F480642
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 782 | 435 | 665 | 290 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2895660088|2895663140 |
| Length | 322 |
| Sequence | TNMPAVNPGASGSGSGSGAGLPSTTDAPRLPSLSRRSSSAPAARRAKAPMSIGTTLVLLIGALYCLTPVLWVVIASTKDGSELFSTFTFLPSSHLWDNIVELTQYRGGLYWRWMVNTALYAGVGAILSTYVSMLSGYALAKFTFPGKSGVFKVLLMGVLVPGVILAIPQYFMLAQVGMTNTYWAVLLPQIISPYGIYLARIYAAAAVPTEIIESGRTEGASELFILHRLAMPMMLPGLVTVFLFQFVAIWNNFMLPYIMLGDDKLFPITVGLSGLLNQGSTVPALYTLVITGALLSIIPLIALFLVLQRYWRVDLAAGAVKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 3 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 4 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 5 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 6 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 7 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 8 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 9 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 10 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 11 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 12 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 13 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 14 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 15 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 16 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 17 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 18 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 19 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 20 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 21 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 22 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 23 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 24 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 25 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 26 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 27 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 28 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 29 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 30 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 31 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 32 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 33 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 34 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 35 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 36 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 37 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 38 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 39 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 40 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 41 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 42 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 43 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 44 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 45 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 46 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 47 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 48 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 49 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 50 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 51 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 52 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 53 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 54 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 55 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 56 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 57 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 58 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 59 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 60 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 61 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 62 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 63 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 64 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 65 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 66 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 67 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 68 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 69 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 70 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 71 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 72 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 73 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 74 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 75 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 76 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 77 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 78 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 79 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 80 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 81 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 82 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 83 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 84 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 85 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 86 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 87 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 88 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 89 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 90 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 91 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 92 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 93 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 94 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 95 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 97 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 98 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 99 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 100 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 101 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 102 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 114 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 117 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 119 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 120 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 121 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 122 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 123 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 124 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 125 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 126 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 127 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 128 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 129 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 130 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 132 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 134 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 135 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 136 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 137 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 138 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 156 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 205 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 206 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 207 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 208 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 209 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 210 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 224 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 247 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 248 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 252 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 253 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 254 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 255 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 256 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 257 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 258 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 259 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 260 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 261 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 262 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 395 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 402 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 405 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 406 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 408 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 410 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 411 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 412 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 413 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 414 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 415 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 416 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 417 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 418 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 419 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 420 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 421 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 422 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 423 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 424 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 425 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 428 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 429 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 430 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 431 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 432 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 433 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 434 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 435 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.53 |
| Metatranscriptomes | 0.51 |
| Isolates | 14.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.37 |
| Nodule | 0.26 |
| Rhizoplane | 1.92 |
| Rhizosphere | 76.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10013390 | 3300001989 | Bacteria | 2995 |
| 2 | JGI24739J22299_10018856 | 3300001989 | Bacteria | 2475 |
| 3 | JGI25406J46586_10003396 | 3300003203 | Bacteria | 7491 |
| 4 | JGI25406J46586_10020748 | 3300003203 | Bacteria | 2650 |
| 5 | rootH1_10016398 | 3300003316 | Bacteria | 16490 |
| 6 | rootL2_10004889 | 3300003322 | Bacteria | 4333 |
| 7 | rootL2_10106867 | 3300003322 | Bacteria | 2652 |
| 8 | rootL2_10187667 | 3300003322 | Bacteria | 1211 |
| 9 | rootH1_10041099 | 3300003323 | Bacteria | 3405 |
| 10 | rootH1_10061199 | 3300003323 | Bacteria | 2200 |
| 11 | Ga0006562J51391_1136929 | 3300003578 | Bacteria | 2050 |
| 12 | Ga0055539_1002865 | 3300003752 | Bacteria | 2520 |
| 13 | Ga0065714_10003307 | 3300005288 | Bacteria | 7769 |
| 14 | Ga0070658_10029441 | 3300005327 | Bacteria | 4411 |
| 15 | Ga0070658_10132103 | 3300005327 | Bacteria | 2081 |
| 16 | Ga0070683_100343311 | 3300005329 | Bacteria | 1422 |
| 17 | Ga0070682_100058749 | 3300005337 | Bacteria | 2426 |
| 18 | Ga0070660_100198461 | 3300005339 | Bacteria | 1627 |
| 19 | Ga0070668_100000386 | 3300005347 | Bacteria | 29165 |
| 20 | Ga0070668_100008412 | 3300005347 | Bacteria | 7663 |
| 21 | Ga0070668_100029140 | 3300005347 | Bacteria | 4192 |
| 22 | Ga0070667_100531654 | 3300005367 | Bacteria | 1079 |
| 23 | Ga0070667_100635003 | 3300005367 | Bacteria | 985 |
| 24 | Ga0070714_100107991 | 3300005435 | Bacteria | 2460 |
| 25 | Ga0070714_100194716 | 3300005435 | Bacteria | 1852 |
| 26 | Ga0070714_100451474 | 3300005435 | Bacteria | 1221 |
| 27 | Ga0070713_100049127 | 3300005436 | Bacteria | 3479 |
| 28 | Ga0070713_100117129 | 3300005436 | Bacteria | 2331 |
| 29 | Ga0070713_100427765 | 3300005436 | Bacteria | 1240 |
| 30 | Ga0070710_10000347 | 3300005437 | Bacteria | 22041 |
| 31 | Ga0070711_100242187 | 3300005439 | Bacteria | 1411 |
| 32 | Ga0070663_100002487 | 3300005455 | Bacteria | 10392 |
| 33 | Ga0070663_100002529 | 3300005455 | Bacteria | 10326 |
| 34 | Ga0070681_10132594 | 3300005458 | Bacteria | 2423 |
| 35 | Ga0070679_100011830 | 3300005530 | Bacteria | 8324 |
| 36 | Ga0070679_100110853 | 3300005530 | Bacteria | 2730 |
| 37 | Ga0070684_100087888 | 3300005535 | Bacteria | 2760 |
| 38 | Ga0068853_100017090 | 3300005539 | Bacteria | 5983 |
| 39 | Ga0068853_100060366 | 3300005539 | Bacteria | 3276 |
| 40 | Ga0070665_100046261 | 3300005548 | Bacteria | 4372 |
| 41 | Ga0070665_100195507 | 3300005548 | Bacteria | 2023 |
| 42 | Ga0070665_100518515 | 3300005548 | Bacteria | 1204 |
| 43 | Ga0068855_100006547 | 3300005563 | Bacteria | 14157 |
| 44 | Ga0068855_100012980 | 3300005563 | Bacteria | 10052 |
| 45 | Ga0068855_100338767 | 3300005563 | Bacteria | 1659 |
| 46 | Ga0068854_100096558 | 3300005578 | Bacteria | 2208 |
| 47 | Ga0068854_100384325 | 3300005578 | Bacteria | 1157 |
| 48 | Ga0068856_100074324 | 3300005614 | Bacteria | 3365 |
| 49 | Ga0068856_100134800 | 3300005614 | Bacteria | 2475 |
| 50 | Ga0068856_100321322 | 3300005614 | Bacteria | 1565 |
