F480642

General Info

Members Datasets Scaffolds Average Seq Length
782 435 665 290

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2895660088|2895663140
Length 322
Sequence TNMPAVNPGASGSGSGSGAGLPSTTDAPRLPSLSRRSSSAPAARRAKAPMSIGTTLVLLIGALYCLTPVLWVVIASTKDGSELFSTFTFLPSSHLWDNIVELTQYRGGLYWRWMVNTALYAGVGAILSTYVSMLSGYALAKFTFPGKSGVFKVLLMGVLVPGVILAIPQYFMLAQVGMTNTYWAVLLPQIISPYGIYLARIYAAAAVPTEIIESGRTEGASELFILHRLAMPMMLPGLVTVFLFQFVAIWNNFMLPYIMLGDDKLFPITVGLSGLLNQGSTVPALYTLVITGALLSIIPLIALFLVLQRYWRVDLAAGAVKA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221553 Microbacterium sp. Root553 Isolate Unclassified
9 2643221572 Leifsonia sp. Root60 Isolate Unclassified
10 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
11 2643221613 Oerskovia sp. Root22 Isolate Unclassified
12 2643221616 Leifsonia sp. Root227 Isolate Unclassified
13 2643221630 Microbacterium sp. Root322 Isolate Unclassified
14 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
15 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
16 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
17 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
18 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
19 2643221714 Streptomyces sp. Root264 Isolate Unclassified
20 2643221721 Oerskovia sp. Root918 Isolate Unclassified
21 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
22 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
23 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
24 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
25 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
26 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
27 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
28 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
29 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
30 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
31 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
32 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
33 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
34 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
35 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
36 2808606372 Agromyces sp. 23-23 Isolate Unclassified
37 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
38 2808606394 Promicromonospora sp. C35 Isolate Unclassified
39 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
40 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
41 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
42 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
43 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
44 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
45 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
46 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
47 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
48 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
49 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
50 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
51 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
52 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
53 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
54 2867428634 Streptomyces sp. RP5T Isolate Unclassified
55 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
56 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
57 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
58 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
59 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
60 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
61 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
62 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
63 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
64 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
65 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
66 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
67 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
68 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
69 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
70 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
71 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
72 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
73 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
74 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
75 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
76 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
77 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
78 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
79 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
80 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
81 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
82 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
83 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
84 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
85 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
86 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
87 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
88 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
89 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
90 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
91 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
92 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
93 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
94 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
95 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
97 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
98 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
99 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
100 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
101 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
102 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
103 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
104 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
105 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
106 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
107 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
108 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
109 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
110 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
111 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
112 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
113 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
114 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
115 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
116 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
120 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
121 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
122 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
129 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
130 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
131 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
132 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
133 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
134 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
135 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
136 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
137 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
138 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
156 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
194 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
195 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
196 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
197 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
198 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
199 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
206 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
207 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
208 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
209 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
210 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
247 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
248 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
249 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
250 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
251 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
254 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
255 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
256 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
257 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
258 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
259 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
260 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
261 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
262 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
293 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
294 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
301 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
302 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
303 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
329 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
337 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
338 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
339 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
340 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
341 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
342 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
343 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
344 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
348 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
364 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
384 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
387 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
388 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
389 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
394 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
397 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
398 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
402 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
403 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
404 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
405 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
406 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
407 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
408 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
409 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
410 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
411 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
412 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
413 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
414 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
415 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
416 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
417 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
418 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
419 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
420 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
421 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
