F480569

General Info

Members Datasets Scaffolds Average Seq Length
781 445 1562 150

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0123048|Ga0395899_0123048_310_789
Length 159
Sequence MTAPRVAQPRLVVDFDKLLTMAGADLGATDWLEITQDRVNLFADATDDHQWIHVDPERAKDGPFGAPIAHGFLTLSLLIPFWGELFDVEGVTTKVNYGLDRVRFTSPVKVGSKVRMLGQIAEVSEVKGAGAQIKVNATIEIEGQERPAVVAEFLARFYK

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
122 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
123 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
124 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
133 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
139 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
140 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
141 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
142 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
143 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
144 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
145 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
146 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
147 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
250 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
328 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
329 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
332 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
337 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
338 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
339 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
340 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
341 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
342 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
343 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
344 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
345 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
346 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
347 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
348 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
349 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
350 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
351 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
354 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
355 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
356 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
359 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
360 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
361 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
362 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
368 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
369 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
370 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
371 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
372 2643221597 Microbacterium sp. Root180 Isolate Unclassified
373 2643221647 Streptomyces sp. Root369 Isolate Unclassified
374 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
375 2643221714 Streptomyces sp. Root264 Isolate Unclassified
376 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
377 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
378 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
379 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
380 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
381 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
382 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
383 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
384 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
385 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
386 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
387 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
388 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
389 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
390 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
391 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
392 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
393 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
394 2862574272 Streptomyces sp. AcE210 Isolate Nodule
395 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
396 2867428634 Streptomyces sp. RP5T Isolate Unclassified
397 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
398 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
399 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
400 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
401 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
402 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
403 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
404 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
405 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
406 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
407 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
408 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
409 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
410 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
411 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
412 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
413 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
414 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
415 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
416 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
417 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
418 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
419 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
420 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
421 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
422 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
423 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
424 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
425 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
426 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
427 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
428 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
429 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
430 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
431 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
432 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
433 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
434 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
435 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
436 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
437 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
438 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
439 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
440 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
441 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
442 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
443 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
444 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
445 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.71
Metatranscriptomes 2.3
Isolates 9.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.96
Nodule 0.64
Rhizoplane 4.35
Rhizosphere 75.42
Stem 0