| 51 | Ga0068856_100469775 | 3300005614 | Bacteria | 1279 |
| 52 | Ga0068852_100044441 | 3300005616 | Bacteria | 3773 |
| 53 | Ga0068859_100120643 | 3300005617 | Bacteria | 2689 |
| 54 | Ga0068859_100320127 | 3300005617 | Bacteria | 1645 |
| 55 | Ga0068859_100346138 | 3300005617 | Bacteria | 1581 |
| 56 | Ga0068861_100197337 | 3300005719 | Bacteria | 1687 |
| 57 | Ga0068863_100664981 | 3300005841 | Bacteria | 1034 |
| 58 | Ga0068858_100175704 | 3300005842 | Bacteria | 2021 |
| 59 | Ga0068860_100020130 | 3300005843 | Bacteria | 6465 |
| 60 | Ga0068862_100096266 | 3300005844 | Bacteria | 2583 |
| 61 | Ga0068862_100117355 | 3300005844 | Bacteria | 2342 |
| 62 | Ga0081455_10000198 | 3300005937 | Bacteria | 76277 |
| 63 | Ga0081455_10015011 | 3300005937 | Bacteria | 7544 |
| 64 | Ga0081539_10000116 | 3300005985 | Bacteria | 186861 |
| 65 | Ga0081539_10002529 | 3300005985 | Bacteria | 25532 |
| 66 | Ga0070717_10122055 | 3300006028 | Bacteria | 2233 |
| 67 | Ga0075363_100017793 | 3300006048 | Bacteria | 3530 |
| 68 | Ga0075363_100116128 | 3300006048 | Bacteria | 1490 |
| 69 | Ga0075363_100230939 | 3300006048 | Bacteria | 1062 |
| 70 | Ga0070712_100121179 | 3300006175 | Bacteria | 1968 |
| 71 | Ga0075367_10000224 | 3300006178 | Bacteria | 18937 |
| 72 | Ga0075428_100001094 | 3300006844 | Bacteria | 28851 |
| 73 | Ga0075430_100003000 | 3300006846 | Bacteria | 14122 |
| 74 | Ga0075431_100015982 | 3300006847 | Bacteria | 7615 |
| 75 | Ga0075429_100000494 | 3300006880 | Bacteria | 29616 |
| 76 | Ga0097620_100120643 | 3300006931 | Bacteria | 2689 |
| 77 | Ga0097620_100320119 | 3300006931 | Bacteria | 1645 |
| 78 | Ga0097620_100346170 | 3300006931 | Bacteria | 1581 |
| 79 | Ga0105240_10020634 | 3300009093 | Bacteria | 8783 |
| 80 | Ga0105240_10186938 | 3300009093 | Bacteria | 2439 |
| 81 | Ga0114129_10372288 | 3300009147 | Bacteria | 1888 |
| 82 | Ga0105243_10113361 | 3300009148 | Bacteria | 2273 |
| 83 | Ga0105243_10237872 | 3300009148 | Bacteria | 1619 |
| 84 | Ga0105243_10394335 | 3300009148 | Bacteria | 1284 |
| 85 | Ga0105241_10000490 | 3300009174 | Bacteria | 29892 |
| 86 | Ga0105241_10017053 | 3300009174 | Bacteria | 5332 |
| 87 | Ga0105242_10149434 | 3300009176 | Bacteria | 2036 |
| 88 | Ga0105248_10706662 | 3300009177 | Bacteria | 1137 |
| 89 | Ga0105237_10051232 | 3300009545 | Bacteria | 4146 |
| 90 | Ga0105238_10057219 | 3300009551 | Bacteria | 3910 |
| 91 | Ga0105238_10240753 | 3300009551 | Bacteria | 1787 |
| 92 | Ga0105238_10449884 | 3300009551 | Bacteria | 1285 |
| 93 | Ga0105029_100341 | 3300009984 | Bacteria | 2445 |
| 94 | Ga0105239_10086406 | 3300010375 | Bacteria | 3457 |
| 95 | Ga0105239_10432100 | 3300010375 | Bacteria | 1492 |
| 96 | Ga0105239_10495921 | 3300010375 | Bacteria | 1388 |
| 97 | Ga0157370_10272139 | 3300013104 | Bacteria | 1565 |
| 98 | Ga0157370_10280396 | 3300013104 | Bacteria | 1540 |
| 99 | Ga0157369_10020878 | 3300013105 | Bacteria | 7322 |
| 100 | Ga0157369_10027187 | 3300013105 | Bacteria | 6344 |
| 101 | Ga0157369_10029746 | 3300013105 | Bacteria | 6033 |
| 102 | Ga0157369_10043041 | 3300013105 | Bacteria | 4923 |
| 103 | Ga0157374_10047880 | 3300013296 | Bacteria | 3965 |
| 104 | Ga0157378_10034741 | 3300013297 | Bacteria | 4458 |
| 105 | Ga0163162_10539534 | 3300013306 | Bacteria | 1295 |
| 106 | Ga0157372_10172262 | 3300013307 | Bacteria | 2504 |
| 107 | Ga0183367_1003 | 3300015688 | Bacteria | 814276 |
| 108 | Ga0183367_1004 | 3300015688 | Bacteria | 716880 |
| 109 | Ga0206354_11401955 | 3300020081 | Bacteria | 2037 |
| 110 | Ga0206353_10480480 | 3300020082 | Bacteria | 1988 |
| 111 | Ga0206353_11206199 | 3300020082 | Bacteria | 21902 |
| 112 | Ga0209563_100586 | 3300025230 | Bacteria | 12043 |
| 113 | Ga0209677_100513 | 3300025253 | Bacteria | 21624 |
| 114 | Ga0209233_1031932 | 3300025261 | Unclassified | 1223 |
| 115 | Ga0209455_1004394 | 3300025272 | Bacteria | 4635 |
| 116 | Ga0207713_1042807 | 3300025735 | Bacteria | 1877 |
| 117 | Ga0207692_10001270 | 3300025898 | Bacteria | 9367 |
| 118 | Ga0207692_10030878 | 3300025898 | Bacteria | 2560 |
| 119 | Ga0207647_10003321 | 3300025904 | Bacteria | 12087 |
| 120 | Ga0207647_10019597 | 3300025904 | Bacteria | 4548 |
| 121 | Ga0207647_10096604 | 3300025904 | Bacteria | 1758 |
| 122 | Ga0207705_10030365 | 3300025909 | Bacteria | 3857 |
| 123 | Ga0207705_10258415 | 3300025909 | Bacteria | 1329 |
| 124 | Ga0207654_10002631 | 3300025911 | Bacteria | 9108 |
| 125 | Ga0207695_10010930 | 3300025913 | Bacteria | 11042 |
| 126 | Ga0207695_10054521 | 3300025913 | Bacteria | 4174 |
| 127 | Ga0207671_10000594 | 3300025914 | Bacteria | 48267 |
| 128 | Ga0207671_10000886 | 3300025914 | Bacteria | 37914 |
| 129 | Ga0207693_10001642 | 3300025915 | Bacteria | 19747 |
| 130 | Ga0207663_10147136 | 3300025916 | Bacteria | 1648 |
| 131 | Ga0207657_10275951 | 3300025919 | Bacteria | 1335 |
| 132 | Ga0207649_10031095 | 3300025920 | Bacteria | 3170 |
| 133 | Ga0207652_10053262 | 3300025921 | Bacteria | 3476 |
| 134 | Ga0207652_10578466 | 3300025921 | Bacteria | 1008 |
| 135 | Ga0207694_10005786 | 3300025924 | Bacteria | 9469 |
| 136 | Ga0207694_10019245 | 3300025924 | Bacteria | 5161 |
| 137 | Ga0207700_10017247 | 3300025928 | Bacteria | 4819 |
| 138 | Ga0207700_10046721 | 3300025928 | Bacteria | 3204 |
| 139 | Ga0207664_10010108 | 3300025929 | Bacteria | 6653 |
| 140 | Ga0207664_10016938 | 3300025929 | Bacteria | 5330 |
| 141 | Ga0207664_10061056 | 3300025929 | Bacteria | 3006 |
| 142 | Ga0207709_10175179 | 3300025935 | Bacteria | 1509 |
| 143 | Ga0207689_10143456 | 3300025942 | Bacteria | 1968 |
| 144 | Ga0207667_10133297 | 3300025949 | Bacteria | 2559 |
| 145 | Ga0207667_10418265 | 3300025949 | Bacteria | 1364 |
| 146 | Ga0207668_10000190 | 3300025972 | Bacteria | 41980 |
| 147 | Ga0207668_10000377 | 3300025972 | Bacteria | 28306 |
| 148 | Ga0207668_10335183 | 3300025972 | Bacteria | 1260 |
| 149 | Ga0207640_10049087 | 3300025981 | Bacteria | 2731 |
| 150 | Ga0207658_10107442 | 3300025986 | Bacteria | 2199 |
| 151 | Ga0207658_10232424 | 3300025986 | Bacteria | 1557 |
| 152 | Ga0207639_10062019 | 3300026041 | Bacteria | 2890 |
| 153 | Ga0207639_10197851 | 3300026041 | Bacteria | 1721 |
| 154 | Ga0207678_10000057 | 3300026067 | Bacteria | 86102 |
| 155 | Ga0207678_10003078 | 3300026067 | Bacteria | 15084 |
| 156 | Ga0207678_10009503 | 3300026067 | Bacteria | 8554 |
| 157 | Ga0207678_10149131 | 3300026067 | Bacteria | 1997 |
| 158 | Ga0207678_10341324 | 3300026067 | Bacteria | 1291 |
| 159 | Ga0207702_10346897 | 3300026078 | Bacteria | 1419 |
| 160 | Ga0207641_10511515 | 3300026088 | Bacteria | 1167 |
| 161 | Ga0207676_10264424 | 3300026095 | Bacteria | 1555 |
| 162 | Ga0207674_10033596 | 3300026116 | Bacteria | 5368 |
| 163 | Ga0207674_10205211 | 3300026116 | Bacteria | 1920 |
| 164 | Ga0207675_100185237 | 3300026118 | Bacteria | 1995 |
| 165 | Ga0207698_10075011 | 3300026142 | Bacteria | 2701 |
| 166 | Ga0268265_10105682 | 3300028380 | Bacteria | 2285 |
| 167 | Ga0268265_10227924 | 3300028380 | Bacteria | 1635 |
| 168 | Ga0268264_10045199 | 3300028381 | Bacteria | 3656 |
| 169 | Ga0268264_10046328 | 3300028381 | Bacteria | 3612 |
| 170 | Ga0268264_10181849 | 3300028381 | Bacteria | 1910 |
| 171 | Ga0265337_1001738 | 3300028556 | Bacteria | 10531 |
| 172 | Ga0265326_10002457 | 3300028558 | Bacteria | 6246 |
| 173 | Ga0265319_1004500 | 3300028563 | Bacteria | 6887 |
| 174 | Ga0265334_10000913 | 3300028573 | Bacteria | 14757 |
| 175 | Ga0265318_10009741 | 3300028577 | Bacteria | 4211 |
| 176 | Ga0265323_10001725 | 3300028653 | Bacteria | 10381 |
| 177 | Ga0265336_10001366 | 3300028666 | Bacteria | 11252 |
| 178 | Ga0307517_10006227 | 3300028786 | Bacteria | 17741 |
| 179 | Ga0307515_10002799 | 3300028794 | Bacteria | 37130 |
| 180 | Ga0307515_10004403 | 3300028794 | Bacteria | 29167 |
| 181 | Ga0307515_10019161 | 3300028794 | Bacteria | 12337 |
| 182 | Ga0307515_10029984 | 3300028794 | Bacteria | 9165 |
| 183 | Ga0307515_10037368 | 3300028794 | Bacteria | 7811 |
| 184 | Ga0307515_10054150 | 3300028794 | Bacteria | 5897 |
| 185 | Ga0307515_10089723 | 3300028794 | Bacteria | 3866 |
| 186 | Ga0307515_10109953 | 3300028794 | Bacteria | 3231 |
| 187 | Ga0307515_10149095 | 3300028794 | Bacteria | 2456 |
| 188 | Ga0265338_10006593 | 3300028800 | Bacteria | 14716 |
| 189 | Ga0265338_10135552 | 3300028800 | Unclassified | 1936 |
| 190 | Ga0265324_10005341 | 3300029957 | Bacteria | 5569 |
| 191 | Ga0307511_10001462 | 3300030521 | Bacteria | 24966 |
| 192 | Ga0307511_10053588 | 3300030521 | Bacteria | 3194 |
| 193 | Ga0307511_10158716 | 3300030521 | Bacteria | 1276 |
| 194 | Ga0307512_10002105 | 3300030522 | Bacteria | 26166 |
| 195 | Ga0307512_10004222 | 3300030522 | Bacteria | 15874 |
| 196 | Ga0307512_10004835 | 3300030522 | Bacteria | 14451 |
| 197 | Ga0307512_10006577 | 3300030522 | Bacteria | 11745 |
| 198 | Ga0307512_10032588 | 3300030522 | Bacteria | 4497 |
| 199 | Ga0307512_10204837 | 3300030522 | Bacteria | 1060 |
| 200 | Ga0316177_1007692 | 3300030731 | Bacteria | 1600 |
| 201 | Ga0316176_1054292 | 3300030732 | Bacteria | 2502 |
| 202 | Ga0314311_1140623 | 3300030733 | Bacteria | 3660 |
| 203 | Ga0316180_1169781 | 3300030736 | Bacteria | 1848 |
| 204 | Ga0265320_10007956 | 3300031240 | Bacteria | 6534 |
| 205 | Ga0265325_10010420 | 3300031241 | Bacteria | 5385 |
| 206 | Ga0265340_10003865 | 3300031247 | Bacteria | 8433 |
| 207 | Ga0265339_10071730 | 3300031249 | Bacteria | 1844 |
| 208 | Ga0307513_10001463 | 3300031456 | Bacteria | 33963 |
| 209 | Ga0307513_10036257 | 3300031456 | Bacteria | 5505 |
| 210 | Ga0307513_10043474 | 3300031456 | Bacteria | 4933 |
| 211 | Ga0307509_10017853 | 3300031507 | Bacteria | 8149 |
| 212 | Ga0307509_10024530 | 3300031507 | Bacteria | 6750 |
| 213 | Ga0307509_10029137 | 3300031507 | Bacteria | 6131 |
| 214 | Ga0307509_10051308 | 3300031507 | Bacteria | 4413 |
| 215 | Ga0307509_10182643 | 3300031507 | Bacteria | 1960 |
| 216 | Ga0307408_100089169 | 3300031548 | Bacteria | 2324 |
| 217 | Ga0307408_100116272 | 3300031548 | Bacteria | 2064 |
| 218 | Ga0307508_10000746 | 3300031616 | Bacteria | 38597 |
| 219 | Ga0307508_10067173 | 3300031616 | Bacteria | 3155 |
| 220 | Ga0307508_10108473 | 3300031616 | Bacteria | 2375 |
| 221 | Ga0307514_10215513 | 3300031649 | Bacteria | 1185 |
| 222 | Ga0265314_10012450 | 3300031711 | Bacteria | 6941 |
| 223 | Ga0265342_10007950 | 3300031712 | Bacteria | 7684 |
| 224 | Ga0307516_10000177 | 3300031730 | Bacteria | 82023 |
| 225 | Ga0307516_10000894 | 3300031730 | Bacteria | 41096 |
| 226 | Ga0307516_10014914 | 3300031730 | Bacteria | 8199 |
| 227 | Ga0307516_10015544 | 3300031730 | Bacteria | 8005 |
| 228 | Ga0307516_10019656 | 3300031730 | Bacteria | 6992 |
| 229 | Ga0307516_10020601 | 3300031730 | Bacteria | 6810 |
| 230 | Ga0307516_10024519 | 3300031730 | Bacteria | 6160 |
| 231 | Ga0307516_10084527 | 3300031730 | Bacteria | 3012 |
| 232 | Ga0307516_10157400 | 3300031730 | Bacteria | 2025 |
| 233 | Ga0307516_10191573 | 3300031730 | Bacteria | 1770 |
| 234 | Ga0307405_10005419 | 3300031731 | Bacteria | 6153 |
| 235 | Ga0307405_10022393 | 3300031731 | Bacteria | 3572 |
| 236 | Ga0307413_10001707 | 3300031824 | Bacteria | 8572 |
| 237 | Ga0307413_10046803 | 3300031824 | Bacteria | 2575 |
| 238 | Ga0307518_10096566 | 3300031838 | Bacteria | 2120 |
| 239 | Ga0307410_10210276 | 3300031852 | Bacteria | 1490 |
| 240 | Ga0307410_10468596 | 3300031852 | Bacteria | 1031 |
| 241 | Ga0307406_10000115 | 3300031901 | Bacteria | 46616 |
| 242 | Ga0307406_10000119 | 3300031901 | Bacteria | 46191 |
| 243 | Ga0307406_10097764 | 3300031901 | Bacteria | 1992 |
| 244 | Ga0307406_10114537 | 3300031901 | Bacteria | 1862 |
| 245 | Ga0307407_10008833 | 3300031903 | Bacteria | 4654 |
| 246 | Ga0307407_10017144 | 3300031903 | Bacteria | 3626 |
| 247 | Ga0307412_10009796 | 3300031911 | Bacteria | 5501 |
| 248 | Ga0307412_10014019 | 3300031911 | Bacteria | 4719 |
| 249 | Ga0307412_10038248 | 3300031911 | Bacteria | 3088 |
| 250 | Ga0307412_10187559 | 3300031911 | Bacteria | 1561 |
| 251 | Ga0307409_100000181 | 3300031995 | Bacteria | 24481 |
| 252 | Ga0307409_100052591 | 3300031995 | Bacteria | 3124 |
| 253 | Ga0307409_100764783 | 3300031995 | Bacteria | 971 |
| 254 | Ga0307416_100039664 | 3300032002 | Bacteria | 3649 |
| 255 | Ga0307416_100059910 | 3300032002 | Bacteria | 3097 |
| 256 | Ga0307414_10006971 | 3300032004 | Bacteria | 6333 |
| 257 | Ga0307414_10008517 | 3300032004 | Bacteria | 5822 |
| 258 | Ga0307411_10031162 | 3300032005 | Bacteria | 3277 |
| 259 | Ga0307411_10274438 | 3300032005 | Bacteria | 1339 |
| 260 | Ga0307411_10485742 | 3300032005 | Bacteria | 1041 |
| 261 | Ga0307415_100000148 | 3300032126 | Bacteria | 31023 |
| 262 | Ga0307415_100028775 | 3300032126 | Bacteria | 3541 |
| 263 | Ga0307415_100086027 | 3300032126 | Bacteria | 2261 |
| 264 | Ga0307415_100089198 | 3300032126 | Bacteria | 2227 |
| 265 | Ga0307415_100136665 | 3300032126 | Bacteria | 1865 |
| 266 | Ga0307507_10000016 | 3300033179 | Bacteria | 225984 |
| 267 | Ga0307507_10022239 | 3300033179 | Bacteria | 7016 |
| 268 | Ga0307507_10043043 | 3300033179 | Bacteria | 4487 |
| 269 | Ga0307507_10058272 | 3300033179 | Bacteria | 3628 |
| 270 | Ga0307507_10138680 | 3300033179 | Bacteria | 1872 |
| 271 | Ga0307510_10097614 | 3300033180 | Bacteria | 2747 |
| 272 | Ga0307510_10155598 | 3300033180 | Bacteria | 1893 |
| 273 | Ga0307510_10236896 | 3300033180 | Bacteria | 1323 |
| 274 | Ga0373950_0018230 | 3300034818 | Bacteria | 1216 |