422 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
423 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
424 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
425 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
426 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
427 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
428 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
429 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
430 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
431 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
432 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
433 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
434 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
435 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.53
Metatranscriptomes 0.51
Isolates 14.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.37
Nodule 0.26
Rhizoplane 1.92
Rhizosphere 76.21
Stem 0
Stem Tuber 0
Unclassified 16.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013390 3300001989 Bacteria 2995
2 JGI24739J22299_10018856 3300001989 Bacteria 2475
3 JGI25406J46586_10003396 3300003203 Bacteria 7491
4 JGI25406J46586_10020748 3300003203 Bacteria 2650
5 rootH1_10016398 3300003316 Bacteria 16490
6 rootL2_10004889 3300003322 Bacteria 4333
7 rootL2_10106867 3300003322 Bacteria 2652
8 rootL2_10187667 3300003322 Bacteria 1211
9 rootH1_10041099 3300003323 Bacteria 3405
10 rootH1_10061199 3300003323 Bacteria 2200
11 Ga0006562J51391_1136929 3300003578 Bacteria 2050
12 Ga0055539_1002865 3300003752 Bacteria 2520
13 Ga0065714_10003307 3300005288 Bacteria 7769
14 Ga0070658_10029441 3300005327 Bacteria 4411
15 Ga0070658_10132103 3300005327 Bacteria 2081
16 Ga0070683_100343311 3300005329 Bacteria 1422
17 Ga0070682_100058749 3300005337 Bacteria 2426
18 Ga0070660_100198461 3300005339 Bacteria 1627
19 Ga0070668_100000386 3300005347 Bacteria 29165
20 Ga0070668_100008412 3300005347 Bacteria 7663
21 Ga0070668_100029140 3300005347 Bacteria 4192
22 Ga0070667_100531654 3300005367 Bacteria 1079
23 Ga0070667_100635003 3300005367 Bacteria 985
24 Ga0070714_100107991 3300005435 Bacteria 2460
25 Ga0070714_100194716 3300005435 Bacteria 1852
26 Ga0070714_100451474 3300005435 Bacteria 1221
27 Ga0070713_100049127 3300005436 Bacteria 3479
28 Ga0070713_100117129 3300005436 Bacteria 2331
29 Ga0070713_100427765 3300005436 Bacteria 1240
30 Ga0070710_10000347 3300005437 Bacteria 22041
31 Ga0070711_100242187 3300005439 Bacteria 1411
32 Ga0070663_100002487 3300005455 Bacteria 10392
33 Ga0070663_100002529 3300005455 Bacteria 10326
34 Ga0070681_10132594 3300005458 Bacteria 2423
35 Ga0070679_100011830 3300005530 Bacteria 8324
36 Ga0070679_100110853 3300005530 Bacteria 2730
37 Ga0070684_100087888 3300005535 Bacteria 2760
38 Ga0068853_100017090 3300005539 Bacteria 5983
39 Ga0068853_100060366 3300005539 Bacteria 3276
40 Ga0070665_100046261 3300005548 Bacteria 4372
41 Ga0070665_100195507 3300005548 Bacteria 2023
42 Ga0070665_100518515 3300005548 Bacteria 1204
43 Ga0068855_100006547 3300005563 Bacteria 14157
44 Ga0068855_100012980 3300005563 Bacteria 10052
45 Ga0068855_100338767 3300005563 Bacteria 1659
46 Ga0068854_100096558 3300005578 Bacteria 2208
47 Ga0068854_100384325 3300005578 Bacteria 1157
48 Ga0068856_100074324 3300005614 Bacteria 3365
49 Ga0068856_100134800 3300005614 Bacteria 2475
50 Ga0068856_100321322 3300005614 Bacteria 1565
51 Ga0068856_100469775 3300005614 Bacteria 1279
52 Ga0068852_100044441 3300005616 Bacteria 3773
53 Ga0068859_100120643 3300005617 Bacteria 2689
54 Ga0068859_100320127 3300005617 Bacteria 1645
55 Ga0068859_100346138 3300005617 Bacteria 1581
56 Ga0068861_100197337 3300005719 Bacteria 1687
57 Ga0068863_100664981 3300005841 Bacteria 1034
58 Ga0068858_100175704 3300005842 Bacteria 2021
59 Ga0068860_100020130 3300005843 Bacteria 6465
60 Ga0068862_100096266 3300005844 Bacteria 2583
61 Ga0068862_100117355 3300005844 Bacteria 2342
62 Ga0081455_10000198 3300005937 Bacteria 76277
63 Ga0081455_10015011 3300005937 Bacteria 7544
64 Ga0081539_10000116 3300005985 Bacteria 186861
65 Ga0081539_10002529 3300005985 Bacteria 25532
66 Ga0070717_10122055 3300006028 Bacteria 2233
67 Ga0075363_100017793 3300006048 Bacteria 3530
68 Ga0075363_100116128 3300006048 Bacteria 1490
69 Ga0075363_100230939 3300006048 Bacteria 1062
70 Ga0070712_100121179 3300006175 Bacteria 1968
71 Ga0075367_10000224 3300006178 Bacteria 18937
72 Ga0075428_100001094 3300006844 Bacteria 28851
73 Ga0075430_100003000 3300006846 Bacteria 14122
74 Ga0075431_100015982 3300006847 Bacteria 7615
75 Ga0075429_100000494 3300006880 Bacteria 29616
76 Ga0097620_100120643 3300006931 Bacteria 2689
77 Ga0097620_100320119 3300006931 Bacteria 1645
78 Ga0097620_100346170 3300006931 Bacteria 1581
79 Ga0105240_10020634 3300009093 Bacteria 8783
80 Ga0105240_10186938 3300009093 Bacteria 2439
81 Ga0114129_10372288 3300009147 Bacteria 1888
82 Ga0105243_10113361 3300009148 Bacteria 2273
83 Ga0105243_10237872 3300009148 Bacteria 1619
84 Ga0105243_10394335 3300009148 Bacteria 1284
85 Ga0105241_10000490 3300009174 Bacteria 29892
86 Ga0105241_10017053 3300009174 Bacteria 5332
87 Ga0105242_10149434 3300009176 Bacteria 2036
88 Ga0105248_10706662 3300009177 Bacteria 1137
89 Ga0105237_10051232 3300009545 Bacteria 4146
90 Ga0105238_10057219 3300009551 Bacteria 3910
91 Ga0105238_10240753 3300009551 Bacteria 1787
92 Ga0105238_10449884 3300009551 Bacteria 1285
93 Ga0105029_100341 3300009984 Bacteria 2445
94 Ga0105239_10086406 3300010375 Bacteria 3457
95 Ga0105239_10432100 3300010375 Bacteria 1492
96 Ga0105239_10495921 3300010375 Bacteria 1388
97 Ga0157370_10272139 3300013104 Bacteria 1565
98 Ga0157370_10280396 3300013104 Bacteria 1540
99 Ga0157369_10020878 3300013105 Bacteria 7322
100 Ga0157369_10027187 3300013105 Bacteria 6344
101 Ga0157369_10029746 3300013105 Bacteria 6033
102 Ga0157369_10043041 3300013105 Bacteria 4923
103 Ga0157374_10047880 3300013296 Bacteria 3965
104 Ga0157378_10034741 3300013297 Bacteria 4458
105 Ga0163162_10539534 3300013306 Bacteria 1295
106 Ga0157372_10172262 3300013307 Bacteria 2504
107 Ga0183367_1003 3300015688 Bacteria 814276
108 Ga0183367_1004 3300015688 Bacteria 716880
109 Ga0206354_11401955 3300020081 Bacteria 2037
110 Ga0206353_10480480 3300020082 Bacteria 1988
111 Ga0206353_11206199 3300020082 Bacteria 21902
112 Ga0209563_100586 3300025230 Bacteria 12043
113 Ga0209677_100513 3300025253 Bacteria 21624
114 Ga0209233_1031932 3300025261 Unclassified 1223
115 Ga0209455_1004394 3300025272 Bacteria 4635
116 Ga0207713_1042807 3300025735 Bacteria 1877
117 Ga0207692_10001270 3300025898 Bacteria 9367
118 Ga0207692_10030878 3300025898 Bacteria 2560
119 Ga0207647_10003321 3300025904 Bacteria 12087
120 Ga0207647_10019597 3300025904 Bacteria 4548
121 Ga0207647_10096604 3300025904 Bacteria 1758
122 Ga0207705_10030365 3300025909 Bacteria 3857
123 Ga0207705_10258415 3300025909 Bacteria 1329
124 Ga0207654_10002631 3300025911 Bacteria 9108
125 Ga0207695_10010930 3300025913 Bacteria 11042
126 Ga0207695_10054521 3300025913 Bacteria 4174
127 Ga0207671_10000594 3300025914 Bacteria 48267
128 Ga0207671_10000886 3300025914 Bacteria 37914
129 Ga0207693_10001642 3300025915 Bacteria 19747
130 Ga0207663_10147136 3300025916 Bacteria 1648
131 Ga0207657_10275951 3300025919 Bacteria 1335
132 Ga0207649_10031095 3300025920 Bacteria 3170
133 Ga0207652_10053262 3300025921 Bacteria 3476
134 Ga0207652_10578466 3300025921 Bacteria 1008
135 Ga0207694_10005786 3300025924 Bacteria 9469
136 Ga0207694_10019245 3300025924 Bacteria 5161
137 Ga0207700_10017247 3300025928 Bacteria 4819
138 Ga0207700_10046721 3300025928 Bacteria 3204
139 Ga0207664_10010108 3300025929 Bacteria 6653
140 Ga0207664_10016938 3300025929 Bacteria 5330
141 Ga0207664_10061056 3300025929 Bacteria 3006
142 Ga0207709_10175179 3300025935 Bacteria 1509
143 Ga0207689_10143456 3300025942 Bacteria 1968
144 Ga0207667_10133297 3300025949 Bacteria 2559
145 Ga0207667_10418265 3300025949 Bacteria 1364
146 Ga0207668_10000190 3300025972 Bacteria 41980
147 Ga0207668_10000377 3300025972 Bacteria 28306
148 Ga0207668_10335183 3300025972 Bacteria 1260
149 Ga0207640_10049087 3300025981 Bacteria 2731
150 Ga0207658_10107442 3300025986 Bacteria 2199
151 Ga0207658_10232424 3300025986 Bacteria 1557
152 Ga0207639_10062019 3300026041 Bacteria 2890
153 Ga0207639_10197851 3300026041 Bacteria 1721
154 Ga0207678_10000057 3300026067 Bacteria 86102
155 Ga0207678_10003078 3300026067 Bacteria 15084
156 Ga0207678_10009503 3300026067 Bacteria 8554
157 Ga0207678_10149131 3300026067 Bacteria 1997
158 Ga0207678_10341324 3300026067 Bacteria 1291
159 Ga0207702_10346897 3300026078 Bacteria 1419
160 Ga0207641_10511515 3300026088 Bacteria 1167
161 Ga0207676_10264424 3300026095 Bacteria 1555
162 Ga0207674_10033596 3300026116 Bacteria 5368
163 Ga0207674_10205211 3300026116 Bacteria 1920
164 Ga0207675_100185237 3300026118 Bacteria 1995
165 Ga0207698_10075011 3300026142 Bacteria 2701
166 Ga0268265_10105682 3300028380 Bacteria 2285
167 Ga0268265_10227924 3300028380 Bacteria 1635
168 Ga0268264_10045199 3300028381 Bacteria 3656
169 Ga0268264_10046328 3300028381 Bacteria 3612
170 Ga0268264_10181849 3300028381 Bacteria 1910
171 Ga0265337_1001738 3300028556 Bacteria 10531
172 Ga0265326_10002457 3300028558 Bacteria 6246
173 Ga0265319_1004500 3300028563 Bacteria 6887
174 Ga0265334_10000913 3300028573 Bacteria 14757
175 Ga0265318_10009741 3300028577 Bacteria 4211
176 Ga0265323_10001725 3300028653 Bacteria 10381
177 Ga0265336_10001366 3300028666 Bacteria 11252
178 Ga0307517_10006227 3300028786 Bacteria 17741
179 Ga0307515_10002799 3300028794 Bacteria 37130
180 Ga0307515_10004403 3300028794 Bacteria 29167
181 Ga0307515_10019161 3300028794 Bacteria 12337
182 Ga0307515_10029984 3300028794 Bacteria 9165
183 Ga0307515_10037368 3300028794 Bacteria 7811
184 Ga0307515_10054150 3300028794 Bacteria 5897
185 Ga0307515_10089723 3300028794 Bacteria 3866
186 Ga0307515_10109953 3300028794 Bacteria 3231
187 Ga0307515_10149095 3300028794 Bacteria 2456
188 Ga0265338_10006593 3300028800 Bacteria 14716
189 Ga0265338_10135552 3300028800 Unclassified 1936
190 Ga0265324_10005341 3300029957 Bacteria 5569
191 Ga0307511_10001462 3300030521 Bacteria 24966
192 Ga0307511_10053588 3300030521 Bacteria 3194
193 Ga0307511_10158716 3300030521 Bacteria 1276
194 Ga0307512_10002105 3300030522 Bacteria 26166
195 Ga0307512_10004222 3300030522 Bacteria 15874
196 Ga0307512_10004835 3300030522 Bacteria 14451
197 Ga0307512_10006577 3300030522 Bacteria 11745
198 Ga0307512_10032588 3300030522 Bacteria 4497
199 Ga0307512_10204837 3300030522 Bacteria 1060
200 Ga0316177_1007692 3300030731 Bacteria 1600
201 Ga0316176_1054292 3300030732 Bacteria 2502
202 Ga0314311_1140623 3300030733 Bacteria 3660
203 Ga0316180_1169781 3300030736 Bacteria 1848
204 Ga0265320_10007956 3300031240 Bacteria 6534
205 Ga0265325_10010420 3300031241 Bacteria 5385
206 Ga0265340_10003865 3300031247 Bacteria 8433
207 Ga0265339_10071730 3300031249 Bacteria 1844
208 Ga0307513_10001463 3300031456 Bacteria 33963
209 Ga0307513_10036257 3300031456 Bacteria 5505
210 Ga0307513_10043474 3300031456 Bacteria 4933
211 Ga0307509_10017853 3300031507 Bacteria 8149
212 Ga0307509_10024530 3300031507 Bacteria 6750
213 Ga0307509_10029137 3300031507 Bacteria 6131
214 Ga0307509_10051308 3300031507 Bacteria 4413
215 Ga0307509_10182643 3300031507 Bacteria 1960
216 Ga0307408_100089169 3300031548 Bacteria 2324
217 Ga0307408_100116272 3300031548 Bacteria 2064
218 Ga0307508_10000746 3300031616 Bacteria 38597
219 Ga0307508_10067173 3300031616 Bacteria 3155
