F480769

General Info

Members Datasets Scaffolds Average Seq Length
785 488 631 337

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2921643360|2921648116
Length 397
Sequence QSGRFFAMGGALHAANVALHRRRRQLSLLQSPGLDVPVPMDVSRGIPRLDPFRLTEQSHMEFRQLGRCGLKVSTLTLGTMMFGDPTDEATAARIVDQAHEQGVNSIDTADVYAGGESERVVGRCIAARRDRWVLATKFASPFGDGDVNARGASRKHMVRAVEASLKRLKTDYIDLLYLHAEDHDTPVDETVRALNDLVQAGKLRYYGLSNHRAWKIAEFSHTAQALGLAAPVASQPLYNLANRQAEAEQLTAAHRYGLGVISYSPLARGVLTGKYELGVTPAADTRAGRGDRRLQQAEWRPESLELARRVREHAEARGLSAGQFALAWVLNSSYISSTIAGPRTAAQWDDYLPALSYRLNAEDENFVDSLVTTGHPSTPGFNDPKHLFFGRIPRHGS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
20 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
21 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
22 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
23 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
24 2643221651 Afipia sp. Root123D2 Isolate Unclassified
25 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
26 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
27 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
28 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
29 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
30 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
31 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
37 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
38 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
39 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
40 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
41 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
42 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
43 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
44 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
45 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
46 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
47 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
48 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
49 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
50 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
51 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
52 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
53 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
54 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
55 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
56 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
57 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
58 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
59 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
60 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
61 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
62 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
63 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
64 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
65 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
66 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
67 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
68 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
69 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
70 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
71 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
72 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
73 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
74 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
75 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
76 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
77 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
78 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
79 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
80 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
81 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
82 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
83 2906610324
84 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
85 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
86 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
87 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
88 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
89 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
90 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
91 2922425934
92 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
93 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
94 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
95 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
96 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
97 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
98 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
99 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
100 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
101 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
102 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
103 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
104 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
105 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
106 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
107 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
108 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
109 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
110 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
111 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
112 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
113 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
114 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
115 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
116 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
117 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
118 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
119 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
120 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
121 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
122 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
123 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
124 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
125 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
126 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
127 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
128 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
129 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
130 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
131 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
132 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
133 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
134 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
135 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
136 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
137 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
138 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
139 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
140 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
141 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
142 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
143 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
144 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
145 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
146 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
147 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
148 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
149 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
150 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
151 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
152 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
153 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
154 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
155 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
156 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
157 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
158 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
159 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
160 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
161 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
162 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
163 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
164 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
165 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
166 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
167 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
168 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
169 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
170 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
171 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
172 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
173 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
174 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
175 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
176 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
177 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
178 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
179 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
180 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
181 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
182 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
183 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
184 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
185 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
186 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
187 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
188 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
189 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
190 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
191 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
192 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
193 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
194 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
195 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
196 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
197 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
198 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
199 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
200 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
201 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
202 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
203 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
204 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
205 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
206 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
207 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
208 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
209 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
210 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
211 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
212 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
213 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
214 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
215 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
216 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
217 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
218 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
219 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
220 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
221 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
224 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
226 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
228 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
271 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
272 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
273 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
274 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
277 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