| 275 | Ga0373951_0000300 | 3300035091 | Bacteria | 15760 |
| 276 | Ga0373955_0287960 | 3300035172 | Bacteria | 989 |
| 277 | Ga0373942_0000443 | 3300035207 | Bacteria | 11609 |
| 278 | Ga0373935_0001950 | 3300035692 | Bacteria | 11604 |
| 279 | Ga0373925_0000237 | 3300037068 | Bacteria | 58351 |
| 280 | Ga0395899_0000833 | 3300037312 | Bacteria | 29778 |
| 281 | Ga0395899_0002077 | 3300037312 | Bacteria | 16450 |
| 282 | Ga0395900_0177717 | 3300037418 | Bacteria | 2165 |
| 283 | Ga0395898_0116450 | 3300037466 | Bacteria | 2561 |
| 284 | Ga0395901_0273843 | 3300038443 | Bacteria | 1755 |
| 285 | Ga0439436_0001148 | 3300041404 | Bacteria | 7520 |
| 286 | Ga0439436_0008662 | 3300041404 | Bacteria | 3127 |
| 287 | Ga0439439_0004980 | 3300041406 | Bacteria | 3014 |
| 288 | Ga0451793_1147289 | 3300041452 | Bacteria | 1486 |
| 289 | Ga0451798_0658012 | 3300041458 | Bacteria | 1205 |
| 290 | Ga0451802_1239871 | 3300041460 | Bacteria | 1650 |
| 291 | Ga0451833_0184157 | 3300041491 | Bacteria | 1581 |
| 292 | Ga0451833_0615816 | 3300041491 | Bacteria | 1548 |
| 293 | Ga0451853_0437132 | 3300041512 | Bacteria | 8360 |
| 294 | Ga0451853_1338476 | 3300041512 | Bacteria | 5597 |
| 295 | Ga0439431_0024570 | 3300041997 | Bacteria | 1467 |
| 296 | Ga0439433_0003978 | 3300041999 | Bacteria | 3180 |
| 297 | Ga0439449_0000771 | 3300042007 | Bacteria | 12317 |
| 298 | Ga0439449_0008913 | 3300042007 | Bacteria | 3806 |
| 299 | Ga0439449_0083501 | 3300042007 | Bacteria | 1178 |
| 300 | Ga0439457_000064 | 3300042014 | Bacteria | 22792 |
| 301 | Ga0439457_004083 | 3300042014 | Bacteria | 3865 |
| 302 | Ga0439457_005509 | 3300042014 | Bacteria | 3181 |
| 303 | Ga0439457_016910 | 3300042014 | Bacteria | 1623 |
| 304 | Ga0450890_011050 | 3300042127 | Bacteria | 1164 |
| 305 | Ga0450899_000219 | 3300042135 | Bacteria | 6008 |
| 306 | Ga0450899_002676 | 3300042135 | Bacteria | 1925 |
| 307 | Ga0450903_003756 | 3300042138 | Bacteria | 2619 |
| 308 | Ga0450906_000627 | 3300042145 | Bacteria | 7564 |
| 309 | Ga0439458_0037620 | 3300042157 | Bacteria | 1167 |
| 310 | Ga0450908_001411 | 3300042184 | Bacteria | 4661 |
| 311 | Ga0466969_0013971 | 3300044656 | Bacteria | 4226 |
| 312 | Ga0466969_0016209 | 3300044656 | Bacteria | 3903 |
| 313 | Ga0466969_0016800 | 3300044656 | Bacteria | 3826 |
| 314 | Ga0466969_0040940 | 3300044656 | Bacteria | 2320 |
| 315 | Ga0466969_0056891 | 3300044656 | Bacteria | 1908 |
| 316 | Ga0466969_0082872 | 3300044656 | Bacteria | 1528 |
| 317 | Ga0466969_0142197 | 3300044656 | Bacteria | 1108 |
| 318 | Ga0466972_0004270 | 3300044658 | Bacteria | 7138 |
| 319 | Ga0466972_0006665 | 3300044658 | Bacteria | 5794 |
| 320 | Ga0466972_0010681 | 3300044658 | Bacteria | 4607 |
| 321 | Ga0466972_0014568 | 3300044658 | Bacteria | 3937 |
| 322 | Ga0466972_0025925 | 3300044658 | Bacteria | 2904 |
| 323 | Ga0466972_0030850 | 3300044658 | Bacteria | 2638 |
| 324 | Ga0466972_0042953 | 3300044658 | Bacteria | 2196 |
| 325 | Ga0466965_0000006 | 3300044683 | Bacteria | 158069 |
| 326 | Ga0466965_0005771 | 3300044683 | Bacteria | 5587 |
| 327 | Ga0466965_0008284 | 3300044683 | Bacteria | 4806 |
| 328 | Ga0466965_0010777 | 3300044683 | Bacteria | 4276 |
| 329 | Ga0466966_0004721 | 3300044684 | Bacteria | 8964 |
| 330 | Ga0466966_0009699 | 3300044684 | Bacteria | 6378 |
| 331 | Ga0466966_0016186 | 3300044684 | Bacteria | 4931 |
| 332 | Ga0466966_0022480 | 3300044684 | Bacteria | 4136 |
| 333 | Ga0466966_0022733 | 3300044684 | Bacteria | 4110 |
| 334 | Ga0466966_0055970 | 3300044684 | Bacteria | 2496 |
| 335 | Ga0466966_0083890 | 3300044684 | Bacteria | 1982 |
| 336 | Ga0466961_0001507 | 3300044693 | Bacteria | 14453 |
| 337 | Ga0466961_0001724 | 3300044693 | Bacteria | 13599 |
| 338 | Ga0466961_0021132 | 3300044693 | Bacteria | 4190 |
| 339 | Ga0466961_0032710 | 3300044693 | Bacteria | 3342 |
| 340 | Ga0466961_0043208 | 3300044693 | Bacteria | 2887 |
| 341 | Ga0466961_0043513 | 3300044693 | Bacteria | 2876 |
| 342 | Ga0466961_0060657 | 3300044693 | Bacteria | 2405 |
| 343 | Ga0466961_0077057 | 3300044693 | Bacteria | 2112 |
| 344 | Ga0466961_0260162 | 3300044693 | Bacteria | 1064 |
| 345 | Ga0466963_0048625 | 3300044694 | Bacteria | 2803 |
| 346 | Ga0466971_0000308 | 3300044719 | Bacteria | 18882 |
| 347 | Ga0466971_0010058 | 3300044719 | Bacteria | 4132 |
| 348 | Ga0466971_0029535 | 3300044719 | Bacteria | 2452 |
| 349 | Ga0466968_0032353 | 3300044735 | Bacteria | 2175 |
| 350 | Ga0466968_0088863 | 3300044735 | Bacteria | 1366 |
| 351 | Ga0466970_0000635 | 3300044765 | Bacteria | 17248 |
| 352 | Ga0466970_0009236 | 3300044765 | Bacteria | 4977 |
| 353 | Ga0466970_0026897 | 3300044765 | Bacteria | 3015 |
| 354 | Ga0466970_0054369 | 3300044765 | Bacteria | 2138 |
| 355 | Ga0466970_0114708 | 3300044765 | Bacteria | 1473 |
| 356 | Ga0466970_0170712 | 3300044765 | Bacteria | 1205 |
| 357 | Ga0466957_0029701 | 3300044842 | Bacteria | 3261 |
| 358 | Ga0466957_0335017 | 3300044842 | Bacteria | 1024 |
| 359 | Ga0466960_0000667 | 3300044901 | Bacteria | 11931 |
| 360 | Ga0466960_0005489 | 3300044901 | Bacteria | 5028 |
| 361 | Ga0466960_0005654 | 3300044901 | Bacteria | 4961 |
| 362 | Ga0466959_0001924 | 3300045049 | Bacteria | 13062 |
| 363 | Ga0466959_0022340 | 3300045049 | Bacteria | 4676 |
| 364 | Ga0466959_0028567 | 3300045049 | Bacteria | 4135 |
| 365 | Ga0466959_0047829 | 3300045049 | Bacteria | 3145 |
| 366 | Ga0466959_0115249 | 3300045049 | Bacteria | 1914 |
| 367 | Ga0466959_0158779 | 3300045049 | Bacteria | 1590 |
| 368 | Ga0466959_0218072 | 3300045049 | Bacteria | 1324 |
| 369 | Ga0466958_0009839 | 3300045836 | Bacteria | 5336 |
| 370 | Ga0466958_0041077 | 3300045836 | Bacteria | 2781 |
| 371 | Ga0466958_0111951 | 3300045836 | Bacteria | 1704 |
| 372 | Ga0466958_0308863 | 3300045836 | Bacteria | 1016 |
| 373 | Ga0466967_0017950 | 3300045976 | Bacteria | 5639 |
| 374 | Ga0466967_0301368 | 3300045976 | Bacteria | 1542 |
| 375 | Ga0495592_0002276 | 3300046454 | Bacteria | 13536 |
| 376 | Ga0495592_0045059 | 3300046454 | Bacteria | 3292 |
| 377 | Ga0495592_0097708 | 3300046454 | Bacteria | 2097 |
| 378 | Ga0495592_0133773 | 3300046454 | Bacteria | 1731 |
| 379 | Ga0495603_0010543 | 3300046455 | Bacteria | 5598 |
| 380 | Ga0495603_0021643 | 3300046455 | Bacteria | 3894 |
| 381 | Ga0495590_0016035 | 3300046457 | Bacteria | 2710 |
| 382 | Ga0495629_0000626 | 3300046459 | Bacteria | 28709 |
| 383 | Ga0495629_0014032 | 3300046459 | Bacteria | 5773 |
| 384 | Ga0495629_0061340 | 3300046459 | Bacteria | 2628 |
| 385 | Ga0495638_0079450 | 3300046460 | Bacteria | 1994 |
| 386 | Ga0495651_0001198 | 3300046462 | Bacteria | 20050 |
| 387 | Ga0495651_0001254 | 3300046462 | Bacteria | 19647 |
| 388 | Ga0495651_0003257 | 3300046462 | Bacteria | 12459 |
| 389 | Ga0495651_0029755 | 3300046462 | Bacteria | 4258 |
| 390 | Ga0495651_0031692 | 3300046462 | Bacteria | 4121 |
| 391 | Ga0495651_0033826 | 3300046462 | Bacteria | 3986 |
| 392 | Ga0495651_0053181 | 3300046462 | Bacteria | 3119 |
| 393 | Ga0495580_0047232 | 3300046472 | Bacteria | 3052 |
| 394 | Ga0495582_0049263 | 3300046473 | Bacteria | 2320 |
| 395 | Ga0495605_0034529 | 3300046474 | Bacteria | 2560 |
| 396 | Ga0495639_0026750 | 3300046475 | Bacteria | 2551 |
| 397 | Ga0495662_0001387 | 3300046476 | Bacteria | 12007 |
| 398 | Ga0495662_0003692 | 3300046476 | Bacteria | 7721 |
| 399 | Ga0495662_0003828 | 3300046476 | Bacteria | 7586 |
| 400 | Ga0495662_0173284 | 3300046476 | Bacteria | 1063 |
| 401 | Ga0495664_0000225 | 3300046477 | Bacteria | 26888 |
| 402 | Ga0495664_0007836 | 3300046477 | Bacteria | 5944 |
| 403 | Ga0495584_0031304 | 3300046491 | Bacteria | 2693 |
| 404 | Ga0495585_0019430 | 3300046492 | Bacteria | 3917 |
| 405 | Ga0495585_0031771 | 3300046492 | Bacteria | 2996 |
| 406 | Ga0495594_0000666 | 3300046499 | Bacteria | 17683 |
| 407 | Ga0495594_0034005 | 3300046499 | Bacteria | 2772 |
| 408 | Ga0495594_0045402 | 3300046499 | Bacteria | 2411 |
| 409 | Ga0495594_0098811 | 3300046499 | Bacteria | 1641 |
| 410 | Ga0495596_0071119 | 3300046500 | Bacteria | 1351 |
| 411 | Ga0495607_0036881 | 3300046501 | Bacteria | 2942 |
| 412 | Ga0495607_0113750 | 3300046501 | Bacteria | 1431 |
| 413 | Ga0495583_0063735 | 3300046506 | Bacteria | 1637 |
| 414 | Ga0495606_0001231 | 3300046507 | Bacteria | 35820 |
| 415 | Ga0495606_0003545 | 3300046507 | Bacteria | 16479 |
| 416 | Ga0495608_0186169 | 3300046511 | Bacteria | 1312 |
| 417 | Ga0495618_0006585 | 3300046514 | Bacteria | 7046 |
| 418 | Ga0495618_0190766 | 3300046514 | Bacteria | 1299 |
| 419 | Ga0495628_0008046 | 3300046516 | Bacteria | 9076 |
| 420 | Ga0495628_0012572 | 3300046516 | Bacteria | 7133 |
| 421 | Ga0495628_0019754 | 3300046516 | Bacteria | 5565 |
| 422 | Ga0495628_0049010 | 3300046516 | Bacteria | 3346 |
| 423 | Ga0495630_0035055 | 3300046517 | Bacteria | 3750 |
| 424 | Ga0495630_0104908 | 3300046517 | Bacteria | 2139 |
| 425 | Ga0495631_0010398 | 3300046518 | Bacteria | 4605 |
| 426 | Ga0495632_0072667 | 3300046519 | Bacteria | 1650 |
| 427 | Ga0495643_0001005 | 3300046522 | Bacteria | 28801 |
| 428 | Ga0495643_0002935 | 3300046522 | Bacteria | 12918 |
| 429 | Ga0495648_0033077 | 3300046524 | Bacteria | 3383 |
| 430 | Ga0495666_0006788 | 3300046526 | Bacteria | 5750 |
| 431 | Ga0495652_0001571 | 3300046529 | Bacteria | 24996 |
| 432 | Ga0495652_0001890 | 3300046529 | Bacteria | 22269 |
| 433 | Ga0495652_0009656 | 3300046529 | Bacteria | 8759 |
| 434 | Ga0495652_0042397 | 3300046529 | Bacteria | 3924 |
| 435 | Ga0495652_0204773 | 3300046529 | Bacteria | 1494 |
| 436 | Ga0495665_0002200 | 3300046531 | Bacteria | 10556 |
| 437 | Ga0495640_0020815 | 3300046533 | Bacteria | 4820 |
| 438 | Ga0495640_0048674 | 3300046533 | Bacteria | 2928 |
| 439 | Ga0495640_0056304 | 3300046533 | Bacteria | 2686 |
| 440 | Ga0495586_0027310 | 3300046535 | Bacteria | 3054 |
| 441 | Ga0495586_0151419 | 3300046535 | Bacteria | 1305 |
| 442 | Ga0495587_0006654 | 3300046536 | Bacteria | 7526 |
| 443 | Ga0495597_0020741 | 3300046542 | Bacteria | 3058 |
| 444 | Ga0495645_0010711 | 3300046543 | Bacteria | 6439 |
| 445 | Ga0495645_0012052 | 3300046543 | Bacteria | 6093 |
| 446 | Ga0495645_0020844 | 3300046543 | Bacteria | 4736 |
| 447 | Ga0495645_0052068 | 3300046543 | Bacteria | 2979 |
| 448 | Ga0495645_0069544 | 3300046543 | Bacteria | 2541 |
| 449 | Ga0495645_0254828 | 3300046543 | Bacteria | 1165 |
| 450 | Ga0495622_0002951 | 3300046557 | Bacteria | 8106 |
| 451 | Ga0495622_0021833 | 3300046557 | Bacteria | 2982 |
| 452 | Ga0495622_0071851 | 3300046557 | Bacteria | 1597 |
| 453 | Ga0495622_0101370 | 3300046557 | Bacteria | 1319 |
| 454 | Ga0495622_0122949 | 3300046557 | Bacteria | 1184 |
| 455 | Ga0495667_0169543 | 3300046559 | Bacteria | 1403 |
| 456 | Ga0495656_0037051 | 3300046615 | Bacteria | 2012 |
| 457 | Ga0495668_0000326 | 3300046616 | Bacteria | 65274 |
| 458 | Ga0495668_0000537 | 3300046616 | Bacteria | 47191 |
| 459 | Ga0495668_0029493 | 3300046616 | Bacteria | 3099 |
| 460 | Ga0495634_0097224 | 3300046642 | Bacteria | 1906 |
| 461 | Ga0495634_0107028 | 3300046642 | Bacteria | 1801 |
| 462 | Ga0495634_0108108 | 3300046642 | Bacteria | 1790 |
| 463 | Ga0495611_0059195 | 3300046648 | Bacteria | 1738 |
| 464 | Ga0495611_0099992 | 3300046648 | Bacteria | 1346 |
| 465 | Ga0495625_0000770 | 3300046660 | Bacteria | 44596 |
| 466 | Ga0495625_0070625 | 3300046660 | Bacteria | 2452 |
| 467 | Ga0495625_0080494 | 3300046660 | Bacteria | 2269 |
| 468 | Ga0495635_0002503 | 3300046663 | Bacteria | 12553 |
| 469 | Ga0495635_0008627 | 3300046663 | Bacteria | 7118 |
| 470 | Ga0495635_0130323 | 3300046663 | Bacteria | 1714 |
| 471 | Ga0495635_0167526 | 3300046663 | Bacteria | 1494 |
| 472 | Ga0495661_0012847 | 3300046665 | Bacteria | 5646 |
| 473 | Ga0495588_0008717 | 3300046674 | Bacteria | 4660 |
| 474 | Ga0495588_0016895 | 3300046674 | Bacteria | 3534 |
| 475 | Ga0495657_0006945 | 3300046675 | Bacteria | 8789 |
| 476 | Ga0495657_0015799 | 3300046675 | Bacteria | 5513 |
| 477 | Ga0495657_0023538 | 3300046675 | Bacteria | 4398 |
| 478 | Ga0495599_0158290 | 3300046678 | Bacteria | 1400 |
| 479 | Ga0495623_0006089 | 3300046679 | Bacteria | 7848 |
| 480 | Ga0495623_0095528 | 3300046679 | Bacteria | 1817 |
| 481 | Ga0495646_0000371 | 3300046680 | Bacteria | 23327 |
| 482 | Ga0495646_0084850 | 3300046680 | Bacteria | 1838 |
| 483 | Ga0495646_0098165 | 3300046680 | Bacteria | 1682 |
| 484 | Ga0495613_0001859 | 3300046689 | Bacteria | 16059 |
| 485 | Ga0495613_0080950 | 3300046689 | Bacteria | 2360 |
| 486 | Ga0495613_0089386 | 3300046689 | Bacteria | 2231 |
| 487 | Ga0495613_0155554 | 3300046689 | Bacteria | 1629 |
| 488 | Ga0495613_0208631 | 3300046689 | Bacteria | 1374 |
| 489 | Ga0495670_0022512 | 3300046691 | Bacteria | 3111 |
| 490 | Ga0495649_0086137 | 3300046694 | Bacteria | 1677 |
| 491 | Ga0495649_0135954 | 3300046694 | Bacteria | 1295 |
| 492 | Ga0495589_0032224 | 3300046794 | Bacteria | 2635 |
| 493 | Ga0495589_0091936 | 3300046794 | Bacteria | 1473 |
| 494 | Ga0495589_0110718 | 3300046794 | Bacteria | 1325 |
| 495 | Ga0495600_0008866 | 3300046809 | Bacteria | 6197 |
| 496 | Ga0495600_0017817 | 3300046809 | Bacteria | 4520 |
| 497 | Ga0495600_0034963 | 3300046809 | Bacteria | 3262 |
| 498 | Ga0495600_0047332 | 3300046809 | Bacteria | 2805 |
| 499 | Ga0495600_0109113 | 3300046809 | Bacteria | 1802 |
| 500 | Ga0495600_0182187 | 3300046809 | Bacteria | 1353 |
| 501 | Ga0495660_0098336 | 3300046810 | Bacteria | 1509 |