220 Ga0307508_10108473 3300031616 Bacteria 2375
221 Ga0307514_10215513 3300031649 Bacteria 1185
222 Ga0265314_10012450 3300031711 Bacteria 6941
223 Ga0265342_10007950 3300031712 Bacteria 7684
224 Ga0307516_10000177 3300031730 Bacteria 82023
225 Ga0307516_10000894 3300031730 Bacteria 41096
226 Ga0307516_10014914 3300031730 Bacteria 8199
227 Ga0307516_10015544 3300031730 Bacteria 8005
228 Ga0307516_10019656 3300031730 Bacteria 6992
229 Ga0307516_10020601 3300031730 Bacteria 6810
230 Ga0307516_10024519 3300031730 Bacteria 6160
231 Ga0307516_10084527 3300031730 Bacteria 3012
232 Ga0307516_10157400 3300031730 Bacteria 2025
233 Ga0307516_10191573 3300031730 Bacteria 1770
234 Ga0307405_10005419 3300031731 Bacteria 6153
235 Ga0307405_10022393 3300031731 Bacteria 3572
236 Ga0307413_10001707 3300031824 Bacteria 8572
237 Ga0307413_10046803 3300031824 Bacteria 2575
238 Ga0307518_10096566 3300031838 Bacteria 2120
239 Ga0307410_10210276 3300031852 Bacteria 1490
240 Ga0307410_10468596 3300031852 Bacteria 1031
241 Ga0307406_10000115 3300031901 Bacteria 46616
242 Ga0307406_10000119 3300031901 Bacteria 46191
243 Ga0307406_10097764 3300031901 Bacteria 1992
244 Ga0307406_10114537 3300031901 Bacteria 1862
245 Ga0307407_10008833 3300031903 Bacteria 4654
246 Ga0307407_10017144 3300031903 Bacteria 3626
247 Ga0307412_10009796 3300031911 Bacteria 5501
248 Ga0307412_10014019 3300031911 Bacteria 4719
249 Ga0307412_10038248 3300031911 Bacteria 3088
250 Ga0307412_10187559 3300031911 Bacteria 1561
251 Ga0307409_100000181 3300031995 Bacteria 24481
252 Ga0307409_100052591 3300031995 Bacteria 3124
253 Ga0307409_100764783 3300031995 Bacteria 971
254 Ga0307416_100039664 3300032002 Bacteria 3649
255 Ga0307416_100059910 3300032002 Bacteria 3097
256 Ga0307414_10006971 3300032004 Bacteria 6333
257 Ga0307414_10008517 3300032004 Bacteria 5822
258 Ga0307411_10031162 3300032005 Bacteria 3277
259 Ga0307411_10274438 3300032005 Bacteria 1339
260 Ga0307411_10485742 3300032005 Bacteria 1041
261 Ga0307415_100000148 3300032126 Bacteria 31023
262 Ga0307415_100028775 3300032126 Bacteria 3541
263 Ga0307415_100086027 3300032126 Bacteria 2261
264 Ga0307415_100089198 3300032126 Bacteria 2227
265 Ga0307415_100136665 3300032126 Bacteria 1865
266 Ga0307507_10000016 3300033179 Bacteria 225984
267 Ga0307507_10022239 3300033179 Bacteria 7016
268 Ga0307507_10043043 3300033179 Bacteria 4487
269 Ga0307507_10058272 3300033179 Bacteria 3628
270 Ga0307507_10138680 3300033179 Bacteria 1872
271 Ga0307510_10097614 3300033180 Bacteria 2747
272 Ga0307510_10155598 3300033180 Bacteria 1893
273 Ga0307510_10236896 3300033180 Bacteria 1323
274 Ga0373950_0018230 3300034818 Bacteria 1216
275 Ga0373951_0000300 3300035091 Bacteria 15760
276 Ga0373955_0287960 3300035172 Bacteria 989
277 Ga0373942_0000443 3300035207 Bacteria 11609
278 Ga0373935_0001950 3300035692 Bacteria 11604
279 Ga0373925_0000237 3300037068 Bacteria 58351
280 Ga0395899_0000833 3300037312 Bacteria 29778
281 Ga0395899_0002077 3300037312 Bacteria 16450
282 Ga0395900_0177717 3300037418 Bacteria 2165
283 Ga0395898_0116450 3300037466 Bacteria 2561
284 Ga0395901_0273843 3300038443 Bacteria 1755
285 Ga0439436_0001148 3300041404 Bacteria 7520
286 Ga0439436_0008662 3300041404 Bacteria 3127
287 Ga0439439_0004980 3300041406 Bacteria 3014
288 Ga0451793_1147289 3300041452 Bacteria 1486
289 Ga0451798_0658012 3300041458 Bacteria 1205
290 Ga0451802_1239871 3300041460 Bacteria 1650
291 Ga0451833_0184157 3300041491 Bacteria 1581
292 Ga0451833_0615816 3300041491 Bacteria 1548
293 Ga0451853_0437132 3300041512 Bacteria 8360
294 Ga0451853_1338476 3300041512 Bacteria 5597
295 Ga0439431_0024570 3300041997 Bacteria 1467
296 Ga0439433_0003978 3300041999 Bacteria 3180
297 Ga0439449_0000771 3300042007 Bacteria 12317
298 Ga0439449_0008913 3300042007 Bacteria 3806
299 Ga0439449_0083501 3300042007 Bacteria 1178
300 Ga0439457_000064 3300042014 Bacteria 22792
301 Ga0439457_004083 3300042014 Bacteria 3865
302 Ga0439457_005509 3300042014 Bacteria 3181
303 Ga0439457_016910 3300042014 Bacteria 1623
304 Ga0450890_011050 3300042127 Bacteria 1164
305 Ga0450899_000219 3300042135 Bacteria 6008
306 Ga0450899_002676 3300042135 Bacteria 1925
307 Ga0450903_003756 3300042138 Bacteria 2619
308 Ga0450906_000627 3300042145 Bacteria 7564
309 Ga0439458_0037620 3300042157 Bacteria 1167
310 Ga0450908_001411 3300042184 Bacteria 4661
311 Ga0466969_0013971 3300044656 Bacteria 4226
312 Ga0466969_0016209 3300044656 Bacteria 3903
313 Ga0466969_0016800 3300044656 Bacteria 3826
314 Ga0466969_0040940 3300044656 Bacteria 2320
315 Ga0466969_0056891 3300044656 Bacteria 1908
316 Ga0466969_0082872 3300044656 Bacteria 1528
317 Ga0466969_0142197 3300044656 Bacteria 1108
318 Ga0466972_0004270 3300044658 Bacteria 7138
319 Ga0466972_0006665 3300044658 Bacteria 5794
320 Ga0466972_0010681 3300044658 Bacteria 4607
321 Ga0466972_0014568 3300044658 Bacteria 3937
322 Ga0466972_0025925 3300044658 Bacteria 2904
323 Ga0466972_0030850 3300044658 Bacteria 2638
324 Ga0466972_0042953 3300044658 Bacteria 2196
325 Ga0466965_0000006 3300044683 Bacteria 158069
326 Ga0466965_0005771 3300044683 Bacteria 5587
327 Ga0466965_0008284 3300044683 Bacteria 4806
328 Ga0466965_0010777 3300044683 Bacteria 4276
329 Ga0466966_0004721 3300044684 Bacteria 8964
330 Ga0466966_0009699 3300044684 Bacteria 6378
331 Ga0466966_0016186 3300044684 Bacteria 4931
332 Ga0466966_0022480 3300044684 Bacteria 4136
333 Ga0466966_0022733 3300044684 Bacteria 4110
334 Ga0466966_0055970 3300044684 Bacteria 2496
335 Ga0466966_0083890 3300044684 Bacteria 1982
336 Ga0466961_0001507 3300044693 Bacteria 14453
337 Ga0466961_0001724 3300044693 Bacteria 13599
338 Ga0466961_0021132 3300044693 Bacteria 4190
339 Ga0466961_0032710 3300044693 Bacteria 3342
340 Ga0466961_0043208 3300044693 Bacteria 2887
341 Ga0466961_0043513 3300044693 Bacteria 2876
342 Ga0466961_0060657 3300044693 Bacteria 2405
343 Ga0466961_0077057 3300044693 Bacteria 2112
344 Ga0466961_0260162 3300044693 Bacteria 1064
345 Ga0466963_0048625 3300044694 Bacteria 2803
346 Ga0466971_0000308 3300044719 Bacteria 18882
347 Ga0466971_0010058 3300044719 Bacteria 4132
348 Ga0466971_0029535 3300044719 Bacteria 2452
349 Ga0466968_0032353 3300044735 Bacteria 2175
350 Ga0466968_0088863 3300044735 Bacteria 1366
351 Ga0466970_0000635 3300044765 Bacteria 17248
352 Ga0466970_0009236 3300044765 Bacteria 4977
353 Ga0466970_0026897 3300044765 Bacteria 3015
354 Ga0466970_0054369 3300044765 Bacteria 2138
355 Ga0466970_0114708 3300044765 Bacteria 1473
356 Ga0466970_0170712 3300044765 Bacteria 1205
357 Ga0466957_0029701 3300044842 Bacteria 3261
358 Ga0466957_0335017 3300044842 Bacteria 1024
359 Ga0466960_0000667 3300044901 Bacteria 11931
360 Ga0466960_0005489 3300044901 Bacteria 5028
361 Ga0466960_0005654 3300044901 Bacteria 4961
362 Ga0466959_0001924 3300045049 Bacteria 13062
363 Ga0466959_0022340 3300045049 Bacteria 4676
364 Ga0466959_0028567 3300045049 Bacteria 4135
365 Ga0466959_0047829 3300045049 Bacteria 3145
366 Ga0466959_0115249 3300045049 Bacteria 1914
367 Ga0466959_0158779 3300045049 Bacteria 1590
368 Ga0466959_0218072 3300045049 Bacteria 1324
369 Ga0466958_0009839 3300045836 Bacteria 5336
370 Ga0466958_0041077 3300045836 Bacteria 2781
371 Ga0466958_0111951 3300045836 Bacteria 1704
372 Ga0466958_0308863 3300045836 Bacteria 1016
373 Ga0466967_0017950 3300045976 Bacteria 5639
374 Ga0466967_0301368 3300045976 Bacteria 1542
375 Ga0495592_0002276 3300046454 Bacteria 13536
376 Ga0495592_0045059 3300046454 Bacteria 3292
377 Ga0495592_0097708 3300046454 Bacteria 2097
378 Ga0495592_0133773 3300046454 Bacteria 1731
379 Ga0495603_0010543 3300046455 Bacteria 5598
380 Ga0495603_0021643 3300046455 Bacteria 3894
381 Ga0495590_0016035 3300046457 Bacteria 2710
382 Ga0495629_0000626 3300046459 Bacteria 28709
383 Ga0495629_0014032 3300046459 Bacteria 5773
384 Ga0495629_0061340 3300046459 Bacteria 2628
385 Ga0495638_0079450 3300046460 Bacteria 1994
386 Ga0495651_0001198 3300046462 Bacteria 20050
387 Ga0495651_0001254 3300046462 Bacteria 19647
388 Ga0495651_0003257 3300046462 Bacteria 12459
389 Ga0495651_0029755 3300046462 Bacteria 4258
390 Ga0495651_0031692 3300046462 Bacteria 4121
391 Ga0495651_0033826 3300046462 Bacteria 3986
392 Ga0495651_0053181 3300046462 Bacteria 3119
393 Ga0495580_0047232 3300046472 Bacteria 3052
394 Ga0495582_0049263 3300046473 Bacteria 2320
395 Ga0495605_0034529 3300046474 Bacteria 2560
396 Ga0495639_0026750 3300046475 Bacteria 2551
397 Ga0495662_0001387 3300046476 Bacteria 12007
398 Ga0495662_0003692 3300046476 Bacteria 7721
399 Ga0495662_0003828 3300046476 Bacteria 7586
400 Ga0495662_0173284 3300046476 Bacteria 1063
401 Ga0495664_0000225 3300046477 Bacteria 26888
402 Ga0495664_0007836 3300046477 Bacteria 5944
403 Ga0495584_0031304 3300046491 Bacteria 2693
404 Ga0495585_0019430 3300046492 Bacteria 3917
405 Ga0495585_0031771 3300046492 Bacteria 2996
406 Ga0495594_0000666 3300046499 Bacteria 17683
407 Ga0495594_0034005 3300046499 Bacteria 2772
408 Ga0495594_0045402 3300046499 Bacteria 2411
409 Ga0495594_0098811 3300046499 Bacteria 1641
410 Ga0495596_0071119 3300046500 Bacteria 1351
411 Ga0495607_0036881 3300046501 Bacteria 2942
412 Ga0495607_0113750 3300046501 Bacteria 1431
413 Ga0495583_0063735 3300046506 Bacteria 1637
414 Ga0495606_0001231 3300046507 Bacteria 35820
415 Ga0495606_0003545 3300046507 Bacteria 16479
416 Ga0495608_0186169 3300046511 Bacteria 1312
417 Ga0495618_0006585 3300046514 Bacteria 7046
418 Ga0495618_0190766 3300046514 Bacteria 1299
419 Ga0495628_0008046 3300046516 Bacteria 9076
420 Ga0495628_0012572 3300046516 Bacteria 7133
421 Ga0495628_0019754 3300046516 Bacteria 5565
422 Ga0495628_0049010 3300046516 Bacteria 3346
423 Ga0495630_0035055 3300046517 Bacteria 3750
424 Ga0495630_0104908 3300046517 Bacteria 2139
425 Ga0495631_0010398 3300046518 Bacteria 4605
426 Ga0495632_0072667 3300046519 Bacteria 1650
427 Ga0495643_0001005 3300046522 Bacteria 28801
428 Ga0495643_0002935 3300046522 Bacteria 12918
429 Ga0495648_0033077 3300046524 Bacteria 3383
430 Ga0495666_0006788 3300046526 Bacteria 5750
431 Ga0495652_0001571 3300046529 Bacteria 24996
432 Ga0495652_0001890 3300046529 Bacteria 22269
433 Ga0495652_0009656 3300046529 Bacteria 8759
434 Ga0495652_0042397 3300046529 Bacteria 3924
435 Ga0495652_0204773 3300046529 Bacteria 1494
436 Ga0495665_0002200 3300046531 Bacteria 10556
437 Ga0495640_0020815 3300046533 Bacteria 4820
438 Ga0495640_0048674 3300046533 Bacteria 2928
439 Ga0495640_0056304 3300046533 Bacteria 2686
440 Ga0495586_0027310 3300046535 Bacteria 3054
441 Ga0495586_0151419 3300046535 Bacteria 1305
442 Ga0495587_0006654 3300046536 Bacteria 7526
443 Ga0495597_0020741 3300046542 Bacteria 3058
444 Ga0495645_0010711 3300046543 Bacteria 6439
445 Ga0495645_0012052 3300046543 Bacteria 6093
446 Ga0495645_0020844 3300046543 Bacteria 4736
447 Ga0495645_0052068 3300046543 Bacteria 2979
448 Ga0495645_0069544 3300046543 Bacteria 2541
449 Ga0495645_0254828 3300046543 Bacteria 1165
450 Ga0495622_0002951 3300046557 Bacteria 8106
451 Ga0495622_0021833 3300046557 Bacteria 2982
452 Ga0495622_0071851 3300046557 Bacteria 1597
453 Ga0495622_0101370 3300046557 Bacteria 1319
454 Ga0495622_0122949 3300046557 Bacteria 1184
455 Ga0495667_0169543 3300046559 Bacteria 1403
456 Ga0495656_0037051 3300046615 Bacteria 2012
457 Ga0495668_0000326 3300046616 Bacteria 65274
458 Ga0495668_0000537 3300046616 Bacteria 47191
459 Ga0495668_0029493 3300046616 Bacteria 3099
460 Ga0495634_0097224 3300046642 Bacteria 1906
461 Ga0495634_0107028 3300046642 Bacteria 1801