Stem Tuber 0.13
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0123048 3300037312 Bacteria 1856
2 JGI24739J22299_10022416 3300001989 Bacteria 2240
3 JGI24737J22298_10107585 3300001990 Bacteria 826
4 JGI24735J21928_10091439 3300002067 Bacteria 872
5 JGI24738J21930_10073941 3300002075 Bacteria 708
6 JGI25160J50197_1021111 3300003354 Bacteria 1945
7 JGI25160J50197_1021183 3300003354 Bacteria 1940
8 Ga0055542_1008192 3300003762 Bacteria 2060
9 Ga0065714_10032115 3300005288 Bacteria 1094
10 Ga0065714_10070825 3300005288 Bacteria 3754
11 Ga0065714_10095341 3300005288 Bacteria 1789
12 Ga0065714_10096532 3300005288 Bacteria 1754
13 Ga0065712_10156388 3300005290 Bacteria 1332
14 Ga0070670_100269497 3300005331 Bacteria 1485
15 Ga0070677_10060718 3300005333 Bacteria 1558
16 Ga0070666_10002269 3300005335 Bacteria 11616
17 Ga0070666_10447732 3300005335 Bacteria 932
18 Ga0070668_100039209 3300005347 Bacteria 3623
19 Ga0070668_100265087 3300005347 Bacteria 1430
20 Ga0070675_100064772 3300005354 Bacteria 3021
21 Ga0070671_100004562 3300005355 Bacteria 10971
22 Ga0070671_100214555 3300005355 Bacteria 1633
23 Ga0070674_100004502 3300005356 Bacteria 7952
24 Ga0070673_100042527 3300005364 Bacteria 3504
25 Ga0070673_101449030 3300005364 Bacteria 647
26 Ga0070667_100096351 3300005367 Bacteria 2551
27 Ga0070698_101188237 3300005471 Bacteria 712
28 Ga0070672_100095555 3300005543 Bacteria 2403
29 Ga0070665_100122008 3300005548 Bacteria 2608
30 Ga0070665_100362641 3300005548 Bacteria 1455
31 Ga0068856_100094109 3300005614 Bacteria 2983
32 Ga0068864_100023949 3300005618 Bacteria 5131
33 Ga0068870_10292500 3300005840 Bacteria 1025
34 Ga0068863_100500960 3300005841 Bacteria 1196
35 Ga0081455_10303849 3300005937 Bacteria 1143
36 Ga0075365_10064376 3300006038 Bacteria 2456
37 Ga0075365_10087589 3300006038 Bacteria 2117
38 Ga0075365_10240289 3300006038 Bacteria 1272
39 Ga0075365_10467485 3300006038 Bacteria 891
40 Ga0075368_10004371 3300006042 Bacteria 4785
41 Ga0075364_10013237 3300006051 Bacteria 5064
42 Ga0075432_10216997 3300006058 Bacteria 763
43 Ga0075367_10000434 3300006178 Bacteria 15538
44 Ga0075367_10527346 3300006178 Bacteria 750
45 Ga0075369_10006180 3300006186 Bacteria 4520
46 Ga0075369_10103748 3300006186 Bacteria 1277
47 Ga0075429_100291719 3300006880 Bacteria 1428
48 Ga0099826_10048198 3300006948 Bacteria 2885
49 Ga0105251_10078766 3300009011 Bacteria 1526
50 Ga0105244_10013281 3300009036 Bacteria 4823
51 Ga0105244_10029982 3300009036 Bacteria 2899
52 Ga0105244_10032502 3300009036 Bacteria 2761
53 Ga0114129_10004812 3300009147 Bacteria 19081
54 Ga0114129_11305114 3300009147 Bacteria 899
55 Ga0105243_10054006 3300009148 Bacteria 3188
56 Ga0105243_10233148 3300009148 Bacteria 1634
57 Ga0105242_10288171 3300009176 Bacteria 1494
58 Ga0105242_10363794 3300009176 Bacteria 1339
59 Ga0105248_10000710 3300009177 Bacteria 37689
60 Ga0105248_10033988 3300009177 Bacteria 5700
61 Ga0105237_10163014 3300009545 Bacteria 2228
62 Ga0105239_10495401 3300010375 Bacteria 1389
63 Ga0105246_10034863 3300011119 Bacteria 3358
64 Ga0105246_10053677 3300011119 Bacteria 2775
65 Ga0105246_10110337 3300011119 Bacteria 2020
66 Ga0105246_10128160 3300011119 Bacteria 1891
67 Ga0105246_10314261 3300011119 Bacteria 1270
68 Ga0105246_11174564 3300011119 Bacteria 705
69 Ga0157373_10014861 3300013100 Bacteria 5701
70 Ga0157371_10426476 3300013102 Bacteria 973
71 Ga0157371_10757235 3300013102 Bacteria 730
72 Ga0157369_10033375 3300013105 Bacteria 5657
73 Ga0157369_10339903 3300013105 Bacteria 1559
74 Ga0163162_10081450 3300013306 Bacteria 3308
75 Ga0157372_10179178 3300013307 Bacteria 2453
76 Ga0157375_10189265 3300013308 Bacteria 2212
77 Ga0163163_10008428 3300014325 Bacteria 9159
78 Ga0182008_10025649 3300014497 Bacteria 2994
79 Ga0182006_1026052 3300015261 Bacteria 2397
80 Ga0182007_10001776 3300015262 Bacteria 11267
81 Ga0183367_1001 3300015688 Bacteria 1225545
82 Ga0163161_10792209 3300017792 Bacteria 796
83 Ga0213875_10014079 3300021388 Bacteria 3910
84 Ga0209148_1004731 3300025254 Bacteria 3272
85 Ga0209148_1016153 3300025254 Bacteria 1289
86 Ga0207426_1005303 3300025302 Bacteria 5935
87 Ga0209051_1030266 3300025303 Bacteria 2103
88 Ga0207697_10000412 3300025315 Bacteria 24182
89 Ga0207697_10000464 3300025315 Bacteria 22857
90 Ga0207655_1004337 3300025728 Bacteria 10109
91 Ga0207655_1011840 3300025728 Bacteria 5153
92 Ga0207655_1065198 3300025728 Bacteria 1384
93 Ga0207713_1074250 3300025735 Bacteria 1245
94 Ga0207682_10004974 3300025893 Bacteria 5456
95 Ga0207688_10047132 3300025901 Bacteria 2407
96 Ga0207680_10067585 3300025903 Bacteria 2202
97 Ga0207647_10006249 3300025904 Bacteria 8679
98 Ga0207647_10105977 3300025904 Bacteria 1665
99 Ga0207645_10003534 3300025907 Bacteria 11823
100 Ga0207643_10055583 3300025908 Bacteria 2251
101 Ga0207671_10103954 3300025914 Bacteria 2154
102 Ga0207681_10025179 3300025923 Bacteria 3824
103 Ga0207650_10063598 3300025925 Bacteria 2759
104 Ga0207650_10148713 3300025925 Bacteria 1847
105 Ga0207659_10014484 3300025926 Bacteria 5088
106 Ga0207687_10092445 3300025927 Bacteria 2209
107 Ga0207644_10124615 3300025931 Bacteria 1965
108 Ga0207644_10148260 3300025931 Bacteria 1813
109 Ga0207686_10222520 3300025934 Bacteria 1364
110 Ga0207686_10562836 3300025934 Bacteria 893
111 Ga0207709_10156541 3300025935 Bacteria 1584
112 Ga0207669_10013767 3300025937 Bacteria 4032
113 Ga0207691_10001950 3300025940 Bacteria 20152
114 Ga0207711_10000398 3300025941 Bacteria 45914
115 Ga0207711_10140047 3300025941 Bacteria 2176
116 Ga0207667_10524641 3300025949 Bacteria 1200
117 Ga0207651_10040419 3300025960 Bacteria 3085
118 Ga0207712_10527227 3300025961 Bacteria 1013
119 Ga0207668_10029555 3300025972 Bacteria 3593
120 Ga0207668_10241810 3300025972 Bacteria 1461
121 Ga0207658_10004961 3300025986 Bacteria 9176
122 Ga0207639_11125898 3300026041 Bacteria 736
123 Ga0207702_10128157 3300026078 Bacteria 2281
124 Ga0207641_10353841 3300026088 Bacteria 1400
125 Ga0207641_10624395 3300026088 Bacteria 1057
126 Ga0207676_10034653 3300026095 Bacteria 3823
127 Ga0209813_10004127 3300027866 Bacteria 3449
128 Ga0207428_10054253 3300027907 Bacteria 3193
129 Ga0268266_10422410 3300028379 Bacteria 1263
130 Ga0268266_10805624 3300028379 Bacteria 907
131 Ga0307517_10006022 3300028786 Bacteria 18070
132 Ga0307517_10006310 3300028786 Bacteria 17596
133 Ga0307515_10000441 3300028794 Bacteria 99819
134 Ga0307511_10000078 3300030521 Bacteria 81896
135 Ga0307511_10027884 3300030521 Bacteria 5146
136 Ga0307512_10002991 3300030522 Bacteria 20377
137 Ga0307512_10044256 3300030522 Bacteria 3662
138 Ga0307512_10222007 3300030522 Bacteria 986
139 Ga0307513_10002116 3300031456 Bacteria 27860
140 Ga0307513_10022839 3300031456 Bacteria 7339
141 Ga0307513_10085929 3300031456 Bacteria 3227
142 Ga0307513_10342752 3300031456 Bacteria 1244
143 Ga0307509_10086034 3300031507 Bacteria 3233
144 Ga0307509_10092633 3300031507 Bacteria 3088
145 Ga0307509_10105905 3300031507 Bacteria 2832
146 Ga0307509_10259050 3300031507 Bacteria 1516
147 Ga0307408_100010705 3300031548 Bacteria 6050
148 Ga0307408_100027835 3300031548 Bacteria 3899
149 Ga0307408_100035995 3300031548 Bacteria 3476
150 Ga0307408_100154421 3300031548 Bacteria 1815
151 Ga0307408_100170889 3300031548 Bacteria 1735
152 Ga0307508_10010698 3300031616 Bacteria 8387
153 Ga0307508_10219605 3300031616 Bacteria 1500