278 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
279 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
280 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
281 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
282 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
283 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
284 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
285 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
286 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
287 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
288 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
289 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
290 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
291 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
292 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
293 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
294 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
295 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
296 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
297 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
298 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
299 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
300 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
301 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
302 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
303 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
304 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
305 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
306 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
307 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
308 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
309 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
310 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
312 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
313 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
314 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
315 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
316 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
317 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
318 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
319 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
320 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
321 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
322 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
323 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
324 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
325 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
326 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
332 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
338 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
339 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
340 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
341 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
342 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
343 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
344 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
345 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
346 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
350 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
351 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
352 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
353 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
354 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
355 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
356 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
357 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
358 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
359 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
360 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
361 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
364 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
365 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
370 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
371 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
372 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
376 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
377 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
378 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
383 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
386 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
387 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
388 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
389 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
390 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
391 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
392 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
393 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
394 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
395 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
418 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
419 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
420 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
423 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
424 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
428 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
429 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
430 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
431 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
432 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
433 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
434 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
435 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
436 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
437 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
438 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
439 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
440 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
441 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
442 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
443 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
444 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
445 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
446 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
447 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
448 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
449 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
450 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
451 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
452 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
453 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
454 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
455 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
456 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
457 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
458 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
459 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
460 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
461 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
462 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
463 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
464 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
465 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
466 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
467 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
468 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
469 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
470 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
471 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
472 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
473 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
474 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
475 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
476 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
477 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
478 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
479 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
480 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
481 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
482 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
483 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
484 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
485 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
486 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
487 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
488 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.59
Metatranscriptomes 0
Isolates 19.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 9.94
Nodule 14.52
Rhizoplane 8.15
Rhizosphere 53.12
Stem 0
Stem Tuber 0
Unclassified 13.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000444 3300003215 Bacteria 26578
2 JGI25153J46596_10015260 3300003215 Bacteria 3141
3 JGI25160J50197_1000315 3300003354 Bacteria 33712
4 JGI25160J50197_1005926 3300003354 Bacteria 5019
5 Ga0055542_1011003 3300003762 Bacteria 1626
6 Ga0065703_1018760 3300005272 Bacteria 11110
7 Ga0070658_10451742 3300005327 Bacteria 1107
8 Ga0070676_10008898 3300005328 Bacteria 5426
9 Ga0070683_100050223 3300005329 Bacteria 3860
10 Ga0070683_100169113 3300005329 Bacteria 2075
11 Ga0070670_100106813 3300005331 Bacteria 2412
12 Ga0068869_100004903 3300005334 Bacteria 8375
13 Ga0068869_100080100 3300005334 Bacteria 2435
14 Ga0070666_10063713 3300005335 Bacteria 2499
15 Ga0070680_100321542 3300005336 Bacteria 1313
16 Ga0068868_100073984 3300005338 Bacteria 2721
17 Ga0068868_100095965 3300005338 Bacteria 2394
18 Ga0068868_100099586 3300005338 Bacteria 2351
19 Ga0070660_100003722 3300005339 Bacteria 10534
20 Ga0070660_100073680 3300005339 Bacteria 2670
21 Ga0070661_100079381 3300005344 Bacteria 2421
22 Ga0070668_100173993 3300005347 Bacteria 1754
23 Ga0070675_100118256 3300005354 Bacteria 2250
24 Ga0070671_100013249 3300005355 Bacteria 6645
25 Ga0070671_100032187 3300005355 Bacteria 4337
26 Ga0070673_100018784 3300005364 Bacteria 4950
27 Ga0070659_100049933 3300005366 Bacteria 3290
28 Ga0070709_10001618 3300005434 Bacteria 12166
29 Ga0070709_10011521 3300005434 Bacteria 4933
30 Ga0070709_10019652 3300005434 Bacteria 3909
31 Ga0070714_100026737 3300005435 Bacteria 4771
32 Ga0070714_100145426 3300005435 Bacteria 2132
33 Ga0070714_100201462 3300005435 Bacteria 1821
34 Ga0070714_100297481 3300005435 Bacteria 1504
35 Ga0070713_100020300 3300005436 Bacteria 5091
36 Ga0070713_100043116 3300005436 Bacteria 3687
37 Ga0070713_100053521 3300005436 Bacteria 3345
38 Ga0070710_10000566 3300005437 Bacteria 17559
39 Ga0070710_10000925 3300005437 Bacteria 13989
40 Ga0070711_100001428 3300005439 Bacteria 13122
41 Ga0070711_100017254 3300005439 Bacteria 4595
42 Ga0070711_100107078 3300005439 Bacteria 2045
43 Ga0070711_100175299 3300005439 Bacteria 1637
44 Ga0070663_100099935 3300005455 Bacteria 2163
45 Ga0070663_100211522 3300005455 Bacteria 1519
46 Ga0070678_100039233 3300005456 Bacteria 3339
47 Ga0070681_10135673 3300005458 Bacteria 2392
48 Ga0070681_10236997 3300005458 Bacteria 1738
49 Ga0068867_100102792 3300005459 Bacteria 2185
50 Ga0070698_100076738 3300005471 Bacteria 3343
51 Ga0070679_100055745 3300005530 Bacteria 3937
52 Ga0070679_100254855 3300005530 Bacteria 1710
53 Ga0070679_100317498 3300005530 Bacteria 1507
54 Ga0070697_100008732 3300005536 Bacteria 7911
55 Ga0068853_100011965 3300005539 Bacteria 7057
56 Ga0068853_100037105 3300005539 Bacteria 4145
57 Ga0068853_100079137 3300005539 Bacteria 2874
58 Ga0068853_100113341 3300005539 Bacteria 2411
59 Ga0068853_100115231 3300005539 Bacteria 2391
60 Ga0068853_100411764 3300005539 Bacteria 1267
61 Ga0070672_100120610 3300005543 Bacteria 2146
62 Ga0070695_100189905 3300005545 Bacteria 1461
63 Ga0070693_100106238 3300005547 Bacteria 1719
64 Ga0070665_100014802 3300005548 Bacteria 7830
65 Ga0070665_100020525 3300005548 Bacteria 6636
66 Ga0070665_100024499 3300005548 Bacteria 6078
67 Ga0070665_100046613 3300005548 Bacteria 4353