| 502 | Ga0495660_0106479 | 3300046810 | Bacteria | 1436 |
| 503 | Ga0495581_0006333 | 3300047315 | Bacteria | 6866 |
| 504 | Ga0495581_0056132 | 3300047315 | Bacteria | 2273 |
| 505 | Ga0495581_0113725 | 3300047315 | Bacteria | 1574 |
| 506 | Ga0495604_0000502 | 3300047317 | Bacteria | 34488 |
| 507 | Ga0495604_0003240 | 3300047317 | Bacteria | 13008 |
| 508 | Ga0495604_0035125 | 3300047317 | Bacteria | 3961 |
| 509 | Ga0495604_0120447 | 3300047317 | Bacteria | 1900 |
| 510 | Ga0495636_0000810 | 3300047318 | Bacteria | 11514 |
| 511 | Ga0495636_0008279 | 3300047318 | Bacteria | 4105 |
| 512 | Ga0495636_0125129 | 3300047318 | Bacteria | 1140 |
| 513 | Ga0495674_0019544 | 3300047319 | Bacteria | 6285 |
| 514 | Ga0495672_0074703 | 3300047320 | Bacteria | 1908 |
| 515 | Ga0495676_0004654 | 3300047321 | Bacteria | 12569 |
| 516 | Ga0495676_0007142 | 3300047321 | Bacteria | 10249 |
| 517 | Ga0495676_0035431 | 3300047321 | Bacteria | 4173 |
| 518 | Ga0495676_0064778 | 3300047321 | Bacteria | 2840 |
| 519 | Ga0495676_0140495 | 3300047321 | Bacteria | 1731 |
| 520 | Ga0495680_0003794 | 3300047322 | Bacteria | 14681 |
| 521 | Ga0495680_0056712 | 3300047322 | Bacteria | 3032 |
| 522 | Ga0495683_0034166 | 3300047323 | Bacteria | 2587 |
| 523 | Ga0495683_0059580 | 3300047323 | Bacteria | 1894 |
| 524 | Ga0495687_002905 | 3300047443 | Bacteria | 13052 |
| 525 | Ga0495687_003222 | 3300047443 | Bacteria | 12074 |
| 526 | Ga0495687_009056 | 3300047443 | Bacteria | 5610 |
| 527 | Ga0495675_0021539 | 3300047444 | Bacteria | 4105 |
| 528 | Ga0495675_0106594 | 3300047444 | Bacteria | 1751 |
| 529 | Ga0495675_0140921 | 3300047444 | Bacteria | 1494 |
| 530 | Ga0495675_0154443 | 3300047444 | Bacteria | 1416 |
| 531 | Ga0495677_0036933 | 3300047445 | Bacteria | 1784 |
| 532 | Ga0495685_000242 | 3300047447 | Bacteria | 18816 |
| 533 | Ga0495685_007723 | 3300047447 | Bacteria | 3558 |
| 534 | Ga0495685_008162 | 3300047447 | Bacteria | 3470 |
| 535 | Ga0495685_033926 | 3300047447 | Bacteria | 1754 |
| 536 | Ga0495681_0005889 | 3300047470 | Bacteria | 8138 |
| 537 | Ga0495686_0087210 | 3300047472 | Bacteria | 1898 |
| 538 | Ga0495593_0008889 | 3300047673 | Bacteria | 5829 |
| 539 | Ga0495593_0033683 | 3300047673 | Bacteria | 2789 |
| 540 | Ga0495602_0016780 | 3300048088 | Bacteria | 7353 |
| 541 | Ga0495602_0083550 | 3300048088 | Bacteria | 2675 |
| 542 | Ga0495602_0107030 | 3300048088 | Bacteria | 2280 |
| 543 | Ga0495614_0026105 | 3300048089 | Bacteria | 2517 |
| 544 | Ga0495626_0000046 | 3300048091 | Bacteria | 162660 |
| 545 | Ga0495626_0000137 | 3300048091 | Bacteria | 92873 |
| 546 | Ga0495626_0012892 | 3300048091 | Bacteria | 4361 |
| 547 | Ga0496105_0335878 | 3300048908 | Bacteria | 1209 |
| 548 | Ga0496105_0341285 | 3300048908 | Bacteria | 1198 |
| 549 | Ga0496106_0034861 | 3300048909 | Bacteria | 3761 |
| 550 | Ga0496108_0000015 | 3300048911 | Bacteria | 243282 |
| 551 | Ga0496108_0050673 | 3300048911 | Bacteria | 3476 |
| 552 | Ga0496108_0097207 | 3300048911 | Bacteria | 2509 |
| 553 | Ga0496109_0022352 | 3300048912 | Bacteria | 5601 |
| 554 | Ga0496110_0299449 | 3300048913 | Bacteria | 1465 |
| 555 | Ga0496111_0001649 | 3300048914 | Bacteria | 12957 |
| 556 | Ga0496112_0067940 | 3300048915 | Bacteria | 3519 |
| 557 | Ga0496114_0010822 | 3300048917 | Bacteria | 7263 |
| 558 | Ga0496114_0110597 | 3300048917 | Bacteria | 2354 |
| 559 | Ga0496117_0000196 | 3300048920 | Bacteria | 119243 |
| 560 | Ga0496118_0076100 | 3300048921 | Bacteria | 2389 |
| 561 | Ga0496119_0060536 | 3300048922 | Bacteria | 2266 |
| 562 | Ga0496119_0115980 | 3300048922 | Bacteria | 1479 |
| 563 | Ga0496125_0049348 | 3300048928 | Bacteria | 3498 |
| 564 | Ga0496126_0054784 | 3300048929 | Bacteria | 3610 |
| 565 | Ga0496126_0057078 | 3300048929 | Bacteria | 3527 |
| 566 | Ga0496126_0060344 | 3300048929 | Bacteria | 3411 |
| 567 | Ga0495678_016992 | 3300049459 | Bacteria | 3309 |
| 568 | Ga0495682_0026202 | 3300049460 | Bacteria | 2167 |
| 569 | Ga0501031_0001193 | 3300049568 | Bacteria | 15835 |
| 570 | Ga0501031_0073104 | 3300049568 | Bacteria | 2233 |
| 571 | Ga0501032_0001375 | 3300049569 | Bacteria | 19307 |
| 572 | Ga0501032_0064028 | 3300049569 | Bacteria | 2461 |
| 573 | Ga0501032_0080971 | 3300049569 | Bacteria | 2160 |
| 574 | Ga0501033_0011940 | 3300049570 | Bacteria | 6636 |
| 575 | Ga0501034_0004272 | 3300049571 | Bacteria | 15940 |
| 576 | Ga0501034_0021972 | 3300049571 | Bacteria | 6501 |
| 577 | Ga0501034_0118142 | 3300049571 | Bacteria | 2639 |
| 578 | Ga0501036_0054086 | 3300049572 | Bacteria | 3399 |
| 579 | Ga0501036_0063142 | 3300049572 | Bacteria | 3136 |
| 580 | Ga0501037_0001086 | 3300049573 | Bacteria | 20170 |
| 581 | Ga0501037_0001575 | 3300049573 | Bacteria | 16622 |
| 582 | Ga0501038_0014929 | 3300049574 | Bacteria | 7072 |
| 583 | Ga0501038_0076202 | 3300049574 | Bacteria | 2833 |
| 584 | Ga0501038_0191266 | 3300049574 | Bacteria | 1646 |
| 585 | Ga0501038_0282487 | 3300049574 | Bacteria | 1306 |
| 586 | Ga0501039_0002353 | 3300049575 | Bacteria | 14073 |
| 587 | Ga0501039_0076474 | 3300049575 | Bacteria | 2602 |
| 588 | Ga0501040_0025318 | 3300049576 | Bacteria | 3989 |
| 589 | Ga0501041_0012595 | 3300049577 | Bacteria | 5009 |
| 590 | Ga0501042_0000296 | 3300049578 | Bacteria | 24701 |
| 591 | Ga0501042_0065215 | 3300049578 | Bacteria | 2602 |
| 592 | Ga0501043_0004901 | 3300049579 | Bacteria | 10816 |
| 593 | Ga0501046_0007535 | 3300049580 | Bacteria | 9547 |
| 594 | Ga0501046_0132302 | 3300049580 | Bacteria | 1891 |
| 595 | Ga0501047_0003044 | 3300049581 | Bacteria | 15905 |
| 596 | Ga0501047_0029479 | 3300049581 | Bacteria | 5290 |
| 597 | Ga0501048_0000513 | 3300049582 | Bacteria | 27155 |
| 598 | Ga0501048_0013876 | 3300049582 | Bacteria | 5974 |
| 599 | Ga0501067_0020963 | 3300049583 | Bacteria | 3615 |
| 600 | Ga0501068_0077821 | 3300049584 | Bacteria | 2031 |
| 601 | Ga0501070_0015332 | 3300049586 | Bacteria | 6449 |
| 602 | Ga0501070_0091682 | 3300049586 | Bacteria | 2515 |
| 603 | Ga0501070_0207527 | 3300049586 | Bacteria | 1608 |
| 604 | Ga0501071_0023537 | 3300049587 | Bacteria | 4302 |
| 605 | Ga0501072_0001837 | 3300049588 | Bacteria | 15806 |
| 606 | Ga0501073_0075093 | 3300049589 | Bacteria | 2353 |
| 607 | Ga0501073_0095404 | 3300049589 | Bacteria | 2065 |
| 608 | Ga0501074_0018140 | 3300049590 | Bacteria | 5111 |
| 609 | Ga0501077_0008026 | 3300049593 | Bacteria | 6527 |
| 610 | Ga0501079_0053821 | 3300049741 | Bacteria | 3104 |
| 611 | Ga0501080_0131575 | 3300049742 | Bacteria | 2316 |
| 612 | Ga0501083_0000059 | 3300049744 | Bacteria | 78374 |
| 613 | Ga0501083_0010196 | 3300049744 | Bacteria | 6621 |
| 614 | Ga0501035_0003230 | 3300049822 | Bacteria | 15614 |
| 615 | Ga0501035_0007647 | 3300049822 | Bacteria | 10096 |
| 616 | Ga0501035_0259169 | 3300049822 | Bacteria | 1475 |
| 617 | Ga0501044_0006899 | 3300049823 | Bacteria | 12505 |
| 618 | Ga0501044_0119640 | 3300049823 | Bacteria | 2635 |
| 619 | Ga0501045_0096748 | 3300049824 | Bacteria | 2184 |
| 620 | nmdc:mga03n38_19253_c1 | 3300050490 | Bacteria | 2709 |
| 621 | nmdc:mga03n38_35023_c1 | 3300050490 | Bacteria | 2148 |
| 622 | nmdc:mga03n38_79540_c1 | 3300050490 | Bacteria | 1537 |
| 623 | nmdc:mga06z11_688_c1 | 3300050494 | Bacteria | 12298 |
| 624 | nmdc:mga05p37_6921_c1 | 3300050507 | Bacteria | 13369 |
| 625 | nmdc:mga09592_346713_c1 | 3300050508 | Bacteria | 1285 |
| 626 | nmdc:mga06r32_694345_c1 | 3300050510 | Bacteria | 984 |
| 627 | Ga0495601_0005136 | 3300053077 | Bacteria | 7607 |
| 628 | Ga0495612_0002515 | 3300053078 | Bacteria | 7566 |
| 629 | Ga0500635_0000073 | 3300053080 | Bacteria | 65023 |
| 630 | Ga0495619_0002746 | 3300053085 | Bacteria | 11492 |
| 631 | Ga0500644_0015782 | 3300053088 | Bacteria | 2163 |
| 632 | Ga0500646_0000134 | 3300053090 | Bacteria | 21323 |
| 633 | Ga0500646_0000964 | 3300053090 | Bacteria | 7901 |
| 634 | Ga0500651_0040400 | 3300053093 | Bacteria | 2939 |
| 635 | Ga0500566_0109140 | 3300053094 | Bacteria | 1506 |
| 636 | Ga0500640_014507 | 3300053095 | Bacteria | 3281 |
| 637 | Ga0500641_0124053 | 3300053096 | Bacteria | 1114 |
| 638 | Ga0500650_0019304 | 3300053098 | Bacteria | 2972 |
| 639 | Ga0500650_0024343 | 3300053098 | Bacteria | 2699 |
| 640 | Ga0500660_039133 | 3300053100 | Bacteria | 2424 |
| 641 | Ga0500553_012772 | 3300053101 | Bacteria | 4255 |
| 642 | Ga0500560_010272 | 3300053107 | Bacteria | 2338 |
| 643 | Ga0500569_003761 | 3300053109 | Bacteria | 3135 |
| 644 | Ga0500594_0026135 | 3300053118 | Bacteria | 1502 |
| 645 | Ga0500652_001575 | 3300053131 | Bacteria | 6969 |
| 646 | Ga0500652_067994 | 3300053131 | Bacteria | 1473 |
| 647 | Ga0500561_0000242 | 3300053137 | Bacteria | 9789 |
| 648 | Ga0500573_0053550 | 3300053140 | Bacteria | 2318 |
| 649 | Ga0500573_0070041 | 3300053140 | Bacteria | 2001 |
| 650 | Ga0500577_0098771 | 3300053142 | Bacteria | 1190 |
| 651 | Ga0500579_072281 | 3300053143 | Bacteria | 1983 |
| 652 | Ga0500588_0012392 | 3300053146 | Bacteria | 2113 |
| 653 | Ga0500588_0017184 | 3300053146 | Bacteria | 1884 |
| 654 | Ga0500616_0000553 | 3300053153 | Bacteria | 46504 |
| 655 | Ga0500624_005662 | 3300053157 | Bacteria | 1668 |
| 656 | Ga0500630_053817 | 3300053159 | Bacteria | 1938 |
| 657 | Ga0500633_0000857 | 3300053160 | Bacteria | 5267 |
| 658 | Ga0500633_0013918 | 3300053160 | Bacteria | 2269 |
| 659 | Ga0501084_0039374 | 3300054114 | Bacteria | 3953 |
| 660 | Ga0501082_0013965 | 3300060353 | Bacteria | 6907 |
| 661 | Ga0501082_0259555 | 3300060353 | Bacteria | 1511 |
| 662 | Ga0466962_0000098 | 3300061719 | Bacteria | 35205 |
| 663 | Ga0466962_0012818 | 3300061719 | Bacteria | 4034 |
| 664 | Ga0466962_0033718 | 3300061719 | Bacteria | 2451 |
| 665 | Ga0466962_0111603 | 3300061719 | Bacteria | 1316 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047318 | Ga0495636_0125129 | Ga0495636_0125129_100_894 | 211 |
| 2 | 3300044658 | Ga0466972_0004270 | Ga0466972_0004270_2414_3289 | 230 |
| 3 | 3300044683 | Ga0466965_0008284 | Ga0466965_0008284_1521_2396 | 230 |
| 4 | 3300044684 | Ga0466966_0022733 | Ga0466966_0022733_2425_3300 | 230 |
| 5 | 3300044693 | Ga0466961_0001724 | Ga0466961_0001724_1216_2091 | 230 |
| 6 | 3300044735 | Ga0466968_0088863 | Ga0466968_0088863_402_1277 | 230 |
| 7 | 3300061719 | Ga0466962_0033718 | Ga0466962_0033718_873_1748 | 230 |
| 8 | 3300042135 | Ga0450899_002676 | Ga0450899_002676_10_807 | 235 |
| 9 | 3300046462 | Ga0495651_0053181 | Ga0495651_0053181_1669_2565 | 237 |
| 10 | 3300009147 | Ga0114129_10372288 | Ga0114129_103722881 | 238 |
| 11 | 3300044765 | Ga0466970_0114708 | Ga0466970_0114708_24_848 | 238 |
| 12 | 3300050507 | nmdc:mga05p37_6921_c1 | nmdc:mga05p37_6921_c1_1072_1908 | 238 |
| 13 | 3300050508 | nmdc:mga09592_346713_c1 | nmdc:mga09592_346713_c1_130_966 | 238 |
| 14 | 3300050510 | nmdc:mga06r32_694345_c1 | nmdc:mga06r32_694345_c1_36_872 | 238 |
| 15 | 3300003322 | rootL2_10106867 | rootL2_101068672 | 240 |
| 16 | 3300009176 | Ga0105242_10149434 | Ga0105242_101494342 | 241 |
| 17 | 3300045836 | Ga0466958_0308863 | Ga0466958_0308863_59_883 | 241 |
| 18 | 3300046454 | Ga0495592_0097708 | Ga0495592_0097708_1049_1873 | 241 |
| 19 | 3300046462 | Ga0495651_0001198 | Ga0495651_0001198_15647_16471 | 241 |
| 20 | 3300046516 | Ga0495628_0008046 | Ga0495628_0008046_1936_2760 | 241 |
| 21 | 3300046529 | Ga0495652_0001571 | Ga0495652_0001571_15577_16401 | 241 |
| 22 | 3300046543 | Ga0495645_0052068 | Ga0495645_0052068_799_1623 | 241 |
| 23 | 3300047317 | Ga0495604_0035125 | Ga0495604_0035125_2664_3488 | 241 |
| 24 | 3300009093 | Ga0105240_10020634 | Ga0105240_100206344 | 242 |
| 25 | 3300009174 | Ga0105241_10017053 | Ga0105241_100170533 | 242 |
| 26 | 3300009545 | Ga0105237_10051232 | Ga0105237_100512324 | 242 |
| 27 | 3300009551 | Ga0105238_10057219 | Ga0105238_100572192 | 242 |
| 28 | 3300010375 | Ga0105239_10432100 | Ga0105239_104321002 | 242 |
| 29 | 3300044656 | Ga0466969_0016209 | Ga0466969_0016209_2851_3675 | 242 |
| 30 | 3300044693 | Ga0466961_0077057 | Ga0466961_0077057_1021_1845 | 242 |
| 31 | 3300044656 | Ga0466969_0142197 | Ga0466969_0142197_55_879 | 245 |
| 32 | 3300005539 | Ga0068853_100060366 | Ga0068853_1000603662 | 246 |
| 33 | 3300005548 | Ga0070665_100195507 | Ga0070665_1001955072 | 246 |
| 34 | 3300005563 | Ga0068855_100006547 | Ga0068855_10000654711 | 246 |
| 35 | 3300005578 | Ga0068854_100096558 | Ga0068854_1000965583 | 246 |
| 36 | 3300005614 | Ga0068856_100074324 | Ga0068856_1000743241 | 246 |
| 37 | 3300005616 | Ga0068852_100044441 | Ga0068852_1000444413 | 246 |
| 38 | 3300025904 | Ga0207647_10003321 | Ga0207647_100033215 | 246 |
| 39 | 3300025911 | Ga0207654_10002631 | Ga0207654_100026314 | 246 |
| 40 | 3300025913 | Ga0207695_10054521 | Ga0207695_100545212 | 246 |
| 41 | 3300025914 | Ga0207671_10000886 | Ga0207671_100008864 | 246 |
| 42 | 3300025924 | Ga0207694_10005786 | Ga0207694_100057862 | 246 |
| 43 | 3300025949 | Ga0207667_10133297 | Ga0207667_101332972 | 246 |
| 44 | 3300026041 | Ga0207639_10197851 | Ga0207639_101978512 | 246 |
| 45 | 3300026078 | Ga0207702_10346897 | Ga0207702_103468972 | 246 |
| 46 | 3300026142 | Ga0207698_10075011 | Ga0207698_100750112 | 246 |
| 47 | 3300006844 | Ga0075428_100001094 | Ga0075428_10000109418 | 248 |
| 48 | 3300009093 | Ga0105240_10186938 | Ga0105240_101869382 | 249 |
| 49 | 3300046462 | Ga0495651_0001254 | Ga0495651_0001254_7868_8764 | 249 |
| 50 | 3300046516 | Ga0495628_0049010 | Ga0495628_0049010_1246_2142 | 249 |
| 51 | 3300046529 | Ga0495652_0001890 | Ga0495652_0001890_14449_15345 | 249 |