154 Ga0307508_10302913 3300031616 Bacteria 1191
155 Ga0307514_10054370 3300031649 Bacteria 3084
156 Ga0307514_10100603 3300031649 Bacteria 2077
157 Ga0307514_10294059 3300031649 Bacteria 916
158 Ga0307514_10368325 3300031649 Bacteria 754
159 Ga0307516_10218051 3300031730 Bacteria 1619
160 Ga0307405_10010781 3300031731 Bacteria 4754
161 Ga0307405_10020383 3300031731 Bacteria 3704
162 Ga0307405_10048076 3300031731 Bacteria 2629
163 Ga0307405_10783132 3300031731 Bacteria 797
164 Ga0307413_10080964 3300031824 Bacteria 2081
165 Ga0307413_10189163 3300031824 Bacteria 1476
166 Ga0307413_10401942 3300031824 Bacteria 1073
167 Ga0307518_10014202 3300031838 Bacteria 5690
168 Ga0307518_10111619 3300031838 Bacteria 1947
169 Ga0307410_10004832 3300031852 Bacteria 7039
170 Ga0307410_10005726 3300031852 Bacteria 6619
171 Ga0307410_10124464 3300031852 Bacteria 1885
172 Ga0307410_10127411 3300031852 Bacteria 1865
173 Ga0307410_10206902 3300031852 Bacteria 1501
174 Ga0307406_10000260 3300031901 Bacteria 31960
175 Ga0307406_10052336 3300031901 Bacteria 2597
176 Ga0307406_11315990 3300031901 Bacteria 631
177 Ga0307407_10010735 3300031903 Bacteria 4330
178 Ga0307407_10014824 3300031903 Bacteria 3830
179 Ga0307407_10033544 3300031903 Bacteria 2802
180 Ga0307407_10128152 3300031903 Bacteria 1619
181 Ga0307412_10014340 3300031911 Bacteria 4671
182 Ga0307412_10019875 3300031911 Bacteria 4077
183 Ga0307412_10095888 3300031911 Bacteria 2086
184 Ga0307412_11373419 3300031911 Bacteria 638
185 Ga0307409_100004513 3300031995 Bacteria 7836
186 Ga0307409_100025309 3300031995 Bacteria 4159
187 Ga0307409_100362348 3300031995 Bacteria 1372
188 Ga0307409_100399464 3300031995 Bacteria 1312
189 Ga0307409_100433311 3300031995 Bacteria 1264
190 Ga0307409_100506405 3300031995 Bacteria 1177
191 Ga0307409_100628921 3300031995 Bacteria 1064
192 Ga0307416_100004263 3300032002 Bacteria 8588
193 Ga0307416_100013845 3300032002 Bacteria 5498
194 Ga0307416_100149219 3300032002 Bacteria 2141
195 Ga0307416_100179944 3300032002 Bacteria 1980
196 Ga0307416_100235966 3300032002 Bacteria 1768
197 Ga0307416_100369713 3300032002 Bacteria 1459
198 Ga0307416_102050660 3300032002 Bacteria 674
199 Ga0307414_10071158 3300032004 Bacteria 2508
200 Ga0307414_10128679 3300032004 Bacteria 1961
201 Ga0307414_10957245 3300032004 Bacteria 787
202 Ga0307411_10159211 3300032005 Bacteria 1688
203 Ga0307411_10316001 3300032005 Bacteria 1259
204 Ga0307415_100616398 3300032126 Bacteria 968
205 Ga0307415_100708144 3300032126 Bacteria 909
206 Ga0307507_10014173 3300033179 Bacteria 9543
207 Ga0307507_10049696 3300033179 Bacteria 4059
208 Ga0307507_10342860 3300033179 Bacteria 884
209 Ga0307510_10018716 3300033180 Bacteria 8138
210 Ga0307510_10220371 3300033180 Bacteria 1409
211 Ga0395899_0006498 3300037312 Bacteria 9057
212 Ga0395899_0285854 3300037312 Bacteria 1120
213 Ga0395900_0021768 3300037418 Bacteria 6555
214 Ga0395900_0115912 3300037418 Bacteria 2749
215 Ga0395900_0137022 3300037418 Bacteria 2508
216 Ga0395900_0388892 3300037418 Bacteria 1361
217 Ga0395898_0005196 3300037466 Bacteria 14074
218 Ga0395898_0005339 3300037466 Bacteria 13893
219 Ga0395898_0014229 3300037466 Bacteria 8179
220 Ga0395898_0125480 3300037466 Bacteria 2459
221 Ga0395898_0141104 3300037466 Bacteria 2306
222 Ga0395898_0192705 3300037466 Bacteria 1947
223 Ga0395905_0031908 3300037471 Bacteria 4956
224 Ga0395905_0036918 3300037471 Bacteria 4590
225 Ga0395905_0408133 3300037471 Bacteria 1254
226 Ga0436364_0460308 3300037853 Bacteria 5443
227 Ga0395901_0004781 3300038443 Bacteria 13667
228 Ga0395901_0093943 3300038443 Bacteria 3141
229 Ga0395901_0115025 3300038443 Bacteria 2825
230 Ga0395901_0128743 3300038443 Bacteria 2661
231 Ga0395901_0675443 3300038443 Bacteria 1033
232 Ga0439436_0000674 3300041404 Bacteria 9163
233 Ga0439436_0001517 3300041404 Bacteria 6747
234 Ga0439436_0022429 3300041404 Bacteria 1870
235 Ga0439438_015554 3300041405 Bacteria 2235
236 Ga0439438_032003 3300041405 Bacteria 1396
237 Ga0439439_0001987 3300041406 Bacteria 4245
238 Ga0439439_0010900 3300041406 Bacteria 2180
239 Ga0439439_0020330 3300041406 Bacteria 1651
240 Ga0439447_096006 3300041407 Bacteria 681
241 Ga0439466_0002356 3300041411 Bacteria 7405
242 Ga0451793_0902738 3300041452 Bacteria 638
243 Ga0451800_0099299 3300041459 Bacteria 696
244 Ga0451807_1784448 3300041486 Bacteria 763
245 Ga0451843_1323196 3300041509 Bacteria 679
246 Ga0451843_1661877 3300041509 Bacteria 646
247 Ga0451853_0041647 3300041512 Bacteria 1053
248 Ga0451853_0551214 3300041512 Bacteria 5322
249 Ga0451853_1235510 3300041512 Bacteria 1214
250 Ga0451853_2416279 3300041512 Bacteria 725
251 Ga0439431_0117664 3300041997 Bacteria 740
252 Ga0439433_0000244 3300041999 Bacteria 9092
253 Ga0439433_0000621 3300041999 Bacteria 6764
254 Ga0439433_0023570 3300041999 Bacteria 1385
255 Ga0439442_000177 3300042002 Bacteria 16193
256 Ga0439442_000461 3300042002 Bacteria 9280
257 Ga0439442_000602 3300042002 Bacteria 7758
258 Ga0439442_001218 3300042002 Bacteria 5115
259 Ga0439442_008031 3300042002 Bacteria 2134
260 Ga0439448_0002008 3300042005 Bacteria 5435
261 Ga0439432_059060 3300042006 Bacteria 1185
262 Ga0439432_215879 3300042006 Bacteria 554
263 Ga0439449_0001345 3300042007 Bacteria 9628
264 Ga0439449_0001787 3300042007 Bacteria 8464
265 Ga0439449_0018526 3300042007 Bacteria 2613
266 Ga0439449_0047321 3300042007 Bacteria 1593
267 Ga0439449_0143415 3300042007 Bacteria 889
268 Ga0439455_0007567 3300042012 Bacteria 2301
269 Ga0439457_000160 3300042014 Bacteria 17392
270 Ga0439457_003062 3300042014 Bacteria 4626
271 Ga0439457_006602 3300042014 Bacteria 2828
272 Ga0439457_009717 3300042014 Bacteria 2231
273 Ga0439462_0008371 3300042015 Bacteria 2606
274 Ga0439462_0028777 3300042015 Bacteria 1469
275 Ga0450919_017143 3300042121 Bacteria 817
276 Ga0450920_000125 3300042122 Bacteria 10438
277 Ga0450920_053415 3300042122 Bacteria 812
278 Ga0450894_000018 3300042131 Bacteria 23505
279 Ga0450898_002345 3300042134 Bacteria 2637
280 Ga0450899_004593 3300042135 Bacteria 1478
281 Ga0450903_001349 3300042138 Bacteria 4590
282 Ga0450906_045875 3300042145 Bacteria 771
283 Ga0450907_000222 3300042146 Bacteria 19774
284 Ga0439458_0000209 3300042157 Bacteria 13705
285 Ga0439458_0038764 3300042157 Bacteria 1151
286 Ga0439434_0019212 3300042435 Bacteria 2048
287 Ga0450918_008388 3300042531 Bacteria 1814
288 Ga0466969_0004293 3300044656 Bacteria 7584
289 Ga0466969_0187890 3300044656 Bacteria 945
290 Ga0466972_0003388 3300044658 Bacteria 7903
291 Ga0466972_0004342 3300044658 Bacteria 7085
292 Ga0466965_0001808 3300044683 Bacteria 8870
293 Ga0466965_0029978 3300044683 Bacteria 2649
294 Ga0466965_0045104 3300044683 Bacteria 2180
295 Ga0466966_0010922 3300044684 Bacteria 6030
296 Ga0466966_0050526 3300044684 Bacteria 2644
297 Ga0466961_0002778 3300044693 Bacteria 10881
298 Ga0466961_0028380 3300044693 Bacteria 3598
299 Ga0466961_0111138 3300044693 Bacteria 1724
300 Ga0466961_0200447 3300044693 Bacteria 1235
301 Ga0466963_0000949 3300044694 Bacteria 14861
302 Ga0466963_0184201 3300044694 Bacteria 1458
303 Ga0466971_0000294 3300044719 Bacteria 19117
304 Ga0466971_0071271 3300044719 Bacteria 1578
305 Ga0466971_0208312 3300044719 Bacteria 924
306 Ga0466968_0045533 3300044735 Bacteria 1862
307 Ga0466970_0001385 3300044765 Bacteria 11683
308 Ga0466970_0058297 3300044765 Bacteria 2067
309 Ga0466970_0168892 3300044765 Bacteria 1212