68 Ga0068855_100020872 3300005563 Bacteria 7856
69 Ga0068855_100300694 3300005563 Bacteria 1777
70 Ga0068855_100303425 3300005563 Bacteria 1768
71 Ga0068855_100513091 3300005563 Bacteria 1301
72 Ga0070664_100046711 3300005564 Bacteria 3658
73 Ga0068857_100037478 3300005577 Bacteria 4295
74 Ga0068857_100073096 3300005577 Bacteria 3055
75 Ga0068857_100181819 3300005577 Bacteria 1914
76 Ga0068854_100052524 3300005578 Bacteria 2923
77 Ga0068856_100006655 3300005614 Bacteria 11325
78 Ga0068852_100011995 3300005616 Bacteria 6555
79 Ga0068864_100069030 3300005618 Bacteria 3072
80 Ga0068861_100011506 3300005719 Bacteria 6155
81 Ga0068860_100079613 3300005843 Bacteria 3115
82 Ga0068860_100379886 3300005843 Bacteria 1394
83 Ga0081540_1047388 3300005983 Bacteria 2162
84 Ga0070717_10014191 3300006028 Bacteria 6126
85 Ga0075365_10058636 3300006038 Bacteria 2563
86 Ga0075365_10068713 3300006038 Bacteria 2380
87 Ga0075368_10064056 3300006042 Bacteria 1475
88 Ga0075363_100026264 3300006048 Bacteria 2978
89 Ga0075364_10001896 3300006051 Bacteria 11619
90 Ga0075364_10015026 3300006051 Bacteria 4793
91 Ga0075364_10114699 3300006051 Bacteria 1800
92 Ga0075364_10293352 3300006051 Bacteria 1107
93 Ga0070715_10017950 3300006163 Bacteria 2687
94 Ga0070716_100073695 3300006173 Bacteria 2015
95 Ga0070716_100110834 3300006173 Bacteria 1700
96 Ga0070712_100035658 3300006175 Bacteria 3377
97 Ga0070712_100036076 3300006175 Bacteria 3361
98 Ga0075369_10030233 3300006186 Bacteria 2280
99 Ga0075366_10149265 3300006195 Bacteria 1415
100 Ga0075370_10000323 3300006353 Bacteria 17249
101 Ga0075370_10004189 3300006353 Bacteria 6962
102 Ga0075370_10031567 3300006353 Bacteria 2958
103 Ga0075370_10077834 3300006353 Bacteria 1903
104 Ga0075370_10105704 3300006353 Bacteria 1632
105 Ga0075370_10115628 3300006353 Bacteria 1559
106 Ga0068871_100132218 3300006358 Bacteria 2116
107 Ga0068871_100215989 3300006358 Bacteria 1660
108 Ga0075434_100129119 3300006871 Bacteria 2545
109 Ga0075436_100087875 3300006914 Bacteria 2159
110 Ga0099825_1025040 3300006941 Bacteria 3383
111 Ga0099823_1031705 3300006944 Bacteria 4344
112 Ga0099795_10007335 3300007788 Bacteria 3070
113 Ga0105251_10012259 3300009011 Bacteria 4858
114 Ga0105240_10005321 3300009093 Bacteria 19204
115 Ga0105240_10013244 3300009093 Bacteria 11341
116 Ga0105240_10197718 3300009093 Bacteria 2358
117 Ga0105245_10012703 3300009098 Bacteria 7332
118 Ga0105245_10363541 3300009098 Bacteria 1437
119 Ga0105247_10041566 3300009101 Bacteria 2814
120 Ga0105247_10078186 3300009101 Bacteria 2080
121 Ga0105241_10014257 3300009174 Bacteria 5821
122 Ga0105241_10020801 3300009174 Bacteria 4850
123 Ga0105242_10246649 3300009176 Bacteria 1608
124 Ga0105248_10638701 3300009177 Bacteria 1201
125 Ga0105237_10003169 3300009545 Bacteria 19752
126 Ga0105237_10009459 3300009545 Bacteria 10438
127 Ga0105237_10081223 3300009545 Bacteria 3232
128 Ga0105237_10355299 3300009545 Bacteria 1470
129 Ga0105238_10009011 3300009551 Bacteria 9983
130 Ga0105238_10011439 3300009551 Bacteria 8937
131 Ga0105238_10020137 3300009551 Bacteria 6790
132 Ga0105238_10176178 3300009551 Bacteria 2115
133 Ga0105238_10249570 3300009551 Bacteria 1753
134 Ga0105239_10097983 3300010375 Bacteria 3241
135 Ga0105239_10122139 3300010375 Bacteria 2893
136 Ga0105239_10130647 3300010375 Bacteria 2793
137 Ga0105239_10253658 3300010375 Bacteria 1976
138 Ga0105246_10001029 3300011119 Bacteria 16043
139 Ga0105246_10115837 3300011119 Bacteria 1977
140 Ga0157369_10017540 3300013105 Bacteria 8044
141 Ga0157369_10042613 3300013105 Bacteria 4951
142 Ga0157374_10003036 3300013296 Bacteria 14072
143 Ga0157378_10143562 3300013297 Bacteria 2219
144 Ga0163162_10014003 3300013306 Bacteria 7839
145 Ga0163162_10427903 3300013306 Bacteria 1456
146 Ga0157372_10096123 3300013307 Bacteria 3376
147 Ga0163163_10001500 3300014325 Bacteria 19760
148 Ga0163163_10003001 3300014325 Bacteria 14279
149 Ga0163163_10011177 3300014325 Bacteria 8130
150 Ga0157379_10002566 3300014968 Bacteria 15242
151 Ga0157379_10085638 3300014968 Bacteria 2825
152 Ga0157379_10089854 3300014968 Bacteria 2756
153 Ga0157376_10188389 3300014969 Bacteria 1890
154 Ga0157376_10222859 3300014969 Bacteria 1748
155 Ga0163161_10138139 3300017792 Bacteria 1844
156 Ga0163161_10145289 3300017792 Bacteria 1798
157 Ga0214544_1000007 3300021320 Bacteria 379989
158 Ga0214542_1000007 3300021321 Bacteria 291816
159 Ga0214545_1000006 3300021324 Bacteria 291693
160 Ga0214543_1000009 3300021327 Bacteria 384302
161 Ga0213874_10010374 3300021377 Bacteria 2331
162 Ga0213876_10002030 3300021384 Bacteria 12044
163 Ga0213875_10072080 3300021388 Bacteria 1613
164 Ga0213871_10009984 3300021441 Bacteria 2141
165 Ga0209677_100307 3300025253 Bacteria 32029
166 Ga0209677_102975 3300025253 Bacteria 5890
167 Ga0209148_1000300 3300025254 Bacteria 71458
168 Ga0209148_1008591 3300025254 Bacteria 2044
169 Ga0209233_1007847 3300025261 Bacteria 3349
170 Ga0209233_1013321 3300025261 Bacteria 2351
171 Ga0209564_1001250 3300025295 Bacteria 28258
172 Ga0209758_1000161 3300025297 Bacteria 154278
173 Ga0209758_1002452 3300025297 Bacteria 18922
174 Ga0209758_1002465 3300025297 Bacteria 18851
175 Ga0209758_1009921 3300025297 Bacteria 5806
176 Ga0209758_1033846 3300025297 Bacteria 2044
177 Ga0209256_1028780 3300025299 Bacteria 1561
178 Ga0207426_1000789 3300025302 Bacteria 34529
179 Ga0207655_1009998 3300025728 Bacteria 5816
180 Ga0207692_10000997 3300025898 Bacteria 10329
181 Ga0207692_10011347 3300025898 Bacteria 3787
182 Ga0207688_10059672 3300025901 Bacteria 2148
183 Ga0207688_10082474 3300025901 Bacteria 1838
184 Ga0207680_10077895 3300025903 Bacteria 2075
185 Ga0207685_10017518 3300025905 Bacteria 2319
186 Ga0207699_10003784 3300025906 Bacteria 7223
187 Ga0207699_10055190 3300025906 Bacteria 2363
188 Ga0207684_10170355 3300025910 Bacteria 1877
189 Ga0207654_10010355 3300025911 Bacteria 4748
190 Ga0207707_10024130 3300025912 Bacteria 5319
191 Ga0207707_10088161 3300025912 Bacteria 2710
192 Ga0207695_10000006 3300025913 Bacteria 1135309
193 Ga0207695_10096550 3300025913 Bacteria 2957
194 Ga0207671_10032989 3300025914 Bacteria 3854
195 Ga0207671_10062564 3300025914 Bacteria 2764
196 Ga0207671_10084211 3300025914 Bacteria 2388
197 Ga0207671_10296290 3300025914 Bacteria 1277
198 Ga0207693_10000613 3300025915 Bacteria 31929
199 Ga0207693_10010008 3300025915 Bacteria 7707
200 Ga0207693_10082715 3300025915 Bacteria 2514
201 Ga0207693_10165330 3300025915 Bacteria 1742
202 Ga0207663_10000464 3300025916 Bacteria 17663
203 Ga0207663_10008879 3300025916 Bacteria 5285
204 Ga0207660_10018171 3300025917 Bacteria 4682
205 Ga0207657_10002667 3300025919 Bacteria 19257
206 Ga0207657_10006315 3300025919 Bacteria 12312
207 Ga0207652_10116431 3300025921 Bacteria 2374
208 Ga0207652_10354739 3300025921 Bacteria 1324
209 Ga0207646_10100188 3300025922 Bacteria 2597
210 Ga0207694_10011452 3300025924 Bacteria 6693
211 Ga0207694_10043027 3300025924 Bacteria 3485
212 Ga0207694_10136196 3300025924 Bacteria 1972
213 Ga0207694_10144762 3300025924 Bacteria 1912
214 Ga0207650_10162210 3300025925 Bacteria 1772
215 Ga0207687_10021465 3300025927 Bacteria 4291
216 Ga0207700_10016153 3300025928 Bacteria 4950
217 Ga0207700_10035980 3300025928 Bacteria 3572
218 Ga0207700_10077565 3300025928 Bacteria 2581
219 Ga0207664_10071799 3300025929 Bacteria 2789
220 Ga0207664_10159572 3300025929 Bacteria 1922
221 Ga0207644_10009024 3300025931 Bacteria 6537
222 Ga0207690_10080187 3300025932 Bacteria 2277
223 Ga0207706_10164385 3300025933 Bacteria 1950
224 Ga0207686_10043916 3300025934 Bacteria 2741
225 Ga0207665_10004142 3300025939 Bacteria 9657
226 Ga0207665_10016079 3300025939 Bacteria 4914
227 Ga0207689_10014071 3300025942 Bacteria 6810
228 Ga0207661_10051711 3300025944 Bacteria 3279
229 Ga0207667_10014461 3300025949 Bacteria 8997
230 Ga0207667_10027181 3300025949 Bacteria 6235
231 Ga0207651_10032574 3300025960 Bacteria 3350
232 Ga0207677_10053662 3300026023 Bacteria 2745
233 Ga0207677_10061939 3300026023 Bacteria 2593
234 Ga0207677_10120390 3300026023 Bacteria 1973
235 Ga0207703_10126748 3300026035 Bacteria 2199
236 Ga0207703_10226057 3300026035 Bacteria 1675
237 Ga0207639_10031182 3300026041 Bacteria 3916
238 Ga0207678_10008407 3300026067 Bacteria 9105
239 Ga0207678_10020421 3300026067 Bacteria 5809
240 Ga0207678_10050937 3300026067 Bacteria 3576
241 Ga0207678_10067033 3300026067 Bacteria 3081
242 Ga0207702_10001389 3300026078 Bacteria 24141
243 Ga0207702_10104084 3300026078 Bacteria 2511
244 Ga0207702_10390322 3300026078 Bacteria 1340
245 Ga0207648_10098568 3300026089 Bacteria 2559
246 Ga0207676_10037374 3300026095 Bacteria 3700
247 Ga0207676_10042812 3300026095 Bacteria 3483
248 Ga0207676_10098859 3300026095 Bacteria 2413
249 Ga0207676_10144228 3300026095 Bacteria 2043
250 Ga0207674_10078005 3300026116 Bacteria 3318
251 Ga0207674_10102299 3300026116 Bacteria 2845
252 Ga0207675_100031083 3300026118 Bacteria 4972
253 Ga0207683_10036419 3300026121 Bacteria 4285
254 Ga0207683_10075706 3300026121 Bacteria 2979
255 Ga0207683_10227565 3300026121 Bacteria 1700
256 Ga0207698_10018340 3300026142 Bacteria 4766
257 Ga0209389_1000062 3300027296 Bacteria 102842
258 Ga0209389_1000440 3300027296 Bacteria 24698
259 Ga0209589_1009502 3300027357 Bacteria 14630
260 Ga0209489_100160 3300027361 Bacteria 102842
261 Ga0209489_104739 3300027361 Bacteria 24698
262 Ga0209700_102603 3300027363 Bacteria 36098
263 Ga0209588_1039662 3300027671 Bacteria 1519
264 Ga0268266_10039172 3300028379 Bacteria 4036
265 Ga0268266_10051102 3300028379 Bacteria 3548
266 Ga0268266_10238073 3300028379 Bacteria 1679
267 Ga0265326_10007529 3300028558 Bacteria 3331
268 Ga0265319_1027203 3300028563 Bacteria 2030
269 Ga0265334_10003755 3300028573 Bacteria 6864
270 Ga0265323_10002629 3300028653 Bacteria 8139
271 Ga0265336_10002003 3300028666 Bacteria 8697
272 Ga0307517_10097310 3300028786 Bacteria 2350
273 Ga0307515_10037908 3300028794 Bacteria 7731
274 Ga0307515_10103669 3300028794 Bacteria 3407
275 Ga0265338_10000076 3300028800 Bacteria 180204
276 Ga0265324_10003718 3300029957 Bacteria 7145
277 Ga0307511_10104726 3300030521 Bacteria 1835
278 Ga0265332_10106784 3300031238 Bacteria 1180
279 Ga0265325_10006052 3300031241 Bacteria 7400
280 Ga0265329_10050502 3300031242 Bacteria 1325
281 Ga0265340_10000053 3300031247 Bacteria 53672
282 Ga0265339_10067494 3300031249 Bacteria 1912
283 Ga0265331_10071552 3300031250 Bacteria 1621
284 Ga0265316_10012548 3300031344 Bacteria 7590
285 Ga0307513_10050495 3300031456 Bacteria 4496
286 Ga0307509_10002279 3300031507 Bacteria 31377
287 Ga0307509_10009503 3300031507 Bacteria 12134
288 Ga0307509_10011405 3300031507 Bacteria 10760
289 Ga0307509_10011769 3300031507 Bacteria 10546
290 Ga0307509_10081969 3300031507 Bacteria 3330
291 Ga0307509_10245700 3300031507 Bacteria 1578
292 Ga0307408_100008455 3300031548 Bacteria 6797
293 Ga0265313_10061318 3300031595 Bacteria 1761
294 Ga0307508_10000028 3300031616 Bacteria 168639
295 Ga0307508_10122987 3300031616 Bacteria 2197
296 Ga0307508_10145962 3300031616 Bacteria 1970
297 Ga0265314_10033463 3300031711 Bacteria 3769
298 Ga0265314_10073071 3300031711 Bacteria 2288
299 Ga0316576_10143351 3300031727 Bacteria 1799
300 Ga0307516_10054397 3300031730 Bacteria 3911
301 Ga0307416_100160525 3300032002 Bacteria 2077
302 Ga0307416_100284702 3300032002 Bacteria 1632
303 Ga0307510_10014505 3300033180 Bacteria 9327
304 Ga0307510_10091949 3300033180 Bacteria 2873
305 Ga0307510_10219308 3300033180 Bacteria 1415
306 Ga0307510_10248898 3300033180 Bacteria 1266
307 Ga0315911_1000005 3300033442 Bacteria 426255
308 Ga0373957_0050007 3300035120 Bacteria 1597
309 Ga0373946_0112225 3300035171 Bacteria 1235
310 Ga0373931_0037777 3300035691 Bacteria 2522
311 Ga0373935_0166981 3300035692 Bacteria 1503
312 Ga0373927_0027993 3300035695 Bacteria 3678
313 Ga0373947_0025584 3300035725 Bacteria 3443
314 Ga0373937_0149349 3300036401 Bacteria 2188
315 Ga0373925_0095102 3300037068 Bacteria 2282
316 Ga0373925_0215211 3300037068 Bacteria 1532
317 Ga0395898_0050914 3300037466 Bacteria 4052
318 Ga0395898_0440082 3300037466 Bacteria 1242
319 Ga0395905_0037683 3300037471 Bacteria 4538
320 Ga0395905_0074950 3300037471 Bacteria 3171
321 Ga0436364_0880019 3300037853 Bacteria 2839
322 Ga0436364_1191514 3300037853 Bacteria 1283
323 Ga0395901_0055099 3300038443 Bacteria 4134
324 Ga0400483_040193 3300039062 Bacteria 8172
325 Ga0400483_262639 3300039062 Bacteria 5166