462 Ga0495634_0108108 3300046642 Bacteria 1790
463 Ga0495611_0059195 3300046648 Bacteria 1738
464 Ga0495611_0099992 3300046648 Bacteria 1346
465 Ga0495625_0000770 3300046660 Bacteria 44596
466 Ga0495625_0070625 3300046660 Bacteria 2452
467 Ga0495625_0080494 3300046660 Bacteria 2269
468 Ga0495635_0002503 3300046663 Bacteria 12553
469 Ga0495635_0008627 3300046663 Bacteria 7118
470 Ga0495635_0130323 3300046663 Bacteria 1714
471 Ga0495635_0167526 3300046663 Bacteria 1494
472 Ga0495661_0012847 3300046665 Bacteria 5646
473 Ga0495588_0008717 3300046674 Bacteria 4660
474 Ga0495588_0016895 3300046674 Bacteria 3534
475 Ga0495657_0006945 3300046675 Bacteria 8789
476 Ga0495657_0015799 3300046675 Bacteria 5513
477 Ga0495657_0023538 3300046675 Bacteria 4398
478 Ga0495599_0158290 3300046678 Bacteria 1400
479 Ga0495623_0006089 3300046679 Bacteria 7848
480 Ga0495623_0095528 3300046679 Bacteria 1817
481 Ga0495646_0000371 3300046680 Bacteria 23327
482 Ga0495646_0084850 3300046680 Bacteria 1838
483 Ga0495646_0098165 3300046680 Bacteria 1682
484 Ga0495613_0001859 3300046689 Bacteria 16059
485 Ga0495613_0080950 3300046689 Bacteria 2360
486 Ga0495613_0089386 3300046689 Bacteria 2231
487 Ga0495613_0155554 3300046689 Bacteria 1629
488 Ga0495613_0208631 3300046689 Bacteria 1374
489 Ga0495670_0022512 3300046691 Bacteria 3111
490 Ga0495649_0086137 3300046694 Bacteria 1677
491 Ga0495649_0135954 3300046694 Bacteria 1295
492 Ga0495589_0032224 3300046794 Bacteria 2635
493 Ga0495589_0091936 3300046794 Bacteria 1473
494 Ga0495589_0110718 3300046794 Bacteria 1325
495 Ga0495600_0008866 3300046809 Bacteria 6197
496 Ga0495600_0017817 3300046809 Bacteria 4520
497 Ga0495600_0034963 3300046809 Bacteria 3262
498 Ga0495600_0047332 3300046809 Bacteria 2805
499 Ga0495600_0109113 3300046809 Bacteria 1802
500 Ga0495600_0182187 3300046809 Bacteria 1353
501 Ga0495660_0098336 3300046810 Bacteria 1509
502 Ga0495660_0106479 3300046810 Bacteria 1436
503 Ga0495581_0006333 3300047315 Bacteria 6866
504 Ga0495581_0056132 3300047315 Bacteria 2273
505 Ga0495581_0113725 3300047315 Bacteria 1574
506 Ga0495604_0000502 3300047317 Bacteria 34488
507 Ga0495604_0003240 3300047317 Bacteria 13008
508 Ga0495604_0035125 3300047317 Bacteria 3961
509 Ga0495604_0120447 3300047317 Bacteria 1900
510 Ga0495636_0000810 3300047318 Bacteria 11514
511 Ga0495636_0008279 3300047318 Bacteria 4105
512 Ga0495636_0125129 3300047318 Bacteria 1140
513 Ga0495674_0019544 3300047319 Bacteria 6285
514 Ga0495672_0074703 3300047320 Bacteria 1908
515 Ga0495676_0004654 3300047321 Bacteria 12569
516 Ga0495676_0007142 3300047321 Bacteria 10249
517 Ga0495676_0035431 3300047321 Bacteria 4173
518 Ga0495676_0064778 3300047321 Bacteria 2840
519 Ga0495676_0140495 3300047321 Bacteria 1731
520 Ga0495680_0003794 3300047322 Bacteria 14681
521 Ga0495680_0056712 3300047322 Bacteria 3032
522 Ga0495683_0034166 3300047323 Bacteria 2587
523 Ga0495683_0059580 3300047323 Bacteria 1894
524 Ga0495687_002905 3300047443 Bacteria 13052
525 Ga0495687_003222 3300047443 Bacteria 12074
526 Ga0495687_009056 3300047443 Bacteria 5610
527 Ga0495675_0021539 3300047444 Bacteria 4105
528 Ga0495675_0106594 3300047444 Bacteria 1751
529 Ga0495675_0140921 3300047444 Bacteria 1494
530 Ga0495675_0154443 3300047444 Bacteria 1416
531 Ga0495677_0036933 3300047445 Bacteria 1784
532 Ga0495685_000242 3300047447 Bacteria 18816
533 Ga0495685_007723 3300047447 Bacteria 3558
534 Ga0495685_008162 3300047447 Bacteria 3470
535 Ga0495685_033926 3300047447 Bacteria 1754
536 Ga0495681_0005889 3300047470 Bacteria 8138
537 Ga0495686_0087210 3300047472 Bacteria 1898
538 Ga0495593_0008889 3300047673 Bacteria 5829
539 Ga0495593_0033683 3300047673 Bacteria 2789
540 Ga0495602_0016780 3300048088 Bacteria 7353
541 Ga0495602_0083550 3300048088 Bacteria 2675
542 Ga0495602_0107030 3300048088 Bacteria 2280
543 Ga0495614_0026105 3300048089 Bacteria 2517
544 Ga0495626_0000046 3300048091 Bacteria 162660
545 Ga0495626_0000137 3300048091 Bacteria 92873
546 Ga0495626_0012892 3300048091 Bacteria 4361
547 Ga0496105_0335878 3300048908 Bacteria 1209
548 Ga0496105_0341285 3300048908 Bacteria 1198
549 Ga0496106_0034861 3300048909 Bacteria 3761
550 Ga0496108_0000015 3300048911 Bacteria 243282
551 Ga0496108_0050673 3300048911 Bacteria 3476
552 Ga0496108_0097207 3300048911 Bacteria 2509
553 Ga0496109_0022352 3300048912 Bacteria 5601
554 Ga0496110_0299449 3300048913 Bacteria 1465
555 Ga0496111_0001649 3300048914 Bacteria 12957
556 Ga0496112_0067940 3300048915 Bacteria 3519
557 Ga0496114_0010822 3300048917 Bacteria 7263
558 Ga0496114_0110597 3300048917 Bacteria 2354
559 Ga0496117_0000196 3300048920 Bacteria 119243
560 Ga0496118_0076100 3300048921 Bacteria 2389
561 Ga0496119_0060536 3300048922 Bacteria 2266
562 Ga0496119_0115980 3300048922 Bacteria 1479
563 Ga0496125_0049348 3300048928 Bacteria 3498
564 Ga0496126_0054784 3300048929 Bacteria 3610
565 Ga0496126_0057078 3300048929 Bacteria 3527
566 Ga0496126_0060344 3300048929 Bacteria 3411
567 Ga0495678_016992 3300049459 Bacteria 3309
568 Ga0495682_0026202 3300049460 Bacteria 2167
569 Ga0501031_0001193 3300049568 Bacteria 15835
570 Ga0501031_0073104 3300049568 Bacteria 2233
571 Ga0501032_0001375 3300049569 Bacteria 19307
572 Ga0501032_0064028 3300049569 Bacteria 2461
573 Ga0501032_0080971 3300049569 Bacteria 2160
574 Ga0501033_0011940 3300049570 Bacteria 6636
575 Ga0501034_0004272 3300049571 Bacteria 15940
576 Ga0501034_0021972 3300049571 Bacteria 6501
577 Ga0501034_0118142 3300049571 Bacteria 2639
578 Ga0501036_0054086 3300049572 Bacteria 3399
579 Ga0501036_0063142 3300049572 Bacteria 3136
580 Ga0501037_0001086 3300049573 Bacteria 20170
581 Ga0501037_0001575 3300049573 Bacteria 16622
582 Ga0501038_0014929 3300049574 Bacteria 7072
583 Ga0501038_0076202 3300049574 Bacteria 2833
584 Ga0501038_0191266 3300049574 Bacteria 1646
585 Ga0501038_0282487 3300049574 Bacteria 1306
586 Ga0501039_0002353 3300049575 Bacteria 14073
587 Ga0501039_0076474 3300049575 Bacteria 2602
588 Ga0501040_0025318 3300049576 Bacteria 3989
589 Ga0501041_0012595 3300049577 Bacteria 5009
590 Ga0501042_0000296 3300049578 Bacteria 24701
591 Ga0501042_0065215 3300049578 Bacteria 2602
592 Ga0501043_0004901 3300049579 Bacteria 10816
593 Ga0501046_0007535 3300049580 Bacteria 9547
594 Ga0501046_0132302 3300049580 Bacteria 1891
595 Ga0501047_0003044 3300049581 Bacteria 15905
596 Ga0501047_0029479 3300049581 Bacteria 5290
597 Ga0501048_0000513 3300049582 Bacteria 27155
598 Ga0501048_0013876 3300049582 Bacteria 5974
599 Ga0501067_0020963 3300049583 Bacteria 3615
600 Ga0501068_0077821 3300049584 Bacteria 2031
601 Ga0501070_0015332 3300049586 Bacteria 6449
602 Ga0501070_0091682 3300049586 Bacteria 2515
603 Ga0501070_0207527 3300049586 Bacteria 1608
604 Ga0501071_0023537 3300049587 Bacteria 4302
605 Ga0501072_0001837 3300049588 Bacteria 15806
606 Ga0501073_0075093 3300049589 Bacteria 2353
607 Ga0501073_0095404 3300049589 Bacteria 2065
608 Ga0501074_0018140 3300049590 Bacteria 5111
609 Ga0501077_0008026 3300049593 Bacteria 6527
610 Ga0501079_0053821 3300049741 Bacteria 3104
611 Ga0501080_0131575 3300049742 Bacteria 2316
612 Ga0501083_0000059 3300049744 Bacteria 78374
613 Ga0501083_0010196 3300049744 Bacteria 6621
614 Ga0501035_0003230 3300049822 Bacteria 15614
615 Ga0501035_0007647 3300049822 Bacteria 10096
616 Ga0501035_0259169 3300049822 Bacteria 1475
617 Ga0501044_0006899 3300049823 Bacteria 12505
618 Ga0501044_0119640 3300049823 Bacteria 2635
619 Ga0501045_0096748 3300049824 Bacteria 2184
620 nmdc:mga03n38_19253_c1 3300050490 Bacteria 2709
621 nmdc:mga03n38_35023_c1 3300050490 Bacteria 2148
622 nmdc:mga03n38_79540_c1 3300050490 Bacteria 1537
623 nmdc:mga06z11_688_c1 3300050494 Bacteria 12298
624 nmdc:mga05p37_6921_c1 3300050507 Bacteria 13369
625 nmdc:mga09592_346713_c1 3300050508 Bacteria 1285
626 nmdc:mga06r32_694345_c1 3300050510 Bacteria 984
627 Ga0495601_0005136 3300053077 Bacteria 7607
628 Ga0495612_0002515 3300053078 Bacteria 7566
629 Ga0500635_0000073 3300053080 Bacteria 65023
630 Ga0495619_0002746 3300053085 Bacteria 11492
631 Ga0500644_0015782 3300053088 Bacteria 2163
632 Ga0500646_0000134 3300053090 Bacteria 21323
633 Ga0500646_0000964 3300053090 Bacteria 7901
634 Ga0500651_0040400 3300053093 Bacteria 2939
635 Ga0500566_0109140 3300053094 Bacteria 1506
636 Ga0500640_014507 3300053095 Bacteria 3281
637 Ga0500641_0124053 3300053096 Bacteria 1114
638 Ga0500650_0019304 3300053098 Bacteria 2972
639 Ga0500650_0024343 3300053098 Bacteria 2699
640 Ga0500660_039133 3300053100 Bacteria 2424
641 Ga0500553_012772 3300053101 Bacteria 4255
642 Ga0500560_010272 3300053107 Bacteria 2338
643 Ga0500569_003761 3300053109 Bacteria 3135
644 Ga0500594_0026135 3300053118 Bacteria 1502
645 Ga0500652_001575 3300053131 Bacteria 6969
646 Ga0500652_067994 3300053131 Bacteria 1473
647 Ga0500561_0000242 3300053137 Bacteria 9789
648 Ga0500573_0053550 3300053140 Bacteria 2318
649 Ga0500573_0070041 3300053140 Bacteria 2001
650 Ga0500577_0098771 3300053142 Bacteria 1190
651 Ga0500579_072281 3300053143 Bacteria 1983
652 Ga0500588_0012392 3300053146 Bacteria 2113
653 Ga0500588_0017184 3300053146 Bacteria 1884
654 Ga0500616_0000553 3300053153 Bacteria 46504
655 Ga0500624_005662 3300053157 Bacteria 1668
656 Ga0500630_053817 3300053159 Bacteria 1938
657 Ga0500633_0000857 3300053160 Bacteria 5267
658 Ga0500633_0013918 3300053160 Bacteria 2269
659 Ga0501084_0039374 3300054114 Bacteria 3953
660 Ga0501082_0013965 3300060353 Bacteria 6907
661 Ga0501082_0259555 3300060353 Bacteria 1511
662 Ga0466962_0000098 3300061719 Bacteria 35205
663 Ga0466962_0012818 3300061719 Bacteria 4034
664 Ga0466962_0033718 3300061719 Bacteria 2451
665 Ga0466962_0111603 3300061719 Bacteria 1316

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0125129 Ga0495636_0125129_100_894 211
2 3300044658 Ga0466972_0004270 Ga0466972_0004270_2414_3289 230
3 3300044683 Ga0466965_0008284 Ga0466965_0008284_1521_2396 230
4 3300044684 Ga0466966_0022733 Ga0466966_0022733_2425_3300 230
5 3300044693 Ga0466961_0001724 Ga0466961_0001724_1216_2091 230
6 3300044735 Ga0466968_0088863 Ga0466968_0088863_402_1277 230
7 3300061719 Ga0466962_0033718 Ga0466962_0033718_873_1748 230
8 3300042135 Ga0450899_002676 Ga0450899_002676_10_807 235
9 3300046462 Ga0495651_0053181 Ga0495651_0053181_1669_2565 237
10 3300009147 Ga0114129_10372288 Ga0114129_103722881 238
11 3300044765 Ga0466970_0114708 Ga0466970_0114708_24_848 238
12 3300050507 nmdc:mga05p37_6921_c1 nmdc:mga05p37_6921_c1_1072_1908 238
13 3300050508 nmdc:mga09592_346713_c1 nmdc:mga09592_346713_c1_130_966 238
14 3300050510 nmdc:mga06r32_694345_c1 nmdc:mga06r32_694345_c1_36_872 238
15 3300003322 rootL2_10106867 rootL2_101068672 240
16 3300009176 Ga0105242_10149434 Ga0105242_101494342 241
17 3300045836 Ga0466958_0308863 Ga0466958_0308863_59_883 241
18 3300046454 Ga0495592_0097708 Ga0495592_0097708_1049_1873 241
19 3300046462 Ga0495651_0001198 Ga0495651_0001198_15647_16471 241
20 3300046516 Ga0495628_0008046 Ga0495628_0008046_1936_2760 241
21 3300046529 Ga0495652_0001571 Ga0495652_0001571_15577_16401 241
22 3300046543 Ga0495645_0052068 Ga0495645_0052068_799_1623 241
23 3300047317 Ga0495604_0035125 Ga0495604_0035125_2664_3488 241
24 3300009093 Ga0105240_10020634 Ga0105240_100206344 242
25 3300009174 Ga0105241_10017053 Ga0105241_100170533 242
26 3300009545 Ga0105237_10051232 Ga0105237_100512324 242
27 3300009551 Ga0105238_10057219 Ga0105238_100572192 242
28 3300010375 Ga0105239_10432100 Ga0105239_104321002 242
29 3300044656 Ga0466969_0016209 Ga0466969_0016209_2851_3675 242