| 52 | 3300046543 | Ga0495645_0020844 | Ga0495645_0020844_3549_4445 | 249 |
| 53 | 3300046809 | Ga0495600_0008866 | Ga0495600_0008866_647_1543 | 249 |
| 54 | 3300030521 | Ga0307511_10001462 | Ga0307511_100014628 | 250 |
| 55 | 3300030521 | Ga0307511_10053588 | Ga0307511_100535883 | 250 |
| 56 | 3300031730 | Ga0307516_10020601 | Ga0307516_100206014 | 250 |
| 57 | 3300033180 | Ga0307510_10097614 | Ga0307510_100976143 | 250 |
| 58 | 3300047443 | Ga0495687_002905 | Ga0495687_002905_4203_5069 | 250 |
| 59 | 3300042014 | Ga0439457_000064 | Ga0439457_000064_17082_17960 | 251 |
| 60 | 3300030521 | Ga0307511_10158716 | Ga0307511_101587162 | 252 |
| 61 | 3300031456 | Ga0307513_10043474 | Ga0307513_100434742 | 252 |
| 62 | 3300033180 | Ga0307510_10155598 | Ga0307510_101555982 | 252 |
| 63 | 3300005578 | Ga0068854_100384325 | Ga0068854_1003843252 | 253 |
| 64 | 3300041406 | Ga0439439_0004980 | Ga0439439_0004980_341_1231 | 253 |
| 65 | 3300003322 | rootL2_10004889 | rootL2_100048895 | 254 |
| 66 | 3300005435 | Ga0070714_100451474 | Ga0070714_1004514742 | 254 |
| 67 | 3300009984 | Ga0105029_100341 | Ga0105029_1003412 | 254 |
| 68 | 3300025230 | Ga0209563_100586 | Ga0209563_1005867 | 254 |
| 69 | 3300026116 | Ga0207674_10205211 | Ga0207674_102052112 | 254 |
| 70 | 3300031507 | Ga0307509_10024530 | Ga0307509_100245302 | 254 |
| 71 | 3300031838 | Ga0307518_10096566 | Ga0307518_100965662 | 254 |
| 72 | 3300035172 | Ga0373955_0287960 | Ga0373955_0287960_54_851 | 254 |
| 73 | 3300044684 | Ga0466966_0055970 | Ga0466966_0055970_576_1412 | 254 |
| 74 | 3300044693 | Ga0466961_0260162 | Ga0466961_0260162_42_821 | 254 |
| 75 | 3300044765 | Ga0466970_0026897 | Ga0466970_0026897_1398_2234 | 254 |
| 76 | 3300045049 | Ga0466959_0022340 | Ga0466959_0022340_2537_3373 | 254 |
| 77 | 3300046499 | Ga0495594_0098811 | Ga0495594_0098811_761_1576 | 254 |
| 78 | 3300046557 | Ga0495622_0122949 | Ga0495622_0122949_290_1102 | 254 |
| 79 | 3300049824 | Ga0501045_0096748 | Ga0501045_0096748_22_834 | 254 |
| 80 | 3300053088 | Ga0500644_0015782 | Ga0500644_0015782_1077_1898 | 254 |
| 81 | 3300053131 | Ga0500652_067994 | Ga0500652_067994_32_835 | 254 |
| 82 | 3300053153 | Ga0500616_0000553 | Ga0500616_0000553_35060_35944 | 254 |
| 83 | iso_pu_bacteria | 2643221601 | 2644017949 | 254 |
| 84 | iso_pu_bacteria | 2643221631 | 2644180763 | 254 |
| 85 | iso_pu_bacteria | 8047710418 | 8047714759 | 254 |
| 86 | 3300025272 | Ga0209455_1004394 | Ga0209455_10043943 | 255 |
| 87 | 3300041491 | Ga0451833_0184157 | Ga0451833_0184157_220_1026 | 255 |
| 88 | 3300044658 | Ga0466972_0025925 | Ga0466972_0025925_13_831 | 255 |
| 89 | 3300044683 | Ga0466965_0005771 | Ga0466965_0005771_3305_4123 | 255 |
| 90 | 3300044693 | Ga0466961_0043208 | Ga0466961_0043208_938_1870 | 255 |
| 91 | 3300044735 | Ga0466968_0032353 | Ga0466968_0032353_306_1124 | 255 |
| 92 | 3300044901 | Ga0466960_0000667 | Ga0466960_0000667_6979_7797 | 255 |
| 93 | 3300048911 | Ga0496108_0097207 | Ga0496108_0097207_488_1387 | 255 |
| 94 | 3300053085 | Ga0495619_0002746 | Ga0495619_0002746_8336_9142 | 255 |
| 95 | 3300053146 | Ga0500588_0017184 | Ga0500588_0017184_94_915 | 255 |
| 96 | 3300005329 | Ga0070683_100343311 | Ga0070683_1003433112 | 256 |
| 97 | 3300006048 | Ga0075363_100230939 | Ga0075363_1002309392 | 256 |
| 98 | 3300028794 | Ga0307515_10149095 | Ga0307515_101490952 | 256 |
| 99 | 3300041512 | Ga0451853_0437132 | Ga0451853_0437132_6760_7587 | 256 |
| 100 | 3300042007 | Ga0439449_0008913 | Ga0439449_0008913_466_1293 | 256 |
| 101 | 3300049582 | Ga0501048_0000513 | Ga0501048_0000513_23333_24184 | 256 |
| 102 | 3300050490 | nmdc:mga03n38_79540_c1 | nmdc:mga03n38_79540_c1_653_1495 | 256 |
| 103 | iso_pu_bacteria | 2675903059 | 2676485630 | 256 |
| 104 | iso_pu_bacteria | 2887478801 | 2887479945 | 256 |
| 105 | 3300005339 | Ga0070660_100198461 | Ga0070660_1001984612 | 257 |
| 106 | 3300005539 | Ga0068853_100017090 | Ga0068853_1000170904 | 257 |
| 107 | 3300005548 | Ga0070665_100046261 | Ga0070665_1000462612 | 257 |
| 108 | 3300005563 | Ga0068855_100012980 | Ga0068855_1000129806 | 257 |
| 109 | 3300006048 | Ga0075363_100116128 | Ga0075363_1001161282 | 257 |
| 110 | 3300009174 | Ga0105241_10000490 | Ga0105241_100004902 | 257 |
| 111 | 3300009551 | Ga0105238_10449884 | Ga0105238_104498842 | 257 |
| 112 | 3300010375 | Ga0105239_10086406 | Ga0105239_100864063 | 257 |
| 113 | 3300013296 | Ga0157374_10047880 | Ga0157374_100478804 | 257 |
| 114 | 3300025904 | Ga0207647_10019597 | Ga0207647_100195974 | 257 |
| 115 | 3300025913 | Ga0207695_10010930 | Ga0207695_100109306 | 257 |
| 116 | 3300025914 | Ga0207671_10000594 | Ga0207671_1000059413 | 257 |
| 117 | 3300025924 | Ga0207694_10019245 | Ga0207694_100192452 | 257 |
| 118 | 3300025981 | Ga0207640_10049087 | Ga0207640_100490872 | 257 |
| 119 | 3300026041 | Ga0207639_10062019 | Ga0207639_100620192 | 257 |
| 120 | 3300032005 | Ga0307411_10031162 | Ga0307411_100311622 | 257 |
| 121 | 3300033179 | Ga0307507_10000016 | Ga0307507_10000016124 | 257 |
| 122 | 3300033179 | Ga0307507_10043043 | Ga0307507_100430433 | 257 |
| 123 | 3300046454 | Ga0495592_0002276 | Ga0495592_0002276_11695_12576 | 257 |
| 124 | 3300046462 | Ga0495651_0031692 | Ga0495651_0031692_919_1800 | 257 |
| 125 | 3300046476 | Ga0495662_0001387 | Ga0495662_0001387_7688_8569 | 257 |
| 126 | 3300046477 | Ga0495664_0000225 | Ga0495664_0000225_8543_9424 | 257 |
| 127 | 3300046514 | Ga0495618_0190766 | Ga0495618_0190766_48_929 | 257 |
| 128 | 3300046516 | Ga0495628_0012572 | Ga0495628_0012572_4497_5378 | 257 |
| 129 | 3300046517 | Ga0495630_0035055 | Ga0495630_0035055_848_1729 | 257 |
| 130 | 3300046529 | Ga0495652_0042397 | Ga0495652_0042397_39_920 | 257 |
| 131 | 3300046533 | Ga0495640_0048674 | Ga0495640_0048674_1036_1917 | 257 |
| 132 | 3300046536 | Ga0495587_0006654 | Ga0495587_0006654_6137_7018 | 257 |
| 133 | 3300046557 | Ga0495622_0101370 | Ga0495622_0101370_301_1182 | 257 |
| 134 | 3300046642 | Ga0495634_0108108 | Ga0495634_0108108_849_1730 | 257 |
| 135 | 3300046663 | Ga0495635_0002503 | Ga0495635_0002503_1044_1925 | 257 |
| 136 | 3300046675 | Ga0495657_0023538 | Ga0495657_0023538_1512_2393 | 257 |
| 137 | 3300046680 | Ga0495646_0000371 | Ga0495646_0000371_13537_14418 | 257 |
| 138 | 3300046689 | Ga0495613_0001859 | Ga0495613_0001859_8613_9494 | 257 |
| 139 | 3300046809 | Ga0495600_0034963 | Ga0495600_0034963_338_1219 | 257 |
| 140 | 3300047315 | Ga0495581_0006333 | Ga0495581_0006333_5505_6386 | 257 |
| 141 | 3300047317 | Ga0495604_0000502 | Ga0495604_0000502_23691_24572 | 257 |
| 142 | 3300047321 | Ga0495676_0007142 | Ga0495676_0007142_5138_6019 | 257 |
| 143 | 3300047673 | Ga0495593_0008889 | Ga0495593_0008889_2752_3633 | 257 |
| 144 | 3300048088 | Ga0495602_0016780 | Ga0495602_0016780_5528_6409 | 257 |
| 145 | 3300048089 | Ga0495614_0026105 | Ga0495614_0026105_1299_2180 | 257 |
| 146 | 3300048922 | Ga0496119_0060536 | Ga0496119_0060536_46_894 | 257 |
| 147 | 3300053095 | Ga0500640_014507 | Ga0500640_014507_378_1259 | 257 |
| 148 | 3300053157 | Ga0500624_005662 | Ga0500624_005662_539_1420 | 257 |
| 149 | 3300005617 | Ga0068859_100320127 | Ga0068859_1003201272 | 258 |
| 150 | 3300005841 | Ga0068863_100664981 | Ga0068863_1006649812 | 258 |
| 151 | 3300005843 | Ga0068860_100020130 | Ga0068860_1000201304 | 258 |
| 152 | 3300005844 | Ga0068862_100117355 | Ga0068862_1001173552 | 258 |
| 153 | 3300006931 | Ga0097620_100320119 | Ga0097620_1003201192 | 258 |
| 154 | 3300025986 | Ga0207658_10107442 | Ga0207658_101074422 | 258 |
| 155 | 3300026088 | Ga0207641_10511515 | Ga0207641_105115152 | 258 |
| 156 | 3300026095 | Ga0207676_10264424 | Ga0207676_102644242 | 258 |
| 157 | 3300028380 | Ga0268265_10227924 | Ga0268265_102279242 | 258 |
| 158 | 3300028381 | Ga0268264_10046328 | Ga0268264_100463282 | 258 |
| 159 | 3300030733 | Ga0314311_1140623 | Ga0314311_11406232 | 258 |
| 160 | 3300031507 | Ga0307509_10017853 | Ga0307509_100178533 | 258 |
| 161 | 3300032005 | Ga0307411_10274438 | Ga0307411_102744381 | 258 |
| 162 | 3300033179 | Ga0307507_10138680 | Ga0307507_101386802 | 258 |
| 163 | 3300044656 | Ga0466969_0013971 | Ga0466969_0013971_726_1622 | 258 |
| 164 | 3300044658 | Ga0466972_0014568 | Ga0466972_0014568_2098_2931 | 258 |
| 165 | 3300044684 | Ga0466966_0009699 | Ga0466966_0009699_4748_5644 | 258 |
| 166 | 3300044765 | Ga0466970_0054369 | Ga0466970_0054369_848_1681 | 258 |
| 167 | 3300044765 | Ga0466970_0170712 | Ga0466970_0170712_265_1161 | 258 |
| 168 | 3300044901 | Ga0466960_0005489 | Ga0466960_0005489_523_1356 | 258 |
| 169 | 3300045049 | Ga0466959_0115249 | Ga0466959_0115249_968_1864 | 258 |
| 170 | 3300003203 | JGI25406J46586_10003396 | JGI25406J46586_100033964 | 259 |
| 171 | 3300005985 | Ga0081539_10000116 | Ga0081539_1000011690 | 259 |
| 172 | 3300028794 | Ga0307515_10054150 | Ga0307515_100541503 | 259 |
| 173 | 3300031824 | Ga0307413_10001707 | Ga0307413_100017075 | 259 |
| 174 | 3300032004 | Ga0307414_10006971 | Ga0307414_100069715 | 259 |
| 175 | 3300046507 | Ga0495606_0003545 | Ga0495606_0003545_15205_16053 | 259 |
| 176 | 3300046616 | Ga0495668_0000537 | Ga0495668_0000537_899_1747 | 259 |
| 177 | 3300046660 | Ga0495625_0080494 | Ga0495625_0080494_900_1748 | 259 |
| 178 | 3300047323 | Ga0495683_0059580 | Ga0495683_0059580_964_1812 | 259 |
| 179 | 3300048091 | Ga0495626_0000137 | Ga0495626_0000137_74558_75406 | 259 |
| 180 | 3300049569 | Ga0501032_0001375 | Ga0501032_0001375_4671_5522 | 259 |
| 181 | 3300049573 | Ga0501037_0001086 | Ga0501037_0001086_11255_12106 | 259 |
| 182 | 3300049574 | Ga0501038_0191266 | Ga0501038_0191266_130_981 | 259 |
| 183 | 3300049574 | Ga0501038_0282487 | Ga0501038_0282487_29_880 | 259 |
| 184 | 3300049575 | Ga0501039_0002353 | Ga0501039_0002353_8454_9305 | 259 |
| 185 | 3300049589 | Ga0501073_0075093 | Ga0501073_0075093_737_1588 | 259 |
| 186 | iso_pu_bacteria | 2582581313 | 2585308176 | 259 |
| 187 | iso_pu_bacteria | 2867428634 | 2867435772 | 259 |
| 188 | iso_pu_bacteria | 2884693830 | 2884700501 | 259 |
| 189 | iso_pu_bacteria | 2895442618 | 2895450279 | 259 |
| 190 | iso_pu_bacteria | 2954711539 | 2954715086 | 259 |
| 191 | iso_pu_bacteria | 2954721474 | 2954725028 | 259 |
| 192 | iso_pu_bacteria | 2954731030 | 2954736790 | 259 |
| 193 | iso_pu_bacteria | 2954740390 | 2954743961 | 259 |
| 194 | iso_pu_bacteria | 2954749733 | 2954755638 | 259 |
| 195 | iso_pu_bacteria | 2954759201 | 2954762901 | 259 |
| 196 | iso_pu_bacteria | 2974302888 | 2974304401 | 259 |
| 197 | iso_pu_bacteria | 8001781756 | 8001785409 | 259 |
| 198 | 3300005337 | Ga0070682_100058749 | Ga0070682_1000587492 | 260 |
| 199 | 3300005458 | Ga0070681_10132594 | Ga0070681_101325942 | 260 |
| 200 | 3300005530 | Ga0070679_100011830 | Ga0070679_1000118302 | 260 |
| 201 | 3300005535 | Ga0070684_100087888 | Ga0070684_1000878882 | 260 |
| 202 | 3300005614 | Ga0068856_100134800 | Ga0068856_1001348002 | 260 |
| 203 | 3300013105 | Ga0157369_10029746 | Ga0157369_100297463 | 260 |
| 204 | 3300020082 | Ga0206353_10480480 | Ga0206353_104804802 | 260 |
| 205 | 3300025909 | Ga0207705_10030365 | Ga0207705_100303653 | 260 |
| 206 | 3300025919 | Ga0207657_10275951 | Ga0207657_102759512 | 260 |
| 207 | 3300025920 | Ga0207649_10031095 | Ga0207649_100310953 | 260 |
| 208 | 3300025921 | Ga0207652_10053262 | Ga0207652_100532623 | 260 |
| 209 | 3300025928 | Ga0207700_10046721 | Ga0207700_100467212 | 260 |
| 210 | 3300026116 | Ga0207674_10033596 | Ga0207674_100335962 | 260 |
| 211 | 3300041458 | Ga0451798_0658012 | Ga0451798_0658012_239_1096 | 260 |
| 212 | 3300044683 | Ga0466965_0000006 | Ga0466965_0000006_147905_148768 | 260 |
| 213 | 3300048908 | Ga0496105_0335878 | Ga0496105_0335878_197_1099 | 260 |
| 214 | 3300048913 | Ga0496110_0299449 | Ga0496110_0299449_459_1361 | 260 |
| 215 | 3300048915 | Ga0496112_0067940 | Ga0496112_0067940_1256_2158 | 260 |
| 216 | 3300053159 | Ga0500630_053817 | Ga0500630_053817_166_1071 | 260 |
| 217 | 3300060353 | Ga0501082_0259555 | Ga0501082_0259555_156_1061 | 260 |
| 218 | iso_pu_bacteria | 2643221548 | 2643759060 | 260 |
| 219 | iso_pu_bacteria | 2643221682 | 2644463522 | 260 |
| 220 | iso_pu_bacteria | 2939657138 | 2939659505 | 260 |
| 221 | 3300034818 | Ga0373950_0018230 | Ga0373950_0018230_145_981 | 261 |
| 222 | 3300035207 | Ga0373942_0000443 | Ga0373942_0000443_2571_3407 | 261 |
| 223 | 3300042014 | Ga0439457_016910 | Ga0439457_016910_258_1166 | 261 |
| 224 | 3300044693 | Ga0466961_0060657 | Ga0466961_0060657_340_1236 | 261 |
| 225 | iso_pu_bacteria | 2818991463 | 2819694374 | 261 |
| 226 | iso_pu_bacteria | 2939657138 | 2939659979 | 261 |
| 227 | iso_pu_bacteria | 2966598605 | 2966603981 | 261 |
| 228 | 3300005327 | Ga0070658_10132103 | Ga0070658_101321031 | 262 |
| 229 | 3300005347 | Ga0070668_100029140 | Ga0070668_1000291404 | 262 |
| 230 | 3300005617 | Ga0068859_100120643 | Ga0068859_1001206432 | 262 |
| 231 | 3300005719 | Ga0068861_100197337 | Ga0068861_1001973372 | 262 |
| 232 | 3300005844 | Ga0068862_100096266 | Ga0068862_1000962663 | 262 |
| 233 | 3300005937 | Ga0081455_10000198 | Ga0081455_100001986 | 262 |
| 234 | 3300006931 | Ga0097620_100120643 | Ga0097620_1001206432 | 262 |
| 235 | 3300025972 | Ga0207668_10000190 | Ga0207668_100001905 | 262 |
| 236 | 3300028380 | Ga0268265_10105682 | Ga0268265_101056822 | 262 |
| 237 | 3300031852 | Ga0307410_10468596 | Ga0307410_104685962 | 262 |
| 238 | 3300032002 | Ga0307416_100039664 | Ga0307416_1000396644 | 262 |
| 239 | 3300042127 | Ga0450890_011050 | Ga0450890_011050_165_1055 | 262 |