326 Ga0436365_0520692 3300039437 Bacteria 2890
327 Ga0436365_1671861 3300039437 Bacteria 1882
328 Ga0436360_0258069 3300039438 Bacteria 1764
329 Ga0436360_1340413 3300039438 Bacteria 2091
330 Ga0436363_0819557 3300039450 Bacteria 5813
331 Ga0436363_1573042 3300039450 Bacteria 4260
332 Ga0436362_1188064 3300039453 Bacteria 1207
333 Ga0451849_0587753 3300041505 Bacteria 1174
334 Ga0466972_0000136 3300044658 Bacteria 60410
335 Ga0466965_0047965 3300044683 Bacteria 2115
336 Ga0466966_0001144 3300044684 Bacteria 17038
337 Ga0466961_0000116 3300044693 Bacteria 53499
338 Ga0466963_0103834 3300044694 Bacteria 1947
339 Ga0466963_0108735 3300044694 Bacteria 1902
340 Ga0466970_0106678 3300044765 Bacteria 1528
341 Ga0466957_0256035 3300044842 Bacteria 1165
342 Ga0466960_0205615 3300044901 Bacteria 1077
343 Ga0466959_0001020 3300045049 Bacteria 16684
344 Ga0466967_0044768 3300045976 Bacteria 3841
345 Ga0495592_0000517 3300046454 Bacteria 27891
346 Ga0495592_0004657 3300046454 Bacteria 10047
347 Ga0495592_0008330 3300046454 Bacteria 7779
348 Ga0495592_0080740 3300046454 Bacteria 2352
349 Ga0495603_0005309 3300046455 Bacteria 7684
350 Ga0495603_0178530 3300046455 Bacteria 1229
351 Ga0495591_000711 3300046458 Bacteria 24183
352 Ga0495629_0006759 3300046459 Bacteria 8474
353 Ga0495629_0017661 3300046459 Bacteria 5113
354 Ga0495629_0102667 3300046459 Bacteria 1995
355 Ga0495638_0011226 3300046460 Bacteria 6182
356 Ga0495641_0028576 3300046461 Bacteria 2697
357 Ga0495651_0006623 3300046462 Bacteria 8847
358 Ga0495651_0069361 3300046462 Bacteria 2685
359 Ga0495651_0194540 3300046462 Bacteria 1424
360 Ga0495653_0005866 3300046463 Bacteria 10054
361 Ga0495653_0043960 3300046463 Bacteria 3470
362 Ga0495580_0000026 3300046472 Bacteria 86209
363 Ga0495580_0001017 3300046472 Bacteria 24622
364 Ga0495580_0002223 3300046472 Bacteria 16964
365 Ga0495580_0208674 3300046472 Bacteria 1344
366 Ga0495582_0001580 3300046473 Bacteria 12845
367 Ga0495582_0017264 3300046473 Bacteria 3949
368 Ga0495605_0098619 3300046474 Bacteria 1346
369 Ga0495662_0005743 3300046476 Bacteria 6208
370 Ga0495662_0012489 3300046476 Bacteria 4144
371 Ga0495664_0001434 3300046477 Bacteria 12655
372 Ga0495664_0034108 3300046477 Bacteria 2993
373 Ga0495664_0040956 3300046477 Bacteria 2740
374 Ga0495664_0098098 3300046477 Bacteria 1764
375 Ga0495584_0162066 3300046491 Bacteria 1137
376 Ga0495596_0008099 3300046500 Bacteria 4692
377 Ga0495607_0000004 3300046501 Bacteria 317271
378 Ga0495606_0002984 3300046507 Bacteria 18595
379 Ga0495606_0077034 3300046507 Bacteria 2082
380 Ga0495606_0095910 3300046507 Bacteria 1815
381 Ga0495616_0068943 3300046513 Bacteria 1716
382 Ga0495618_0001702 3300046514 Bacteria 14597
383 Ga0495618_0004326 3300046514 Bacteria 8743
384 Ga0495628_0000424 3300046516 Bacteria 38594
385 Ga0495628_0003276 3300046516 Bacteria 14484
386 Ga0495628_0022098 3300046516 Bacteria 5228
387 Ga0495628_0031080 3300046516 Bacteria 4319
388 Ga0495630_0003710 3300046517 Bacteria 10652
389 Ga0495630_0006200 3300046517 Bacteria 8483
390 Ga0495630_0006863 3300046517 Bacteria 8114
391 Ga0495631_0000227 3300046518 Bacteria 38474
392 Ga0495632_0000012 3300046519 Bacteria 264389
393 Ga0495632_0160186 3300046519 Bacteria 1037
394 Ga0495643_0023922 3300046522 Bacteria 3467
395 Ga0495643_0116365 3300046522 Bacteria 1354
396 Ga0495648_0000785 3300046524 Bacteria 33882
397 Ga0495648_0003297 3300046524 Bacteria 14259
398 Ga0495648_0003717 3300046524 Bacteria 13333
399 Ga0495648_0004420 3300046524 Bacteria 12011
400 Ga0495652_0024876 3300046529 Bacteria 5297
401 Ga0495652_0286006 3300046529 Bacteria 1205
402 Ga0495665_0000267 3300046531 Bacteria 26452
403 Ga0495665_0005436 3300046531 Bacteria 6863
404 Ga0495665_0023184 3300046531 Bacteria 3333
405 Ga0495665_0077859 3300046531 Bacteria 1745
406 Ga0495665_0092527 3300046531 Bacteria 1589
407 Ga0495640_0003485 3300046533 Bacteria 12659
408 Ga0495640_0005964 3300046533 Bacteria 9660
409 Ga0495586_0072458 3300046535 Bacteria 1884
410 Ga0495586_0073249 3300046535 Bacteria 1873
411 Ga0495587_0000304 3300046536 Bacteria 35047
412 Ga0495587_0010602 3300046536 Bacteria 5855
413 Ga0495609_0104696 3300046538 Bacteria 1224
414 Ga0495645_0001945 3300046543 Bacteria 14026
415 Ga0495645_0018749 3300046543 Bacteria 4975
416 Ga0495622_0000083 3300046557 Bacteria 84580
417 Ga0495622_0005391 3300046557 Bacteria 5937
418 Ga0495622_0047564 3300046557 Bacteria 1993
419 Ga0495668_0136617 3300046616 Bacteria 1342
420 Ga0495634_0003679 3300046642 Bacteria 12236
421 Ga0495634_0007596 3300046642 Bacteria 8123
422 Ga0495625_0019114 3300046660 Bacteria 5329
423 Ga0495635_0009030 3300046663 Bacteria 6955
424 Ga0495635_0024417 3300046663 Bacteria 4213
425 Ga0495635_0067834 3300046663 Bacteria 2446
426 Ga0495661_0001806 3300046665 Bacteria 17160
427 Ga0495661_0003928 3300046665 Bacteria 10853
428 Ga0495661_0107068 3300046665 Bacteria 1564
429 Ga0495588_0000818 3300046674 Bacteria 13881
430 Ga0495657_0019604 3300046675 Bacteria 4877
431 Ga0495599_0000494 3300046678 Bacteria 22488
432 Ga0495599_0002606 3300046678 Bacteria 10517
433 Ga0495599_0091408 3300046678 Bacteria 1899
434 Ga0495623_0024073 3300046679 Bacteria 3927
435 Ga0495646_0004115 3300046680 Bacteria 9127
436 Ga0495669_0022987 3300046684 Bacteria 2710
437 Ga0495613_0023887 3300046689 Bacteria 4555
438 Ga0495613_0108338 3300046689 Bacteria 2003
439 Ga0495624_0001186 3300046690 Bacteria 20594
440 Ga0495624_0007044 3300046690 Bacteria 7921
441 Ga0495624_0026825 3300046690 Bacteria 3774
442 Ga0495671_0093764 3300046692 Bacteria 1469
443 Ga0495649_0143095 3300046694 Bacteria 1258
444 Ga0495589_0000002 3300046794 Bacteria 758846
445 Ga0495600_0008287 3300046809 Bacteria 6380
446 Ga0495600_0056044 3300046809 Bacteria 2574
447 Ga0495660_0000024 3300046810 Bacteria 268209
448 Ga0495581_0014543 3300047315 Bacteria 4563
449 Ga0495604_0010315 3300047317 Bacteria 7400
450 Ga0495604_0045705 3300047317 Bacteria 3416
451 Ga0495604_0081963 3300047317 Bacteria 2413
452 Ga0495674_0062201 3300047319 Bacteria 3251
453 Ga0495674_0099721 3300047319 Bacteria 2472
454 Ga0495672_0000116 3300047320 Bacteria 127119
455 Ga0495672_0071200 3300047320 Bacteria 1968
456 Ga0495672_0092040 3300047320 Bacteria 1663
457 Ga0495676_0000210 3300047321 Bacteria 46503
458 Ga0495676_0000932 3300047321 Bacteria 24565
459 Ga0495676_0019545 3300047321 Bacteria 5957
460 Ga0495676_0136026 3300047321 Bacteria 1767
461 Ga0495676_0193662 3300047321 Bacteria 1417
462 Ga0495680_0003196 3300047322 Bacteria 16300
463 Ga0495683_0011427 3300047323 Bacteria 4672
464 Ga0495687_084434 3300047443 Bacteria 1234
465 Ga0495675_0001991 3300047444 Bacteria 12201
466 Ga0495675_0012069 3300047444 Bacteria 5431
467 Ga0495675_0019078 3300047444 Bacteria 4356
468 Ga0495679_000518 3300047446 Bacteria 27299
469 Ga0495679_003967 3300047446 Bacteria 6967
470 Ga0495673_0014126 3300047469 Bacteria 4162
471 Ga0495686_0094381 3300047472 Bacteria 1813
472 Ga0495593_0005526 3300047673 Bacteria 7462
473 Ga0495593_0013068 3300047673 Bacteria 4740
474 Ga0495593_0039444 3300047673 Bacteria 2546
475 Ga0495602_0004900 3300048088 Bacteria 14017
476 Ga0495602_0019229 3300048088 Bacteria 6790
477 Ga0495602_0024830 3300048088 Bacteria 5810
478 Ga0495602_0040323 3300048088 Bacteria 4284
479 Ga0495602_0092674 3300048088 Bacteria 2502
480 Ga0495614_0009545 3300048089 Bacteria 4289
481 Ga0496100_0113507 3300048903 Bacteria 1886
482 Ga0496100_0178247 3300048903 Bacteria 1535
483 Ga0496101_0001703 3300048904 Bacteria 13165
484 Ga0496101_0013194 3300048904 Bacteria 5532
485 Ga0496101_0036045 3300048904 Bacteria 3502
486 Ga0496101_0118722 3300048904 Bacteria 1998
487 Ga0496101_0184209 3300048904 Bacteria 1609
488 Ga0496101_0190859 3300048904 Bacteria 1581
489 Ga0496102_0001416 3300048905 Bacteria 21268
490 Ga0496102_0140876 3300048905 Bacteria 2261
491 Ga0496103_0006382 3300048906 Bacteria 7045
492 Ga0496103_0009799 3300048906 Bacteria 5673
493 Ga0496103_0076722 3300048906 Bacteria 2098
494 Ga0496104_0009770 3300048907 Bacteria 8556
495 Ga0496104_0012329 3300048907 Bacteria 7684
496 Ga0496104_0030774 3300048907 Bacteria 4989
497 Ga0496104_0035072 3300048907 Bacteria 4682
498 Ga0496104_0133235 3300048907 Bacteria 2387
499 Ga0496104_0234634 3300048907 Bacteria 1746
500 Ga0496105_0001406 3300048908 Bacteria 16895
501 Ga0496105_0006324 3300048908 Bacteria 9100
502 Ga0496105_0060911 3300048908 Bacteria 3114
503 Ga0496105_0073570 3300048908 Bacteria 2823
504 Ga0496105_0104315 3300048908 Bacteria 2341
505 Ga0496106_0015784 3300048909 Bacteria 5586
506 Ga0496106_0050400 3300048909 Bacteria 3138
507 Ga0496106_0089559 3300048909 Bacteria 2373
508 Ga0496107_0046569 3300048910 Bacteria 3121
509 Ga0496107_0245078 3300048910 Bacteria 1333
510 Ga0496108_0032771 3300048911 Bacteria 4315
511 Ga0496108_0042638 3300048911 Bacteria 3788
512 Ga0496108_0050322 3300048911 Bacteria 3487
513 Ga0496109_0007366 3300048912 Bacteria 9312
514 Ga0496109_0048877 3300048912 Bacteria 3849
515 Ga0496109_0151738 3300048912 Bacteria 2169
516 Ga0496110_0003839 3300048913 Bacteria 11575
517 Ga0496110_0007702 3300048913 Bacteria 8619
518 Ga0496110_0103848 3300048913 Bacteria 2549
519 Ga0496110_0149158 3300048913 Bacteria 2116
520 Ga0496110_0342201 3300048913 Bacteria 1362
521 Ga0496110_0515115 3300048913 Bacteria 1088
522 Ga0496111_0002565 3300048914 Bacteria 10975
523 Ga0496111_0004414 3300048914 Bacteria 8890
524 Ga0496111_0037270 3300048914 Bacteria 3480
525 Ga0496111_0096369 3300048914 Bacteria 2171
526 Ga0496112_0001410 3300048915 Bacteria 18391
527 Ga0496112_0009361 3300048915 Bacteria 8821
528 Ga0496112_0031255 3300048915 Bacteria 5162
529 Ga0496112_0362370 3300048915 Bacteria 1391
530 Ga0496113_0070309 3300048916 Bacteria 2660
531 Ga0496113_0070335 3300048916 Bacteria 2660
532 Ga0496113_0083908 3300048916 Bacteria 2445
533 Ga0496114_0064397 3300048917 Bacteria 3070
534 Ga0496114_0094890 3300048917 Bacteria 2538
535 Ga0496114_0161729 3300048917 Bacteria 1947
536 Ga0496115_0018078 3300048918 Bacteria 5403
537 Ga0496115_0041129 3300048918 Bacteria 3677
538 Ga0496115_0047008 3300048918 Bacteria 3451
539 Ga0496115_0080991 3300048918 Bacteria 2644
540 Ga0496115_0081313 3300048918 Bacteria 2639
541 Ga0496115_0088612 3300048918 Bacteria 2527
542 Ga0496117_0004624 3300048920 Bacteria 14996
543 Ga0496117_0010097 3300048920 Bacteria 8665
544 Ga0496117_0045299 3300048920 Bacteria 3179
545 Ga0496118_0001325 3300048921 Bacteria 37547
546 Ga0496118_0009789 3300048921 Bacteria 9610
547 Ga0496118_0020315 3300048921 Bacteria 5893
548 Ga0496118_0022825 3300048921 Bacteria 5455
549 Ga0496118_0082969 3300048921 Bacteria 2243
550 Ga0496119_0056287 3300048922 Bacteria 2383
551 Ga0496121_0000214 3300048924 Bacteria 127349
552 Ga0496121_0000685 3300048924 Bacteria 63117
553 Ga0496121_0058370 3300048924 Bacteria 3191
554 Ga0496121_0084919 3300048924 Bacteria 2494
555 Ga0496121_0105941 3300048924 Bacteria 2156
556 Ga0496121_0214180 3300048924 Bacteria 1362
557 Ga0496123_0034733 3300048926 Bacteria 3606
558 Ga0496124_0004137 3300048927 Bacteria 17138
559 Ga0496124_0328766 3300048927 Bacteria 1091
560 Ga0496124_0340126 3300048927 Bacteria 1066
561 Ga0496125_0000243 3300048928 Bacteria 111891
562 Ga0496125_0000735 3300048928 Bacteria 54271
563 Ga0496125_0008333 3300048928 Bacteria 10875
564 Ga0496125_0014574 3300048928 Bacteria 7649
565 Ga0496125_0082897 3300048928 Bacteria 2442
566 Ga0496126_0001148 3300048929 Bacteria 43932
567 Ga0496126_0014474 3300048929 Bacteria 7973
568 Ga0496126_0017824 3300048929 Bacteria 7066
569 Ga0496126_0036058 3300048929 Bacteria 4629
570 Ga0496126_0041303 3300048929 Bacteria 4270
571 Ga0496126_0060112 3300048929 Bacteria 3419
572 Ga0496126_0074480 3300048929 Bacteria 3015
573 Ga0496126_0118232 3300048929 Bacteria 2301
574 Ga0496126_0202141 3300048929 Bacteria 1677
575 Ga0496126_0249456 3300048929 Bacteria 1480
576 Ga0495678_000002 3300049459 Bacteria 999613
577 Ga0495682_0011736 3300049460 Bacteria 3367
578 Ga0501032_0257883 3300049569 Bacteria 1131
579 Ga0501036_0223672 3300049572 Bacteria 1580
580 Ga0501036_0444050 3300049572 Bacteria 1081
581 Ga0501043_0109872 3300049579 Bacteria 2165
582 Ga0501070_0050483 3300049586 Bacteria 3454
583 Ga0501072_0044462 3300049588 Bacteria 3493
584 Ga0501072_0173433 3300049588 Bacteria 1721
585 Ga0501073_0170834 3300049589 Bacteria 1505
586 Ga0501035_0042813 3300049822 Bacteria 4082
587 nmdc:mga00v17_35624_c1 3300050491 Bacteria 2963