30 3300044693 Ga0466961_0077057 Ga0466961_0077057_1021_1845 242
31 3300044656 Ga0466969_0142197 Ga0466969_0142197_55_879 245
32 3300005539 Ga0068853_100060366 Ga0068853_1000603662 246
33 3300005548 Ga0070665_100195507 Ga0070665_1001955072 246
34 3300005563 Ga0068855_100006547 Ga0068855_10000654711 246
35 3300005578 Ga0068854_100096558 Ga0068854_1000965583 246
36 3300005614 Ga0068856_100074324 Ga0068856_1000743241 246
37 3300005616 Ga0068852_100044441 Ga0068852_1000444413 246
38 3300025904 Ga0207647_10003321 Ga0207647_100033215 246
39 3300025911 Ga0207654_10002631 Ga0207654_100026314 246
40 3300025913 Ga0207695_10054521 Ga0207695_100545212 246
41 3300025914 Ga0207671_10000886 Ga0207671_100008864 246
42 3300025924 Ga0207694_10005786 Ga0207694_100057862 246
43 3300025949 Ga0207667_10133297 Ga0207667_101332972 246
44 3300026041 Ga0207639_10197851 Ga0207639_101978512 246
45 3300026078 Ga0207702_10346897 Ga0207702_103468972 246
46 3300026142 Ga0207698_10075011 Ga0207698_100750112 246
47 3300006844 Ga0075428_100001094 Ga0075428_10000109418 248
48 3300009093 Ga0105240_10186938 Ga0105240_101869382 249
49 3300046462 Ga0495651_0001254 Ga0495651_0001254_7868_8764 249
50 3300046516 Ga0495628_0049010 Ga0495628_0049010_1246_2142 249
51 3300046529 Ga0495652_0001890 Ga0495652_0001890_14449_15345 249
52 3300046543 Ga0495645_0020844 Ga0495645_0020844_3549_4445 249
53 3300046809 Ga0495600_0008866 Ga0495600_0008866_647_1543 249
54 3300030521 Ga0307511_10001462 Ga0307511_100014628 250
55 3300030521 Ga0307511_10053588 Ga0307511_100535883 250
56 3300031730 Ga0307516_10020601 Ga0307516_100206014 250
57 3300033180 Ga0307510_10097614 Ga0307510_100976143 250
58 3300047443 Ga0495687_002905 Ga0495687_002905_4203_5069 250
59 3300042014 Ga0439457_000064 Ga0439457_000064_17082_17960 251
60 3300030521 Ga0307511_10158716 Ga0307511_101587162 252
61 3300031456 Ga0307513_10043474 Ga0307513_100434742 252
62 3300033180 Ga0307510_10155598 Ga0307510_101555982 252
63 3300005578 Ga0068854_100384325 Ga0068854_1003843252 253
64 3300041406 Ga0439439_0004980 Ga0439439_0004980_341_1231 253
65 3300003322 rootL2_10004889 rootL2_100048895 254
66 3300005435 Ga0070714_100451474 Ga0070714_1004514742 254
67 3300009984 Ga0105029_100341 Ga0105029_1003412 254
68 3300025230 Ga0209563_100586 Ga0209563_1005867 254
69 3300026116 Ga0207674_10205211 Ga0207674_102052112 254
70 3300031507 Ga0307509_10024530 Ga0307509_100245302 254
71 3300031838 Ga0307518_10096566 Ga0307518_100965662 254
72 3300035172 Ga0373955_0287960 Ga0373955_0287960_54_851 254
73 3300044684 Ga0466966_0055970 Ga0466966_0055970_576_1412 254
74 3300044693 Ga0466961_0260162 Ga0466961_0260162_42_821 254
75 3300044765 Ga0466970_0026897 Ga0466970_0026897_1398_2234 254
76 3300045049 Ga0466959_0022340 Ga0466959_0022340_2537_3373 254
77 3300046499 Ga0495594_0098811 Ga0495594_0098811_761_1576 254
78 3300046557 Ga0495622_0122949 Ga0495622_0122949_290_1102 254
79 3300049824 Ga0501045_0096748 Ga0501045_0096748_22_834 254
80 3300053088 Ga0500644_0015782 Ga0500644_0015782_1077_1898 254
81 3300053131 Ga0500652_067994 Ga0500652_067994_32_835 254
82 3300053153 Ga0500616_0000553 Ga0500616_0000553_35060_35944 254
83 iso_pu_bacteria 2643221601 2644017949 254
84 iso_pu_bacteria 2643221631 2644180763 254
85 iso_pu_bacteria 8047710418 8047714759 254
86 3300025272 Ga0209455_1004394 Ga0209455_10043943 255
87 3300041491 Ga0451833_0184157 Ga0451833_0184157_220_1026 255
88 3300044658 Ga0466972_0025925 Ga0466972_0025925_13_831 255
89 3300044683 Ga0466965_0005771 Ga0466965_0005771_3305_4123 255
90 3300044693 Ga0466961_0043208 Ga0466961_0043208_938_1870 255
91 3300044735 Ga0466968_0032353 Ga0466968_0032353_306_1124 255
92 3300044901 Ga0466960_0000667 Ga0466960_0000667_6979_7797 255
93 3300048911 Ga0496108_0097207 Ga0496108_0097207_488_1387 255
94 3300053085 Ga0495619_0002746 Ga0495619_0002746_8336_9142 255
95 3300053146 Ga0500588_0017184 Ga0500588_0017184_94_915 255
96 3300005329 Ga0070683_100343311 Ga0070683_1003433112 256
97 3300006048 Ga0075363_100230939 Ga0075363_1002309392 256
98 3300028794 Ga0307515_10149095 Ga0307515_101490952 256
99 3300041512 Ga0451853_0437132 Ga0451853_0437132_6760_7587 256
100 3300042007 Ga0439449_0008913 Ga0439449_0008913_466_1293 256
101 3300049582 Ga0501048_0000513 Ga0501048_0000513_23333_24184 256
102 3300050490 nmdc:mga03n38_79540_c1 nmdc:mga03n38_79540_c1_653_1495 256
103 iso_pu_bacteria 2675903059 2676485630 256
104 iso_pu_bacteria 2887478801 2887479945 256
105 3300005339 Ga0070660_100198461 Ga0070660_1001984612 257
106 3300005539 Ga0068853_100017090 Ga0068853_1000170904 257
107 3300005548 Ga0070665_100046261 Ga0070665_1000462612 257
108 3300005563 Ga0068855_100012980 Ga0068855_1000129806 257
109 3300006048 Ga0075363_100116128 Ga0075363_1001161282 257
110 3300009174 Ga0105241_10000490 Ga0105241_100004902 257
111 3300009551 Ga0105238_10449884 Ga0105238_104498842 257
112 3300010375 Ga0105239_10086406 Ga0105239_100864063 257
113 3300013296 Ga0157374_10047880 Ga0157374_100478804 257
114 3300025904 Ga0207647_10019597 Ga0207647_100195974 257
115 3300025913 Ga0207695_10010930 Ga0207695_100109306 257
116 3300025914 Ga0207671_10000594 Ga0207671_1000059413 257
117 3300025924 Ga0207694_10019245 Ga0207694_100192452 257
118 3300025981 Ga0207640_10049087 Ga0207640_100490872 257
119 3300026041 Ga0207639_10062019 Ga0207639_100620192 257
120 3300032005 Ga0307411_10031162 Ga0307411_100311622 257
121 3300033179 Ga0307507_10000016 Ga0307507_10000016124 257
122 3300033179 Ga0307507_10043043 Ga0307507_100430433 257
123 3300046454 Ga0495592_0002276 Ga0495592_0002276_11695_12576 257
124 3300046462 Ga0495651_0031692 Ga0495651_0031692_919_1800 257
125 3300046476 Ga0495662_0001387 Ga0495662_0001387_7688_8569 257
126 3300046477 Ga0495664_0000225 Ga0495664_0000225_8543_9424 257
127 3300046514 Ga0495618_0190766 Ga0495618_0190766_48_929 257
128 3300046516 Ga0495628_0012572 Ga0495628_0012572_4497_5378 257
129 3300046517 Ga0495630_0035055 Ga0495630_0035055_848_1729 257
130 3300046529 Ga0495652_0042397 Ga0495652_0042397_39_920 257
131 3300046533 Ga0495640_0048674 Ga0495640_0048674_1036_1917 257
132 3300046536 Ga0495587_0006654 Ga0495587_0006654_6137_7018 257
133 3300046557 Ga0495622_0101370 Ga0495622_0101370_301_1182 257
134 3300046642 Ga0495634_0108108 Ga0495634_0108108_849_1730 257
135 3300046663 Ga0495635_0002503 Ga0495635_0002503_1044_1925 257
136 3300046675 Ga0495657_0023538 Ga0495657_0023538_1512_2393 257
137 3300046680 Ga0495646_0000371 Ga0495646_0000371_13537_14418 257
138 3300046689 Ga0495613_0001859 Ga0495613_0001859_8613_9494 257
139 3300046809 Ga0495600_0034963 Ga0495600_0034963_338_1219 257
140 3300047315 Ga0495581_0006333 Ga0495581_0006333_5505_6386 257
141 3300047317 Ga0495604_0000502 Ga0495604_0000502_23691_24572 257
142 3300047321 Ga0495676_0007142 Ga0495676_0007142_5138_6019 257
143 3300047673 Ga0495593_0008889 Ga0495593_0008889_2752_3633 257
144 3300048088 Ga0495602_0016780 Ga0495602_0016780_5528_6409 257
145 3300048089 Ga0495614_0026105 Ga0495614_0026105_1299_2180 257
146 3300048922 Ga0496119_0060536 Ga0496119_0060536_46_894 257
147 3300053095 Ga0500640_014507 Ga0500640_014507_378_1259 257
148 3300053157 Ga0500624_005662 Ga0500624_005662_539_1420 257
149 3300005617 Ga0068859_100320127 Ga0068859_1003201272 258
150 3300005841 Ga0068863_100664981 Ga0068863_1006649812 258
151 3300005843 Ga0068860_100020130 Ga0068860_1000201304 258
152 3300005844 Ga0068862_100117355 Ga0068862_1001173552 258
153 3300006931 Ga0097620_100320119 Ga0097620_1003201192 258
154 3300025986 Ga0207658_10107442 Ga0207658_101074422 258
155 3300026088 Ga0207641_10511515 Ga0207641_105115152 258
156 3300026095 Ga0207676_10264424 Ga0207676_102644242 258
157 3300028380 Ga0268265_10227924 Ga0268265_102279242 258
158 3300028381 Ga0268264_10046328 Ga0268264_100463282 258
159 3300030733 Ga0314311_1140623 Ga0314311_11406232 258
160 3300031507 Ga0307509_10017853 Ga0307509_100178533 258
161 3300032005 Ga0307411_10274438 Ga0307411_102744381 258
162 3300033179 Ga0307507_10138680 Ga0307507_101386802 258
163 3300044656 Ga0466969_0013971 Ga0466969_0013971_726_1622 258
164 3300044658 Ga0466972_0014568 Ga0466972_0014568_2098_2931 258
165 3300044684 Ga0466966_0009699 Ga0466966_0009699_4748_5644 258
166 3300044765 Ga0466970_0054369 Ga0466970_0054369_848_1681 258
167 3300044765 Ga0466970_0170712 Ga0466970_0170712_265_1161 258
168 3300044901 Ga0466960_0005489 Ga0466960_0005489_523_1356 258
169 3300045049 Ga0466959_0115249 Ga0466959_0115249_968_1864 258
170 3300003203 JGI25406J46586_10003396 JGI25406J46586_100033964 259
171 3300005985 Ga0081539_10000116 Ga0081539_1000011690 259
172 3300028794 Ga0307515_10054150 Ga0307515_100541503 259
173 3300031824 Ga0307413_10001707 Ga0307413_100017075 259
174 3300032004 Ga0307414_10006971 Ga0307414_100069715 259
175 3300046507 Ga0495606_0003545 Ga0495606_0003545_15205_16053 259
176 3300046616 Ga0495668_0000537 Ga0495668_0000537_899_1747 259
177 3300046660 Ga0495625_0080494 Ga0495625_0080494_900_1748 259
178 3300047323 Ga0495683_0059580 Ga0495683_0059580_964_1812 259
179 3300048091 Ga0495626_0000137 Ga0495626_0000137_74558_75406 259
180 3300049569 Ga0501032_0001375 Ga0501032_0001375_4671_5522 259
181 3300049573 Ga0501037_0001086 Ga0501037_0001086_11255_12106 259
182 3300049574 Ga0501038_0191266 Ga0501038_0191266_130_981 259
183 3300049574 Ga0501038_0282487 Ga0501038_0282487_29_880 259
184 3300049575 Ga0501039_0002353 Ga0501039_0002353_8454_9305 259
185 3300049589 Ga0501073_0075093 Ga0501073_0075093_737_1588 259
186 iso_pu_bacteria 2582581313 2585308176 259
187 iso_pu_bacteria 2867428634 2867435772 259
188 iso_pu_bacteria 2884693830 2884700501 259
189 iso_pu_bacteria 2895442618 2895450279 259
190 iso_pu_bacteria 2954711539 2954715086 259
191 iso_pu_bacteria 2954721474 2954725028 259
192 iso_pu_bacteria 2954731030 2954736790 259
193 iso_pu_bacteria 2954740390 2954743961 259
194 iso_pu_bacteria 2954749733 2954755638 259
195 iso_pu_bacteria 2954759201 2954762901 259
196 iso_pu_bacteria 2974302888 2974304401 259
197 iso_pu_bacteria 8001781756 8001785409 259
198 3300005337 Ga0070682_100058749 Ga0070682_1000587492 260
199 3300005458 Ga0070681_10132594 Ga0070681_101325942 260
200 3300005530 Ga0070679_100011830 Ga0070679_1000118302 260
201 3300005535 Ga0070684_100087888 Ga0070684_1000878882 260
202 3300005614 Ga0068856_100134800 Ga0068856_1001348002 260
203 3300013105 Ga0157369_10029746 Ga0157369_100297463 260
204 3300020082 Ga0206353_10480480 Ga0206353_104804802 260
205 3300025909 Ga0207705_10030365 Ga0207705_100303653 260
206 3300025919 Ga0207657_10275951 Ga0207657_102759512 260
207 3300025920 Ga0207649_10031095 Ga0207649_100310953 260
208 3300025921 Ga0207652_10053262 Ga0207652_100532623 260
209 3300025928 Ga0207700_10046721 Ga0207700_100467212 260
210 3300026116 Ga0207674_10033596 Ga0207674_100335962 260
211 3300041458 Ga0451798_0658012 Ga0451798_0658012_239_1096 260
212 3300044683 Ga0466965_0000006 Ga0466965_0000006_147905_148768 260
213 3300048908 Ga0496105_0335878 Ga0496105_0335878_197_1099 260
214 3300048913 Ga0496110_0299449 Ga0496110_0299449_459_1361 260
215 3300048915 Ga0496112_0067940 Ga0496112_0067940_1256_2158 260
216 3300053159 Ga0500630_053817 Ga0500630_053817_166_1071 260
217 3300060353 Ga0501082_0259555 Ga0501082_0259555_156_1061 260
218 iso_pu_bacteria 2643221548 2643759060 260
219 iso_pu_bacteria 2643221682 2644463522 260
220 iso_pu_bacteria 2939657138 2939659505 260
221 3300034818 Ga0373950_0018230 Ga0373950_0018230_145_981 261
222 3300035207 Ga0373942_0000443 Ga0373942_0000443_2571_3407 261