310 Ga0466957_0000752 3300044842 Bacteria 16515
311 Ga0466960_0070020 3300044901 Bacteria 1744
312 Ga0466960_0073699 3300044901 Bacteria 1704
313 Ga0466959_0006963 3300045049 Bacteria 7900
314 Ga0466959_0560877 3300045049 Bacteria 770
315 Ga0466958_0037735 3300045836 Bacteria 2895
316 Ga0466958_0582812 3300045836 Bacteria 727
317 Ga0466967_0008755 3300045976 Bacteria 7455
318 Ga0466967_0070648 3300045976 Bacteria 3124
319 Ga0495592_0027299 3300046454 Bacteria 4329
320 Ga0495592_0033670 3300046454 Bacteria 3864
321 Ga0495603_0066929 3300046455 Bacteria 2116
322 Ga0495603_0095950 3300046455 Bacteria 1732
323 Ga0495603_0269113 3300046455 Bacteria 980
324 Ga0495590_0089424 3300046457 Bacteria 1089
325 Ga0495629_0009641 3300046459 Bacteria 7053
326 Ga0495629_0130143 3300046459 Bacteria 1753
327 Ga0495629_0181123 3300046459 Bacteria 1460
328 Ga0495638_0238348 3300046460 Bacteria 1008
329 Ga0495651_0019860 3300046462 Bacteria 5210
330 Ga0495651_0020501 3300046462 Bacteria 5132
331 Ga0495651_0063023 3300046462 Bacteria 2835
332 Ga0495653_0019851 3300046463 Bacteria 5447
333 Ga0495650_0000546 3300046471 Bacteria 53831
334 Ga0495650_0003187 3300046471 Bacteria 12224
335 Ga0495650_0063387 3300046471 Bacteria 1474
336 Ga0495580_0017553 3300046472 Bacteria 5349
337 Ga0495580_0019062 3300046472 Bacteria 5101
338 Ga0495580_0197621 3300046472 Bacteria 1386
339 Ga0495582_0033939 3300046473 Bacteria 2806
340 Ga0495605_0007297 3300046474 Bacteria 6279
341 Ga0495605_0404418 3300046474 Bacteria 567
342 Ga0495639_0023328 3300046475 Bacteria 2718
343 Ga0495662_0001106 3300046476 Bacteria 13271
344 Ga0495662_0003749 3300046476 Bacteria 7662
345 Ga0495662_0014964 3300046476 Bacteria 3769
346 Ga0495664_0000944 3300046477 Bacteria 14940
347 Ga0495664_0003495 3300046477 Bacteria 8557
348 Ga0495585_0056783 3300046492 Bacteria 2161
349 Ga0495585_0058063 3300046492 Bacteria 2135
350 Ga0495585_0073027 3300046492 Bacteria 1868
351 Ga0495594_0031678 3300046499 Bacteria 2867
352 Ga0495594_0071436 3300046499 Bacteria 1930
353 Ga0495594_0200556 3300046499 Bacteria 1137
354 Ga0495594_0252323 3300046499 Bacteria 1005
355 Ga0495607_0074060 3300046501 Bacteria 1891
356 Ga0495583_0067092 3300046506 Bacteria 1585
357 Ga0495583_0126737 3300046506 Bacteria 1071
358 Ga0495606_0011656 3300046507 Bacteria 7143
359 Ga0495608_0038091 3300046511 Bacteria 3231
360 Ga0495610_0049125 3300046512 Bacteria 2067
361 Ga0495610_0264893 3300046512 Bacteria 675
362 Ga0495616_0034668 3300046513 Bacteria 2618
363 Ga0495618_0071521 3300046514 Bacteria 2207
364 Ga0495618_0197349 3300046514 Bacteria 1274
365 Ga0495620_0059732 3300046515 Bacteria 1592
366 Ga0495620_0063354 3300046515 Bacteria 1533
367 Ga0495620_0186575 3300046515 Bacteria 801
368 Ga0495628_0009491 3300046516 Bacteria 8306
369 Ga0495628_0119453 3300046516 Bacteria 2023
370 Ga0495628_0474891 3300046516 Bacteria 905
371 Ga0495630_0112967 3300046517 Bacteria 2057
372 Ga0495631_0004500 3300046518 Bacteria 7409
373 Ga0495631_0020553 3300046518 Bacteria 3084
374 Ga0495631_0405693 3300046518 Bacteria 580
375 Ga0495632_0028377 3300046519 Bacteria 2921
376 Ga0495637_0011728 3300046520 Bacteria 4206
377 Ga0495643_0015471 3300046522 Bacteria 4507
378 Ga0495643_0021595 3300046522 Bacteria 3691
379 Ga0495643_0218012 3300046522 Bacteria 907
380 Ga0495643_0324793 3300046522 Bacteria 695
381 Ga0495644_0282447 3300046523 Bacteria 648
382 Ga0495663_0051533 3300046525 Bacteria 1275
383 Ga0495666_0001706 3300046526 Bacteria 10856
384 Ga0495666_0014223 3300046526 Bacteria 3965
385 Ga0495642_0018991 3300046528 Bacteria 2692
386 Ga0495652_0135094 3300046529 Bacteria 1947
387 Ga0495652_0151885 3300046529 Bacteria 1808
388 Ga0495652_0213392 3300046529 Bacteria 1455
389 Ga0495652_0447181 3300046529 Bacteria 905
390 Ga0495665_0051007 3300046531 Bacteria 2192
391 Ga0495665_0052305 3300046531 Bacteria 2162
392 Ga0495640_0004901 3300046533 Bacteria 10642
393 Ga0495640_0119508 3300046533 Bacteria 1714
394 Ga0495586_0016082 3300046535 Bacteria 3981
395 Ga0495586_0042314 3300046535 Bacteria 2453
396 Ga0495586_0158607 3300046535 Bacteria 1275
397 Ga0495586_0300947 3300046535 Bacteria 919
398 Ga0495586_0813105 3300046535 Bacteria 539
399 Ga0495587_0005723 3300046536 Bacteria 8099
400 Ga0495587_0017657 3300046536 Bacteria 4430
401 Ga0495621_0210382 3300046539 Bacteria 785
402 Ga0495597_0061951 3300046542 Bacteria 1628
403 Ga0495645_0001887 3300046543 Bacteria 14246
404 Ga0495645_0011669 3300046543 Bacteria 6186
405 Ga0495645_0013935 3300046543 Bacteria 5699
406 Ga0495645_0147148 3300046543 Bacteria 1640
407 Ga0495622_0094613 3300046557 Bacteria 1371
408 Ga0495622_0129063 3300046557 Bacteria 1152
409 Ga0495633_0010590 3300046558 Bacteria 5025
410 Ga0495667_0021005 3300046559 Bacteria 4403
411 Ga0495667_0263332 3300046559 Bacteria 1096
412 Ga0495656_0000824 3300046615 Bacteria 9975
413 Ga0495656_0076739 3300046615 Bacteria 1498
414 Ga0495656_0099734 3300046615 Bacteria 1341
415 Ga0495668_0011623 3300046616 Bacteria 5265
416 Ga0495668_0021391 3300046616 Bacteria 3709
417 Ga0495634_0003733 3300046642 Bacteria 12131
418 Ga0495634_0072823 3300046642 Bacteria 2259
419 Ga0495634_0095140 3300046642 Bacteria 1929
420 Ga0495611_0047008 3300046648 Bacteria 1936
421 Ga0495611_0092495 3300046648 Bacteria 1398
422 Ga0495611_0300197 3300046648 Bacteria 740
423 Ga0495625_0003398 3300046660 Bacteria 15934
424 Ga0495625_0082137 3300046660 Bacteria 2241
425 Ga0495625_0132201 3300046660 Bacteria 1690
426 Ga0495625_0157267 3300046660 Bacteria 1524
427 Ga0495635_0019722 3300046663 Bacteria 4696
428 Ga0495635_0067921 3300046663 Bacteria 2444
429 Ga0495659_0001350 3300046664 Bacteria 8432
430 Ga0495661_0150276 3300046665 Bacteria 1259
431 Ga0495588_0000457 3300046674 Bacteria 20545
432 Ga0495588_0304120 3300046674 Bacteria 839
433 Ga0495657_0009095 3300046675 Bacteria 7550
434 Ga0495657_0082483 3300046675 Bacteria 2077
435 Ga0495657_0125780 3300046675 Bacteria 1610
436 Ga0495657_0239046 3300046675 Bacteria 1096
437 Ga0495599_0090721 3300046678 Bacteria 1906
438 Ga0495599_0292368 3300046678 Bacteria 985
439 Ga0495623_0057784 3300046679 Bacteria 2439
440 Ga0495623_0258735 3300046679 Bacteria 976
441 Ga0495646_0006326 3300046680 Bacteria 7513
442 Ga0495646_0147915 3300046680 Bacteria 1308
443 Ga0495646_0403827 3300046680 Bacteria 710
444 Ga0495658_0127343 3300046683 Bacteria 1547
445 Ga0495613_0008940 3300046689 Bacteria 7434
446 Ga0495613_0028895 3300046689 Bacteria 4123
447 Ga0495613_0045655 3300046689 Bacteria 3239
448 Ga0495613_0063712 3300046689 Bacteria 2696
449 Ga0495670_0000592 3300046691 Bacteria 17270
450 Ga0495670_0058317 3300046691 Bacteria 1938
451 Ga0495670_0228477 3300046691 Bacteria 989
452 Ga0495671_0037936 3300046692 Bacteria 2435
453 Ga0495649_0198706 3300046694 Bacteria 1042
454 Ga0495589_0001319 3300046794 Bacteria 14568
455 Ga0495589_0018296 3300046794 Bacteria 3594
456 Ga0495589_0021412 3300046794 Bacteria 3304
457 Ga0495589_0041917 3300046794 Bacteria 2282
458 Ga0495589_0052568 3300046794 Bacteria 2012
459 Ga0495589_0350472 3300046794 Bacteria 680
460 Ga0495600_0013998 3300046809 Bacteria 5055
461 Ga0495600_0022370 3300046809 Bacteria 4057
462 Ga0495600_0106144 3300046809 Bacteria 1830
463 Ga0495600_0281739 3300046809 Bacteria 1052
464 Ga0495600_0377197 3300046809 Bacteria 885
465 Ga0495660_0028052 3300046810 Bacteria 3183