588 nmdc:mga0yw44_149066_c1 3300050492 Bacteria 1525
589 nmdc:mga0yw44_37691_c1 3300050492 Bacteria 2856
590 nmdc:mga0yw44_38782_c1 3300050492 Bacteria 2821
591 nmdc:mga0yw44_55103_c1 3300050492 Bacteria 2419
592 nmdc:mga0k408_88270_c1 3300050493 Bacteria 1821
593 nmdc:mga06z11_82339_c1 3300050494 Bacteria 1730
594 nmdc:mga07m45_156504_c1 3300050496 Bacteria 1322
595 nmdc:mga07m45_23848_c1 3300050496 Bacteria 3346
596 nmdc:mga07m45_4827_c1 3300050496 Bacteria 6630
597 nmdc:mga07m45_6915_c1 3300050496 Bacteria 5771
598 nmdc:mga0n895_534669_c1 3300050512 Bacteria 1179
599 nmdc:mga08x19_78548_c1 3300050514 Bacteria 2163
600 Ga0500578_0057815 3300053086 Bacteria 2479
601 Ga0500643_000331 3300053087 Bacteria 37802
602 Ga0500644_0021162 3300053088 Bacteria 1944
603 Ga0500651_0004448 3300053093 Bacteria 7853
604 Ga0500566_0000173 3300053094 Bacteria 32832
605 Ga0500566_0000468 3300053094 Bacteria 22516
606 Ga0500554_002275 3300053102 Bacteria 3753
607 Ga0500555_002543 3300053103 Bacteria 5261
608 Ga0500557_000164 3300053105 Bacteria 14527
609 Ga0500562_043952 3300053108 Bacteria 1189
610 Ga0500591_042582 3300053115 Bacteria 2155
611 Ga0500594_0001716 3300053118 Bacteria 4780
612 Ga0500595_000210 3300053119 Bacteria 39725
613 Ga0500614_000764 3300053123 Bacteria 8165
614 Ga0500642_0000088 3300053130 Bacteria 47518
615 Ga0500559_0000075 3300053136 Bacteria 77303
616 Ga0500559_0004833 3300053136 Bacteria 6291
617 Ga0500559_0005803 3300053136 Bacteria 5630
618 Ga0500573_0054422 3300053140 Bacteria 2297
619 Ga0500573_0058385 3300053140 Bacteria 2212
620 Ga0500603_000079 3300053150 Bacteria 22213
621 Ga0500603_000287 3300053150 Bacteria 13425
622 Ga0500622_0010008 3300053156 Bacteria 5228
623 Ga0500630_000627 3300053159 Bacteria 16005
624 Ga0500638_090207 3300053162 Bacteria 1444
625 Ga0500639_000012 3300053163 Bacteria 127545
626 Ga0500636_0180175 3300053177 Bacteria 1135
627 Ga0500637_0029535 3300053178 Bacteria 3042
628 Ga0500637_0030060 3300053178 Bacteria 3018
629 Ga0500645_083204 3300053730 Bacteria 912
630 Ga0500609_006832 3300053731 Bacteria 1548
631 Ga0500596_000886 3300053735 Bacteria 5968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053730 Ga0500645_083204 Ga0500645_083204_69_896 272
2 3300049572 Ga0501036_0444050 Ga0501036_0444050_23_868 276
3 iso_pu_bacteria 8016566248 8016568723 291
4 3300031507 Ga0307509_10002279 Ga0307509_1000227934 299
5 3300033180 Ga0307510_10219308 Ga0307510_102193082 299
6 3300046454 Ga0495592_0000517 Ga0495592_0000517_439_1458 299
7 3300046794 Ga0495589_0000002 Ga0495589_0000002_686540_687601 301
8 3300006353 Ga0075370_10031567 Ga0075370_100315672 302
9 3300050496 nmdc:mga07m45_4827_c1 nmdc:mga07m45_4827_c1_856_1881 302
10 3300048907 Ga0496104_0009770 Ga0496104_0009770_739_1650 303
11 3300048911 Ga0496108_0032771 Ga0496108_0032771_1495_2406 303
12 3300048913 Ga0496110_0003839 Ga0496110_0003839_4051_4962 303
13 3300048914 Ga0496111_0002565 Ga0496111_0002565_2038_2949 303
14 3300048915 Ga0496112_0001410 Ga0496112_0001410_4308_5219 303
15 3300033180 Ga0307510_10091949 Ga0307510_100919492 304
16 3300053088 Ga0500644_0021162 Ga0500644_0021162_648_1667 304
17 3300053108 Ga0500562_043952 Ga0500562_043952_119_1138 304
18 3300053118 Ga0500594_0001716 Ga0500594_0001716_3221_4240 304
19 3300053119 Ga0500595_000210 Ga0500595_000210_32192_33208 304
20 3300053136 Ga0500559_0005803 Ga0500559_0005803_565_1584 304
21 3300006353 Ga0075370_10000323 Ga0075370_1000032314 308
22 3300046472 Ga0495580_0001017 Ga0495580_0001017_9414_10463 308
23 3300050496 nmdc:mga07m45_6915_c1 nmdc:mga07m45_6915_c1_2828_3853 308
24 3300031548 Ga0307408_100008455 Ga0307408_1000084555 309
25 3300032002 Ga0307416_100160525 Ga0307416_1001605252 309
26 3300053156 Ga0500622_0010008 Ga0500622_0010008_3665_4684 310
27 3300028794 Ga0307515_10103669 Ga0307515_101036692 311
28 3300031507 Ga0307509_10011769 Ga0307509_1001176910 311
29 3300010375 Ga0105239_10130647 Ga0105239_101306473 312
30 3300046531 Ga0495665_0077859 Ga0495665_0077859_304_1353 312
31 3300047321 Ga0495676_0000210 Ga0495676_0000210_31528_32577 312
32 3300046472 Ga0495580_0000026 Ga0495580_0000026_23006_24061 313
33 3300047444 Ga0495675_0019078 Ga0495675_0019078_1981_3036 313
34 3300025942 Ga0207689_10014071 Ga0207689_100140714 315
35 3300046454 Ga0495592_0080740 Ga0495592_0080740_484_1473 315
36 3300039453 Ga0436362_1188064 Ga0436362_1188064_230_1180 316
37 3300044842 Ga0466957_0256035 Ga0466957_0256035_24_974 316
38 3300046507 Ga0495606_0077034 Ga0495606_0077034_29_991 316
39 3300046519 Ga0495632_0160186 Ga0495632_0160186_12_962 316
40 3300048906 Ga0496103_0006382 Ga0496103_0006382_5399_6424 316
41 3300048913 Ga0496110_0149158 Ga0496110_0149158_27_977 316
42 3300048913 Ga0496110_0515115 Ga0496110_0515115_33_983 316
43 3300048920 Ga0496117_0004624 Ga0496117_0004624_2885_3910 316
44 3300048921 Ga0496118_0001325 Ga0496118_0001325_36213_37238 316
45 3300048926 Ga0496123_0034733 Ga0496123_0034733_2408_3484 316
46 3300048927 Ga0496124_0004137 Ga0496124_0004137_9477_10553 316
47 3300048928 Ga0496125_0014574 Ga0496125_0014574_39_989 316
48 iso_pu_bacteria 2984564862 2984567184 316
49 iso_pu_bacteria 2990265787 2990267278 316
50 iso_pu_bacteria 2993693658 2993694231 316
51 3300013105 Ga0157369_10017540 Ga0157369_100175402 317
52 3300046516 Ga0495628_0022098 Ga0495628_0022098_1577_2632 317
53 3300049589 Ga0501073_0170834 Ga0501073_0170834_410_1420 317
54 iso_pu_bacteria 8016522445 8016525440 320
55 3300046690 Ga0495624_0007044 Ga0495624_0007044_3039_4094 321
56 3300046516 Ga0495628_0000424 Ga0495628_0000424_17202_18254 323
57 3300046517 Ga0495630_0006200 Ga0495630_0006200_5734_6786 323
58 3300046529 Ga0495652_0286006 Ga0495652_0286006_46_1098 323
59 3300046531 Ga0495665_0000267 Ga0495665_0000267_1826_2878 323
60 3300046690 Ga0495624_0001186 Ga0495624_0001186_13257_14309 323
61 3300047321 Ga0495676_0000932 Ga0495676_0000932_14908_15960 323
62 3300048088 Ga0495602_0004900 Ga0495602_0004900_7371_8423 323
63 3300005272 Ga0065703_1018760 Ga0065703_10187602 324
64 iso_pu_bacteria 2508501071 2508851124 324
65 3300039062 Ga0400483_262639 Ga0400483_262639_3535_4521 325
66 iso_pu_bacteria 2599185236 2599722732 329
67 3300053140 Ga0500573_0058385 Ga0500573_0058385_609_1709 330
68 iso_pu_bacteria 2857576091 2857578725 330
69 iso_pu_bacteria 2906643746 2906647895 330
70 iso_pu_bacteria 2515154122 2515681516 331
71 iso_pu_bacteria 2738541296 2738821246 331
72 iso_pu_bacteria 2738541298 2738833729 331
73 iso_pu_bacteria 2738541306 2738877135 331
74 iso_pu_bacteria 2738543002 2739186885 331
75 iso_pu_bacteria 2738543008 2739223729 331
76 iso_pu_bacteria 2842324504 2842327662 331
77 iso_pu_bacteria 2842348783 2842351731 331
78 iso_pu_bacteria 2842454564 2842460714 331
79 iso_pu_bacteria 2900634093 2900642557 331
80 iso_pu_bacteria 2902682994 2902685935 331
81 iso_pu_bacteria 2945934425 2945939543 331
82 iso_pu_bacteria 2990703756 2990706872 331
83 iso_pu_bacteria 641736151 642425938 331
84 3300005335 Ga0070666_10063713 Ga0070666_100637132 332
85 3300005530 Ga0070679_100254855 Ga0070679_1002548552 332
86 3300005548 Ga0070665_100046613 Ga0070665_1000466135 332
87 3300006051 Ga0075364_10001896 Ga0075364_100018964 332
88 3300025903 Ga0207680_10077895 Ga0207680_100778951 332
89 iso_pu_bacteria 2507262055 2507504541 332
90 iso_pu_bacteria 2508501009 2508545964 332
91 iso_pu_bacteria 2508501042 2508694818 332
92 iso_pu_bacteria 2513237092 2513626940 332
93 iso_pu_bacteria 2513237094 2513638400 332
94 iso_pu_bacteria 2513237095 2513649302 332
95 iso_pu_bacteria 2513237096 2513657578 332
96 iso_pu_bacteria 2513237098 2513678708 332
97 iso_pu_bacteria 2513237137 2513861646 332
98 iso_pu_bacteria 2513237139 2513875523 332
99 iso_pu_bacteria 2513237141 2513891749 332
100 iso_pu_bacteria 2513237145 2513916831 332
101 iso_pu_bacteria 2515154112 2515624242 332
102 iso_pu_bacteria 2517093001 2517102969 332
103 iso_pu_bacteria 2517572143 2517889741 332
104 iso_pu_bacteria 2524023205 2524438796 332
105 iso_pu_bacteria 2524023210 2524465443 332
106 iso_pu_bacteria 2524023228 2524533094 332
107 iso_pu_bacteria 2617270735 2617347642 332
108 iso_pu_bacteria 2643221651 2644288998 332
109 iso_pu_bacteria 2667528175 2671119593 332
110 iso_pu_bacteria 2728368998 2728748409 332
111 iso_pu_bacteria 2744054633 2745080423 332
112 iso_pu_bacteria 2791355197 2793070277 332
113 iso_pu_bacteria 2802429603 2805921122 332
114 iso_pu_bacteria 2816332527 2818240691 332
115 iso_pu_bacteria 2824671348 2824677039 332
116 iso_pu_bacteria 2824679649 2824684655 332
117 iso_pu_bacteria 2824687955 2824693449 332
118 iso_pu_bacteria 2824696289 2824704347 332
119 iso_pu_bacteria 2824732956 2824740246 332
120 iso_pu_bacteria 2824746037 2824747642 332
121 iso_pu_bacteria 2824773399 2824777022 332
122 iso_pu_bacteria 2838122688 2838129234 332
123 iso_pu_bacteria 2841949485 2841954688 332
124 iso_pu_bacteria 2841957949 2841963109 332
125 iso_pu_bacteria 2841966195 2841968920 332
126 iso_pu_bacteria 2841974524 2841979644 332
127 iso_pu_bacteria 2841983080 2841989710 332
128 iso_pu_bacteria 2842775625 2842779135 332
129 iso_pu_bacteria 2844315083 2844316180 332
130 iso_pu_bacteria 2847930680 2847931871 332
131 iso_pu_bacteria 2847939898 2847941422 332
132 iso_pu_bacteria 2857509624 2857514909 332
133 iso_pu_bacteria 2874590934 2874595473 332
134 iso_pu_bacteria 2874612657 2874620086 332
135 iso_pu_bacteria 2874628541 2874629511 332
136 iso_pu_bacteria 2874645413 2874651901 332
137 iso_pu_bacteria 2876761206 2876765752 332
138 iso_pu_bacteria 2876771140 2876775667 332
139 iso_pu_bacteria 2876818435 2876823659 332
140 iso_pu_bacteria 2879074833 2879079758 332
141 iso_pu_bacteria 2879083081 2879091219 332
142 iso_pu_bacteria 2879099564 2879103118 332
143 iso_pu_bacteria 2879127579 2879133839 332
144 iso_pu_bacteria 2879142872 2879144517 332
145 iso_pu_bacteria 2881665667 2881670317 332
146 iso_pu_bacteria 2883087390 2883089364 332
147 iso_pu_bacteria 2885366525 2885368314 332
148 iso_pu_bacteria 2885383462 2885390512 332
149 iso_pu_bacteria 2888378607 2888380341 332
150 iso_pu_bacteria 2888388044 2888391331 332
151 iso_pu_bacteria 2903727486 2903729415 332
152 iso_pu_bacteria 2903748898 2903751212 332
153 iso_pu_bacteria 2903768456 2903776176 332
154 iso_pu_bacteria 2904690495 2904695526 332
155 iso_pu_bacteria 2906602504 2906606627 332
156 iso_pu_bacteria 2906610324 2906614717 332
157 iso_pu_bacteria 2906635258 2906638224 332
158 iso_pu_bacteria 2906660503 2906661238 332
159 iso_pu_bacteria 2908756301 2908764174 332
160 iso_pu_bacteria 2908775508 2908782852 332
161 iso_pu_bacteria 2922393267 2922398719 332
162 iso_pu_bacteria 2922425934 2922426584 332
163 iso_pu_bacteria 2932809354 2932815455 332
164 iso_pu_bacteria 2932818245 2932825106 332
165 iso_pu_bacteria 2935608549 2935613055 332
166 iso_pu_bacteria 2935630451 2935632921 332
167 iso_pu_bacteria 2935648319 2935651379 332
168 iso_pu_bacteria 2935656913 2935659853 332
169 iso_pu_bacteria 2935694250 2935699187 332
170 iso_pu_bacteria 2935760218 2935767836 332
171 iso_pu_bacteria 2935777560 2935779889 332
172 iso_pu_bacteria 2935819856 2935825093 332
173 iso_pu_bacteria 2935847175 2935852312 332
174 iso_pu_bacteria 2935916978 2935921926 332
175 iso_pu_bacteria 2935959822 2935964904 332
176 iso_pu_bacteria 2935975950 2935982575 332
177 iso_pu_bacteria 2935984226 2935984446 332
178 iso_pu_bacteria 2936011229 2936014269 332
179 iso_pu_bacteria 2936019824 2936022822 332
180 iso_pu_bacteria 2936028420 2936030959 332
181 iso_pu_bacteria 2936046547 2936049080 332
182 iso_pu_bacteria 2936055302 2936055526 332
183 iso_pu_bacteria 2941507105 2941509777 332
184 iso_pu_bacteria 2941515067 2941517606 332
185 iso_pu_bacteria 2941523033 2941526441 332
186 iso_pu_bacteria 3005474847 3005475931 332
187 iso_pu_bacteria 3005587118 3005591283 332
188 iso_pu_bacteria 3005594810 3005595784 332
189 iso_pu_bacteria 3005710791 3005711752 332
190 iso_pu_bacteria 3005718088 3005718993 332
191 iso_pu_bacteria 8006926726 8006929661 332
192 iso_pu_bacteria 8006933436 8006937237 332
193 iso_pu_bacteria 8006973647 8006977248 332
194 iso_pu_bacteria 8016613128 8016619152 332
195 iso_pu_bacteria 8016630954 8016636678 332
196 iso_pu_bacteria 8019538911 8019541247 332
197 iso_pu_bacteria 8019619141 8019623613 332
198 iso_pu_bacteria 8019629233 8019638422 332
199 iso_pu_bacteria 8019638758 8019641211 332
200 iso_pu_bacteria 8019648815 8019653405 332