223 3300042014 Ga0439457_016910 Ga0439457_016910_258_1166 261
224 3300044693 Ga0466961_0060657 Ga0466961_0060657_340_1236 261
225 iso_pu_bacteria 2818991463 2819694374 261
226 iso_pu_bacteria 2939657138 2939659979 261
227 iso_pu_bacteria 2966598605 2966603981 261
228 3300005327 Ga0070658_10132103 Ga0070658_101321031 262
229 3300005347 Ga0070668_100029140 Ga0070668_1000291404 262
230 3300005617 Ga0068859_100120643 Ga0068859_1001206432 262
231 3300005719 Ga0068861_100197337 Ga0068861_1001973372 262
232 3300005844 Ga0068862_100096266 Ga0068862_1000962663 262
233 3300005937 Ga0081455_10000198 Ga0081455_100001986 262
234 3300006931 Ga0097620_100120643 Ga0097620_1001206432 262
235 3300025972 Ga0207668_10000190 Ga0207668_100001905 262
236 3300028380 Ga0268265_10105682 Ga0268265_101056822 262
237 3300031852 Ga0307410_10468596 Ga0307410_104685962 262
238 3300032002 Ga0307416_100039664 Ga0307416_1000396644 262
239 3300042127 Ga0450890_011050 Ga0450890_011050_165_1055 262
240 3300044656 Ga0466969_0016800 Ga0466969_0016800_189_1070 262
241 3300044656 Ga0466969_0082872 Ga0466969_0082872_357_1253 262
242 3300044693 Ga0466961_0001507 Ga0466961_0001507_4639_5520 262
243 3300044719 Ga0466971_0000308 Ga0466971_0000308_9815_10696 262
244 3300044842 Ga0466957_0335017 Ga0466957_0335017_48_944 262
245 3300045049 Ga0466959_0047829 Ga0466959_0047829_1984_2865 262
246 3300045836 Ga0466958_0111951 Ga0466958_0111951_505_1386 262
247 3300046459 Ga0495629_0000626 Ga0495629_0000626_14682_15548 262
248 3300046492 Ga0495585_0019430 Ga0495585_0019430_1045_1911 262
249 3300046499 Ga0495594_0000666 Ga0495594_0000666_7300_8166 262
250 3300046557 Ga0495622_0021833 Ga0495622_0021833_54_920 262
251 3300046674 Ga0495588_0008717 Ga0495588_0008717_295_1161 262
252 3300046794 Ga0495589_0091936 Ga0495589_0091936_397_1263 262
253 3300047321 Ga0495676_0004654 Ga0495676_0004654_1553_2419 262
254 3300047323 Ga0495683_0034166 Ga0495683_0034166_673_1539 262
255 3300049580 Ga0501046_0132302 Ga0501046_0132302_42_950 262
256 3300061719 Ga0466962_0000098 Ga0466962_0000098_24009_24890 262
257 iso_pu_bacteria 2582581312 2585300834 262
258 iso_pu_bacteria 2582581314 2585319513 262
259 iso_pu_bacteria 2784746768 2785370693 262
260 iso_pu_bacteria 2867346516 2867352873 262
261 iso_pu_bacteria 2895427314 2895427320 262
262 iso_pu_bacteria 2905926851 2905930624 262
263 iso_pu_bacteria 2946003308 2946006744 262
264 iso_pu_bacteria 2954691527 2954695664 262
265 iso_pu_bacteria 2954701450 2954710857 262
266 3300005347 Ga0070668_100000386 Ga0070668_10000038625 263
267 3300005617 Ga0068859_100346138 Ga0068859_1003461381 263
268 3300006931 Ga0097620_100346170 Ga0097620_1003461701 263
269 3300025972 Ga0207668_10000377 Ga0207668_1000037722 263
270 3300025972 Ga0207668_10335183 Ga0207668_103351832 263
271 3300028381 Ga0268264_10181849 Ga0268264_101818492 263
272 3300050490 nmdc:mga03n38_35023_c1 nmdc:mga03n38_35023_c1_897_1787 263
273 3300005367 Ga0070667_100531654 Ga0070667_1005316541 264
274 3300013105 Ga0157369_10043041 Ga0157369_100430414 264
275 3300028794 Ga0307515_10004403 Ga0307515_1000440319 264
276 3300028794 Ga0307515_10037368 Ga0307515_100373684 264
277 3300030522 Ga0307512_10004835 Ga0307512_100048353 264
278 3300031456 Ga0307513_10001463 Ga0307513_1000146331 264
279 3300031616 Ga0307508_10000746 Ga0307508_1000074613 264
280 3300042184 Ga0450908_001411 Ga0450908_001411_1633_2523 264
281 3300046689 Ga0495613_0208631 Ga0495613_0208631_69_947 264
282 iso_pu_bacteria 2751185734 2753075276 264
283 iso_pu_bacteria 2870721527 2870729365 264
284 3300005436 Ga0070713_100117129 Ga0070713_1001171293 265
285 3300005614 Ga0068856_100469775 Ga0068856_1004697752 265
286 3300006028 Ga0070717_10122055 Ga0070717_101220551 265
287 3300006175 Ga0070712_100121179 Ga0070712_1001211792 265
288 3300013297 Ga0157378_10034741 Ga0157378_100347413 265
289 3300026118 Ga0207675_100185237 Ga0207675_1001852372 265
290 3300028381 Ga0268264_10045199 Ga0268264_100451992 265
291 3300030522 Ga0307512_10032588 Ga0307512_100325885 265
292 3300031456 Ga0307513_10036257 Ga0307513_100362574 265
293 3300031507 Ga0307509_10029137 Ga0307509_100291374 265
294 3300042007 Ga0439449_0083501 Ga0439449_0083501_153_1031 265
295 3300044656 Ga0466969_0040940 Ga0466969_0040940_1074_1955 265
296 3300044693 Ga0466961_0043513 Ga0466961_0043513_1875_2756 265
297 3300045049 Ga0466959_0218072 Ga0466959_0218072_336_1214 265
298 3300046462 Ga0495651_0003257 Ga0495651_0003257_8338_9210 265
299 3300046514 Ga0495618_0006585 Ga0495618_0006585_1705_2577 265
300 3300046516 Ga0495628_0019754 Ga0495628_0019754_1767_2639 265
301 3300046529 Ga0495652_0009656 Ga0495652_0009656_3119_3991 265
302 3300046642 Ga0495634_0097224 Ga0495634_0097224_246_1118 265
303 3300046663 Ga0495635_0008627 Ga0495635_0008627_4550_5422 265
304 3300046679 Ga0495623_0006089 Ga0495623_0006089_4448_5320 265
305 3300046680 Ga0495646_0084850 Ga0495646_0084850_64_936 265
306 3300046809 Ga0495600_0182187 Ga0495600_0182187_86_958 265
307 3300047318 Ga0495636_0000810 Ga0495636_0000810_7001_7882 265
308 3300047443 Ga0495687_009056 Ga0495687_009056_634_1515 265
309 3300048088 Ga0495602_0083550 Ga0495602_0083550_1527_2399 265
310 3300053077 Ga0495601_0005136 Ga0495601_0005136_6629_7501 265
311 3300053078 Ga0495612_0002515 Ga0495612_0002515_5421_6293 265
312 iso_pu_bacteria 2857729791 2857730915 265
313 iso_pu_bacteria 2862993130 2862995212 265
314 iso_pu_bacteria 2928121344 2928122282 265
315 iso_pu_bacteria 2928121344 2928122517 265
316 3300005435 Ga0070714_100194716 Ga0070714_1001947162 266
317 3300005455 Ga0070663_100002529 Ga0070663_1000025298 266
318 3300006048 Ga0075363_100017793 Ga0075363_1000177932 266
319 3300013104 Ga0157370_10272139 Ga0157370_102721392 266
320 3300013104 Ga0157370_10280396 Ga0157370_102803962 266
321 3300025942 Ga0207689_10143456 Ga0207689_101434562 266
322 3300026067 Ga0207678_10000057 Ga0207678_1000005764 266
323 3300035692 Ga0373935_0001950 Ga0373935_0001950_1813_2721 266
324 3300037312 Ga0395899_0002077 Ga0395899_0002077_13312_14199 266
325 3300037418 Ga0395900_0177717 Ga0395900_0177717_891_1778 266
326 3300041452 Ga0451793_1147289 Ga0451793_1147289_291_1154 266
327 3300044658 Ga0466972_0010681 Ga0466972_0010681_2446_3303 266
328 3300044684 Ga0466966_0016186 Ga0466966_0016186_3286_4170 266
329 3300044719 Ga0466971_0029535 Ga0466971_0029535_500_1384 266
330 3300045049 Ga0466959_0001924 Ga0466959_0001924_7722_8606 266
331 3300045836 Ga0466958_0041077 Ga0466958_0041077_80_964 266
332 3300047447 Ga0495685_033926 Ga0495685_033926_425_1330 266
333 3300048909 Ga0496106_0034861 Ga0496106_0034861_1005_1850 266
334 iso_pu_bacteria 2675903060 2676493253 266
335 iso_pu_bacteria 2857729791 2857731148 266
336 iso_pu_bacteria 2990044586 2990044662 266
337 3300013105 Ga0157369_10027187 Ga0157369_100271873 267
338 3300031901 Ga0307406_10000115 Ga0307406_100001153 267
339 3300032126 Ga0307415_100089198 Ga0307415_1000891982 267
340 3300044684 Ga0466966_0004721 Ga0466966_0004721_2580_3473 267
341 3300044693 Ga0466961_0021132 Ga0466961_0021132_2347_3240 267
342 3300044719 Ga0466971_0010058 Ga0466971_0010058_2609_3502 267
343 3300045049 Ga0466959_0158779 Ga0466959_0158779_138_1031 267
344 3300061719 Ga0466962_0111603 Ga0466962_0111603_254_1147 267
345 iso_pu_bacteria 2758568522 2760303220 267
346 iso_pu_bacteria 2939657138 2939659985 267
347 3300009148 Ga0105243_10394335 Ga0105243_103943351 268
348 3300009177 Ga0105248_10706662 Ga0105248_107066622 268
349 3300009551 Ga0105238_10240753 Ga0105238_102407532 268
350 3300010375 Ga0105239_10495921 Ga0105239_104959212 268
351 3300013306 Ga0163162_10539534 Ga0163162_105395342 268
352 3300025929 Ga0207664_10010108 Ga0207664_100101086 268
353 3300026067 Ga0207678_10341324 Ga0207678_103413242 268
354 3300047315 Ga0495581_0113725 Ga0495581_0113725_439_1317 268
355 3300048911 Ga0496108_0000015 Ga0496108_0000015_170547_171443 268
356 3300048917 Ga0496114_0010822 Ga0496114_0010822_3887_4765 268
357 iso_pu_bacteria 2643221616 2644094400 268
358 iso_pu_bacteria 2739367654 2739604547 268
359 iso_pu_bacteria 2808606394 2809027718 268
360 iso_pu_bacteria 2868088558 2868093559 268
361 iso_pu_bacteria 2895427314 2895430680 268
362 iso_pu_bacteria 2977251589 2977253055 268
363 3300003203 JGI25406J46586_10020748 JGI25406J46586_100207482 269
364 3300003323 rootH1_10041099 rootH1_100410993 269
365 3300005347 Ga0070668_100008412 Ga0070668_1000084125 269
366 3300005437 Ga0070710_10000347 Ga0070710_1000034714 269
367 3300005548 Ga0070665_100518515 Ga0070665_1005185151 269
368 3300005985 Ga0081539_10002529 Ga0081539_1000252921 269
369 3300006846 Ga0075430_100003000 Ga0075430_1000030008 269
370 3300006847 Ga0075431_100015982 Ga0075431_1000159823 269
371 3300006880 Ga0075429_100000494 Ga0075429_10000049420 269
372 3300013105 Ga0157369_10020878 Ga0157369_100208783 269
373 3300025898 Ga0207692_10001270 Ga0207692_100012706 269
374 3300028794 Ga0307515_10019161 Ga0307515_1001916110 269
375 3300028794 Ga0307515_10089723 Ga0307515_100897233 269
376 3300030522 Ga0307512_10002105 Ga0307512_1000210518 269
377 3300030522 Ga0307512_10004222 Ga0307512_100042222 269
378 3300030731 Ga0316177_1007692 Ga0316177_10076922 269
379 3300030732 Ga0316176_1054292 Ga0316176_10542923 269
380 3300030736 Ga0316180_1169781 Ga0316180_11697812 269
381 3300031548 Ga0307408_100089169 Ga0307408_1000891692 269
382 3300031616 Ga0307508_10067173 Ga0307508_100671732 269
383 3300031730 Ga0307516_10000177 Ga0307516_1000017730 269
384 3300031730 Ga0307516_10191573 Ga0307516_101915732 269
385 3300031731 Ga0307405_10022393 Ga0307405_100223933 269
386 3300031824 Ga0307413_10046803 Ga0307413_100468032 269
387 3300031852 Ga0307410_10210276 Ga0307410_102102761 269
388 3300031903 Ga0307407_10017144 Ga0307407_100171442 269
389 3300031995 Ga0307409_100000181 Ga0307409_10000018116 269
390 3300032126 Ga0307415_100000148 Ga0307415_10000014819 269
391 3300032126 Ga0307415_100086027 Ga0307415_1000860272 269
392 3300032126 Ga0307415_100136665 Ga0307415_1001366652 269
393 3300041460 Ga0451802_1239871 Ga0451802_1239871_106_1005 269
394 3300041491 Ga0451833_0615816 Ga0451833_0615816_333_1226 269
395 3300046689 Ga0495613_0080950 Ga0495613_0080950_1106_2002 269
396 3300046694 Ga0495649_0086137 Ga0495649_0086137_85_990 269
397 3300048917 Ga0496114_0110597 Ga0496114_0110597_971_1891 269
398 3300048921 Ga0496118_0076100 Ga0496118_0076100_1208_2116 269
399 3300049568 Ga0501031_0001193 Ga0501031_0001193_7586_8491 269
400 3300049569 Ga0501032_0064028 Ga0501032_0064028_871_1776 269
401 3300049569 Ga0501032_0080971 Ga0501032_0080971_679_1605 269
402 3300049570 Ga0501033_0011940 Ga0501033_0011940_3950_4855 269
403 3300049571 Ga0501034_0004272 Ga0501034_0004272_7351_8256 269
404 3300049571 Ga0501034_0021972 Ga0501034_0021972_990_1916 269
405 3300049572 Ga0501036_0054086 Ga0501036_0054086_908_1834 269
406 3300049572 Ga0501036_0063142 Ga0501036_0063142_1973_2878 269
407 3300049573 Ga0501037_0001575 Ga0501037_0001575_5419_6324 269
408 3300049574 Ga0501038_0014929 Ga0501038_0014929_259_1164 269
409 3300049574 Ga0501038_0076202 Ga0501038_0076202_1594_2520 269
410 3300049575 Ga0501039_0076474 Ga0501039_0076474_1112_2017 269
411 3300049576 Ga0501040_0025318 Ga0501040_0025318_1973_2878 269
412 3300049577 Ga0501041_0012595 Ga0501041_0012595_2124_3029 269
413 3300049578 Ga0501042_0000296 Ga0501042_0000296_18073_18975 269
414 3300049578 Ga0501042_0065215 Ga0501042_0065215_1112_2017 269
415 3300049579 Ga0501043_0004901 Ga0501043_0004901_2553_3458 269
416 3300049580 Ga0501046_0007535 Ga0501046_0007535_4936_5841 269