466 Ga0495581_0020074 3300047315 Bacteria 3879
467 Ga0495581_0020881 3300047315 Bacteria 3800
468 Ga0495581_0048637 3300047315 Bacteria 2448
469 Ga0495581_0185057 3300047315 Bacteria 1218
470 Ga0495581_0188964 3300047315 Bacteria 1204
471 Ga0495604_0003998 3300047317 Bacteria 11732
472 Ga0495604_0124992 3300047317 Bacteria 1856
473 Ga0495636_0000549 3300047318 Bacteria 13794
474 Ga0495636_0039582 3300047318 Bacteria 1953
475 Ga0495674_0021729 3300047319 Bacteria 5931
476 Ga0495672_0270509 3300047320 Bacteria 816
477 Ga0495676_0019198 3300047321 Bacteria 6014
478 Ga0495676_0021214 3300047321 Bacteria 5679
479 Ga0495676_0038263 3300047321 Bacteria 3985
480 Ga0495676_0038606 3300047321 Bacteria 3964
481 Ga0495676_0055233 3300047321 Bacteria 3150
482 Ga0495676_0118273 3300047321 Bacteria 1932
483 Ga0495680_0627722 3300047322 Bacteria 716
484 Ga0495680_0972827 3300047322 Bacteria 544
485 Ga0495683_0025708 3300047323 Bacteria 3016
486 Ga0495683_0029820 3300047323 Bacteria 2787
487 Ga0495683_0103639 3300047323 Bacteria 1365
488 Ga0495687_003569 3300047443 Bacteria 11163
489 Ga0495687_005167 3300047443 Bacteria 8447
490 Ga0495687_027206 3300047443 Bacteria 2679
491 Ga0495675_0073327 3300047444 Bacteria 2159
492 Ga0495675_0080058 3300047444 Bacteria 2057
493 Ga0495675_0094195 3300047444 Bacteria 1878
494 Ga0495675_0435364 3300047444 Bacteria 760
495 Ga0495679_027516 3300047446 Bacteria 1875
496 Ga0495685_000946 3300047447 Bacteria 8788
497 Ga0495685_003370 3300047447 Bacteria 5096
498 Ga0495685_027572 3300047447 Bacteria 1954
499 Ga0495685_056773 3300047447 Bacteria 1323
500 Ga0495685_100898 3300047447 Bacteria 953
501 Ga0495685_212743 3300047447 Bacteria 618
502 Ga0495681_0000568 3300047470 Bacteria 28235
503 Ga0495681_0012674 3300047470 Bacteria 4941
504 Ga0495681_0016496 3300047470 Bacteria 4136
505 Ga0495681_0139148 3300047470 Bacteria 1027
506 Ga0495684_0057400 3300047471 Bacteria 2967
507 Ga0495684_0112105 3300047471 Bacteria 2057
508 Ga0495686_0022865 3300047472 Bacteria 4131
509 Ga0495686_0062562 3300047472 Bacteria 2308
510 Ga0495686_0063219 3300047472 Bacteria 2294
511 Ga0495593_0000284 3300047673 Bacteria 27640
512 Ga0495593_0021565 3300047673 Bacteria 3596
513 Ga0495593_0035318 3300047673 Bacteria 2715
514 Ga0495593_0067969 3300047673 Bacteria 1854
515 Ga0495602_0028059 3300048088 Bacteria 5396
516 Ga0495602_0053551 3300048088 Bacteria 3572
517 Ga0495602_0110671 3300048088 Bacteria 2232
518 Ga0495614_0094292 3300048089 Bacteria 1304
519 Ga0495614_0097791 3300048089 Bacteria 1280
520 Ga0495615_0103327 3300048090 Bacteria 807
521 Ga0495626_0039038 3300048091 Bacteria 2248
522 Ga0496101_0102816 3300048904 Bacteria 2140
523 Ga0496101_1326643 3300048904 Bacteria 562
524 Ga0496102_0001162 3300048905 Bacteria 24059
525 Ga0496102_0155601 3300048905 Bacteria 2149
526 Ga0496103_0013661 3300048906 Bacteria 4817
527 Ga0496103_0032272 3300048906 Bacteria 3195
528 Ga0496103_0067388 3300048906 Bacteria 2235
529 Ga0496104_0005983 3300048907 Bacteria 10657
530 Ga0496104_0147830 3300048907 Bacteria 2256
531 Ga0496104_1686106 3300048907 Bacteria 536
532 Ga0496105_0162405 3300048908 Bacteria 1834
533 Ga0496105_0171982 3300048908 Bacteria 1776
534 Ga0496106_0022157 3300048909 Bacteria 4717
535 Ga0496106_0038336 3300048909 Bacteria 3586
536 Ga0496107_0035233 3300048910 Bacteria 3587
537 Ga0496107_0701654 3300048910 Bacteria 744
538 Ga0496108_0049563 3300048911 Bacteria 3512
539 Ga0496108_0099586 3300048911 Bacteria 2478
540 Ga0496109_0030900 3300048912 Bacteria 4802
541 Ga0496109_0056531 3300048912 Bacteria 3580
542 Ga0496109_0821190 3300048912 Bacteria 868
543 Ga0496110_0346089 3300048913 Bacteria 1354
544 Ga0496111_0074255 3300048914 Bacteria 2477
545 Ga0496112_0481751 3300048915 Bacteria 1177
546 Ga0496113_0081478 3300048916 Bacteria 2481
547 Ga0496113_0338611 3300048916 Bacteria 1206
548 Ga0496114_0067809 3300048917 Bacteria 2993
549 Ga0496114_0226770 3300048917 Bacteria 1641
550 Ga0496115_0018277 3300048918 Bacteria 5379
551 Ga0496115_0455782 3300048918 Bacteria 1032
552 Ga0496116_0403434 3300048919 Bacteria 604
553 Ga0496117_0026452 3300048920 Bacteria 4539
554 Ga0496118_0009260 3300048921 Bacteria 9989
555 Ga0496119_0007391 3300048922 Bacteria 9910
556 Ga0496119_0225093 3300048922 Bacteria 958
557 Ga0496120_0006761 3300048923 Bacteria 8709
558 Ga0496122_0000358 3300048925 Bacteria 98103
559 Ga0496122_0087985 3300048925 Bacteria 2131
560 Ga0496123_0000280 3300048926 Bacteria 100544
561 Ga0496124_0015167 3300048927 Bacteria 7401
562 Ga0496124_0019241 3300048927 Bacteria 6364
563 Ga0496124_0096797 3300048927 Bacteria 2397
564 Ga0496125_0018179 3300048928 Bacteria 6680
565 Ga0496125_0029138 3300048928 Bacteria 4968
566 Ga0496126_0042674 3300048929 Bacteria 4187
567 Ga0496126_0499539 3300048929 Bacteria 972
568 Ga0501306_027925 3300049127 Bacteria 824
569 Ga0501309_011899 3300049129 Bacteria 1140
570 Ga0501307_025657 3300049162 Bacteria 792
571 Ga0495678_200504 3300049459 Bacteria 615
572 Ga0501315_034410 3300049531 Bacteria 744
573 Ga0501317_005023 3300049533 Bacteria 1401
574 Ga0501317_009295 3300049533 Bacteria 1151
575 Ga0501318_001314 3300049534 Bacteria 1917
576 Ga0501318_022387 3300049534 Bacteria 810
577 Ga0501320_017138 3300049536 Bacteria 807
578 Ga0501321_075312 3300049537 Bacteria 531
579 Ga0501324_018119 3300049540 Bacteria 703
580 Ga0501325_011144 3300049541 Bacteria 826
581 Ga0501333_005582 3300049549 Bacteria 820
582 Ga0501340_023326 3300049556 Bacteria 530
583 Ga0501031_0008351 3300049568 Bacteria 6732
584 Ga0501031_0042282 3300049568 Bacteria 2975
585 Ga0501032_0004814 3300049569 Bacteria 10121
586 Ga0501033_0090186 3300049570 Bacteria 2242
587 Ga0501033_0115404 3300049570 Bacteria 1951
588 Ga0501034_0000488 3300049571 Bacteria 64385
589 Ga0501034_0001465 3300049571 Bacteria 31253
590 Ga0501034_1252833 3300049571 Bacteria 619
591 Ga0501036_0006415 3300049572 Bacteria 9549
592 Ga0501036_0017106 3300049572 Bacteria 6060
593 Ga0501036_0265300 3300049572 Bacteria 1438
594 Ga0501037_0003133 3300049573 Bacteria 11997
595 Ga0501037_0167088 3300049573 Bacteria 1566
596 Ga0501037_0475643 3300049573 Bacteria 850
597 Ga0501038_0016070 3300049574 Bacteria 6795
598 Ga0501038_0040593 3300049574 Bacteria 4062
599 Ga0501038_0086285 3300049574 Bacteria 2637
600 Ga0501039_0052491 3300049575 Bacteria 3154
601 Ga0501039_0093818 3300049575 Bacteria 2339
602 Ga0501041_0073140 3300049577 Bacteria 2106
603 Ga0501042_0005133 3300049578 Bacteria 8403
604 Ga0501043_0000363 3300049579 Bacteria 41190
605 Ga0501043_0008415 3300049579 Bacteria 8125
606 Ga0501043_0149732 3300049579 Bacteria 1826
607 Ga0501046_0004043 3300049580 Bacteria 13386
608 Ga0501046_0152351 3300049580 Bacteria 1744
609 Ga0501047_0000720 3300049581 Bacteria 34413
610 Ga0501047_0002947 3300049581 Bacteria 16127
611 Ga0501047_0060375 3300049581 Bacteria 3659
612 Ga0501047_0310186 3300049581 Bacteria 1418
613 Ga0501048_0006956 3300049582 Bacteria 8595
614 Ga0501067_0011256 3300049583 Bacteria 4951
615 Ga0501068_0116236 3300049584 Bacteria 1666
616 Ga0501069_0204957 3300049585 Bacteria 1143
617 Ga0501071_0025839 3300049587 Bacteria 4116
618 Ga0501072_0001490 3300049588 Bacteria 17533
619 Ga0501072_0561122 3300049588 Bacteria 901
620 Ga0501073_0014287 3300049589 Bacteria 5767
621 Ga0501073_0052732 3300049589 Bacteria 2848
622 Ga0501073_0552588 3300049589 Bacteria 795