| 240 | 3300044656 | Ga0466969_0016800 | Ga0466969_0016800_189_1070 | 262 |
| 241 | 3300044656 | Ga0466969_0082872 | Ga0466969_0082872_357_1253 | 262 |
| 242 | 3300044693 | Ga0466961_0001507 | Ga0466961_0001507_4639_5520 | 262 |
| 243 | 3300044719 | Ga0466971_0000308 | Ga0466971_0000308_9815_10696 | 262 |
| 244 | 3300044842 | Ga0466957_0335017 | Ga0466957_0335017_48_944 | 262 |
| 245 | 3300045049 | Ga0466959_0047829 | Ga0466959_0047829_1984_2865 | 262 |
| 246 | 3300045836 | Ga0466958_0111951 | Ga0466958_0111951_505_1386 | 262 |
| 247 | 3300046459 | Ga0495629_0000626 | Ga0495629_0000626_14682_15548 | 262 |
| 248 | 3300046492 | Ga0495585_0019430 | Ga0495585_0019430_1045_1911 | 262 |
| 249 | 3300046499 | Ga0495594_0000666 | Ga0495594_0000666_7300_8166 | 262 |
| 250 | 3300046557 | Ga0495622_0021833 | Ga0495622_0021833_54_920 | 262 |
| 251 | 3300046674 | Ga0495588_0008717 | Ga0495588_0008717_295_1161 | 262 |
| 252 | 3300046794 | Ga0495589_0091936 | Ga0495589_0091936_397_1263 | 262 |
| 253 | 3300047321 | Ga0495676_0004654 | Ga0495676_0004654_1553_2419 | 262 |
| 254 | 3300047323 | Ga0495683_0034166 | Ga0495683_0034166_673_1539 | 262 |
| 255 | 3300049580 | Ga0501046_0132302 | Ga0501046_0132302_42_950 | 262 |
| 256 | 3300061719 | Ga0466962_0000098 | Ga0466962_0000098_24009_24890 | 262 |
| 257 | iso_pu_bacteria | 2582581312 | 2585300834 | 262 |
| 258 | iso_pu_bacteria | 2582581314 | 2585319513 | 262 |
| 259 | iso_pu_bacteria | 2784746768 | 2785370693 | 262 |
| 260 | iso_pu_bacteria | 2867346516 | 2867352873 | 262 |
| 261 | iso_pu_bacteria | 2895427314 | 2895427320 | 262 |
| 262 | iso_pu_bacteria | 2905926851 | 2905930624 | 262 |
| 263 | iso_pu_bacteria | 2946003308 | 2946006744 | 262 |
| 264 | iso_pu_bacteria | 2954691527 | 2954695664 | 262 |
| 265 | iso_pu_bacteria | 2954701450 | 2954710857 | 262 |
| 266 | 3300005347 | Ga0070668_100000386 | Ga0070668_10000038625 | 263 |
| 267 | 3300005617 | Ga0068859_100346138 | Ga0068859_1003461381 | 263 |
| 268 | 3300006931 | Ga0097620_100346170 | Ga0097620_1003461701 | 263 |
| 269 | 3300025972 | Ga0207668_10000377 | Ga0207668_1000037722 | 263 |
| 270 | 3300025972 | Ga0207668_10335183 | Ga0207668_103351832 | 263 |
| 271 | 3300028381 | Ga0268264_10181849 | Ga0268264_101818492 | 263 |
| 272 | 3300050490 | nmdc:mga03n38_35023_c1 | nmdc:mga03n38_35023_c1_897_1787 | 263 |
| 273 | 3300005367 | Ga0070667_100531654 | Ga0070667_1005316541 | 264 |
| 274 | 3300013105 | Ga0157369_10043041 | Ga0157369_100430414 | 264 |
| 275 | 3300028794 | Ga0307515_10004403 | Ga0307515_1000440319 | 264 |
| 276 | 3300028794 | Ga0307515_10037368 | Ga0307515_100373684 | 264 |
| 277 | 3300030522 | Ga0307512_10004835 | Ga0307512_100048353 | 264 |
| 278 | 3300031456 | Ga0307513_10001463 | Ga0307513_1000146331 | 264 |
| 279 | 3300031616 | Ga0307508_10000746 | Ga0307508_1000074613 | 264 |
| 280 | 3300042184 | Ga0450908_001411 | Ga0450908_001411_1633_2523 | 264 |
| 281 | 3300046689 | Ga0495613_0208631 | Ga0495613_0208631_69_947 | 264 |
| 282 | iso_pu_bacteria | 2751185734 | 2753075276 | 264 |
| 283 | iso_pu_bacteria | 2870721527 | 2870729365 | 264 |
| 284 | 3300005436 | Ga0070713_100117129 | Ga0070713_1001171293 | 265 |
| 285 | 3300005614 | Ga0068856_100469775 | Ga0068856_1004697752 | 265 |
| 286 | 3300006028 | Ga0070717_10122055 | Ga0070717_101220551 | 265 |
| 287 | 3300006175 | Ga0070712_100121179 | Ga0070712_1001211792 | 265 |
| 288 | 3300013297 | Ga0157378_10034741 | Ga0157378_100347413 | 265 |
| 289 | 3300026118 | Ga0207675_100185237 | Ga0207675_1001852372 | 265 |
| 290 | 3300028381 | Ga0268264_10045199 | Ga0268264_100451992 | 265 |
| 291 | 3300030522 | Ga0307512_10032588 | Ga0307512_100325885 | 265 |
| 292 | 3300031456 | Ga0307513_10036257 | Ga0307513_100362574 | 265 |
| 293 | 3300031507 | Ga0307509_10029137 | Ga0307509_100291374 | 265 |
| 294 | 3300042007 | Ga0439449_0083501 | Ga0439449_0083501_153_1031 | 265 |
| 295 | 3300044656 | Ga0466969_0040940 | Ga0466969_0040940_1074_1955 | 265 |
| 296 | 3300044693 | Ga0466961_0043513 | Ga0466961_0043513_1875_2756 | 265 |
| 297 | 3300045049 | Ga0466959_0218072 | Ga0466959_0218072_336_1214 | 265 |
| 298 | 3300046462 | Ga0495651_0003257 | Ga0495651_0003257_8338_9210 | 265 |
| 299 | 3300046514 | Ga0495618_0006585 | Ga0495618_0006585_1705_2577 | 265 |
| 300 | 3300046516 | Ga0495628_0019754 | Ga0495628_0019754_1767_2639 | 265 |
| 301 | 3300046529 | Ga0495652_0009656 | Ga0495652_0009656_3119_3991 | 265 |
| 302 | 3300046642 | Ga0495634_0097224 | Ga0495634_0097224_246_1118 | 265 |
| 303 | 3300046663 | Ga0495635_0008627 | Ga0495635_0008627_4550_5422 | 265 |
| 304 | 3300046679 | Ga0495623_0006089 | Ga0495623_0006089_4448_5320 | 265 |
| 305 | 3300046680 | Ga0495646_0084850 | Ga0495646_0084850_64_936 | 265 |
| 306 | 3300046809 | Ga0495600_0182187 | Ga0495600_0182187_86_958 | 265 |
| 307 | 3300047318 | Ga0495636_0000810 | Ga0495636_0000810_7001_7882 | 265 |
| 308 | 3300047443 | Ga0495687_009056 | Ga0495687_009056_634_1515 | 265 |
| 309 | 3300048088 | Ga0495602_0083550 | Ga0495602_0083550_1527_2399 | 265 |
| 310 | 3300053077 | Ga0495601_0005136 | Ga0495601_0005136_6629_7501 | 265 |
| 311 | 3300053078 | Ga0495612_0002515 | Ga0495612_0002515_5421_6293 | 265 |
| 312 | iso_pu_bacteria | 2857729791 | 2857730915 | 265 |
| 313 | iso_pu_bacteria | 2862993130 | 2862995212 | 265 |
| 314 | iso_pu_bacteria | 2928121344 | 2928122282 | 265 |
| 315 | iso_pu_bacteria | 2928121344 | 2928122517 | 265 |
| 316 | 3300005435 | Ga0070714_100194716 | Ga0070714_1001947162 | 266 |
| 317 | 3300005455 | Ga0070663_100002529 | Ga0070663_1000025298 | 266 |
| 318 | 3300006048 | Ga0075363_100017793 | Ga0075363_1000177932 | 266 |
| 319 | 3300013104 | Ga0157370_10272139 | Ga0157370_102721392 | 266 |
| 320 | 3300013104 | Ga0157370_10280396 | Ga0157370_102803962 | 266 |
| 321 | 3300025942 | Ga0207689_10143456 | Ga0207689_101434562 | 266 |
| 322 | 3300026067 | Ga0207678_10000057 | Ga0207678_1000005764 | 266 |
| 323 | 3300035692 | Ga0373935_0001950 | Ga0373935_0001950_1813_2721 | 266 |
| 324 | 3300037312 | Ga0395899_0002077 | Ga0395899_0002077_13312_14199 | 266 |
| 325 | 3300037418 | Ga0395900_0177717 | Ga0395900_0177717_891_1778 | 266 |
| 326 | 3300041452 | Ga0451793_1147289 | Ga0451793_1147289_291_1154 | 266 |
| 327 | 3300044658 | Ga0466972_0010681 | Ga0466972_0010681_2446_3303 | 266 |
| 328 | 3300044684 | Ga0466966_0016186 | Ga0466966_0016186_3286_4170 | 266 |
| 329 | 3300044719 | Ga0466971_0029535 | Ga0466971_0029535_500_1384 | 266 |
| 330 | 3300045049 | Ga0466959_0001924 | Ga0466959_0001924_7722_8606 | 266 |
| 331 | 3300045836 | Ga0466958_0041077 | Ga0466958_0041077_80_964 | 266 |
| 332 | 3300047447 | Ga0495685_033926 | Ga0495685_033926_425_1330 | 266 |
| 333 | 3300048909 | Ga0496106_0034861 | Ga0496106_0034861_1005_1850 | 266 |
| 334 | iso_pu_bacteria | 2675903060 | 2676493253 | 266 |
| 335 | iso_pu_bacteria | 2857729791 | 2857731148 | 266 |
| 336 | iso_pu_bacteria | 2990044586 | 2990044662 | 266 |
| 337 | 3300013105 | Ga0157369_10027187 | Ga0157369_100271873 | 267 |
| 338 | 3300031901 | Ga0307406_10000115 | Ga0307406_100001153 | 267 |
| 339 | 3300032126 | Ga0307415_100089198 | Ga0307415_1000891982 | 267 |
| 340 | 3300044684 | Ga0466966_0004721 | Ga0466966_0004721_2580_3473 | 267 |
| 341 | 3300044693 | Ga0466961_0021132 | Ga0466961_0021132_2347_3240 | 267 |
| 342 | 3300044719 | Ga0466971_0010058 | Ga0466971_0010058_2609_3502 | 267 |
| 343 | 3300045049 | Ga0466959_0158779 | Ga0466959_0158779_138_1031 | 267 |
| 344 | 3300061719 | Ga0466962_0111603 | Ga0466962_0111603_254_1147 | 267 |
| 345 | iso_pu_bacteria | 2758568522 | 2760303220 | 267 |
| 346 | iso_pu_bacteria | 2939657138 | 2939659985 | 267 |
| 347 | 3300009148 | Ga0105243_10394335 | Ga0105243_103943351 | 268 |
| 348 | 3300009177 | Ga0105248_10706662 | Ga0105248_107066622 | 268 |
| 349 | 3300009551 | Ga0105238_10240753 | Ga0105238_102407532 | 268 |
| 350 | 3300010375 | Ga0105239_10495921 | Ga0105239_104959212 | 268 |
| 351 | 3300013306 | Ga0163162_10539534 | Ga0163162_105395342 | 268 |
| 352 | 3300025929 | Ga0207664_10010108 | Ga0207664_100101086 | 268 |
| 353 | 3300026067 | Ga0207678_10341324 | Ga0207678_103413242 | 268 |
| 354 | 3300047315 | Ga0495581_0113725 | Ga0495581_0113725_439_1317 | 268 |
| 355 | 3300048911 | Ga0496108_0000015 | Ga0496108_0000015_170547_171443 | 268 |
| 356 | 3300048917 | Ga0496114_0010822 | Ga0496114_0010822_3887_4765 | 268 |
| 357 | iso_pu_bacteria | 2643221616 | 2644094400 | 268 |
| 358 | iso_pu_bacteria | 2739367654 | 2739604547 | 268 |
| 359 | iso_pu_bacteria | 2808606394 | 2809027718 | 268 |
| 360 | iso_pu_bacteria | 2868088558 | 2868093559 | 268 |
| 361 | iso_pu_bacteria | 2895427314 | 2895430680 | 268 |
| 362 | iso_pu_bacteria | 2977251589 | 2977253055 | 268 |
| 363 | 3300003203 | JGI25406J46586_10020748 | JGI25406J46586_100207482 | 269 |
| 364 | 3300003323 | rootH1_10041099 | rootH1_100410993 | 269 |
| 365 | 3300005347 | Ga0070668_100008412 | Ga0070668_1000084125 | 269 |
| 366 | 3300005437 | Ga0070710_10000347 | Ga0070710_1000034714 | 269 |
| 367 | 3300005548 | Ga0070665_100518515 | Ga0070665_1005185151 | 269 |
| 368 | 3300005985 | Ga0081539_10002529 | Ga0081539_1000252921 | 269 |
| 369 | 3300006846 | Ga0075430_100003000 | Ga0075430_1000030008 | 269 |
| 370 | 3300006847 | Ga0075431_100015982 | Ga0075431_1000159823 | 269 |
| 371 | 3300006880 | Ga0075429_100000494 | Ga0075429_10000049420 | 269 |
| 372 | 3300013105 | Ga0157369_10020878 | Ga0157369_100208783 | 269 |
| 373 | 3300025898 | Ga0207692_10001270 | Ga0207692_100012706 | 269 |
| 374 | 3300028794 | Ga0307515_10019161 | Ga0307515_1001916110 | 269 |
| 375 | 3300028794 | Ga0307515_10089723 | Ga0307515_100897233 | 269 |
| 376 | 3300030522 | Ga0307512_10002105 | Ga0307512_1000210518 | 269 |
| 377 | 3300030522 | Ga0307512_10004222 | Ga0307512_100042222 | 269 |
| 378 | 3300030731 | Ga0316177_1007692 | Ga0316177_10076922 | 269 |
| 379 | 3300030732 | Ga0316176_1054292 | Ga0316176_10542923 | 269 |
| 380 | 3300030736 | Ga0316180_1169781 | Ga0316180_11697812 | 269 |
| 381 | 3300031548 | Ga0307408_100089169 | Ga0307408_1000891692 | 269 |
| 382 | 3300031616 | Ga0307508_10067173 | Ga0307508_100671732 | 269 |
| 383 | 3300031730 | Ga0307516_10000177 | Ga0307516_1000017730 | 269 |
| 384 | 3300031730 | Ga0307516_10191573 | Ga0307516_101915732 | 269 |
| 385 | 3300031731 | Ga0307405_10022393 | Ga0307405_100223933 | 269 |
| 386 | 3300031824 | Ga0307413_10046803 | Ga0307413_100468032 | 269 |
| 387 | 3300031852 | Ga0307410_10210276 | Ga0307410_102102761 | 269 |
| 388 | 3300031903 | Ga0307407_10017144 | Ga0307407_100171442 | 269 |
| 389 | 3300031995 | Ga0307409_100000181 | Ga0307409_10000018116 | 269 |
| 390 | 3300032126 | Ga0307415_100000148 | Ga0307415_10000014819 | 269 |
| 391 | 3300032126 | Ga0307415_100086027 | Ga0307415_1000860272 | 269 |
| 392 | 3300032126 | Ga0307415_100136665 | Ga0307415_1001366652 | 269 |
| 393 | 3300041460 | Ga0451802_1239871 | Ga0451802_1239871_106_1005 | 269 |
| 394 | 3300041491 | Ga0451833_0615816 | Ga0451833_0615816_333_1226 | 269 |
| 395 | 3300046689 | Ga0495613_0080950 | Ga0495613_0080950_1106_2002 | 269 |
| 396 | 3300046694 | Ga0495649_0086137 | Ga0495649_0086137_85_990 | 269 |
| 397 | 3300048917 | Ga0496114_0110597 | Ga0496114_0110597_971_1891 | 269 |
| 398 | 3300048921 | Ga0496118_0076100 | Ga0496118_0076100_1208_2116 | 269 |
| 399 | 3300049568 | Ga0501031_0001193 | Ga0501031_0001193_7586_8491 | 269 |
| 400 | 3300049569 | Ga0501032_0064028 | Ga0501032_0064028_871_1776 | 269 |
| 401 | 3300049569 | Ga0501032_0080971 | Ga0501032_0080971_679_1605 | 269 |
| 402 | 3300049570 | Ga0501033_0011940 | Ga0501033_0011940_3950_4855 | 269 |
| 403 | 3300049571 | Ga0501034_0004272 | Ga0501034_0004272_7351_8256 | 269 |
| 404 | 3300049571 | Ga0501034_0021972 | Ga0501034_0021972_990_1916 | 269 |
| 405 | 3300049572 | Ga0501036_0054086 | Ga0501036_0054086_908_1834 | 269 |
| 406 | 3300049572 | Ga0501036_0063142 | Ga0501036_0063142_1973_2878 | 269 |
| 407 | 3300049573 | Ga0501037_0001575 | Ga0501037_0001575_5419_6324 | 269 |
| 408 | 3300049574 | Ga0501038_0014929 | Ga0501038_0014929_259_1164 | 269 |
| 409 | 3300049574 | Ga0501038_0076202 | Ga0501038_0076202_1594_2520 | 269 |
| 410 | 3300049575 | Ga0501039_0076474 | Ga0501039_0076474_1112_2017 | 269 |
| 411 | 3300049576 | Ga0501040_0025318 | Ga0501040_0025318_1973_2878 | 269 |
| 412 | 3300049577 | Ga0501041_0012595 | Ga0501041_0012595_2124_3029 | 269 |
| 413 | 3300049578 | Ga0501042_0000296 | Ga0501042_0000296_18073_18975 | 269 |
| 414 | 3300049578 | Ga0501042_0065215 | Ga0501042_0065215_1112_2017 | 269 |
| 415 | 3300049579 | Ga0501043_0004901 | Ga0501043_0004901_2553_3458 | 269 |
| 416 | 3300049580 | Ga0501046_0007535 | Ga0501046_0007535_4936_5841 | 269 |
| 417 | 3300049581 | Ga0501047_0003044 | Ga0501047_0003044_12705_13610 | 269 |
| 418 | 3300049581 | Ga0501047_0029479 | Ga0501047_0029479_1460_2386 | 269 |
| 419 | 3300049582 | Ga0501048_0013876 | Ga0501048_0013876_131_1036 | 269 |
| 420 | 3300049583 | Ga0501067_0020963 | Ga0501067_0020963_2560_3465 | 269 |
| 421 | 3300049584 | Ga0501068_0077821 | Ga0501068_0077821_714_1619 | 269 |
| 422 | 3300049586 | Ga0501070_0015332 | Ga0501070_0015332_1769_2695 | 269 |
| 423 | 3300049586 | Ga0501070_0207527 | Ga0501070_0207527_151_1056 | 269 |
| 424 | 3300049587 | Ga0501071_0023537 | Ga0501071_0023537_2956_3861 | 269 |
| 425 | 3300049588 | Ga0501072_0001837 | Ga0501072_0001837_7565_8470 | 269 |
| 426 | 3300049589 | Ga0501073_0095404 | Ga0501073_0095404_49_954 | 269 |