417 3300049581 Ga0501047_0003044 Ga0501047_0003044_12705_13610 269
418 3300049581 Ga0501047_0029479 Ga0501047_0029479_1460_2386 269
419 3300049582 Ga0501048_0013876 Ga0501048_0013876_131_1036 269
420 3300049583 Ga0501067_0020963 Ga0501067_0020963_2560_3465 269
421 3300049584 Ga0501068_0077821 Ga0501068_0077821_714_1619 269
422 3300049586 Ga0501070_0015332 Ga0501070_0015332_1769_2695 269
423 3300049586 Ga0501070_0207527 Ga0501070_0207527_151_1056 269
424 3300049587 Ga0501071_0023537 Ga0501071_0023537_2956_3861 269
425 3300049588 Ga0501072_0001837 Ga0501072_0001837_7565_8470 269
426 3300049589 Ga0501073_0095404 Ga0501073_0095404_49_954 269
427 3300049590 Ga0501074_0018140 Ga0501074_0018140_2425_3330 269
428 3300049593 Ga0501077_0008026 Ga0501077_0008026_4669_5574 269
429 3300049741 Ga0501079_0053821 Ga0501079_0053821_418_1323 269
430 3300049742 Ga0501080_0131575 Ga0501080_0131575_586_1491 269
431 3300049744 Ga0501083_0000059 Ga0501083_0000059_59924_60826 269
432 3300049744 Ga0501083_0010196 Ga0501083_0010196_40_945 269
433 3300049822 Ga0501035_0003230 Ga0501035_0003230_7359_8264 269
434 3300049822 Ga0501035_0259169 Ga0501035_0259169_160_1062 269
435 3300049823 Ga0501044_0006899 Ga0501044_0006899_4239_5144 269
436 3300049823 Ga0501044_0119640 Ga0501044_0119640_1461_2387 269
437 3300050490 nmdc:mga03n38_19253_c1 nmdc:mga03n38_19253_c1_331_1236 269
438 3300053090 Ga0500646_0000964 Ga0500646_0000964_5771_6673 269
439 3300053093 Ga0500651_0040400 Ga0500651_0040400_1940_2803 269
440 3300053098 Ga0500650_0019304 Ga0500650_0019304_468_1346 269
441 3300053098 Ga0500650_0024343 Ga0500650_0024343_1320_2183 269
442 3300053101 Ga0500553_012772 Ga0500553_012772_994_1890 269
443 3300053118 Ga0500594_0026135 Ga0500594_0026135_150_1013 269
444 3300053140 Ga0500573_0053550 Ga0500573_0053550_1388_2290 269
445 3300053142 Ga0500577_0098771 Ga0500577_0098771_153_1031 269
446 3300054114 Ga0501084_0039374 Ga0501084_0039374_1267_2172 269
447 3300060353 Ga0501082_0013965 Ga0501082_0013965_826_1731 269
448 iso_pu_bacteria 2643221714 2644627623 269
449 iso_pu_bacteria 2751185782 2753270823 269
450 iso_pu_bacteria 2877676314 2877684813 269
451 3300005842 Ga0068858_100175704 Ga0068858_1001757041 270
452 3300015688 Ga0183367_1004 Ga0183367_1004614 270
453 3300026067 Ga0207678_10149131 Ga0207678_101491311 270
454 3300028800 Ga0265338_10135552 Ga0265338_101355522 270
455 3300031507 Ga0307509_10051308 Ga0307509_100513083 270
456 3300031730 Ga0307516_10157400 Ga0307516_101574002 270
457 3300031995 Ga0307409_100764783 Ga0307409_1007647831 270
458 3300033179 Ga0307507_10022239 Ga0307507_100222394 270
459 3300033180 Ga0307510_10236896 Ga0307510_102368962 270
460 3300044658 Ga0466972_0042953 Ga0466972_0042953_507_1397 270
461 3300046459 Ga0495629_0061340 Ga0495629_0061340_1422_2315 270
462 3300046543 Ga0495645_0069544 Ga0495645_0069544_594_1478 270
463 3300047444 Ga0495675_0106594 Ga0495675_0106594_813_1697 270
464 3300048914 Ga0496111_0001649 Ga0496111_0001649_830_1723 270
465 3300048920 Ga0496117_0000196 Ga0496117_0000196_79948_80844 270
466 3300048922 Ga0496119_0115980 Ga0496119_0115980_343_1239 270
467 3300048928 Ga0496125_0049348 Ga0496125_0049348_1546_2442 270
468 3300048929 Ga0496126_0057078 Ga0496126_0057078_2123_3001 270
469 3300048929 Ga0496126_0060344 Ga0496126_0060344_352_1248 270
470 3300053094 Ga0500566_0109140 Ga0500566_0109140_128_1021 270
471 3300053100 Ga0500660_039133 Ga0500660_039133_1283_2176 270
472 iso_pu_bacteria 2547132111 2547408736 270
473 iso_pu_bacteria 2616644814 2616693426 270
474 iso_pu_bacteria 2643221678 2644441947 270
475 iso_pu_bacteria 2643221714 2644630630 270
476 iso_pu_bacteria 2738541272 2738697470 270
477 iso_pu_bacteria 2738543027 2739328067 270
478 iso_pu_bacteria 2784746763 2785346646 270
479 iso_pu_bacteria 2808606359 2808847014 270
480 iso_pu_bacteria 2808606375 2808917726 270
481 iso_pu_bacteria 2811994879 2812361332 270
482 iso_pu_bacteria 2811994917 2812477336 270
483 iso_pu_bacteria 2852635781 2852639269 270
484 iso_pu_bacteria 2862281513 2862282516 270
485 iso_pu_bacteria 2862382967 2862388130 270
486 iso_pu_bacteria 2863404153 2863408163 270
487 iso_pu_bacteria 2919468124 2919470104 270
488 iso_pu_bacteria 2939660829 2939663578 270
489 iso_pu_bacteria 2946064051 2946064757 270
490 iso_pu_bacteria 2946072368 2946073123 270
491 iso_pu_bacteria 2947224130 2947224717 270
492 iso_pu_bacteria 2990059506 2990065738 270
493 iso_pu_bacteria 3006493962 3006498392 270
494 iso_pu_bacteria 8008558824 8008560505 270
495 iso_pu_bacteria 8008574985 8008581298 270
496 iso_pu_bacteria 8048406513 8048413937 270
497 3300005327 Ga0070658_10029441 Ga0070658_100294412 271
498 3300005435 Ga0070714_100107991 Ga0070714_1001079913 271
499 3300005436 Ga0070713_100049127 Ga0070713_1000491273 271
500 3300005436 Ga0070713_100427765 Ga0070713_1004277652 271
501 3300005439 Ga0070711_100242187 Ga0070711_1002421872 271
502 3300005530 Ga0070679_100110853 Ga0070679_1001108531 271
503 3300005614 Ga0068856_100321322 Ga0068856_1003213222 271
504 3300025898 Ga0207692_10030878 Ga0207692_100308782 271
505 3300025909 Ga0207705_10258415 Ga0207705_102584152 271
506 3300025915 Ga0207693_10001642 Ga0207693_100016422 271
507 3300025916 Ga0207663_10147136 Ga0207663_101471362 271
508 3300025921 Ga0207652_10578466 Ga0207652_105784661 271
509 3300025928 Ga0207700_10017247 Ga0207700_100172472 271
510 3300025929 Ga0207664_10016938 Ga0207664_100169384 271
511 3300025929 Ga0207664_10061056 Ga0207664_100610562 271
512 3300026067 Ga0207678_10009503 Ga0207678_100095032 271
513 3300028556 Ga0265337_1001738 Ga0265337_10017384 271
514 3300028558 Ga0265326_10002457 Ga0265326_100024574 271
515 3300028563 Ga0265319_1004500 Ga0265319_10045002 271
516 3300028573 Ga0265334_10000913 Ga0265334_100009138 271
517 3300028577 Ga0265318_10009741 Ga0265318_100097412 271
518 3300028653 Ga0265323_10001725 Ga0265323_1000172510 271
519 3300028666 Ga0265336_10001366 Ga0265336_100013666 271
520 3300028786 Ga0307517_10006227 Ga0307517_100062274 271
521 3300028794 Ga0307515_10002799 Ga0307515_1000279919 271
522 3300028800 Ga0265338_10006593 Ga0265338_100065935 271
523 3300029957 Ga0265324_10005341 Ga0265324_100053413 271
524 3300031240 Ga0265320_10007956 Ga0265320_100079566 271
525 3300031241 Ga0265325_10010420 Ga0265325_100104202 271
526 3300031247 Ga0265340_10003865 Ga0265340_100038654 271
527 3300031249 Ga0265339_10071730 Ga0265339_100717302 271
528 3300031507 Ga0307509_10182643 Ga0307509_101826432 271
529 3300031711 Ga0265314_10012450 Ga0265314_100124503 271
530 3300031712 Ga0265342_10007950 Ga0265342_100079506 271
531 3300031730 Ga0307516_10000894 Ga0307516_100008943 271
532 3300031730 Ga0307516_10014914 Ga0307516_100149144 271
533 3300031730 Ga0307516_10015544 Ga0307516_100155444 271
534 3300031731 Ga0307405_10005419 Ga0307405_100054192 271
535 3300031901 Ga0307406_10097764 Ga0307406_100977641 271
536 3300031911 Ga0307412_10009796 Ga0307412_100097963 271
537 3300032126 Ga0307415_100028775 Ga0307415_1000287753 271
538 3300035091 Ga0373951_0000300 Ga0373951_0000300_150_1058 271
539 3300037068 Ga0373925_0000237 Ga0373925_0000237_41356_42270 271
540 3300046454 Ga0495592_0045059 Ga0495592_0045059_1238_2128 271
541 3300046462 Ga0495651_0033826 Ga0495651_0033826_31_921 271
542 3300046472 Ga0495580_0047232 Ga0495580_0047232_211_1101 271
543 3300046476 Ga0495662_0003828 Ga0495662_0003828_2159_3049 271
544 3300046477 Ga0495664_0007836 Ga0495664_0007836_574_1464 271
545 3300046492 Ga0495585_0031771 Ga0495585_0031771_198_1094 271
546 3300046501 Ga0495607_0113750 Ga0495607_0113750_319_1215 271
547 3300046517 Ga0495630_0104908 Ga0495630_0104908_31_921 271
548 3300046519 Ga0495632_0072667 Ga0495632_0072667_719_1615 271
549 3300046522 Ga0495643_0002935 Ga0495643_0002935_9788_10684 271
550 3300046526 Ga0495666_0006788 Ga0495666_0006788_4550_5440 271
551 3300046529 Ga0495652_0204773 Ga0495652_0204773_574_1464 271
552 3300046531 Ga0495665_0002200 Ga0495665_0002200_1154_2044 271
553 3300046533 Ga0495640_0020815 Ga0495640_0020815_73_963 271
554 3300046535 Ga0495586_0027310 Ga0495586_0027310_1204_2094 271
555 3300046543 Ga0495645_0010711 Ga0495645_0010711_2156_3046 271
556 3300046642 Ga0495634_0107028 Ga0495634_0107028_466_1356 271
557 3300046663 Ga0495635_0167526 Ga0495635_0167526_574_1464 271
558 3300046675 Ga0495657_0015799 Ga0495657_0015799_4544_5434 271
559 3300046678 Ga0495599_0158290 Ga0495599_0158290_84_974 271
560 3300046680 Ga0495646_0098165 Ga0495646_0098165_84_974 271
561 3300046691 Ga0495670_0022512 Ga0495670_0022512_195_1091 271
562 3300046794 Ga0495589_0110718 Ga0495589_0110718_366_1262 271
563 3300046809 Ga0495600_0017817 Ga0495600_0017817_31_921 271
564 3300047315 Ga0495581_0056132 Ga0495581_0056132_266_1156 271
565 3300047317 Ga0495604_0120447 Ga0495604_0120447_980_1870 271
566 3300047319 Ga0495674_0019544 Ga0495674_0019544_3735_4625 271
567 3300047322 Ga0495680_0056712 Ga0495680_0056712_1127_2029 271
568 3300047444 Ga0495675_0140921 Ga0495675_0140921_574_1464 271
569 3300047447 Ga0495685_000242 Ga0495685_000242_13516_14412 271
570 3300047470 Ga0495681_0005889 Ga0495681_0005889_6831_7727 271
571 3300048088 Ga0495602_0107030 Ga0495602_0107030_31_921 271
572 3300048929 Ga0496126_0054784 Ga0496126_0054784_1165_2079 271
573 3300053080 Ga0500635_0000073 Ga0500635_0000073_39393_40280 271
574 3300053107 Ga0500560_010272 Ga0500560_010272_564_1460 271
575 3300053109 Ga0500569_003761 Ga0500569_003761_2081_2977 271
576 3300053131 Ga0500652_001575 Ga0500652_001575_1020_1916 271
577 3300053137 Ga0500561_0000242 Ga0500561_0000242_249_1145 271
578 3300053143 Ga0500579_072281 Ga0500579_072281_72_968 271
579 3300053160 Ga0500633_0000857 Ga0500633_0000857_464_1360 271
580 iso_pu_bacteria 2643221542 2643733108 271
581 iso_pu_bacteria 2643221613 2644083928 271
582 iso_pu_bacteria 2643221630 2644171895 271
583 iso_pu_bacteria 2643221721 2644666806 271
584 iso_pu_bacteria 2816332139 2816508546 271
585 iso_pu_bacteria 2935890801 2935894795 271
586 3300031730 Ga0307516_10019656 Ga0307516_100196564 272
587 3300031730 Ga0307516_10024519 Ga0307516_100245194 272
588 3300031730 Ga0307516_10084527 Ga0307516_100845273 272
589 3300032002 Ga0307416_100059910 Ga0307416_1000599101 272
590 3300049571 Ga0501034_0118142 Ga0501034_0118142_1591_2460 272
591 3300053140 Ga0500573_0070041 Ga0500573_0070041_550_1449 272
592 iso_pu_bacteria 2643221572 2643876793 272
593 iso_pu_bacteria 2643221669 2644383848 272
594 iso_pu_bacteria 2964326757 2964327788 272
595 3300005288 Ga0065714_10003307 Ga0065714_100033074 273
596 3300025735 Ga0207713_1042807 Ga0207713_10428072 273
597 3300028794 Ga0307515_10029984 Ga0307515_100299843 273
598 3300041997 Ga0439431_0024570 Ga0439431_0024570_511_1407 273
599 3300046507 Ga0495606_0001231 Ga0495606_0001231_6276_7157 273
600 3300046616 Ga0495668_0000326 Ga0495668_0000326_39704_40585 273
601 3300046660 Ga0495625_0000770 Ga0495625_0000770_27819_28700 273
602 3300048091 Ga0495626_0000046 Ga0495626_0000046_39253_40134 273
603 3300048911 Ga0496108_0050673 Ga0496108_0050673_2264_3169 273
604 3300048912 Ga0496109_0022352 Ga0496109_0022352_874_1779 273
605 3300053090 Ga0500646_0000134 Ga0500646_0000134_18718_19593 273
606 iso_pu_bacteria 2808606368 2808884940 273
607 iso_pu_bacteria 2808606372 2808900756 273
608 iso_pu_bacteria 2862993130 2862993407 273
609 iso_pu_bacteria 2887443736 2887445747 273
610 iso_pu_bacteria 2935409751 2935411829 273
611 iso_pu_bacteria 8016254467 8016256521 273
612 3300001989 JGI24739J22299_10018856 JGI24739J22299_100188562 274