201 iso_pu_bacteria 8019678201 8019680254 332
202 iso_pu_bacteria 8056689827 8056694162 332
203 iso_pu_bacteria 8056967851 8056974343 332
204 3300005548 Ga0070665_100024499 Ga0070665_1000244992 333
205 3300028379 Ga0268266_10051102 Ga0268266_100511023 333
206 3300031242 Ga0265329_10050502 Ga0265329_100505022 333
207 3300037471 Ga0395905_0074950 Ga0395905_0074950_808_1809 333
208 3300038443 Ga0395901_0055099 Ga0395901_0055099_2971_3984 333
209 3300005471 Ga0070698_100076738 Ga0070698_1000767385 334
210 3300005530 Ga0070679_100055745 Ga0070679_1000557453 334
211 3300046501 Ga0495607_0000004 Ga0495607_0000004_294333_295337 334
212 3300046522 Ga0495643_0116365 Ga0495643_0116365_62_1072 334
213 3300005329 Ga0070683_100169113 Ga0070683_1001691132 335
214 3300005434 Ga0070709_10019652 Ga0070709_100196523 335
215 3300005435 Ga0070714_100145426 Ga0070714_1001454262 335
216 3300005439 Ga0070711_100017254 Ga0070711_1000172542 335
217 3300005539 Ga0068853_100411764 Ga0068853_1004117641 335
218 3300005563 Ga0068855_100020872 Ga0068855_1000208723 335
219 3300006051 Ga0075364_10293352 Ga0075364_102933521 335
220 3300006175 Ga0070712_100036076 Ga0070712_1000360764 335
221 3300009011 Ga0105251_10012259 Ga0105251_100122595 335
222 3300009093 Ga0105240_10013244 Ga0105240_100132449 335
223 3300009098 Ga0105245_10012703 Ga0105245_100127039 335
224 3300009176 Ga0105242_10246649 Ga0105242_102466491 335
225 3300009177 Ga0105248_10638701 Ga0105248_106387011 335
226 3300009551 Ga0105238_10020137 Ga0105238_100201376 335
227 3300013307 Ga0157372_10096123 Ga0157372_100961232 335
228 3300014325 Ga0163163_10001500 Ga0163163_1000150014 335
229 3300014325 Ga0163163_10003001 Ga0163163_1000300122 335
230 3300014968 Ga0157379_10002566 Ga0157379_100025663 335
231 3300014968 Ga0157379_10085638 Ga0157379_100856382 335
232 3300025299 Ga0209256_1028780 Ga0209256_10287801 335
233 3300025728 Ga0207655_1009998 Ga0207655_10099985 335
234 3300025910 Ga0207684_10170355 Ga0207684_101703551 335
235 3300025915 Ga0207693_10010008 Ga0207693_100100087 335
236 3300025924 Ga0207694_10144762 Ga0207694_101447622 335
237 3300025929 Ga0207664_10071799 Ga0207664_100717992 335
238 3300025934 Ga0207686_10043916 Ga0207686_100439162 335
239 3300025939 Ga0207665_10016079 Ga0207665_100160795 335
240 3300025949 Ga0207667_10027181 Ga0207667_100271814 335
241 3300026067 Ga0207678_10020421 Ga0207678_100204216 335
242 3300026095 Ga0207676_10042812 Ga0207676_100428122 335
243 3300026121 Ga0207683_10075706 Ga0207683_100757061 335
244 3300031727 Ga0316576_10143351 Ga0316576_101433511 335
245 3300039438 Ga0436360_1340413 Ga0436360_1340413_969_1976 335
246 3300046454 Ga0495592_0004657 Ga0495592_0004657_2148_3173 335
247 3300046454 Ga0495592_0008330 Ga0495592_0008330_4108_5133 335
248 3300046458 Ga0495591_000711 Ga0495591_000711_5514_6539 335
249 3300046459 Ga0495629_0006759 Ga0495629_0006759_4906_5931 335
250 3300046459 Ga0495629_0017661 Ga0495629_0017661_539_1564 335
251 3300046460 Ga0495638_0011226 Ga0495638_0011226_3083_4102 335
252 3300046461 Ga0495641_0028576 Ga0495641_0028576_1564_2589 335
253 3300046462 Ga0495651_0069361 Ga0495651_0069361_981_2006 335
254 3300046463 Ga0495653_0005866 Ga0495653_0005866_1381_2430 335
255 3300046472 Ga0495580_0002223 Ga0495580_0002223_6851_7876 335
256 3300046472 Ga0495580_0208674 Ga0495580_0208674_56_1081 335
257 3300046473 Ga0495582_0001580 Ga0495582_0001580_4788_5813 335
258 3300046473 Ga0495582_0017264 Ga0495582_0017264_2516_3541 335
259 3300046476 Ga0495662_0005743 Ga0495662_0005743_2616_3641 335
260 3300046476 Ga0495662_0012489 Ga0495662_0012489_1278_2303 335
261 3300046477 Ga0495664_0001434 Ga0495664_0001434_4788_5813 335
262 3300046500 Ga0495596_0008099 Ga0495596_0008099_1053_2078 335
263 3300046507 Ga0495606_0095910 Ga0495606_0095910_152_1168 335
264 3300046514 Ga0495618_0001702 Ga0495618_0001702_8050_9075 335
265 3300046514 Ga0495618_0004326 Ga0495618_0004326_5051_6076 335
266 3300046516 Ga0495628_0003276 Ga0495628_0003276_6610_7635 335
267 3300046516 Ga0495628_0031080 Ga0495628_0031080_3036_4061 335
268 3300046517 Ga0495630_0003710 Ga0495630_0003710_2725_3750 335
269 3300046517 Ga0495630_0006863 Ga0495630_0006863_6040_7065 335
270 3300046518 Ga0495631_0000227 Ga0495631_0000227_35052_36074 335
271 3300046524 Ga0495648_0000785 Ga0495648_0000785_13430_14455 335
272 3300046524 Ga0495648_0003717 Ga0495648_0003717_2172_3251 335
273 3300046529 Ga0495652_0024876 Ga0495652_0024876_3678_4703 335
274 3300046531 Ga0495665_0005436 Ga0495665_0005436_4855_5880 335
275 3300046531 Ga0495665_0023184 Ga0495665_0023184_149_1174 335
276 3300046533 Ga0495640_0003485 Ga0495640_0003485_2906_3931 335
277 3300046533 Ga0495640_0005964 Ga0495640_0005964_3772_4797 335
278 3300046535 Ga0495586_0072458 Ga0495586_0072458_217_1242 335
279 3300046535 Ga0495586_0073249 Ga0495586_0073249_650_1675 335
280 3300046536 Ga0495587_0000304 Ga0495587_0000304_2560_3585 335
281 3300046536 Ga0495587_0010602 Ga0495587_0010602_3148_4173 335
282 3300046543 Ga0495645_0001945 Ga0495645_0001945_6151_7176 335
283 3300046557 Ga0495622_0000083 Ga0495622_0000083_14275_15300 335
284 3300046642 Ga0495634_0003679 Ga0495634_0003679_4586_5611 335
285 3300046642 Ga0495634_0007596 Ga0495634_0007596_3455_4480 335
286 3300046663 Ga0495635_0009030 Ga0495635_0009030_2615_3640 335
287 3300046663 Ga0495635_0024417 Ga0495635_0024417_649_1674 335
288 3300046665 Ga0495661_0003928 Ga0495661_0003928_5603_6628 335
289 3300046678 Ga0495599_0000494 Ga0495599_0000494_19177_20202 335
290 3300046678 Ga0495599_0002606 Ga0495599_0002606_8097_9122 335
291 3300046678 Ga0495599_0091408 Ga0495599_0091408_250_1299 335
292 3300046679 Ga0495623_0024073 Ga0495623_0024073_320_1345 335
293 3300046680 Ga0495646_0004115 Ga0495646_0004115_2848_3873 335
294 3300046684 Ga0495669_0022987 Ga0495669_0022987_765_1790 335
295 3300046689 Ga0495613_0108338 Ga0495613_0108338_652_1677 335
296 3300046692 Ga0495671_0093764 Ga0495671_0093764_62_1087 335
297 3300046694 Ga0495649_0143095 Ga0495649_0143095_184_1194 335
298 3300047315 Ga0495581_0014543 Ga0495581_0014543_2645_3670 335
299 3300047317 Ga0495604_0010315 Ga0495604_0010315_1103_2128 335
300 3300047317 Ga0495604_0045705 Ga0495604_0045705_2281_3306 335
301 3300047319 Ga0495674_0099721 Ga0495674_0099721_595_1620 335
302 3300047320 Ga0495672_0071200 Ga0495672_0071200_132_1211 335
303 3300047320 Ga0495672_0092040 Ga0495672_0092040_123_1172 335
304 3300047321 Ga0495676_0019545 Ga0495676_0019545_4497_5522 335
305 3300047322 Ga0495680_0003196 Ga0495680_0003196_8776_9801 335
306 3300047323 Ga0495683_0011427 Ga0495683_0011427_1965_2990 335
307 3300047444 Ga0495675_0001991 Ga0495675_0001991_10007_11032 335
308 3300047444 Ga0495675_0012069 Ga0495675_0012069_2887_3912 335
309 3300047446 Ga0495679_000518 Ga0495679_000518_19206_20231 335
310 3300047446 Ga0495679_003967 Ga0495679_003967_3455_4480 335
311 3300047673 Ga0495593_0005526 Ga0495593_0005526_3926_4951 335
312 3300047673 Ga0495593_0013068 Ga0495593_0013068_814_1839 335
313 3300048088 Ga0495602_0019229 Ga0495602_0019229_1101_2150 335
314 3300048088 Ga0495602_0024830 Ga0495602_0024830_4459_5484 335
315 3300048088 Ga0495602_0040323 Ga0495602_0040323_772_1797 335
316 3300048089 Ga0495614_0009545 Ga0495614_0009545_1105_2130 335
317 3300048908 Ga0496105_0001406 Ga0496105_0001406_86_1105 335
318 3300048913 Ga0496110_0103848 Ga0496110_0103848_882_1901 335
319 3300048918 Ga0496115_0080991 Ga0496115_0080991_797_1804 335
320 3300048929 Ga0496126_0001148 Ga0496126_0001148_30704_31759 335
321 3300048929 Ga0496126_0041303 Ga0496126_0041303_1259_2404 335
322 3300048929 Ga0496126_0074480 Ga0496126_0074480_1558_2565 335
323 3300049460 Ga0495682_0011736 Ga0495682_0011736_1378_2403 335
324 3300049588 Ga0501072_0173433 Ga0501072_0173433_267_1277 335
325 3300053140 Ga0500573_0054422 Ga0500573_0054422_322_1338 335
326 iso_pu_bacteria 2921643360 2921648116 335
327 3300003215 JGI25153J46596_10000444 JGI25153J46596_100004446 336
328 3300003215 JGI25153J46596_10015260 JGI25153J46596_100152604 336
329 3300003354 JGI25160J50197_1000315 JGI25160J50197_100031524 336
330 3300003354 JGI25160J50197_1005926 JGI25160J50197_10059261 336
331 3300003762 Ga0055542_1011003 Ga0055542_10110032 336
332 3300005327 Ga0070658_10451742 Ga0070658_104517421 336
333 3300005328 Ga0070676_10008898 Ga0070676_100088982 336
334 3300005329 Ga0070683_100050223 Ga0070683_1000502231 336
335 3300005331 Ga0070670_100106813 Ga0070670_1001068132 336
336 3300005334 Ga0068869_100004903 Ga0068869_1000049036 336
337 3300005334 Ga0068869_100080100 Ga0068869_1000801003 336
338 3300005336 Ga0070680_100321542 Ga0070680_1003215421 336
339 3300005338 Ga0068868_100073984 Ga0068868_1000739842 336
340 3300005338 Ga0068868_100095965 Ga0068868_1000959651 336
341 3300005338 Ga0068868_100099586 Ga0068868_1000995862 336
342 3300005339 Ga0070660_100003722 Ga0070660_1000037221 336
343 3300005339 Ga0070660_100073680 Ga0070660_1000736803 336
344 3300005344 Ga0070661_100079381 Ga0070661_1000793812 336
345 3300005347 Ga0070668_100173993 Ga0070668_1001739931 336
346 3300005354 Ga0070675_100118256 Ga0070675_1001182561 336
347 3300005355 Ga0070671_100013249 Ga0070671_1000132497 336
348 3300005355 Ga0070671_100032187 Ga0070671_1000321874 336
349 3300005364 Ga0070673_100018784 Ga0070673_1000187843 336
350 3300005366 Ga0070659_100049933 Ga0070659_1000499334 336
351 3300005434 Ga0070709_10001618 Ga0070709_100016185 336
352 3300005434 Ga0070709_10011521 Ga0070709_100115211 336
353 3300005435 Ga0070714_100026737 Ga0070714_1000267371 336
354 3300005435 Ga0070714_100201462 Ga0070714_1002014621 336
355 3300005435 Ga0070714_100297481 Ga0070714_1002974812 336
356 3300005436 Ga0070713_100020300 Ga0070713_1000203002 336
357 3300005436 Ga0070713_100043116 Ga0070713_1000431164 336
358 3300005436 Ga0070713_100053521 Ga0070713_1000535213 336
359 3300005437 Ga0070710_10000566 Ga0070710_100005662 336
360 3300005437 Ga0070710_10000925 Ga0070710_1000092510 336
361 3300005439 Ga0070711_100001428 Ga0070711_1000014285 336
362 3300005439 Ga0070711_100107078 Ga0070711_1001070781 336
363 3300005439 Ga0070711_100175299 Ga0070711_1001752991 336
364 3300005455 Ga0070663_100099935 Ga0070663_1000999353 336
365 3300005455 Ga0070663_100211522 Ga0070663_1002115221 336
366 3300005456 Ga0070678_100039233 Ga0070678_1000392334 336
367 3300005458 Ga0070681_10135673 Ga0070681_101356732 336
368 3300005458 Ga0070681_10236997 Ga0070681_102369972 336
369 3300005459 Ga0068867_100102792 Ga0068867_1001027922 336
370 3300005530 Ga0070679_100317498 Ga0070679_1003174982 336
371 3300005536 Ga0070697_100008732 Ga0070697_1000087324 336
372 3300005539 Ga0068853_100011965 Ga0068853_10001196514 336
373 3300005539 Ga0068853_100037105 Ga0068853_1000371054 336
374 3300005539 Ga0068853_100079137 Ga0068853_1000791372 336
375 3300005539 Ga0068853_100113341 Ga0068853_1001133411 336
376 3300005539 Ga0068853_100115231 Ga0068853_1001152312 336
377 3300005543 Ga0070672_100120610 Ga0070672_1001206102 336
378 3300005545 Ga0070695_100189905 Ga0070695_1001899051 336
379 3300005547 Ga0070693_100106238 Ga0070693_1001062382 336
380 3300005548 Ga0070665_100014802 Ga0070665_1000148021 336
381 3300005548 Ga0070665_100020525 Ga0070665_1000205253 336
382 3300005563 Ga0068855_100300694 Ga0068855_1003006942 336
383 3300005563 Ga0068855_100303425 Ga0068855_1003034251 336
384 3300005563 Ga0068855_100513091 Ga0068855_1005130911 336
385 3300005564 Ga0070664_100046711 Ga0070664_1000467116 336
386 3300005577 Ga0068857_100037478 Ga0068857_1000374782 336
387 3300005577 Ga0068857_100073096 Ga0068857_1000730963 336
388 3300005577 Ga0068857_100181819 Ga0068857_1001818192 336
389 3300005578 Ga0068854_100052524 Ga0068854_1000525243 336
390 3300005614 Ga0068856_100006655 Ga0068856_10000665510 336
391 3300005616 Ga0068852_100011995 Ga0068852_1000119954 336
392 3300005618 Ga0068864_100069030 Ga0068864_1000690302 336
393 3300005719 Ga0068861_100011506 Ga0068861_1000115064 336
394 3300005843 Ga0068860_100079613 Ga0068860_1000796134 336
395 3300005843 Ga0068860_100379886 Ga0068860_1003798861 336
396 3300005983 Ga0081540_1047388 Ga0081540_10473883 336
397 3300006028 Ga0070717_10014191 Ga0070717_100141918 336
398 3300006038 Ga0075365_10058636 Ga0075365_100586362 336
399 3300006038 Ga0075365_10068713 Ga0075365_100687131 336
400 3300006042 Ga0075368_10064056 Ga0075368_100640562 336
401 3300006048 Ga0075363_100026264 Ga0075363_1000262643 336
402 3300006051 Ga0075364_10015026 Ga0075364_100150266 336