| 427 | 3300049590 | Ga0501074_0018140 | Ga0501074_0018140_2425_3330 | 269 |
| 428 | 3300049593 | Ga0501077_0008026 | Ga0501077_0008026_4669_5574 | 269 |
| 429 | 3300049741 | Ga0501079_0053821 | Ga0501079_0053821_418_1323 | 269 |
| 430 | 3300049742 | Ga0501080_0131575 | Ga0501080_0131575_586_1491 | 269 |
| 431 | 3300049744 | Ga0501083_0000059 | Ga0501083_0000059_59924_60826 | 269 |
| 432 | 3300049744 | Ga0501083_0010196 | Ga0501083_0010196_40_945 | 269 |
| 433 | 3300049822 | Ga0501035_0003230 | Ga0501035_0003230_7359_8264 | 269 |
| 434 | 3300049822 | Ga0501035_0259169 | Ga0501035_0259169_160_1062 | 269 |
| 435 | 3300049823 | Ga0501044_0006899 | Ga0501044_0006899_4239_5144 | 269 |
| 436 | 3300049823 | Ga0501044_0119640 | Ga0501044_0119640_1461_2387 | 269 |
| 437 | 3300050490 | nmdc:mga03n38_19253_c1 | nmdc:mga03n38_19253_c1_331_1236 | 269 |
| 438 | 3300053090 | Ga0500646_0000964 | Ga0500646_0000964_5771_6673 | 269 |
| 439 | 3300053093 | Ga0500651_0040400 | Ga0500651_0040400_1940_2803 | 269 |
| 440 | 3300053098 | Ga0500650_0019304 | Ga0500650_0019304_468_1346 | 269 |
| 441 | 3300053098 | Ga0500650_0024343 | Ga0500650_0024343_1320_2183 | 269 |
| 442 | 3300053101 | Ga0500553_012772 | Ga0500553_012772_994_1890 | 269 |
| 443 | 3300053118 | Ga0500594_0026135 | Ga0500594_0026135_150_1013 | 269 |
| 444 | 3300053140 | Ga0500573_0053550 | Ga0500573_0053550_1388_2290 | 269 |
| 445 | 3300053142 | Ga0500577_0098771 | Ga0500577_0098771_153_1031 | 269 |
| 446 | 3300054114 | Ga0501084_0039374 | Ga0501084_0039374_1267_2172 | 269 |
| 447 | 3300060353 | Ga0501082_0013965 | Ga0501082_0013965_826_1731 | 269 |
| 448 | iso_pu_bacteria | 2643221714 | 2644627623 | 269 |
| 449 | iso_pu_bacteria | 2751185782 | 2753270823 | 269 |
| 450 | iso_pu_bacteria | 2877676314 | 2877684813 | 269 |
| 451 | 3300005842 | Ga0068858_100175704 | Ga0068858_1001757041 | 270 |
| 452 | 3300015688 | Ga0183367_1004 | Ga0183367_1004614 | 270 |
| 453 | 3300026067 | Ga0207678_10149131 | Ga0207678_101491311 | 270 |
| 454 | 3300028800 | Ga0265338_10135552 | Ga0265338_101355522 | 270 |
| 455 | 3300031507 | Ga0307509_10051308 | Ga0307509_100513083 | 270 |
| 456 | 3300031730 | Ga0307516_10157400 | Ga0307516_101574002 | 270 |
| 457 | 3300031995 | Ga0307409_100764783 | Ga0307409_1007647831 | 270 |
| 458 | 3300033179 | Ga0307507_10022239 | Ga0307507_100222394 | 270 |
| 459 | 3300033180 | Ga0307510_10236896 | Ga0307510_102368962 | 270 |
| 460 | 3300044658 | Ga0466972_0042953 | Ga0466972_0042953_507_1397 | 270 |
| 461 | 3300046459 | Ga0495629_0061340 | Ga0495629_0061340_1422_2315 | 270 |
| 462 | 3300046543 | Ga0495645_0069544 | Ga0495645_0069544_594_1478 | 270 |
| 463 | 3300047444 | Ga0495675_0106594 | Ga0495675_0106594_813_1697 | 270 |
| 464 | 3300048914 | Ga0496111_0001649 | Ga0496111_0001649_830_1723 | 270 |
| 465 | 3300048920 | Ga0496117_0000196 | Ga0496117_0000196_79948_80844 | 270 |
| 466 | 3300048922 | Ga0496119_0115980 | Ga0496119_0115980_343_1239 | 270 |
| 467 | 3300048928 | Ga0496125_0049348 | Ga0496125_0049348_1546_2442 | 270 |
| 468 | 3300048929 | Ga0496126_0057078 | Ga0496126_0057078_2123_3001 | 270 |
| 469 | 3300048929 | Ga0496126_0060344 | Ga0496126_0060344_352_1248 | 270 |
| 470 | 3300053094 | Ga0500566_0109140 | Ga0500566_0109140_128_1021 | 270 |
| 471 | 3300053100 | Ga0500660_039133 | Ga0500660_039133_1283_2176 | 270 |
| 472 | iso_pu_bacteria | 2547132111 | 2547408736 | 270 |
| 473 | iso_pu_bacteria | 2616644814 | 2616693426 | 270 |
| 474 | iso_pu_bacteria | 2643221678 | 2644441947 | 270 |
| 475 | iso_pu_bacteria | 2643221714 | 2644630630 | 270 |
| 476 | iso_pu_bacteria | 2738541272 | 2738697470 | 270 |
| 477 | iso_pu_bacteria | 2738543027 | 2739328067 | 270 |
| 478 | iso_pu_bacteria | 2784746763 | 2785346646 | 270 |
| 479 | iso_pu_bacteria | 2808606359 | 2808847014 | 270 |
| 480 | iso_pu_bacteria | 2808606375 | 2808917726 | 270 |
| 481 | iso_pu_bacteria | 2811994879 | 2812361332 | 270 |
| 482 | iso_pu_bacteria | 2811994917 | 2812477336 | 270 |
| 483 | iso_pu_bacteria | 2852635781 | 2852639269 | 270 |
| 484 | iso_pu_bacteria | 2862281513 | 2862282516 | 270 |
| 485 | iso_pu_bacteria | 2862382967 | 2862388130 | 270 |
| 486 | iso_pu_bacteria | 2863404153 | 2863408163 | 270 |
| 487 | iso_pu_bacteria | 2919468124 | 2919470104 | 270 |
| 488 | iso_pu_bacteria | 2939660829 | 2939663578 | 270 |
| 489 | iso_pu_bacteria | 2946064051 | 2946064757 | 270 |
| 490 | iso_pu_bacteria | 2946072368 | 2946073123 | 270 |
| 491 | iso_pu_bacteria | 2947224130 | 2947224717 | 270 |
| 492 | iso_pu_bacteria | 2990059506 | 2990065738 | 270 |
| 493 | iso_pu_bacteria | 3006493962 | 3006498392 | 270 |
| 494 | iso_pu_bacteria | 8008558824 | 8008560505 | 270 |
| 495 | iso_pu_bacteria | 8008574985 | 8008581298 | 270 |
| 496 | iso_pu_bacteria | 8048406513 | 8048413937 | 270 |
| 497 | 3300005327 | Ga0070658_10029441 | Ga0070658_100294412 | 271 |
| 498 | 3300005435 | Ga0070714_100107991 | Ga0070714_1001079913 | 271 |
| 499 | 3300005436 | Ga0070713_100049127 | Ga0070713_1000491273 | 271 |
| 500 | 3300005436 | Ga0070713_100427765 | Ga0070713_1004277652 | 271 |
| 501 | 3300005439 | Ga0070711_100242187 | Ga0070711_1002421872 | 271 |
| 502 | 3300005530 | Ga0070679_100110853 | Ga0070679_1001108531 | 271 |
| 503 | 3300005614 | Ga0068856_100321322 | Ga0068856_1003213222 | 271 |
| 504 | 3300025898 | Ga0207692_10030878 | Ga0207692_100308782 | 271 |
| 505 | 3300025909 | Ga0207705_10258415 | Ga0207705_102584152 | 271 |
| 506 | 3300025915 | Ga0207693_10001642 | Ga0207693_100016422 | 271 |
| 507 | 3300025916 | Ga0207663_10147136 | Ga0207663_101471362 | 271 |
| 508 | 3300025921 | Ga0207652_10578466 | Ga0207652_105784661 | 271 |
| 509 | 3300025928 | Ga0207700_10017247 | Ga0207700_100172472 | 271 |
| 510 | 3300025929 | Ga0207664_10016938 | Ga0207664_100169384 | 271 |
| 511 | 3300025929 | Ga0207664_10061056 | Ga0207664_100610562 | 271 |
| 512 | 3300026067 | Ga0207678_10009503 | Ga0207678_100095032 | 271 |
| 513 | 3300028556 | Ga0265337_1001738 | Ga0265337_10017384 | 271 |
| 514 | 3300028558 | Ga0265326_10002457 | Ga0265326_100024574 | 271 |
| 515 | 3300028563 | Ga0265319_1004500 | Ga0265319_10045002 | 271 |
| 516 | 3300028573 | Ga0265334_10000913 | Ga0265334_100009138 | 271 |
| 517 | 3300028577 | Ga0265318_10009741 | Ga0265318_100097412 | 271 |
| 518 | 3300028653 | Ga0265323_10001725 | Ga0265323_1000172510 | 271 |
| 519 | 3300028666 | Ga0265336_10001366 | Ga0265336_100013666 | 271 |
| 520 | 3300028786 | Ga0307517_10006227 | Ga0307517_100062274 | 271 |
| 521 | 3300028794 | Ga0307515_10002799 | Ga0307515_1000279919 | 271 |
| 522 | 3300028800 | Ga0265338_10006593 | Ga0265338_100065935 | 271 |
| 523 | 3300029957 | Ga0265324_10005341 | Ga0265324_100053413 | 271 |
| 524 | 3300031240 | Ga0265320_10007956 | Ga0265320_100079566 | 271 |
| 525 | 3300031241 | Ga0265325_10010420 | Ga0265325_100104202 | 271 |
| 526 | 3300031247 | Ga0265340_10003865 | Ga0265340_100038654 | 271 |
| 527 | 3300031249 | Ga0265339_10071730 | Ga0265339_100717302 | 271 |
| 528 | 3300031507 | Ga0307509_10182643 | Ga0307509_101826432 | 271 |
| 529 | 3300031711 | Ga0265314_10012450 | Ga0265314_100124503 | 271 |
| 530 | 3300031712 | Ga0265342_10007950 | Ga0265342_100079506 | 271 |
| 531 | 3300031730 | Ga0307516_10000894 | Ga0307516_100008943 | 271 |
| 532 | 3300031730 | Ga0307516_10014914 | Ga0307516_100149144 | 271 |
| 533 | 3300031730 | Ga0307516_10015544 | Ga0307516_100155444 | 271 |
| 534 | 3300031731 | Ga0307405_10005419 | Ga0307405_100054192 | 271 |
| 535 | 3300031901 | Ga0307406_10097764 | Ga0307406_100977641 | 271 |
| 536 | 3300031911 | Ga0307412_10009796 | Ga0307412_100097963 | 271 |
| 537 | 3300032126 | Ga0307415_100028775 | Ga0307415_1000287753 | 271 |
| 538 | 3300035091 | Ga0373951_0000300 | Ga0373951_0000300_150_1058 | 271 |
| 539 | 3300037068 | Ga0373925_0000237 | Ga0373925_0000237_41356_42270 | 271 |
| 540 | 3300046454 | Ga0495592_0045059 | Ga0495592_0045059_1238_2128 | 271 |
| 541 | 3300046462 | Ga0495651_0033826 | Ga0495651_0033826_31_921 | 271 |
| 542 | 3300046472 | Ga0495580_0047232 | Ga0495580_0047232_211_1101 | 271 |
| 543 | 3300046476 | Ga0495662_0003828 | Ga0495662_0003828_2159_3049 | 271 |
| 544 | 3300046477 | Ga0495664_0007836 | Ga0495664_0007836_574_1464 | 271 |
| 545 | 3300046492 | Ga0495585_0031771 | Ga0495585_0031771_198_1094 | 271 |
| 546 | 3300046501 | Ga0495607_0113750 | Ga0495607_0113750_319_1215 | 271 |
| 547 | 3300046517 | Ga0495630_0104908 | Ga0495630_0104908_31_921 | 271 |
| 548 | 3300046519 | Ga0495632_0072667 | Ga0495632_0072667_719_1615 | 271 |
| 549 | 3300046522 | Ga0495643_0002935 | Ga0495643_0002935_9788_10684 | 271 |
| 550 | 3300046526 | Ga0495666_0006788 | Ga0495666_0006788_4550_5440 | 271 |
| 551 | 3300046529 | Ga0495652_0204773 | Ga0495652_0204773_574_1464 | 271 |
| 552 | 3300046531 | Ga0495665_0002200 | Ga0495665_0002200_1154_2044 | 271 |
| 553 | 3300046533 | Ga0495640_0020815 | Ga0495640_0020815_73_963 | 271 |
| 554 | 3300046535 | Ga0495586_0027310 | Ga0495586_0027310_1204_2094 | 271 |
| 555 | 3300046543 | Ga0495645_0010711 | Ga0495645_0010711_2156_3046 | 271 |
| 556 | 3300046642 | Ga0495634_0107028 | Ga0495634_0107028_466_1356 | 271 |
| 557 | 3300046663 | Ga0495635_0167526 | Ga0495635_0167526_574_1464 | 271 |
| 558 | 3300046675 | Ga0495657_0015799 | Ga0495657_0015799_4544_5434 | 271 |
| 559 | 3300046678 | Ga0495599_0158290 | Ga0495599_0158290_84_974 | 271 |
| 560 | 3300046680 | Ga0495646_0098165 | Ga0495646_0098165_84_974 | 271 |
| 561 | 3300046691 | Ga0495670_0022512 | Ga0495670_0022512_195_1091 | 271 |
| 562 | 3300046794 | Ga0495589_0110718 | Ga0495589_0110718_366_1262 | 271 |
| 563 | 3300046809 | Ga0495600_0017817 | Ga0495600_0017817_31_921 | 271 |
| 564 | 3300047315 | Ga0495581_0056132 | Ga0495581_0056132_266_1156 | 271 |
| 565 | 3300047317 | Ga0495604_0120447 | Ga0495604_0120447_980_1870 | 271 |
| 566 | 3300047319 | Ga0495674_0019544 | Ga0495674_0019544_3735_4625 | 271 |
| 567 | 3300047322 | Ga0495680_0056712 | Ga0495680_0056712_1127_2029 | 271 |
| 568 | 3300047444 | Ga0495675_0140921 | Ga0495675_0140921_574_1464 | 271 |
| 569 | 3300047447 | Ga0495685_000242 | Ga0495685_000242_13516_14412 | 271 |
| 570 | 3300047470 | Ga0495681_0005889 | Ga0495681_0005889_6831_7727 | 271 |
| 571 | 3300048088 | Ga0495602_0107030 | Ga0495602_0107030_31_921 | 271 |
| 572 | 3300048929 | Ga0496126_0054784 | Ga0496126_0054784_1165_2079 | 271 |
| 573 | 3300053080 | Ga0500635_0000073 | Ga0500635_0000073_39393_40280 | 271 |
| 574 | 3300053107 | Ga0500560_010272 | Ga0500560_010272_564_1460 | 271 |
| 575 | 3300053109 | Ga0500569_003761 | Ga0500569_003761_2081_2977 | 271 |
| 576 | 3300053131 | Ga0500652_001575 | Ga0500652_001575_1020_1916 | 271 |
| 577 | 3300053137 | Ga0500561_0000242 | Ga0500561_0000242_249_1145 | 271 |
| 578 | 3300053143 | Ga0500579_072281 | Ga0500579_072281_72_968 | 271 |
| 579 | 3300053160 | Ga0500633_0000857 | Ga0500633_0000857_464_1360 | 271 |
| 580 | iso_pu_bacteria | 2643221542 | 2643733108 | 271 |
| 581 | iso_pu_bacteria | 2643221613 | 2644083928 | 271 |
| 582 | iso_pu_bacteria | 2643221630 | 2644171895 | 271 |
| 583 | iso_pu_bacteria | 2643221721 | 2644666806 | 271 |
| 584 | iso_pu_bacteria | 2816332139 | 2816508546 | 271 |
| 585 | iso_pu_bacteria | 2935890801 | 2935894795 | 271 |
| 586 | 3300031730 | Ga0307516_10019656 | Ga0307516_100196564 | 272 |
| 587 | 3300031730 | Ga0307516_10024519 | Ga0307516_100245194 | 272 |
| 588 | 3300031730 | Ga0307516_10084527 | Ga0307516_100845273 | 272 |
| 589 | 3300032002 | Ga0307416_100059910 | Ga0307416_1000599101 | 272 |
| 590 | 3300049571 | Ga0501034_0118142 | Ga0501034_0118142_1591_2460 | 272 |
| 591 | 3300053140 | Ga0500573_0070041 | Ga0500573_0070041_550_1449 | 272 |
| 592 | iso_pu_bacteria | 2643221572 | 2643876793 | 272 |
| 593 | iso_pu_bacteria | 2643221669 | 2644383848 | 272 |
| 594 | iso_pu_bacteria | 2964326757 | 2964327788 | 272 |
| 595 | 3300005288 | Ga0065714_10003307 | Ga0065714_100033074 | 273 |
| 596 | 3300025735 | Ga0207713_1042807 | Ga0207713_10428072 | 273 |
| 597 | 3300028794 | Ga0307515_10029984 | Ga0307515_100299843 | 273 |
| 598 | 3300041997 | Ga0439431_0024570 | Ga0439431_0024570_511_1407 | 273 |
| 599 | 3300046507 | Ga0495606_0001231 | Ga0495606_0001231_6276_7157 | 273 |
| 600 | 3300046616 | Ga0495668_0000326 | Ga0495668_0000326_39704_40585 | 273 |
| 601 | 3300046660 | Ga0495625_0000770 | Ga0495625_0000770_27819_28700 | 273 |
| 602 | 3300048091 | Ga0495626_0000046 | Ga0495626_0000046_39253_40134 | 273 |
| 603 | 3300048911 | Ga0496108_0050673 | Ga0496108_0050673_2264_3169 | 273 |
| 604 | 3300048912 | Ga0496109_0022352 | Ga0496109_0022352_874_1779 | 273 |
| 605 | 3300053090 | Ga0500646_0000134 | Ga0500646_0000134_18718_19593 | 273 |
| 606 | iso_pu_bacteria | 2808606368 | 2808884940 | 273 |
| 607 | iso_pu_bacteria | 2808606372 | 2808900756 | 273 |
| 608 | iso_pu_bacteria | 2862993130 | 2862993407 | 273 |
| 609 | iso_pu_bacteria | 2887443736 | 2887445747 | 273 |
| 610 | iso_pu_bacteria | 2935409751 | 2935411829 | 273 |
| 611 | iso_pu_bacteria | 8016254467 | 8016256521 | 273 |
| 612 | 3300001989 | JGI24739J22299_10018856 | JGI24739J22299_100188562 | 274 |
| 613 | 3300003316 | rootH1_10016398 | rootH1_1001639817 | 274 |
| 614 | 3300003322 | rootL2_10187667 | rootL2_101876672 | 274 |
| 615 | 3300003323 | rootH1_10061199 | rootH1_100611992 | 274 |
| 616 | 3300003578 | Ga0006562J51391_1136929 | Ga0006562J51391_11369291 | 274 |
| 617 | 3300005563 | Ga0068855_100338767 | Ga0068855_1003387672 | 274 |
| 618 | 3300006178 | Ga0075367_10000224 | Ga0075367_1000022418 | 274 |