613 3300003316 rootH1_10016398 rootH1_1001639817 274
614 3300003322 rootL2_10187667 rootL2_101876672 274
615 3300003323 rootH1_10061199 rootH1_100611992 274
616 3300003578 Ga0006562J51391_1136929 Ga0006562J51391_11369291 274
617 3300005563 Ga0068855_100338767 Ga0068855_1003387672 274
618 3300006178 Ga0075367_10000224 Ga0075367_1000022418 274
619 3300009148 Ga0105243_10237872 Ga0105243_102378722 274
620 3300015688 Ga0183367_1003 Ga0183367_1003512 274
621 3300025949 Ga0207667_10418265 Ga0207667_104182652 274
622 3300028794 Ga0307515_10109953 Ga0307515_101099534 274
623 3300030522 Ga0307512_10006577 Ga0307512_100065775 274
624 3300030522 Ga0307512_10204837 Ga0307512_102048372 274
625 3300031548 Ga0307408_100116272 Ga0307408_1001162722 274
626 3300031616 Ga0307508_10108473 Ga0307508_101084732 274
627 3300031649 Ga0307514_10215513 Ga0307514_102155131 274
628 3300031903 Ga0307407_10008833 Ga0307407_100088334 274
629 3300031911 Ga0307412_10014019 Ga0307412_100140193 274
630 3300031911 Ga0307412_10187559 Ga0307412_101875592 274
631 3300031995 Ga0307409_100052591 Ga0307409_1000525912 274
632 3300032005 Ga0307411_10485742 Ga0307411_104857422 274
633 3300033179 Ga0307507_10058272 Ga0307507_100582722 274
634 3300041404 Ga0439436_0001148 Ga0439436_0001148_4349_5254 274
635 3300041404 Ga0439436_0008662 Ga0439436_0008662_1779_2687 274
636 3300041512 Ga0451853_1338476 Ga0451853_1338476_192_1097 274
637 3300041999 Ga0439433_0003978 Ga0439433_0003978_1832_2740 274
638 3300042007 Ga0439449_0000771 Ga0439449_0000771_9748_10653 274
639 3300042014 Ga0439457_004083 Ga0439457_004083_2034_2939 274
640 3300042014 Ga0439457_005509 Ga0439457_005509_209_1117 274
641 3300042135 Ga0450899_000219 Ga0450899_000219_160_1065 274
642 3300042145 Ga0450906_000627 Ga0450906_000627_1258_2163 274
643 3300044656 Ga0466969_0056891 Ga0466969_0056891_766_1671 274
644 3300044658 Ga0466972_0006665 Ga0466972_0006665_1533_2438 274
645 3300044684 Ga0466966_0083890 Ga0466966_0083890_833_1738 274
646 3300044694 Ga0466963_0048625 Ga0466963_0048625_970_1875 274
647 3300044765 Ga0466970_0009236 Ga0466970_0009236_3319_4224 274
648 3300045976 Ga0466967_0017950 Ga0466967_0017950_1443_2348 274
649 3300045976 Ga0466967_0301368 Ga0466967_0301368_148_1053 274
650 3300046454 Ga0495592_0133773 Ga0495592_0133773_259_1164 274
651 3300046455 Ga0495603_0021643 Ga0495603_0021643_942_1847 274
652 3300046457 Ga0495590_0016035 Ga0495590_0016035_1299_2204 274
653 3300046460 Ga0495638_0079450 Ga0495638_0079450_1067_1972 274
654 3300046462 Ga0495651_0029755 Ga0495651_0029755_621_1526 274
655 3300046473 Ga0495582_0049263 Ga0495582_0049263_64_969 274
656 3300046474 Ga0495605_0034529 Ga0495605_0034529_594_1499 274
657 3300046475 Ga0495639_0026750 Ga0495639_0026750_1120_2025 274
658 3300046476 Ga0495662_0003692 Ga0495662_0003692_34_939 274
659 3300046476 Ga0495662_0173284 Ga0495662_0173284_88_996 274
660 3300046491 Ga0495584_0031304 Ga0495584_0031304_1093_1998 274
661 3300046499 Ga0495594_0034005 Ga0495594_0034005_529_1434 274
662 3300046500 Ga0495596_0071119 Ga0495596_0071119_301_1206 274
663 3300046501 Ga0495607_0036881 Ga0495607_0036881_1048_1953 274
664 3300046511 Ga0495608_0186169 Ga0495608_0186169_241_1146 274
665 3300046518 Ga0495631_0010398 Ga0495631_0010398_1111_2016 274
666 3300046522 Ga0495643_0001005 Ga0495643_0001005_15451_16356 274
667 3300046524 Ga0495648_0033077 Ga0495648_0033077_1529_2434 274
668 3300046533 Ga0495640_0056304 Ga0495640_0056304_566_1471 274
669 3300046535 Ga0495586_0151419 Ga0495586_0151419_85_990 274
670 3300046542 Ga0495597_0020741 Ga0495597_0020741_1101_2006 274
671 3300046543 Ga0495645_0254828 Ga0495645_0254828_90_995 274
672 3300046557 Ga0495622_0002951 Ga0495622_0002951_4559_5464 274
673 3300046559 Ga0495667_0169543 Ga0495667_0169543_312_1217 274
674 3300046615 Ga0495656_0037051 Ga0495656_0037051_441_1346 274
675 3300046616 Ga0495668_0029493 Ga0495668_0029493_755_1660 274
676 3300046648 Ga0495611_0059195 Ga0495611_0059195_11_916 274
677 3300046663 Ga0495635_0130323 Ga0495635_0130323_676_1581 274
678 3300046665 Ga0495661_0012847 Ga0495661_0012847_418_1323 274
679 3300046674 Ga0495588_0016895 Ga0495588_0016895_771_1676 274
680 3300046675 Ga0495657_0006945 Ga0495657_0006945_596_1501 274
681 3300046679 Ga0495623_0095528 Ga0495623_0095528_568_1473 274
682 3300046689 Ga0495613_0089386 Ga0495613_0089386_330_1235 274
683 3300046694 Ga0495649_0135954 Ga0495649_0135954_86_991 274
684 3300046794 Ga0495589_0032224 Ga0495589_0032224_1645_2550 274
685 3300046809 Ga0495600_0047332 Ga0495600_0047332_109_1014 274
686 3300046809 Ga0495600_0109113 Ga0495600_0109113_232_1137 274
687 3300046810 Ga0495660_0098336 Ga0495660_0098336_11_916 274
688 3300046810 Ga0495660_0106479 Ga0495660_0106479_51_956 274
689 3300047317 Ga0495604_0003240 Ga0495604_0003240_915_1823 274
690 3300047320 Ga0495672_0074703 Ga0495672_0074703_597_1502 274
691 3300047321 Ga0495676_0035431 Ga0495676_0035431_1396_2301 274
692 3300047321 Ga0495676_0140495 Ga0495676_0140495_449_1354 274
693 3300047322 Ga0495680_0003794 Ga0495680_0003794_11228_12133 274
694 3300047444 Ga0495675_0021539 Ga0495675_0021539_2316_3224 274
695 3300047444 Ga0495675_0154443 Ga0495675_0154443_64_969 274
696 3300047445 Ga0495677_0036933 Ga0495677_0036933_644_1549 274
697 3300047472 Ga0495686_0087210 Ga0495686_0087210_886_1791 274
698 3300047673 Ga0495593_0033683 Ga0495593_0033683_574_1479 274
699 3300048091 Ga0495626_0012892 Ga0495626_0012892_2256_3161 274
700 3300048908 Ga0496105_0341285 Ga0496105_0341285_270_1175 274
701 3300049459 Ga0495678_016992 Ga0495678_016992_707_1612 274
702 3300049460 Ga0495682_0026202 Ga0495682_0026202_822_1727 274
703 3300049586 Ga0501070_0091682 Ga0501070_0091682_1416_2321 274
704 3300050494 nmdc:mga06z11_688_c1 nmdc:mga06z11_688_c1_5397_6302 274
705 iso_pu_bacteria 2582581313 2585307981 274
706 iso_pu_bacteria 2643221553 2643784599 274
707 iso_pu_bacteria 2643221724 2644678221 274
708 iso_pu_bacteria 2728369380 2730231238 274
709 iso_pu_bacteria 2747842429 2747954674 274
710 iso_pu_bacteria 2862705112 2862707611 274
711 iso_pu_bacteria 2919443155 2919445306 274
712 iso_pu_bacteria 2995463766 2995467568 274
713 iso_pu_bacteria 8008485437 8008489776 274
714 iso_pu_bacteria 8025524527 8025528648 274
715 3300031901 Ga0307406_10000119 Ga0307406_100001197 275
716 3300044658 Ga0466972_0030850 Ga0466972_0030850_1186_2103 275
717 3300044683 Ga0466965_0010777 Ga0466965_0010777_3177_4094 275
718 3300044684 Ga0466966_0022480 Ga0466966_0022480_2668_3585 275
719 3300044693 Ga0466961_0032710 Ga0466961_0032710_1442_2359 275
720 3300044842 Ga0466957_0029701 Ga0466957_0029701_1234_2151 275
721 3300044901 Ga0466960_0005654 Ga0466960_0005654_1794_2711 275
722 3300045049 Ga0466959_0028567 Ga0466959_0028567_1655_2572 275
723 3300045836 Ga0466958_0009839 Ga0466958_0009839_295_1212 275
724 3300049568 Ga0501031_0073104 Ga0501031_0073104_1284_2219 275
725 3300053096 Ga0500641_0124053 Ga0500641_0124053_46_942 275
726 3300053146 Ga0500588_0012392 Ga0500588_0012392_465_1361 275
727 3300053160 Ga0500633_0013918 Ga0500633_0013918_1223_2119 275
728 3300061719 Ga0466962_0012818 Ga0466962_0012818_1279_2196 275
729 iso_pu_bacteria 2643221635 2644199339 275
730 3300005367 Ga0070667_100635003 Ga0070667_1006350031 276
731 3300025986 Ga0207658_10232424 Ga0207658_102324242 276
732 3300031901 Ga0307406_10114537 Ga0307406_101145371 276
733 3300031911 Ga0307412_10038248 Ga0307412_100382482 276
734 3300032004 Ga0307414_10008517 Ga0307414_100085172 276
735 3300046506 Ga0495583_0063735 Ga0495583_0063735_172_1092 276
736 3300047443 Ga0495687_003222 Ga0495687_003222_3329_4249 276
737 3300047447 Ga0495685_008162 Ga0495685_008162_2045_2965 276
738 3300049822 Ga0501035_0007647 Ga0501035_0007647_6350_7273 276
739 iso_pu_bacteria 2862281513 2862283824 276
740 iso_pu_bacteria 2919443155 2919446761 276
741 3300046543 Ga0495645_0012052 Ga0495645_0012052_639_1589 277
742 3300047318 Ga0495636_0008279 Ga0495636_0008279_2191_3126 277
743 iso_pu_bacteria 2808606447 2809225616 277
744 iso_pu_bacteria 2852632344 2852635536 277
745 iso_pu_bacteria 2895660088 2895662322 277
746 iso_pu_bacteria 2895660088 2895663140 277
747 iso_pu_bacteria 2966924647 2966925727 277
748 3300005455 Ga0070663_100002487 Ga0070663_1000024876 278
749 3300005937 Ga0081455_10015011 Ga0081455_100150113 278
750 3300026067 Ga0207678_10003078 Ga0207678_100030786 278
751 3300046660 Ga0495625_0070625 Ga0495625_0070625_1116_2045 278
752 3300047447 Ga0495685_007723 Ga0495685_007723_222_1151 278
753 iso_pu_bacteria 2784746768 2785374287 278
754 iso_pu_bacteria 2946072368 2946079300 278
755 iso_pu_bacteria 2977264416 2977264515 278
756 3300003752 Ga0055539_1002865 Ga0055539_10028653 279
757 3300013307 Ga0157372_10172262 Ga0157372_101722622 279
758 3300020081 Ga0206354_11401955 Ga0206354_114019552 279
759 3300020082 Ga0206353_11206199 Ga0206353_1120619918 279
760 3300025253 Ga0209677_100513 Ga0209677_10051316 279
761 3300037312 Ga0395899_0000833 Ga0395899_0000833_20230_21165 279
762 3300037466 Ga0395898_0116450 Ga0395898_0116450_939_1874 279
763 3300038443 Ga0395901_0273843 Ga0395901_0273843_783_1718 279
764 3300044765 Ga0466970_0000635 Ga0466970_0000635_15344_16264 279
765 iso_pu_bacteria 2643221572 2643877487 279
766 iso_pu_bacteria 2643221669 2644384542 279
767 3300046455 Ga0495603_0010543 Ga0495603_0010543_22_957 280
768 3300046459 Ga0495629_0014032 Ga0495629_0014032_1033_1968 280
769 3300046499 Ga0495594_0045402 Ga0495594_0045402_910_1845 280
770 3300046557 Ga0495622_0071851 Ga0495622_0071851_595_1530 280
771 3300046648 Ga0495611_0099992 Ga0495611_0099992_242_1177 280
772 3300047321 Ga0495676_0064778 Ga0495676_0064778_1022_1957 280
773 3300025261 Ga0209233_1031932 Ga0209233_10319322 281
774 3300046689 Ga0495613_0155554 Ga0495613_0155554_588_1496 281
775 iso_pu_bacteria 2935409751 2935411640 281
776 3300001989 JGI24739J22299_10013390 JGI24739J22299_100133901 282
777 3300009148 Ga0105243_10113361 Ga0105243_101133613 282
778 3300025904 Ga0207647_10096604 Ga0207647_100966043 282
779 3300025935 Ga0207709_10175179 Ga0207709_101751792 282
780 3300042138 Ga0450903_003756 Ga0450903_003756_242_1135 282
781 3300042157 Ga0439458_0037620 Ga0439458_0037620_61_954 282
782 iso_pu_bacteria 2811994878 2812352076 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

128

312

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8513 22 282
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8501 22 275
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8428 19 273
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8317 19 282
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8163 12 271
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9331 19 271 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9284 19 269 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9084 19 271 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8976 19 270 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8936 19 271 1.10.3720.10
ID Description Score Start End GO Terms
AF-L8EMI2-F1-model_v4 deleted 0.9701 86 280
AF-F3ZK38-F1-model_v4 Putative ABC transporter permease protein 0.9666 35 282 GO:0005886
GO:0055085
AF-A0A6I5CRJ2-F1-model_v4 ABC transporter permease subunit 0.966 76 282 GO:0005886
GO:0055085
AF-A0A3M2JH75-F1-model_v4 Carbohydrate ABC transporter permease 0.9642 21 282 GO:0005886
GO:0055085
AF-A0A4V2XQX3-F1-model_v4 Carbohydrate ABC transporter permease 0.9625 31 279 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
87.79 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map