403 3300006051 Ga0075364_10114699 Ga0075364_101146992 336
404 3300006163 Ga0070715_10017950 Ga0070715_100179503 336
405 3300006173 Ga0070716_100073695 Ga0070716_1000736952 336
406 3300006173 Ga0070716_100110834 Ga0070716_1001108341 336
407 3300006175 Ga0070712_100035658 Ga0070712_1000356584 336
408 3300006186 Ga0075369_10030233 Ga0075369_100302332 336
409 3300006195 Ga0075366_10149265 Ga0075366_101492651 336
410 3300006353 Ga0075370_10004189 Ga0075370_100041894 336
411 3300006353 Ga0075370_10077834 Ga0075370_100778343 336
412 3300006353 Ga0075370_10105704 Ga0075370_101057042 336
413 3300006353 Ga0075370_10115628 Ga0075370_101156282 336
414 3300006358 Ga0068871_100132218 Ga0068871_1001322181 336
415 3300006358 Ga0068871_100215989 Ga0068871_1002159892 336
416 3300006871 Ga0075434_100129119 Ga0075434_1001291193 336
417 3300006914 Ga0075436_100087875 Ga0075436_1000878753 336
418 3300006941 Ga0099825_1025040 Ga0099825_10250403 336
419 3300006944 Ga0099823_1031705 Ga0099823_10317053 336
420 3300007788 Ga0099795_10007335 Ga0099795_100073354 336
421 3300009093 Ga0105240_10005321 Ga0105240_100053219 336
422 3300009093 Ga0105240_10197718 Ga0105240_101977181 336
423 3300009098 Ga0105245_10363541 Ga0105245_103635411 336
424 3300009101 Ga0105247_10041566 Ga0105247_100415663 336
425 3300009101 Ga0105247_10078186 Ga0105247_100781862 336
426 3300009174 Ga0105241_10014257 Ga0105241_100142573 336
427 3300009174 Ga0105241_10020801 Ga0105241_100208012 336
428 3300009545 Ga0105237_10003169 Ga0105237_1000316913 336
429 3300009545 Ga0105237_10009459 Ga0105237_100094598 336
430 3300009545 Ga0105237_10081223 Ga0105237_100812232 336
431 3300009545 Ga0105237_10355299 Ga0105237_103552992 336
432 3300009551 Ga0105238_10009011 Ga0105238_100090114 336
433 3300009551 Ga0105238_10011439 Ga0105238_100114398 336
434 3300009551 Ga0105238_10176178 Ga0105238_101761783 336
435 3300009551 Ga0105238_10249570 Ga0105238_102495702 336
436 3300010375 Ga0105239_10097983 Ga0105239_100979832 336
437 3300010375 Ga0105239_10122139 Ga0105239_101221393 336
438 3300010375 Ga0105239_10253658 Ga0105239_102536581 336
439 3300011119 Ga0105246_10001029 Ga0105246_100010294 336
440 3300011119 Ga0105246_10115837 Ga0105246_101158372 336
441 3300013105 Ga0157369_10042613 Ga0157369_100426135 336
442 3300013296 Ga0157374_10003036 Ga0157374_1000303621 336
443 3300013297 Ga0157378_10143562 Ga0157378_101435621 336
444 3300013306 Ga0163162_10014003 Ga0163162_100140032 336
445 3300013306 Ga0163162_10427903 Ga0163162_104279032 336
446 3300014325 Ga0163163_10011177 Ga0163163_100111774 336
447 3300014968 Ga0157379_10089854 Ga0157379_100898542 336
448 3300014969 Ga0157376_10188389 Ga0157376_101883892 336
449 3300014969 Ga0157376_10222859 Ga0157376_102228591 336
450 3300017792 Ga0163161_10138139 Ga0163161_101381392 336
451 3300017792 Ga0163161_10145289 Ga0163161_101452891 336
452 3300021320 Ga0214544_1000007 Ga0214544_1000007284 336
453 3300021321 Ga0214542_1000007 Ga0214542_100000797 336
454 3300021324 Ga0214545_1000006 Ga0214545_1000006196 336
455 3300021327 Ga0214543_1000009 Ga0214543_1000009284 336
456 3300021377 Ga0213874_10010374 Ga0213874_100103742 336
457 3300021384 Ga0213876_10002030 Ga0213876_100020301 336
458 3300021388 Ga0213875_10072080 Ga0213875_100720801 336
459 3300021441 Ga0213871_10009984 Ga0213871_100099842 336
460 3300025253 Ga0209677_100307 Ga0209677_1003077 336
461 3300025253 Ga0209677_102975 Ga0209677_1029752 336
462 3300025254 Ga0209148_1000300 Ga0209148_10003002 336
463 3300025254 Ga0209148_1008591 Ga0209148_10085911 336
464 3300025261 Ga0209233_1007847 Ga0209233_10078473 336
465 3300025261 Ga0209233_1013321 Ga0209233_10133213 336
466 3300025295 Ga0209564_1001250 Ga0209564_100125019 336
467 3300025297 Ga0209758_1000161 Ga0209758_100016118 336
468 3300025297 Ga0209758_1002452 Ga0209758_10024527 336
469 3300025297 Ga0209758_1002465 Ga0209758_100246518 336
470 3300025297 Ga0209758_1009921 Ga0209758_10099212 336
471 3300025297 Ga0209758_1033846 Ga0209758_10338462 336
472 3300025302 Ga0207426_1000789 Ga0207426_100078925 336
473 3300025898 Ga0207692_10000997 Ga0207692_100009974 336
474 3300025898 Ga0207692_10011347 Ga0207692_100113473 336
475 3300025901 Ga0207688_10059672 Ga0207688_100596723 336
476 3300025901 Ga0207688_10082474 Ga0207688_100824741 336
477 3300025905 Ga0207685_10017518 Ga0207685_100175182 336
478 3300025906 Ga0207699_10003784 Ga0207699_100037846 336
479 3300025906 Ga0207699_10055190 Ga0207699_100551903 336
480 3300025911 Ga0207654_10010355 Ga0207654_100103553 336
481 3300025912 Ga0207707_10024130 Ga0207707_100241303 336
482 3300025912 Ga0207707_10088161 Ga0207707_100881612 336
483 3300025913 Ga0207695_10000006 Ga0207695_10000006304 336
484 3300025913 Ga0207695_10096550 Ga0207695_100965504 336
485 3300025914 Ga0207671_10032989 Ga0207671_100329894 336
486 3300025914 Ga0207671_10062564 Ga0207671_100625644 336
487 3300025914 Ga0207671_10084211 Ga0207671_100842114 336
488 3300025914 Ga0207671_10296290 Ga0207671_102962901 336
489 3300025915 Ga0207693_10000613 Ga0207693_1000061328 336
490 3300025915 Ga0207693_10082715 Ga0207693_100827152 336
491 3300025915 Ga0207693_10165330 Ga0207693_101653302 336
492 3300025916 Ga0207663_10000464 Ga0207663_100004642 336
493 3300025916 Ga0207663_10008879 Ga0207663_100088795 336
494 3300025917 Ga0207660_10018171 Ga0207660_100181714 336
495 3300025919 Ga0207657_10002667 Ga0207657_100026678 336
496 3300025919 Ga0207657_10006315 Ga0207657_100063155 336
497 3300025921 Ga0207652_10116431 Ga0207652_101164311 336
498 3300025921 Ga0207652_10354739 Ga0207652_103547391 336
499 3300025922 Ga0207646_10100188 Ga0207646_101001881 336
500 3300025924 Ga0207694_10011452 Ga0207694_100114522 336
501 3300025924 Ga0207694_10043027 Ga0207694_100430274 336
502 3300025924 Ga0207694_10136196 Ga0207694_101361962 336
503 3300025925 Ga0207650_10162210 Ga0207650_101622102 336
504 3300025927 Ga0207687_10021465 Ga0207687_100214653 336
505 3300025928 Ga0207700_10016153 Ga0207700_100161535 336
506 3300025928 Ga0207700_10035980 Ga0207700_100359802 336
507 3300025928 Ga0207700_10077565 Ga0207700_100775653 336
508 3300025929 Ga0207664_10159572 Ga0207664_101595722 336
509 3300025931 Ga0207644_10009024 Ga0207644_100090244 336
510 3300025932 Ga0207690_10080187 Ga0207690_100801874 336
511 3300025933 Ga0207706_10164385 Ga0207706_101643853 336
512 3300025939 Ga0207665_10004142 Ga0207665_100041425 336
513 3300025944 Ga0207661_10051711 Ga0207661_100517114 336
514 3300025949 Ga0207667_10014461 Ga0207667_100144614 336
515 3300025960 Ga0207651_10032574 Ga0207651_100325742 336
516 3300026023 Ga0207677_10053662 Ga0207677_100536622 336
517 3300026023 Ga0207677_10061939 Ga0207677_100619394 336
518 3300026023 Ga0207677_10120390 Ga0207677_101203901 336
519 3300026035 Ga0207703_10126748 Ga0207703_101267482 336
520 3300026035 Ga0207703_10226057 Ga0207703_102260572 336
521 3300026041 Ga0207639_10031182 Ga0207639_100311824 336
522 3300026067 Ga0207678_10008407 Ga0207678_1000840710 336
523 3300026067 Ga0207678_10050937 Ga0207678_100509373 336
524 3300026067 Ga0207678_10067033 Ga0207678_100670333 336
525 3300026078 Ga0207702_10001389 Ga0207702_100013899 336
526 3300026078 Ga0207702_10104084 Ga0207702_101040842 336
527 3300026078 Ga0207702_10390322 Ga0207702_103903222 336
528 3300026089 Ga0207648_10098568 Ga0207648_100985682 336
529 3300026095 Ga0207676_10037374 Ga0207676_100373745 336
530 3300026095 Ga0207676_10098859 Ga0207676_100988591 336
531 3300026095 Ga0207676_10144228 Ga0207676_101442281 336
532 3300026116 Ga0207674_10078005 Ga0207674_100780053 336
533 3300026116 Ga0207674_10102299 Ga0207674_101022992 336
534 3300026118 Ga0207675_100031083 Ga0207675_1000310833 336
535 3300026121 Ga0207683_10036419 Ga0207683_100364194 336
536 3300026121 Ga0207683_10227565 Ga0207683_102275651 336
537 3300026142 Ga0207698_10018340 Ga0207698_100183405 336
538 3300027296 Ga0209389_1000062 Ga0209389_10000623 336
539 3300027296 Ga0209389_1000440 Ga0209389_100044030 336
540 3300027357 Ga0209589_1009502 Ga0209589_100950215 336
541 3300027361 Ga0209489_100160 Ga0209489_1001603 336
542 3300027361 Ga0209489_104739 Ga0209489_10473930 336
543 3300027363 Ga0209700_102603 Ga0209700_10260336 336
544 3300027671 Ga0209588_1039662 Ga0209588_10396622 336
545 3300028379 Ga0268266_10039172 Ga0268266_100391723 336
546 3300028379 Ga0268266_10238073 Ga0268266_102380732 336
547 3300028558 Ga0265326_10007529 Ga0265326_100075292 336
548 3300028563 Ga0265319_1027203 Ga0265319_10272033 336
549 3300028573 Ga0265334_10003755 Ga0265334_100037557 336
550 3300028653 Ga0265323_10002629 Ga0265323_100026297 336
551 3300028666 Ga0265336_10002003 Ga0265336_100020038 336
552 3300028786 Ga0307517_10097310 Ga0307517_100973102 336
553 3300028794 Ga0307515_10037908 Ga0307515_100379088 336
554 3300028800 Ga0265338_10000076 Ga0265338_1000007638 336
555 3300029957 Ga0265324_10003718 Ga0265324_100037186 336
556 3300030521 Ga0307511_10104726 Ga0307511_101047262 336
557 3300031238 Ga0265332_10106784 Ga0265332_101067841 336
558 3300031241 Ga0265325_10006052 Ga0265325_100060524 336
559 3300031247 Ga0265340_10000053 Ga0265340_1000005353 336
560 3300031249 Ga0265339_10067494 Ga0265339_100674943 336
561 3300031250 Ga0265331_10071552 Ga0265331_100715521 336
562 3300031344 Ga0265316_10012548 Ga0265316_100125481 336
563 3300031456 Ga0307513_10050495 Ga0307513_100504953 336
564 3300031507 Ga0307509_10009503 Ga0307509_100095034 336
565 3300031507 Ga0307509_10011405 Ga0307509_100114058 336
566 3300031507 Ga0307509_10081969 Ga0307509_100819693 336
567 3300031507 Ga0307509_10245700 Ga0307509_102457002 336
568 3300031595 Ga0265313_10061318 Ga0265313_100613182 336
569 3300031616 Ga0307508_10000028 Ga0307508_10000028135 336
570 3300031616 Ga0307508_10122987 Ga0307508_101229872 336
571 3300031616 Ga0307508_10145962 Ga0307508_101459622 336
572 3300031711 Ga0265314_10033463 Ga0265314_100334634 336
573 3300031711 Ga0265314_10073071 Ga0265314_100730712 336
574 3300031730 Ga0307516_10054397 Ga0307516_100543973 336
575 3300032002 Ga0307416_100284702 Ga0307416_1002847022 336
576 3300033180 Ga0307510_10014505 Ga0307510_100145058 336
577 3300033180 Ga0307510_10248898 Ga0307510_102488982 336
578 3300033442 Ga0315911_1000005 Ga0315911_1000005128 336
579 3300035120 Ga0373957_0050007 Ga0373957_0050007_314_1327 336
580 3300035171 Ga0373946_0112225 Ga0373946_0112225_117_1130 336
581 3300035691 Ga0373931_0037777 Ga0373931_0037777_1299_2318 336
582 3300035692 Ga0373935_0166981 Ga0373935_0166981_109_1122 336
583 3300035695 Ga0373927_0027993 Ga0373927_0027993_2007_3020 336
584 3300035725 Ga0373947_0025584 Ga0373947_0025584_2411_3424 336
585 3300036401 Ga0373937_0149349 Ga0373937_0149349_480_1499 336
586 3300037068 Ga0373925_0095102 Ga0373925_0095102_95_1108 336
587 3300037068 Ga0373925_0215211 Ga0373925_0215211_511_1521 336
588 3300037466 Ga0395898_0050914 Ga0395898_0050914_1106_2116 336
589 3300037466 Ga0395898_0440082 Ga0395898_0440082_84_1094 336
590 3300037471 Ga0395905_0037683 Ga0395905_0037683_406_1419 336
591 3300037853 Ga0436364_0880019 Ga0436364_0880019_120_1184 336
592 3300037853 Ga0436364_1191514 Ga0436364_1191514_87_1097 336
593 3300039062 Ga0400483_040193 Ga0400483_040193_3532_4551 336
594 3300039437 Ga0436365_0520692 Ga0436365_0520692_918_1928 336
595 3300039437 Ga0436365_1671861 Ga0436365_1671861_253_1266 336
596 3300039438 Ga0436360_0258069 Ga0436360_0258069_482_1492 336
597 3300039450 Ga0436363_0819557 Ga0436363_0819557_4527_5540 336
598 3300039450 Ga0436363_1573042 Ga0436363_1573042_1397_2410 336
599 3300041505 Ga0451849_0587753 Ga0451849_0587753_34_1044 336
600 3300044658 Ga0466972_0000136 Ga0466972_0000136_25555_26565 336
601 3300044683 Ga0466965_0047965 Ga0466965_0047965_999_2009 336
602 3300044684 Ga0466966_0001144 Ga0466966_0001144_7996_9006 336
603 3300044693 Ga0466961_0000116 Ga0466961_0000116_18209_19219 336
604 3300044694 Ga0466963_0103834 Ga0466963_0103834_153_1163 336
605 3300044694 Ga0466963_0108735 Ga0466963_0108735_769_1782 336
606 3300044765 Ga0466970_0106678 Ga0466970_0106678_171_1181 336
607 3300044901 Ga0466960_0205615 Ga0466960_0205615_16_1056 336
608 3300045049 Ga0466959_0001020 Ga0466959_0001020_2196_3206 336
609 3300045976 Ga0466967_0044768 Ga0466967_0044768_1909_2919 336
610 3300046455 Ga0495603_0005309 Ga0495603_0005309_1692_2705 336
611 3300046455 Ga0495603_0178530 Ga0495603_0178530_32_1042 336
612 3300046459 Ga0495629_0102667 Ga0495629_0102667_245_1264 336