| 619 | 3300009148 | Ga0105243_10237872 | Ga0105243_102378722 | 274 |
| 620 | 3300015688 | Ga0183367_1003 | Ga0183367_1003512 | 274 |
| 621 | 3300025949 | Ga0207667_10418265 | Ga0207667_104182652 | 274 |
| 622 | 3300028794 | Ga0307515_10109953 | Ga0307515_101099534 | 274 |
| 623 | 3300030522 | Ga0307512_10006577 | Ga0307512_100065775 | 274 |
| 624 | 3300030522 | Ga0307512_10204837 | Ga0307512_102048372 | 274 |
| 625 | 3300031548 | Ga0307408_100116272 | Ga0307408_1001162722 | 274 |
| 626 | 3300031616 | Ga0307508_10108473 | Ga0307508_101084732 | 274 |
| 627 | 3300031649 | Ga0307514_10215513 | Ga0307514_102155131 | 274 |
| 628 | 3300031903 | Ga0307407_10008833 | Ga0307407_100088334 | 274 |
| 629 | 3300031911 | Ga0307412_10014019 | Ga0307412_100140193 | 274 |
| 630 | 3300031911 | Ga0307412_10187559 | Ga0307412_101875592 | 274 |
| 631 | 3300031995 | Ga0307409_100052591 | Ga0307409_1000525912 | 274 |
| 632 | 3300032005 | Ga0307411_10485742 | Ga0307411_104857422 | 274 |
| 633 | 3300033179 | Ga0307507_10058272 | Ga0307507_100582722 | 274 |
| 634 | 3300041404 | Ga0439436_0001148 | Ga0439436_0001148_4349_5254 | 274 |
| 635 | 3300041404 | Ga0439436_0008662 | Ga0439436_0008662_1779_2687 | 274 |
| 636 | 3300041512 | Ga0451853_1338476 | Ga0451853_1338476_192_1097 | 274 |
| 637 | 3300041999 | Ga0439433_0003978 | Ga0439433_0003978_1832_2740 | 274 |
| 638 | 3300042007 | Ga0439449_0000771 | Ga0439449_0000771_9748_10653 | 274 |
| 639 | 3300042014 | Ga0439457_004083 | Ga0439457_004083_2034_2939 | 274 |
| 640 | 3300042014 | Ga0439457_005509 | Ga0439457_005509_209_1117 | 274 |
| 641 | 3300042135 | Ga0450899_000219 | Ga0450899_000219_160_1065 | 274 |
| 642 | 3300042145 | Ga0450906_000627 | Ga0450906_000627_1258_2163 | 274 |
| 643 | 3300044656 | Ga0466969_0056891 | Ga0466969_0056891_766_1671 | 274 |
| 644 | 3300044658 | Ga0466972_0006665 | Ga0466972_0006665_1533_2438 | 274 |
| 645 | 3300044684 | Ga0466966_0083890 | Ga0466966_0083890_833_1738 | 274 |
| 646 | 3300044694 | Ga0466963_0048625 | Ga0466963_0048625_970_1875 | 274 |
| 647 | 3300044765 | Ga0466970_0009236 | Ga0466970_0009236_3319_4224 | 274 |
| 648 | 3300045976 | Ga0466967_0017950 | Ga0466967_0017950_1443_2348 | 274 |
| 649 | 3300045976 | Ga0466967_0301368 | Ga0466967_0301368_148_1053 | 274 |
| 650 | 3300046454 | Ga0495592_0133773 | Ga0495592_0133773_259_1164 | 274 |
| 651 | 3300046455 | Ga0495603_0021643 | Ga0495603_0021643_942_1847 | 274 |
| 652 | 3300046457 | Ga0495590_0016035 | Ga0495590_0016035_1299_2204 | 274 |
| 653 | 3300046460 | Ga0495638_0079450 | Ga0495638_0079450_1067_1972 | 274 |
| 654 | 3300046462 | Ga0495651_0029755 | Ga0495651_0029755_621_1526 | 274 |
| 655 | 3300046473 | Ga0495582_0049263 | Ga0495582_0049263_64_969 | 274 |
| 656 | 3300046474 | Ga0495605_0034529 | Ga0495605_0034529_594_1499 | 274 |
| 657 | 3300046475 | Ga0495639_0026750 | Ga0495639_0026750_1120_2025 | 274 |
| 658 | 3300046476 | Ga0495662_0003692 | Ga0495662_0003692_34_939 | 274 |
| 659 | 3300046476 | Ga0495662_0173284 | Ga0495662_0173284_88_996 | 274 |
| 660 | 3300046491 | Ga0495584_0031304 | Ga0495584_0031304_1093_1998 | 274 |
| 661 | 3300046499 | Ga0495594_0034005 | Ga0495594_0034005_529_1434 | 274 |
| 662 | 3300046500 | Ga0495596_0071119 | Ga0495596_0071119_301_1206 | 274 |
| 663 | 3300046501 | Ga0495607_0036881 | Ga0495607_0036881_1048_1953 | 274 |
| 664 | 3300046511 | Ga0495608_0186169 | Ga0495608_0186169_241_1146 | 274 |
| 665 | 3300046518 | Ga0495631_0010398 | Ga0495631_0010398_1111_2016 | 274 |
| 666 | 3300046522 | Ga0495643_0001005 | Ga0495643_0001005_15451_16356 | 274 |
| 667 | 3300046524 | Ga0495648_0033077 | Ga0495648_0033077_1529_2434 | 274 |
| 668 | 3300046533 | Ga0495640_0056304 | Ga0495640_0056304_566_1471 | 274 |
| 669 | 3300046535 | Ga0495586_0151419 | Ga0495586_0151419_85_990 | 274 |
| 670 | 3300046542 | Ga0495597_0020741 | Ga0495597_0020741_1101_2006 | 274 |
| 671 | 3300046543 | Ga0495645_0254828 | Ga0495645_0254828_90_995 | 274 |
| 672 | 3300046557 | Ga0495622_0002951 | Ga0495622_0002951_4559_5464 | 274 |
| 673 | 3300046559 | Ga0495667_0169543 | Ga0495667_0169543_312_1217 | 274 |
| 674 | 3300046615 | Ga0495656_0037051 | Ga0495656_0037051_441_1346 | 274 |
| 675 | 3300046616 | Ga0495668_0029493 | Ga0495668_0029493_755_1660 | 274 |
| 676 | 3300046648 | Ga0495611_0059195 | Ga0495611_0059195_11_916 | 274 |
| 677 | 3300046663 | Ga0495635_0130323 | Ga0495635_0130323_676_1581 | 274 |
| 678 | 3300046665 | Ga0495661_0012847 | Ga0495661_0012847_418_1323 | 274 |
| 679 | 3300046674 | Ga0495588_0016895 | Ga0495588_0016895_771_1676 | 274 |
| 680 | 3300046675 | Ga0495657_0006945 | Ga0495657_0006945_596_1501 | 274 |
| 681 | 3300046679 | Ga0495623_0095528 | Ga0495623_0095528_568_1473 | 274 |
| 682 | 3300046689 | Ga0495613_0089386 | Ga0495613_0089386_330_1235 | 274 |
| 683 | 3300046694 | Ga0495649_0135954 | Ga0495649_0135954_86_991 | 274 |
| 684 | 3300046794 | Ga0495589_0032224 | Ga0495589_0032224_1645_2550 | 274 |
| 685 | 3300046809 | Ga0495600_0047332 | Ga0495600_0047332_109_1014 | 274 |
| 686 | 3300046809 | Ga0495600_0109113 | Ga0495600_0109113_232_1137 | 274 |
| 687 | 3300046810 | Ga0495660_0098336 | Ga0495660_0098336_11_916 | 274 |
| 688 | 3300046810 | Ga0495660_0106479 | Ga0495660_0106479_51_956 | 274 |
| 689 | 3300047317 | Ga0495604_0003240 | Ga0495604_0003240_915_1823 | 274 |
| 690 | 3300047320 | Ga0495672_0074703 | Ga0495672_0074703_597_1502 | 274 |
| 691 | 3300047321 | Ga0495676_0035431 | Ga0495676_0035431_1396_2301 | 274 |
| 692 | 3300047321 | Ga0495676_0140495 | Ga0495676_0140495_449_1354 | 274 |
| 693 | 3300047322 | Ga0495680_0003794 | Ga0495680_0003794_11228_12133 | 274 |
| 694 | 3300047444 | Ga0495675_0021539 | Ga0495675_0021539_2316_3224 | 274 |
| 695 | 3300047444 | Ga0495675_0154443 | Ga0495675_0154443_64_969 | 274 |
| 696 | 3300047445 | Ga0495677_0036933 | Ga0495677_0036933_644_1549 | 274 |
| 697 | 3300047472 | Ga0495686_0087210 | Ga0495686_0087210_886_1791 | 274 |
| 698 | 3300047673 | Ga0495593_0033683 | Ga0495593_0033683_574_1479 | 274 |
| 699 | 3300048091 | Ga0495626_0012892 | Ga0495626_0012892_2256_3161 | 274 |
| 700 | 3300048908 | Ga0496105_0341285 | Ga0496105_0341285_270_1175 | 274 |
| 701 | 3300049459 | Ga0495678_016992 | Ga0495678_016992_707_1612 | 274 |
| 702 | 3300049460 | Ga0495682_0026202 | Ga0495682_0026202_822_1727 | 274 |
| 703 | 3300049586 | Ga0501070_0091682 | Ga0501070_0091682_1416_2321 | 274 |
| 704 | 3300050494 | nmdc:mga06z11_688_c1 | nmdc:mga06z11_688_c1_5397_6302 | 274 |
| 705 | iso_pu_bacteria | 2582581313 | 2585307981 | 274 |
| 706 | iso_pu_bacteria | 2643221553 | 2643784599 | 274 |
| 707 | iso_pu_bacteria | 2643221724 | 2644678221 | 274 |
| 708 | iso_pu_bacteria | 2728369380 | 2730231238 | 274 |
| 709 | iso_pu_bacteria | 2747842429 | 2747954674 | 274 |
| 710 | iso_pu_bacteria | 2862705112 | 2862707611 | 274 |
| 711 | iso_pu_bacteria | 2919443155 | 2919445306 | 274 |
| 712 | iso_pu_bacteria | 2995463766 | 2995467568 | 274 |
| 713 | iso_pu_bacteria | 8008485437 | 8008489776 | 274 |
| 714 | iso_pu_bacteria | 8025524527 | 8025528648 | 274 |
| 715 | 3300031901 | Ga0307406_10000119 | Ga0307406_100001197 | 275 |
| 716 | 3300044658 | Ga0466972_0030850 | Ga0466972_0030850_1186_2103 | 275 |
| 717 | 3300044683 | Ga0466965_0010777 | Ga0466965_0010777_3177_4094 | 275 |
| 718 | 3300044684 | Ga0466966_0022480 | Ga0466966_0022480_2668_3585 | 275 |
| 719 | 3300044693 | Ga0466961_0032710 | Ga0466961_0032710_1442_2359 | 275 |
| 720 | 3300044842 | Ga0466957_0029701 | Ga0466957_0029701_1234_2151 | 275 |
| 721 | 3300044901 | Ga0466960_0005654 | Ga0466960_0005654_1794_2711 | 275 |
| 722 | 3300045049 | Ga0466959_0028567 | Ga0466959_0028567_1655_2572 | 275 |
| 723 | 3300045836 | Ga0466958_0009839 | Ga0466958_0009839_295_1212 | 275 |
| 724 | 3300049568 | Ga0501031_0073104 | Ga0501031_0073104_1284_2219 | 275 |
| 725 | 3300053096 | Ga0500641_0124053 | Ga0500641_0124053_46_942 | 275 |
| 726 | 3300053146 | Ga0500588_0012392 | Ga0500588_0012392_465_1361 | 275 |
| 727 | 3300053160 | Ga0500633_0013918 | Ga0500633_0013918_1223_2119 | 275 |
| 728 | 3300061719 | Ga0466962_0012818 | Ga0466962_0012818_1279_2196 | 275 |
| 729 | iso_pu_bacteria | 2643221635 | 2644199339 | 275 |
| 730 | 3300005367 | Ga0070667_100635003 | Ga0070667_1006350031 | 276 |
| 731 | 3300025986 | Ga0207658_10232424 | Ga0207658_102324242 | 276 |
| 732 | 3300031901 | Ga0307406_10114537 | Ga0307406_101145371 | 276 |
| 733 | 3300031911 | Ga0307412_10038248 | Ga0307412_100382482 | 276 |
| 734 | 3300032004 | Ga0307414_10008517 | Ga0307414_100085172 | 276 |
| 735 | 3300046506 | Ga0495583_0063735 | Ga0495583_0063735_172_1092 | 276 |
| 736 | 3300047443 | Ga0495687_003222 | Ga0495687_003222_3329_4249 | 276 |
| 737 | 3300047447 | Ga0495685_008162 | Ga0495685_008162_2045_2965 | 276 |
| 738 | 3300049822 | Ga0501035_0007647 | Ga0501035_0007647_6350_7273 | 276 |
| 739 | iso_pu_bacteria | 2862281513 | 2862283824 | 276 |
| 740 | iso_pu_bacteria | 2919443155 | 2919446761 | 276 |
| 741 | 3300046543 | Ga0495645_0012052 | Ga0495645_0012052_639_1589 | 277 |
| 742 | 3300047318 | Ga0495636_0008279 | Ga0495636_0008279_2191_3126 | 277 |
| 743 | iso_pu_bacteria | 2808606447 | 2809225616 | 277 |
| 744 | iso_pu_bacteria | 2852632344 | 2852635536 | 277 |
| 745 | iso_pu_bacteria | 2895660088 | 2895662322 | 277 |
| 746 | iso_pu_bacteria | 2895660088 | 2895663140 | 277 |
| 747 | iso_pu_bacteria | 2966924647 | 2966925727 | 277 |
| 748 | 3300005455 | Ga0070663_100002487 | Ga0070663_1000024876 | 278 |
| 749 | 3300005937 | Ga0081455_10015011 | Ga0081455_100150113 | 278 |
| 750 | 3300026067 | Ga0207678_10003078 | Ga0207678_100030786 | 278 |
| 751 | 3300046660 | Ga0495625_0070625 | Ga0495625_0070625_1116_2045 | 278 |
| 752 | 3300047447 | Ga0495685_007723 | Ga0495685_007723_222_1151 | 278 |
| 753 | iso_pu_bacteria | 2784746768 | 2785374287 | 278 |
| 754 | iso_pu_bacteria | 2946072368 | 2946079300 | 278 |
| 755 | iso_pu_bacteria | 2977264416 | 2977264515 | 278 |
| 756 | 3300003752 | Ga0055539_1002865 | Ga0055539_10028653 | 279 |
| 757 | 3300013307 | Ga0157372_10172262 | Ga0157372_101722622 | 279 |
| 758 | 3300020081 | Ga0206354_11401955 | Ga0206354_114019552 | 279 |
| 759 | 3300020082 | Ga0206353_11206199 | Ga0206353_1120619918 | 279 |
| 760 | 3300025253 | Ga0209677_100513 | Ga0209677_10051316 | 279 |
| 761 | 3300037312 | Ga0395899_0000833 | Ga0395899_0000833_20230_21165 | 279 |
| 762 | 3300037466 | Ga0395898_0116450 | Ga0395898_0116450_939_1874 | 279 |
| 763 | 3300038443 | Ga0395901_0273843 | Ga0395901_0273843_783_1718 | 279 |
| 764 | 3300044765 | Ga0466970_0000635 | Ga0466970_0000635_15344_16264 | 279 |
| 765 | iso_pu_bacteria | 2643221572 | 2643877487 | 279 |
| 766 | iso_pu_bacteria | 2643221669 | 2644384542 | 279 |
| 767 | 3300046455 | Ga0495603_0010543 | Ga0495603_0010543_22_957 | 280 |
| 768 | 3300046459 | Ga0495629_0014032 | Ga0495629_0014032_1033_1968 | 280 |
| 769 | 3300046499 | Ga0495594_0045402 | Ga0495594_0045402_910_1845 | 280 |
| 770 | 3300046557 | Ga0495622_0071851 | Ga0495622_0071851_595_1530 | 280 |
| 771 | 3300046648 | Ga0495611_0099992 | Ga0495611_0099992_242_1177 | 280 |
| 772 | 3300047321 | Ga0495676_0064778 | Ga0495676_0064778_1022_1957 | 280 |
| 773 | 3300025261 | Ga0209233_1031932 | Ga0209233_10319322 | 281 |
| 774 | 3300046689 | Ga0495613_0155554 | Ga0495613_0155554_588_1496 | 281 |
| 775 | iso_pu_bacteria | 2935409751 | 2935411640 | 281 |
| 776 | 3300001989 | JGI24739J22299_10013390 | JGI24739J22299_100133901 | 282 |
| 777 | 3300009148 | Ga0105243_10113361 | Ga0105243_101133613 | 282 |
| 778 | 3300025904 | Ga0207647_10096604 | Ga0207647_100966043 | 282 |
| 779 | 3300025935 | Ga0207709_10175179 | Ga0207709_101751792 | 282 |
| 780 | 3300042138 | Ga0450903_003756 | Ga0450903_003756_242_1135 | 282 |
| 781 | 3300042157 | Ga0439458_0037620 | Ga0439458_0037620_61_954 | 282 |
| 782 | iso_pu_bacteria | 2811994878 | 2812352076 | 282 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
128
312
0.8
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_B | mycobacterium smegmatis sugabc complex | 0.8513 | 22 | 282 |
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.8501 | 22 | 275 |
| 4tqu-assembly1.cif.gz_N | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.8428 | 19 | 273 |
| 3rlf-assembly1.cif.gz_G | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.8317 | 19 | 282 |
| 4jbw-assembly2.cif.gz_I | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.8163 | 12 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9331 | 19 | 271 | 1.10.3720.10 |
| af_P77716_1_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9284 | 19 | 269 | 1.10.3720.10 |
| af_P9WG01_5_265_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9084 | 19 | 271 | 1.10.3720.10 |
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8976 | 19 | 270 | 1.10.3720.10 |
| af_P10906_2_274_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8936 | 19 | 271 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L8EMI2-F1-model_v4 | deleted | 0.9701 | 86 | 280 |
|
| AF-F3ZK38-F1-model_v4 | Putative ABC transporter permease protein | 0.9666 | 35 | 282 |
GO:0005886
GO:0055085 |
| AF-A0A6I5CRJ2-F1-model_v4 | ABC transporter permease subunit | 0.966 | 76 | 282 |
GO:0005886
GO:0055085 |
| AF-A0A3M2JH75-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9642 | 21 | 282 |
GO:0005886
GO:0055085 |
| AF-A0A4V2XQX3-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9625 | 31 | 279 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar