0007058
1421 Ga0501039_0002659
1422 Ga0501039_0011442
1423 Ga0501040_0000331
1424 Ga0501041_0003611
1425 Ga0501042_0002613
1426 Ga0501042_0347473
1427 Ga0501043_0001090
1428 Ga0501043_0057468
1429 Ga0501046_0001177
1430 Ga0501046_0005853
1431 Ga0501046_0183468
1432 Ga0501047_0006822
1433 Ga0501047_0008100
1434 Ga0501047_0027247
1435 Ga0501047_0082967
1436 Ga0501047_0082975
1437 Ga0501047_0215472
1438 Ga0501048_0008211
1439 Ga0501048_0017851
1440 Ga0501048_0134647
1441 Ga0501069_0025159
1442 Ga0501069_0034010
1443 Ga0501070_0000361
1444 Ga0501070_0004366
1445 Ga0501070_0129503
1446 Ga0501071_0006825
1447 Ga0501072_0004629
1448 Ga0501072_0025522
1449 Ga0501073_0018775
1450 Ga0501073_0021304
1451 Ga0501074_0072649
1452 Ga0501075_0011434
1453 Ga0501075_0057870
1454 Ga0501076_0001263
1455 Ga0501076_0484527
1456 Ga0501077_0004397
1457 Ga0501077_0039900
1458 Ga0501079_0000481
1459 Ga0501080_0019989
1460 Ga0501080_0069900
1461 Ga0501080_0082072
1462 Ga0501080_0206090
1463 Ga0501081_0005255
1464 Ga0501083_0085609
1465 Ga0501035_0000284
1466 Ga0501035_0004044
1467 Ga0501035_0030520
1468 Ga0501044_0000153
1469 Ga0501044_0003328
1470 Ga0501044_0003620
1471 Ga0501044_0024603
1472 Ga0501044_0062314
1473 Ga0501044_0187373
1474 Ga0501045_0000904
1475 nmdc:mga03683_15288_c1
1476 nmdc:mga03n38_1366_c1
1477 nmdc:mga03n38_183484_c1
1478 nmdc:mga03n38_22747_c1
1479 nmdc:mga03n38_2864_c1
1480 nmdc:mga03n38_34179_c1
1481 nmdc:mga03n38_4825_c1
1482 nmdc:mga03n38_8309_c1
1483 nmdc:mga00v17_114496_c1
1484 nmdc:mga00v17_163671_c1
1485 nmdc:mga00v17_18012_c1
1486 nmdc:mga00v17_4827_c1
1487 nmdc:mga00v17_67615_c1
1488 nmdc:mga00v17_8580_c1
1489 nmdc:mga00v17_9246_c1
1490 nmdc:mga0yw44_210719_c1
1491 nmdc:mga0yw44_292944_c1
1492 nmdc:mga0yw44_65620_c1
1493 nmdc:mga0k408_106089_c1
1494 nmdc:mga06z11_81191_c1
1495 nmdc:mga06z11_81_c1
1496 nmdc:mga04h51_54_c1
1497 nmdc:mga07m45_150165_c1
1498 nmdc:mga07m45_19834_c1
1499 nmdc:mga07m45_2671_c1
1500 nmdc:mga07m45_29680_c1
1501 nmdc:mga05p37_16804_c1
1502 nmdc:mga05p37_235288_c1
1503 nmdc:mga05p37_97574_c1
1504 nmdc:mga09592_73064_c1
1505 nmdc:mga0qj67_123782_c1
1506 nmdc:mga0qj67_173329_c1
1507 nmdc:mga0qj67_18555_c1
1508 nmdc:mga06r32_236381_c1
1509 nmdc:mga06r32_7625_c1
1510 nmdc:mga06r32_91777_c1
1511 nmdc:mga08y16_314953_c1
1512 nmdc:mga08y16_533776_c1
1513 nmdc:mga08y16_5935_c1
1514 nmdc:mga0a205_31201_c1
1515 nmdc:mga0sz30_5025_c1
1516 nmdc:mga0sz30_56405_c1
1517 Ga0500610_0032756
1518 Ga0500635_0002450
1519 Ga0495619_0117517
1520 Ga0500643_002385
1521 Ga0500583_0010443
1522 Ga0500556_0114634
1523 Ga0500617_010689
1524 Ga0500652_001260
1525 Ga0500652_003647
1526 Ga0500658_0075215
1527 Ga0500559_0055994
1528 Ga0500559_0101153
1529 Ga0500568_0033142
1530 Ga0500573_0117703
1531 Ga0500588_0037754
1532 Ga0500616_0040955
1533 Ga0500616_0047237
1534 Ga0500622_0002503
1535 Ga0500622_0003142
1536 Ga0500624_000066
1537 Ga0500624_000126
1538 Ga0500627_0051440
1539 Ga0500637_0112814
1540 Ga0500645_000006
1541 Ga0501084_0017581
1542 Ga0501084_0031720
1543 Ga0590075_003606
1544 Ga0501082_0002940
1545 Ga0501082_0048956
1546 Ga0501082_0050005
1547 Ga0466962_0037484
1548 Ga0530510_0001185
1549 Ga0530510_0001961
1550 2512646146
1551 2616693620
1552 2644511706
1553 2644635428
1554 2671833288
1555 2686539398
1556 2689993777
1557 2738886897
1558 2744958788
1559 2774851444
1560 2842139660
1561 2895887679
1562 2902804574
1563 2902813362
1564 2919713020
1565 2919713600
1566 2929217669
1567 2939587900
1568 3003006721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

235

0.93

PF08659

KR

KR domain

36

213

0.85

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

269

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9395 6 243
3h7a-assembly1.cif.gz_D crystal structure of short-chain dehydrogenase from rhodopseudomonas palustris 0.9373 8 239
3s55-assembly1.cif.gz_C crystal structure of a putative short-chain dehydrogenase/reductase from mycobacterium abscessus bound to nad 0.9359 5 243
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.93 4 243
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9288 6 239
ID Description Score Start End Superfamily
1gz6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9789 2 246 3.40.50.720
1gz6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9709 2 246 3.40.50.720
af_P96825_7_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9665 9 281 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9648 3 248 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9569 5 92 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2G8B3N3-F1-model_v4 Short-chain dehydrogenase 0.9999 1 301 GO:0016491
AF-A0A100ZWE6-F1-model_v4 deleted 0.9997 1 307
AF-A0A7I7PD29-F1-model_v4 Short-chain dehydrogenase 0.9992 1 307 GO:0016491
AF-A0A538QU47-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9977 6 202 GO:0016491
AF-A0A1E3SLK0-F1-model_v4 Short-chain dehydrogenase 0.9976 1 302 GO:0016491

Map