613 3300046462 Ga0495651_0006623 Ga0495651_0006623_5550_6560 336
614 3300046462 Ga0495651_0194540 Ga0495651_0194540_142_1161 336
615 3300046463 Ga0495653_0043960 Ga0495653_0043960_355_1365 336
616 3300046474 Ga0495605_0098619 Ga0495605_0098619_15_1025 336
617 3300046477 Ga0495664_0034108 Ga0495664_0034108_517_1530 336
618 3300046477 Ga0495664_0040956 Ga0495664_0040956_360_1463 336
619 3300046477 Ga0495664_0098098 Ga0495664_0098098_432_1445 336
620 3300046491 Ga0495584_0162066 Ga0495584_0162066_11_1021 336
621 3300046507 Ga0495606_0002984 Ga0495606_0002984_16837_17940 336
622 3300046513 Ga0495616_0068943 Ga0495616_0068943_432_1442 336
623 3300046519 Ga0495632_0000012 Ga0495632_0000012_101145_102164 336
624 3300046522 Ga0495643_0023922 Ga0495643_0023922_412_1422 336
625 3300046524 Ga0495648_0003297 Ga0495648_0003297_11186_12199 336
626 3300046524 Ga0495648_0004420 Ga0495648_0004420_2770_3795 336
627 3300046531 Ga0495665_0092527 Ga0495665_0092527_284_1297 336
628 3300046538 Ga0495609_0104696 Ga0495609_0104696_172_1185 336
629 3300046543 Ga0495645_0018749 Ga0495645_0018749_1498_2511 336
630 3300046557 Ga0495622_0005391 Ga0495622_0005391_4904_5914 336
631 3300046557 Ga0495622_0047564 Ga0495622_0047564_906_1925 336
632 3300046616 Ga0495668_0136617 Ga0495668_0136617_146_1159 336
633 3300046660 Ga0495625_0019114 Ga0495625_0019114_4219_5229 336
634 3300046663 Ga0495635_0067834 Ga0495635_0067834_90_1103 336
635 3300046665 Ga0495661_0001806 Ga0495661_0001806_2483_3502 336
636 3300046665 Ga0495661_0107068 Ga0495661_0107068_52_1098 336
637 3300046674 Ga0495588_0000818 Ga0495588_0000818_10817_11827 336
638 3300046675 Ga0495657_0019604 Ga0495657_0019604_1502_2512 336
639 3300046689 Ga0495613_0023887 Ga0495613_0023887_2504_3514 336
640 3300046690 Ga0495624_0026825 Ga0495624_0026825_1426_2436 336
641 3300046809 Ga0495600_0008287 Ga0495600_0008287_2798_3808 336
642 3300046809 Ga0495600_0056044 Ga0495600_0056044_737_1750 336
643 3300046810 Ga0495660_0000024 Ga0495660_0000024_202648_203682 336
644 3300047317 Ga0495604_0081963 Ga0495604_0081963_1111_2121 336
645 3300047319 Ga0495674_0062201 Ga0495674_0062201_1528_2631 336
646 3300047320 Ga0495672_0000116 Ga0495672_0000116_13087_14106 336
647 3300047321 Ga0495676_0136026 Ga0495676_0136026_649_1659 336
648 3300047321 Ga0495676_0193662 Ga0495676_0193662_394_1407 336
649 3300047443 Ga0495687_084434 Ga0495687_084434_132_1142 336
650 3300047469 Ga0495673_0014126 Ga0495673_0014126_1941_2954 336
651 3300047472 Ga0495686_0094381 Ga0495686_0094381_118_1140 336
652 3300047673 Ga0495593_0039444 Ga0495593_0039444_796_1815 336
653 3300048088 Ga0495602_0092674 Ga0495602_0092674_315_1334 336
654 3300048903 Ga0496100_0113507 Ga0496100_0113507_31_1041 336
655 3300048903 Ga0496100_0178247 Ga0496100_0178247_439_1452 336
656 3300048904 Ga0496101_0001703 Ga0496101_0001703_285_1307 336
657 3300048904 Ga0496101_0013194 Ga0496101_0013194_3388_4401 336
658 3300048904 Ga0496101_0036045 Ga0496101_0036045_378_1388 336
659 3300048904 Ga0496101_0118722 Ga0496101_0118722_203_1216 336
660 3300048904 Ga0496101_0184209 Ga0496101_0184209_516_1529 336
661 3300048904 Ga0496101_0190859 Ga0496101_0190859_526_1536 336
662 3300048905 Ga0496102_0001416 Ga0496102_0001416_3180_4202 336
663 3300048905 Ga0496102_0140876 Ga0496102_0140876_675_1685 336
664 3300048906 Ga0496103_0009799 Ga0496103_0009799_4041_5063 336
665 3300048906 Ga0496103_0076722 Ga0496103_0076722_462_1565 336
666 3300048907 Ga0496104_0012329 Ga0496104_0012329_5659_6777 336
667 3300048907 Ga0496104_0030774 Ga0496104_0030774_3837_4847 336
668 3300048907 Ga0496104_0035072 Ga0496104_0035072_200_1222 336
669 3300048907 Ga0496104_0133235 Ga0496104_0133235_317_1330 336
670 3300048907 Ga0496104_0234634 Ga0496104_0234634_298_1308 336
671 3300048908 Ga0496105_0006324 Ga0496105_0006324_5679_6689 336
672 3300048908 Ga0496105_0060911 Ga0496105_0060911_938_1948 336
673 3300048908 Ga0496105_0073570 Ga0496105_0073570_1268_2281 336
674 3300048908 Ga0496105_0104315 Ga0496105_0104315_158_1276 336
675 3300048909 Ga0496106_0015784 Ga0496106_0015784_4076_5194 336
676 3300048909 Ga0496106_0050400 Ga0496106_0050400_1027_2037 336
677 3300048909 Ga0496106_0089559 Ga0496106_0089559_536_1585 336
678 3300048910 Ga0496107_0046569 Ga0496107_0046569_1981_2994 336
679 3300048910 Ga0496107_0245078 Ga0496107_0245078_30_1040 336
680 3300048911 Ga0496108_0042638 Ga0496108_0042638_784_1902 336
681 3300048911 Ga0496108_0050322 Ga0496108_0050322_62_1075 336
682 3300048912 Ga0496109_0007366 Ga0496109_0007366_1420_2433 336
683 3300048912 Ga0496109_0048877 Ga0496109_0048877_336_1454 336
684 3300048912 Ga0496109_0151738 Ga0496109_0151738_584_1594 336
685 3300048913 Ga0496110_0007702 Ga0496110_0007702_2783_3901 336
686 3300048913 Ga0496110_0342201 Ga0496110_0342201_25_1035 336
687 3300048914 Ga0496111_0004414 Ga0496111_0004414_5599_6609 336
688 3300048914 Ga0496111_0037270 Ga0496111_0037270_863_1873 336
689 3300048914 Ga0496111_0096369 Ga0496111_0096369_1090_2103 336
690 3300048915 Ga0496112_0009361 Ga0496112_0009361_6420_7538 336
691 3300048915 Ga0496112_0031255 Ga0496112_0031255_3477_4487 336
692 3300048915 Ga0496112_0362370 Ga0496112_0362370_172_1194 336
693 3300048916 Ga0496113_0070309 Ga0496113_0070309_534_1547 336
694 3300048916 Ga0496113_0070335 Ga0496113_0070335_89_1207 336
695 3300048916 Ga0496113_0083908 Ga0496113_0083908_730_1752 336
696 3300048917 Ga0496114_0064397 Ga0496114_0064397_1043_2053 336
697 3300048917 Ga0496114_0094890 Ga0496114_0094890_494_1504 336
698 3300048917 Ga0496114_0161729 Ga0496114_0161729_877_1890 336
699 3300048918 Ga0496115_0018078 Ga0496115_0018078_2188_3210 336
700 3300048918 Ga0496115_0041129 Ga0496115_0041129_223_1236 336
701 3300048918 Ga0496115_0047008 Ga0496115_0047008_1272_2390 336
702 3300048918 Ga0496115_0081313 Ga0496115_0081313_1325_2338 336
703 3300048918 Ga0496115_0088612 Ga0496115_0088612_593_1603 336
704 3300048920 Ga0496117_0010097 Ga0496117_0010097_2547_3560 336
705 3300048920 Ga0496117_0045299 Ga0496117_0045299_158_1168 336
706 3300048921 Ga0496118_0009789 Ga0496118_0009789_6028_7041 336
707 3300048921 Ga0496118_0020315 Ga0496118_0020315_161_1171 336
708 3300048921 Ga0496118_0022825 Ga0496118_0022825_1867_2877 336
709 3300048921 Ga0496118_0082969 Ga0496118_0082969_1084_2094 336
710 3300048922 Ga0496119_0056287 Ga0496119_0056287_562_1572 336
711 3300048924 Ga0496121_0000214 Ga0496121_0000214_37427_38458 336
712 3300048924 Ga0496121_0000685 Ga0496121_0000685_2598_3611 336
713 3300048924 Ga0496121_0058370 Ga0496121_0058370_18_1028 336
714 3300048924 Ga0496121_0084919 Ga0496121_0084919_1227_2240 336
715 3300048924 Ga0496121_0105941 Ga0496121_0105941_54_1064 336
716 3300048924 Ga0496121_0214180 Ga0496121_0214180_33_1043 336
717 3300048927 Ga0496124_0328766 Ga0496124_0328766_59_1069 336
718 3300048927 Ga0496124_0340126 Ga0496124_0340126_41_1051 336
719 3300048928 Ga0496125_0000243 Ga0496125_0000243_27270_28289 336
720 3300048928 Ga0496125_0000735 Ga0496125_0000735_10472_11485 336
721 3300048928 Ga0496125_0008333 Ga0496125_0008333_9638_10651 336
722 3300048928 Ga0496125_0082897 Ga0496125_0082897_90_1100 336
723 3300048929 Ga0496126_0014474 Ga0496126_0014474_4359_5372 336
724 3300048929 Ga0496126_0017824 Ga0496126_0017824_3024_4037 336
725 3300048929 Ga0496126_0036058 Ga0496126_0036058_131_1144 336
726 3300048929 Ga0496126_0060112 Ga0496126_0060112_1339_2349 336
727 3300048929 Ga0496126_0118232 Ga0496126_0118232_801_1817 336
728 3300048929 Ga0496126_0202141 Ga0496126_0202141_516_1526 336
729 3300048929 Ga0496126_0249456 Ga0496126_0249456_14_1027 336
730 3300049459 Ga0495678_000002 Ga0495678_000002_391481_392515 336
731 3300049569 Ga0501032_0257883 Ga0501032_0257883_48_1067 336
732 3300049572 Ga0501036_0223672 Ga0501036_0223672_468_1487 336
733 3300049579 Ga0501043_0109872 Ga0501043_0109872_212_1231 336
734 3300049586 Ga0501070_0050483 Ga0501070_0050483_468_1487 336
735 3300049588 Ga0501072_0044462 Ga0501072_0044462_466_1515 336
736 3300049822 Ga0501035_0042813 Ga0501035_0042813_655_1674 336
737 3300050491 nmdc:mga00v17_35624_c1 nmdc:mga00v17_35624_c1_1191_2201 336
738 3300050492 nmdc:mga0yw44_149066_c1 nmdc:mga0yw44_149066_c1_210_1220 336
739 3300050492 nmdc:mga0yw44_37691_c1 nmdc:mga0yw44_37691_c1_1758_2768 336
740 3300050492 nmdc:mga0yw44_38782_c1 nmdc:mga0yw44_38782_c1_1313_2335 336
741 3300050492 nmdc:mga0yw44_55103_c1 nmdc:mga0yw44_55103_c1_575_1585 336
742 3300050493 nmdc:mga0k408_88270_c1 nmdc:mga0k408_88270_c1_406_1416 336
743 3300050494 nmdc:mga06z11_82339_c1 nmdc:mga06z11_82339_c1_364_1386 336
744 3300050496 nmdc:mga07m45_156504_c1 nmdc:mga07m45_156504_c1_68_1093 336
745 3300050496 nmdc:mga07m45_23848_c1 nmdc:mga07m45_23848_c1_1712_2728 336
746 3300050512 nmdc:mga0n895_534669_c1 nmdc:mga0n895_534669_c1_137_1159 336
747 3300050514 nmdc:mga08x19_78548_c1 nmdc:mga08x19_78548_c1_499_1509 336
748 3300053086 Ga0500578_0057815 Ga0500578_0057815_533_1555 336
749 3300053087 Ga0500643_000331 Ga0500643_000331_19425_20435 336
750 3300053093 Ga0500651_0004448 Ga0500651_0004448_6311_7333 336
751 3300053094 Ga0500566_0000173 Ga0500566_0000173_27656_28684 336
752 3300053094 Ga0500566_0000468 Ga0500566_0000468_4066_5130 336
753 3300053102 Ga0500554_002275 Ga0500554_002275_33_1046 336
754 3300053103 Ga0500555_002543 Ga0500555_002543_331_1377 336
755 3300053105 Ga0500557_000164 Ga0500557_000164_2308_3318 336
756 3300053115 Ga0500591_042582 Ga0500591_042582_159_1187 336
757 3300053123 Ga0500614_000764 Ga0500614_000764_3183_4211 336
758 3300053130 Ga0500642_0000088 Ga0500642_0000088_22547_23557 336
759 3300053136 Ga0500559_0000075 Ga0500559_0000075_71570_72619 336
760 3300053136 Ga0500559_0004833 Ga0500559_0004833_3531_4559 336
761 3300053150 Ga0500603_000079 Ga0500603_000079_17455_18468 336
762 3300053150 Ga0500603_000287 Ga0500603_000287_644_1672 336
763 3300053159 Ga0500630_000627 Ga0500630_000627_3923_4951 336
764 3300053162 Ga0500638_090207 Ga0500638_090207_380_1390 336
765 3300053163 Ga0500639_000012 Ga0500639_000012_115389_116417 336
766 3300053177 Ga0500636_0180175 Ga0500636_0180175_21_1031 336
767 3300053178 Ga0500637_0029535 Ga0500637_0029535_302_1330 336
768 3300053178 Ga0500637_0030060 Ga0500637_0030060_10_1023 336
769 3300053731 Ga0500609_006832 Ga0500609_006832_461_1471 336
770 3300053735 Ga0500596_000886 Ga0500596_000886_942_1970 336
771 iso_pu_bacteria 2617270741 2617376958 336
772 iso_pu_bacteria 2935769743 2935774923 336
773 iso_pu_bacteria 2935785616 2935792159 336
774 iso_pu_bacteria 2935793552 2935798672 336
775 iso_pu_bacteria 2941531003 2941534788 336
776 iso_pu_bacteria 3005483717 3005490339 336
777 iso_pu_bacteria 8016530956 8016539032 336
778 iso_pu_bacteria 8016539877 8016543318 336
779 iso_pu_bacteria 8016548790 8016549980 336
780 iso_pu_bacteria 8016557553 8016558392 336
781 iso_pu_bacteria 8016575299 8016581372 336
782 iso_pu_bacteria 8016595262 8016596382 336
783 iso_pu_bacteria 8016622563 8016630440 336
784 iso_pu_bacteria 8019530166 8019538695 336
785 iso_pu_bacteria 8019547302 8019549385 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

74

372

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9544 1 312
3eb3-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone 0.9342 1 309
3eb4-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone 0.9338 1 309
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9323 1 320
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9298 1 327
ID Description Score Start End Superfamily
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9495 1 309 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.943 1 309 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.935 1 309 3.20.20.100
af_P97382_23_247_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.92 100 309 3.20.20.100
af_A0A1D6KXU0_49_191_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9186 1 122 3.20.20.100
ID Description Score Start End GO Terms
AF-F3CAX4-F1-model_v4 Aldo/keto reductase family oxidoreductase 0.99 1 179 GO:0005829
GO:0016491
AF-A0A2M8P5I0-F1-model_v4 Aldo/keto reductase 0.9891 103 202 GO:0005829
GO:0016491
AF-A0A7X8XGQ2-F1-model_v4 Aldo/keto reductase 0.9883 1 126 GO:0005829
AF-A0A529HD53-F1-model_v4 Aldo/keto reductase 0.9872 86 209 GO:0005829
GO:0016491
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.9863 1 202 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.88 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map