623 Ga0501073_0708921 3300049589 Bacteria 694
624 Ga0501074_0097166 3300049590 Bacteria 2108
625 Ga0501076_0013874 3300049592 Bacteria 6051
626 Ga0501077_0009715 3300049593 Bacteria 5981
627 Ga0501079_1563897 3300049741 Bacteria 519
628 Ga0501080_0071179 3300049742 Bacteria 3234
629 Ga0501080_0304974 3300049742 Bacteria 1444
630 Ga0501083_0011002 3300049744 Bacteria 6359
631 Ga0501035_0000875 3300049822 Bacteria 32012
632 Ga0501035_0005206 3300049822 Bacteria 12308
633 Ga0501035_0031238 3300049822 Bacteria 4851
634 Ga0501035_0179403 3300049822 Bacteria 1825
635 Ga0501044_0000958 3300049823 Bacteria 34677
636 Ga0501044_0017668 3300049823 Bacteria 7649
637 Ga0501044_0577873 3300049823 Bacteria 1018
638 nmdc:mga00v17_15360_c1 3300050491 Bacteria 4297
639 nmdc:mga00v17_38569_c1 3300050491 Bacteria 2857
640 nmdc:mga0yw44_212529_c1 3300050492 Bacteria 1280
641 nmdc:mga0yw44_36456_c1 3300050492 Bacteria 2898
642 nmdc:mga0yw44_419387_c1 3300050492 Bacteria 906
643 nmdc:mga0yw44_77801_c1 3300050492 Bacteria 2073
644 nmdc:mga06z11_2052_c1 3300050494 Bacteria 7645
645 nmdc:mga04h51_1501_c1 3300050495 Bacteria 5400
646 nmdc:mga04h51_312293_c1 3300050495 Bacteria 643
647 nmdc:mga07m45_156808_c1 3300050496 Bacteria 1321
648 nmdc:mga05p37_5161_c1 3300050507 Bacteria 15308
649 nmdc:mga09592_237704_c1 3300050508 Bacteria 1578
650 nmdc:mga0sz30_30327_c1 3300050516 Bacteria 2234
651 Ga0495601_0008658 3300053077 Bacteria 6005
652 Ga0495612_0086778 3300053078 Bacteria 1320
653 Ga0500610_0060495 3300053079 Bacteria 1977
654 Ga0500635_0000668 3300053080 Bacteria 8690
655 Ga0500635_0271834 3300053080 Bacteria 666
656 Ga0495655_0211332 3300053083 Bacteria 638
657 Ga0495619_0033451 3300053085 Bacteria 3339
658 Ga0495619_0033872 3300053085 Bacteria 3318
659 Ga0500578_0057615 3300053086 Bacteria 2483
660 Ga0500578_0134918 3300053086 Bacteria 1546
661 Ga0500647_0285797 3300053091 Bacteria 711
662 Ga0500583_0065722 3300053092 Bacteria 1724
663 Ga0500583_0084407 3300053092 Bacteria 1539
664 Ga0500583_0364142 3300053092 Bacteria 699
665 Ga0500651_0140657 3300053093 Bacteria 1455
666 Ga0500566_0012041 3300053094 Bacteria 5094
667 Ga0500641_0041936 3300053096 Bacteria 1853
668 Ga0500650_0236364 3300053098 Bacteria 823
669 Ga0500654_047066 3300053099 Bacteria 2371
670 Ga0500660_048922 3300053100 Bacteria 2104
671 Ga0500553_095001 3300053101 Bacteria 1300
672 Ga0500556_0000972 3300053104 Bacteria 15260
673 Ga0500556_0248689 3300053104 Bacteria 700
674 Ga0500558_226084 3300053106 Bacteria 632
675 Ga0500560_096532 3300053107 Bacteria 989
676 Ga0500560_276697 3300053107 Bacteria 512
677 Ga0500562_000664 3300053108 Bacteria 8337
678 Ga0500572_106979 3300053111 Bacteria 897
679 Ga0500593_045541 3300053117 Bacteria 1955
680 Ga0500594_0019000 3300053118 Bacteria 1699
681 Ga0500628_004401 3300053129 Bacteria 2333
682 Ga0500652_001663 3300053131 Bacteria 6757
683 Ga0500655_007644 3300053133 Bacteria 1946
684 Ga0500658_0013764 3300053134 Bacteria 2991
685 Ga0500559_0000267 3300053136 Bacteria 40699
686 Ga0500561_0000925 3300053137 Bacteria 4692
687 Ga0500573_0040943 3300053140 Bacteria 2675
688 Ga0500573_0186478 3300053140 Bacteria 1111
689 Ga0500573_0298807 3300053140 Bacteria 806
690 Ga0500579_055102 3300053143 Bacteria 2403
691 Ga0500600_0029849 3300053149 Bacteria 3214
692 Ga0500616_0010508 3300053153 Bacteria 5536
693 Ga0500616_0061858 3300053153 Bacteria 1936
694 Ga0500624_010546 3300053157 Bacteria 1333
695 Ga0500633_0002958 3300053160 Bacteria 3613
696 Ga0500634_0046269 3300053161 Bacteria 2351
697 Ga0501084_0009201 3300054114 Bacteria 8168
698 Ga0587098_013179 3300059604 Bacteria 958
699 Ga0587106_049867 3300059605 Bacteria 739
700 Ga0587067_035372 3300059640 Bacteria 945
701 Ga0587068_028813 3300059641 Bacteria 952
702 Ga0501082_0006857 3300060353 Bacteria 9849
703 Ga0466962_0028070 3300061719 Bacteria 2697
704 2537900231 2537561592 Bacteria 4348607
705 2585311236 2582581313 Bacteria 10042643
706 2585311876 2582581314 Bacteria 11452267
707 2616693506 2616644814 Bacteria 11555299
708 2643997798 2643221597 Bacteria 3347721
709 2644266478 2643221647 Bacteria 10741251
710 2644438037 2643221678 Bacteria 9540101
711 2644631925 2643221714 Bacteria 9015452
712 2775658807 2775506735 Bacteria 4556596
713 2785339895 2784746763 Bacteria 9783172
714 2785372827 2784746768 Bacteria 10036182
715 2786675149 2786546132 Bacteria 10419719
716 2793977318 2791355406 Bacteria 11364898
717 2808829599 2808606357 Bacteria 4466944
718 2808845180 2808606359 Bacteria 9866990
719 2808850771 2808606360 Bacteria 4404006
720 2808876703 2808606366 Bacteria 4415912
721 2808898215 2808606371 Bacteria 4251511
722 2808914775 2808606375 Bacteria 9466072
723 2812318704 2811994871 Bacteria 4497550
724 2812354519 2811994879 Bacteria 9313447
725 2831937717 2831935698 Bacteria 5963223
726 2852636140 2852635781 Bacteria 8251373
727 2857740906 2857740372 Bacteria 4782044
728 2862283200 2862281513 Bacteria 9621493
729 2862385710 2862382967 Bacteria 10317375
730 2862576750 2862574272 Bacteria 10567477
731 2863410105 2863404153 Bacteria 9672205
732 2867428868 2867428634 Bacteria 9590268
733 2868095546 2868088558 Bacteria 7609351
734 2877677866 2877676314 Bacteria 9512378
735 2899376518 2899370129 Bacteria 6781179
736 2904501486 2904497146 Bacteria 4731781
737 2904778114 2904776348 Bacteria 4658726
738 2912716129 2912715099 Bacteria 9460473
739 2919035460 2919034639 Bacteria 4763403
740 2919055020 2919051321 Bacteria 4210889
741 2919471012 2919468124 Bacteria 9133025
742 2919539324 2919538618 Bacteria 4677069
743 2932427876 2932426870 Bacteria 4547726
744 2933422358 2933418574 Bacteria 4476724
745 2939601885 2939598168 Bacteria 4687164
746 2939650318 2939647034 Bacteria 4681660
747 2939677746 2939674588 Bacteria 4844420
748 2945923174 2945920336 Bacteria 4501603
749 2945945129 2945941187 Bacteria 4682474
750 2945959092 2945956166 Bacteria 5110334
751 2946041113 2946037020 Bacteria 4900426
752 2946071148 2946064051 Bacteria 8957905
753 2946079045 2946072368 Bacteria 8999607
754 2947225586 2947224130 Bacteria 9938529
755 2954009760 2954002825 Bacteria 9173742
756 2954382654 2954380949 Bacteria 10050426
757 2954680226 2954673503 Bacteria 9685905
758 2954683925 2954682443 Bacteria 9862841
759 2954693476 2954691527 Bacteria 10720516
760 2954708570 2954701450 Bacteria 10834262
761 2954713142 2954711539 Bacteria 10867210
762 2954723102 2954721474 Bacteria 10456478
763 2954738727 2954731030 Bacteria 10243860
764 2954742009 2954740390 Bacteria 10229294
765 2954757585 2954749733 Bacteria 10366972
766 2954760987 2954759201 Bacteria 9358192
767 2990065458 2990059506 Bacteria 9321252
768 2997455097 2997451912 Bacteria 8492419
769 2997601242 2997600082 Bacteria 9896405
770 3006501707 3006493962 Bacteria 8825450
771 8003873696 8003870546 Bacteria 7396674
772 8008564126 8008558824 Bacteria 10610750
773 8008581973 8008574985 Bacteria 7815457
774 8047903486 8047893842 Bacteria 11723082
775 8048133336 8048127548 Bacteria 11053136
776 8048356744 8048356638 Bacteria 11044339
777 8048379076 8048369669 Bacteria 11666822
778 8048388181 8048379754 Bacteria 11877923
779 8048410858 8048406513 Bacteria 8936924
780 8054108629 8054107350 Bacteria 5022511
781 8054734112 8054727385 Bacteria 7558670
782 Ga0395899_0123048
783 JGI24739J22299_10022416
784 JGI24737J22298_10107585
785 JGI24735J21928_10091439
786 JGI24738J21930_10073941
787 JGI25160J50197_1021111
788 JGI25160J50197_1021183
789 Ga0055542_1008192
790 Ga0065714_10032115
791 Ga0065714_10070825
792 Ga0065714_10095341
793 Ga0065714_10096532
794 Ga0065712_10156388
795 Ga0070670_100269497
796 Ga0070677_10060718
797 Ga0070666_10002269
798 Ga0070666_10447732
799 Ga0070668_100039209
800 Ga0070668_100265087
801 Ga0070675_100064772
802 Ga0070671_100004562
803 Ga0070671_100214555
804 Ga0070674_100004502
805 Ga0070673_100042527
806 Ga0070673_101449030
807 Ga0070667_100096351
808 Ga0070698_101188237
809 Ga0070672_100095555
810 Ga0070665_100122008
811 Ga0070665_100362641
812 Ga0068856_100094109
813 Ga0068864_100023949
814 Ga0068870_10292500
815 Ga0068863_100500960
816 Ga0081455_10303849
817 Ga0075365_10064376
818 Ga0075365_10087589
819 Ga0075365_10240289
820 Ga0075365_10467485
821 Ga0075368_10004371
822 Ga0075364_10013237
823 Ga0075432_10216997
824 Ga0075367_10000434
825 Ga0075367_10527346
826 Ga0075369_10006180
827 Ga0075369_10103748
828 Ga0075429_100291719
829 Ga0099826_10048198
830 Ga0105251_10078766
831 Ga0105244_10013281
832 Ga0105244_10029982
833 Ga0105244_10032502
834 Ga0114129_10004812
835 Ga0114129_11305114
836 Ga0105243_10054006
837 Ga0105243_10233148
838 Ga0105242_10288171
839 Ga0105242_10363794
840 Ga0105248_10000710
841 Ga0105248_10033988
842 Ga0105237_10163014
843 Ga0105239_10495401
844 Ga0105246_10034863
845 Ga0105246_10053677
846 Ga0105246_10110337
847 Ga0105246_10128160
848 Ga0105246_10314261
849 Ga0105246_11174564
850 Ga0157373_10014861
851 Ga0157371_10426476
852 Ga0157371_10757235
853 Ga0157369_10033375
854 Ga0157369_10339903
855 Ga0163162_10081450
856 Ga0157372_10179178
857 Ga0157375_10189265
858 Ga0163163_10008428
859 Ga0182008_10025649
860 Ga0182006_1026052
861 Ga0182007_10001776
862 Ga0183367_1001
863 Ga0163161_10792209
864 Ga0213875_10014079
865 Ga0209148_1004731
866 Ga0209148_1016153
867 Ga0207426_1005303
868 Ga0209051_1030266
869 Ga0207697_10000412
870 Ga0207697_10000464
871 Ga0207655_1004337
872 Ga0207655_1011840
873 Ga0207655_1065198
874 Ga0207713_1074250
875 Ga0207682_10004974
876 Ga0207688_10047132
877 Ga0207680_10067585
878 Ga0207647_10006249
879 Ga0207647_10105977
880 Ga0207645_10003534
881 Ga0207643_10055583
882 Ga0207671_10103954
883 Ga0207681_10025179
884 Ga0207650_10063598
885 Ga0207650_10148713
886 Ga0207659_10014484
887 Ga0207687_10092445
888 Ga0207644_10124615
889 Ga0207644_10148260
890 Ga0207686_10222520
891 Ga0207686_10562836
892 Ga0207709_10156541
893 Ga0207669_10013767
894 Ga0207691_10001950
895 Ga0207711_10000398
896 Ga0207711_10140047
897 Ga0207667_10524641
898 Ga0207651_10040419
899 Ga0207712_10527227
900 Ga0207668_10029555
901 Ga0207668_10241810
902 Ga0207658_10004961
903 Ga0207639_11125898
904 Ga0207702_10128157
905 Ga0207641_10353841
906 Ga0207641_10624395
907 Ga0207676_10034653
908 Ga0209813_10004127
909 Ga0207428_10054253
910 Ga0268266_10422410
911 Ga0268266_10805624
912 Ga0307517_10006022
913 Ga0307517_10006310
914 Ga0307515_10000441
915 Ga0307511_10000078
916 Ga0307511_10027884
917 Ga0307512_10002991
918 Ga0307512_10044256
919 Ga0307512_10222007
920 Ga0307513_10002116
921 Ga0307513_10022839
922 Ga0307513_10085929
923 Ga0307513_10342752
924 Ga0307509_10086034
925 Ga0307509_10092633
926 Ga0307509_10105905
927 Ga0307509_10259050
928 Ga0307408_100010705
929 Ga0307408_100027835
930 Ga0307408_100035995
931 Ga0307408_100154421
932 Ga0307408_100170889
933 Ga0307508_10010698
934 Ga0307508_10219605
935 Ga0307508_10302913
936 Ga0307514_10054370
937 Ga0307514_10100603
938 Ga0307514_10294059
939 Ga0307514_10368325
940 Ga0307516_10218051
941 Ga0307405_10010781
942 Ga0307405_10020383
943 Ga0307405_10048076
944 Ga0307405_10783132
945 Ga0307413_10080964
946 Ga0307413_10189163
947 Ga0307413_10401942
948 Ga0307518_10014202
949 Ga0307518_10111619
950 Ga0307410_10004832
951 Ga0307410_10005726
952 Ga0307410_10124464
953 Ga0307410_10127411
954 Ga0307410_10206902
955 Ga0307406_10000260
956 Ga0307406_10052336
957 Ga0307406_11315990
958 Ga0307407_10010735
959 Ga0307407_10014824
960 Ga0307407_10033544
961 Ga0307407_10128152
962 Ga0307412_10014340
963 Ga0307412_10019875
964 Ga0307412_10095888
965 Ga0307412_11373419
966 Ga0307409_100004513
967 Ga0307409_100025309
968 Ga0307409_100362348
969 Ga0307409_100399464
970 Ga0307409_100433311
971 Ga0307409_100506405
972 Ga0307409_100628921
973 Ga0307416_100004263
974 Ga0307416_100013845
975 Ga0307416_100149219
976 Ga0307416_100179944
977 Ga0307416_100235966
978 Ga0307416_100369713
979 Ga0307416_102050660
980 Ga0307414_10071158
981 Ga0307414_10128679
982 Ga0307414_10957245
983 Ga0307411_10159211
984 Ga0307411_10316001
985 Ga0307415_100616398
986 Ga0307415_100708144
987 Ga0307507_10014173
988 Ga0307507_10049696
989 Ga0307507_10342860
990 Ga0307510_10018716
991 Ga0307510_10220371
992 Ga0395899_0006498
993 Ga0395899_0285854
994 Ga0395900_0021768
995 Ga0395900_0115912
996 Ga0395900_0137022
997 Ga0395900_0388892
998 Ga0395898_0005196
999 Ga0395898_0005339
1000 Ga0395898_0014229
1001 Ga0395898_0125480
1002 Ga0395898_0141104
1003 Ga0395898_0192705
1004 Ga0395905_0031908
1005 Ga0395905_0036918
1006 Ga0395905_0408133
1007 Ga0436364_0460308
1008 Ga0395901_0004781
1009 Ga0395901_0093943
1010 Ga0395901_0115025
1011 Ga0395901_0128743
1012 Ga0395901_0675443
1013 Ga0439436_0000674
1014 Ga0439436_0001517
1015 Ga0439436_0022429
1016 Ga0439438_015554
1017 Ga0439438_032003
1018 Ga0439439_0001987
1019 Ga0439439_0010900
1020 Ga0439439_0020330
1021 Ga0439447_096006
1022 Ga0439466_0002356
1023 Ga0451793_0902738
1024 Ga0451800_0099299
1025 Ga0451807_1784448
1026 Ga0451843_1323196
1027 Ga0451843_1661877
1028 Ga0451853_0041647
1029 Ga0451853_0551214
1030 Ga0451853_1235510
1031 Ga0451853_2416279
1032 Ga0439431_0117664
1033 Ga0439433_0000244
1034 Ga0439433_0000621
1035 Ga0439433_0023570
1036 Ga0439442_000177
1037 Ga0439442_000461
1038 Ga0439442_000602
1039 Ga0439442_001218
1040 Ga0439442_008031
1041 Ga0439448_0002008
1042 Ga0439432_059060
1043 Ga0439432_215879
1044 Ga0439449_0001345
1045 Ga0439449_0001787
1046 Ga0439449_0018526
1047 Ga0439449_0047321
1048 Ga0439449_0143415
1049 Ga0439455_0007567
1050 Ga0439457_000160
1051 Ga0439457_003062
1052 Ga0439457_006602
1053 Ga0439457_009717
1054 Ga0439462_0008371
1055 Ga0439462_0028777
1056 Ga0450919_017143
1057 Ga0450920_000125
1058 Ga0450920_053415
1059 Ga0450894_000018
1060 Ga0450898_002345
1061 Ga0450899_004593
1062 Ga0450903_001349
1063 Ga0450906_045875
1064 Ga0450907_000222
1065 Ga0439458_0000209
1066 Ga0439458_0038764
1067 Ga0439434_0019212
1068 Ga0450918_008388
1069 Ga0466969_0004293
1070 Ga0466969_0187890
1071 Ga0466972_0003388
1072 Ga0466972_0004342
1073 Ga0466965_0001808
1074 Ga0466965_0029978
1075 Ga0466965_0045104
1076 Ga0466966_0010922
1077 Ga0466966_0050526
1078 Ga0466961_0002778
1079 Ga0466961_0028380
1080 Ga0466961_0111138
1081 Ga0466961_0200447
1082 Ga0466963_0000949
1083 Ga0466963_0184201
1084 Ga0466971_0000294
1085 Ga0466971_0071271
1086 Ga0466971_0208312
1087 Ga0466968_0045533
1088 Ga0466970_0001385
1089 Ga0466970_0058297
1090 Ga0466970_0168892
1091 Ga0466957_0000752
1092 Ga0466960_0070020
1093 Ga0466960_0073699
1094 Ga0466959_0006963
1095 Ga0466959_0560877
1096 Ga0466958_0037735
1097 Ga0466958_0582812
1098 Ga0466967_0008755
1099 Ga0466967_0070648
1100 Ga0495592_0027299
1101 Ga0495592_0033670
1102 Ga0495603_0066929
1103 Ga0495603_0095950
1104 Ga0495603_0269113
1105 Ga0495590_0089424
1106 Ga0495629_0009641
1107 Ga0495629_0130143
1108 Ga0495629_0181123
1109 Ga0495638_0238348
1110 Ga0495651_0019860
1111 Ga0495651_0020501
1112 Ga0495651_0063023
1113 Ga0495653_0019851
1114 Ga0495650_0000546
1115 Ga0495650_0003187
1116 Ga0495650_0063387
1117 Ga0495580_0017553
1118 Ga0495580_0019062
1119 Ga0495580_0197621
1120 Ga0495582_0033939
1121 Ga0495605_0007297
1122 Ga0495605_0404418
1123 Ga0495639_0023328
1124 Ga0495662_0001106
1125 Ga0495662_0003749
1126 Ga0495662_0014964
1127 Ga0495664_0000944
1128 Ga0495664_0003495
1129 Ga0495585_0056783
1130 Ga0495585_0058063
1131 Ga0495585_0073027
1132 Ga0495594_0031678
1133 Ga0495594_0071436
1134 Ga0495594_0200556
1135 Ga0495594_0252323
1136 Ga0495607_0074060
1137 Ga0495583_0067092
1138 Ga0495583_0126737
1139 Ga0495606_0011656
1140 Ga0495608_0038091
1141 Ga0495610_0049125
1142 Ga0495610_0264893
1143 Ga0495616_0034668
1144 Ga0495618_0071521
1145 Ga0495618_0197349
1146 Ga0495620_0059732
1147 Ga0495620_0063354
1148 Ga0495620_0186575
1149 Ga0495628_0009491
1150 Ga0495628_0119453
1151 Ga0495628_0474891
1152 Ga0495630_0112967
1153 Ga0495631_0004500
1154 Ga0495631_0020553
1155 Ga0495631_0405693
1156 Ga0495632_0028377
1157 Ga0495637_0011728
1158 Ga0495643_0015471
1159 Ga0495643_0021595
1160 Ga0495643_0218012
1161 Ga0495643_0324793
1162 Ga0495644_0282447
1163 Ga0495663_0051533
1164 Ga0495666_0001706
1165 Ga0495666_0014223
1166 Ga0495642_0018991
1167 Ga0495652_0135094
1168 Ga0495652_0151885
1169 Ga0495652_0213392
1170 Ga0495652_0447181
1171 Ga0495665_0051007
1172 Ga0495665_0052305
1173 Ga0495640_0004901
1174 Ga0495640_0119508
1175 Ga0495586_0016082
1176 Ga0495586_0042314
1177 Ga0495586_0158607
1178 Ga0495586_0300947
1179 Ga0495586_0813105
1180 Ga0495587_0005723
1181 Ga0495587_0017657
1182 Ga0495621_0210382
1183 Ga0495597_0061951
1184 Ga0495645_0001887
1185 Ga0495645_0011669
1186 Ga0495645_0013935
1187 Ga0495645_0147148
1188 Ga0495622_0094613
1189 Ga0495622_0129063
1190 Ga0495633_0010590
1191 Ga0495667_0021005
1192 Ga0495667_0263332
1193 Ga0495656_0000824
1194 Ga0495656_0076739
1195 Ga0495656_0099734
1196 Ga0495668_0011623
1197 Ga0495668_0021391
1198 Ga0495634_0003733
1199 Ga0495634_0072823
1200 Ga0495634_0095140
1201 Ga0495611_0047008
1202 Ga0495611_0092495
1203 Ga0495611_0300197
1204 Ga0495625_0003398
1205 Ga0495625_0082137
1206 Ga0495625_0132201
1207 Ga0495625_0157267
1208 Ga0495635_0019722
1209 Ga0495635_0067921
1210 Ga0495659_0001350
1211 Ga0495661_0150276
1212 Ga0495588_0000457
1213 Ga0495588_0304120
1214 Ga0495657_0009095
1215 Ga0495657_0082483
1216 Ga0495657_0125780
1217 Ga0495657_0239046
1218 Ga0495599_0090721
1219 Ga0495599_0292368
1220 Ga0495623_0057784
1221 Ga0495623_0258735
1222 Ga0495646_0006326
1223 Ga0495646_0147915
1224 Ga0495646_0403827
1225 Ga0495658_0127343
1226 Ga0495613_0008940
1227 Ga0495613_0028895
1228 Ga0495613_0045655
1229 Ga0495613_0063712
1230 Ga0495670_0000592
1231 Ga0495670_0058317
1232 Ga0495670_0228477
1233 Ga0495671_0037936
1234 Ga0495649_0198706
1235 Ga0495589_0001319
1236 Ga0495589_0018296
1237 Ga0495589_0021412
1238 Ga0495589_0041917
1239 Ga0495589_0052568
1240 Ga0495589_0350472
1241 Ga0495600_0013998
1242 Ga0495600_0022370
1243 Ga0495600_0106144
1244 Ga0495600_0281739
1245 Ga0495600_0377197
1246 Ga0495660_0028052
1247 Ga0495581_0020074
1248 Ga0495581_0020881
1249 Ga0495581_0048637
1250 Ga0495581_0185057
1251 Ga0495581_0188964
1252 Ga0495604_0003998
1253 Ga0495604_0124992
1254 Ga0495636_0000549
1255 Ga0495636_0039582
1256 Ga0495674_0021729
1257 Ga0495672_0270509
1258 Ga0495676_0019198
1259 Ga0495676_0021214
1260 Ga0495676_0038263
1261 Ga0495676_0038606
1262 Ga0495676_0055233
1263 Ga0495676_0118273
1264 Ga0495680_0627722
1265 Ga0495680_0972827
1266 Ga0495683_0025708
1267 Ga0495683_0029820
1268 Ga0495683_0103639
1269 Ga0495687_003569
1270 Ga0495687_005167
1271 Ga0495687_027206
1272 Ga0495675_0073327
1273 Ga0495675_0080058
1274 Ga0495675_0094195
1275 Ga0495675_0435364
1276 Ga0495679_027516
1277 Ga0495685_000946
1278 Ga0495685_003370
1279 Ga0495685_027572
1280 Ga0495685_056773
1281 Ga0495685_100898
1282 Ga0495685_212743
1283 Ga0495681_0000568
1284 Ga0495681_0012674
1285 Ga0495681_0016496
1286 Ga0495681_0139148
1287 Ga0495684_0057400
1288 Ga0495684_0112105
1289 Ga0495686_0022865
1290 Ga0495686_0062562
1291 Ga0495686_0063219
1292 Ga0495593_0000284
1293 Ga0495593_0021565
1294 Ga0495593_0035318
1295 Ga0495593_0067969
1296 Ga0495602_0028059
1297 Ga0495602_0053551
1298 Ga0495602_0110671
1299 Ga0495614_0094292
1300 Ga0495614_0097791
1301 Ga0495615_0103327
1302 Ga0495626_0039038
1303 Ga0496101_0102816
1304 Ga0496101_1326643
1305 Ga0496102_0001162
1306 Ga0496102_0155601
1307 Ga0496103_0013661
1308 Ga0496103_0032272
1309 Ga0496103_0067388
1310 Ga0496104_0005983
1311 Ga0496104_0147830
1312 Ga0496104_1686106
1313 Ga0496105_0162405
1314 Ga0496105_0171982
1315 Ga0496106_0022157
1316 Ga0496106_0038336
1317 Ga0496107_0035233
1318 Ga0496107_0701654
1319 Ga0496108_0049563
1320 Ga0496108_0099586
1321 Ga0496109_0030900
1322 Ga0496109_0056531
1323 Ga0496109_0821190
1324 Ga0496110_0346089
1325 Ga0496111_0074255
1326 Ga0496112_0481751
1327 Ga0496113_0081478
1328 Ga0496113_0338611
1329 Ga0496114_0067809
1330 Ga0496114_0226770
1331 Ga0496115_0018277
1332 Ga0496115_0455782
1333 Ga0496116_0403434
1334 Ga0496117_0026452
1335 Ga0496118_0009260
1336 Ga0496119_0007391
1337 Ga0496119_0225093
1338 Ga0496120_0006761
1339 Ga0496122_0000358
1340 Ga0496122_0087985
1341 Ga0496123_0000280
1342 Ga0496124_0015167
1343 Ga0496124_0019241
1344 Ga0496124_0096797
1345 Ga0496125_0018179
1346 Ga0496125_0029138
1347 Ga0496126_0042674
1348 Ga0496126_0499539
1349 Ga0501306_027925
1350 Ga0501309_011899
1351 Ga0501307_025657
1352 Ga0495678_200504
1353 Ga0501315_034410
1354 Ga0501317_005023
1355 Ga0501317_009295
1356 Ga0501318_001314
1357 Ga0501318_022387
1358 Ga0501320_017138
1359 Ga0501321_075312
1360 Ga0501324_018119
1361 Ga0501325_011144
1362 Ga0501333_005582
1363 Ga0501340_023326
1364 Ga0501031_0008351
1365 Ga0501031_0042282
1366 Ga0501032_0004814
1367 Ga0501033_0090186
1368 Ga0501033_0115404
1369 Ga0501034_0000488
1370 Ga0501034_0001465
1371 Ga0501034_1252833
1372 Ga0501036_0006415
1373 Ga0501036_0017106
1374 Ga0501036_0265300
1375 Ga0501037_0003133
1376 Ga0501037_0167088
1377 Ga0501037_0475643
1378 Ga0501038_0016070
1379 Ga0501038_0040593
1380 Ga0501038_0086285
1381 Ga0501039_0052491
1382 Ga0501039_0093818
1383 Ga0501041_0073140
1384 Ga0501042_0005133
1385 Ga0501043_0000363
1386 Ga0501043_0008415
1387 Ga0501043_0149732
1388 Ga0501046_0004043
1389 Ga0501046_0152351
1390 Ga0501047_0000720
1391 Ga0501047_0002947
1392 Ga0501047_0060375
1393 Ga0501047_0310186
1394 Ga0501048_0006956
1395 Ga0501067_0011256
1396 Ga0501068_0116236
1397 Ga0501069_0204957
1398 Ga0501071_0025839
1399 Ga0501072_0001490
1400 Ga0501072_0561122
1401 Ga0501073_0014287
1402 Ga0501073_0052732
1403 Ga0501073_0552588
1404 Ga0501073_0708921
1405 Ga0501074_0097166
1406 Ga0501076_0013874
1407 Ga0501077_0009715
1408 Ga0501079_1563897
1409 Ga0501080_0071179
1410 Ga0501080_0304974
1411 Ga0501083_0011002
1412 Ga0501035_0000875
1413 Ga0501035_0005206
1414 Ga0501035_0031238
1415 Ga0501035_0179403
1416 Ga0501044_0000958
1417 Ga0501044_0017668
1418 Ga0501044_0577873
1419 nmdc:mga00v17_15360_c1
1420 nmdc:mga00v17_38569_c1
1421 nmdc:mga0yw44_212529_c1
1422 nmdc:mga0yw44_36456_c1
1423 nmdc:mga0yw44_419387_c1
1424 nmdc:mga0yw44_77801_c1
1425 nmdc:mga06z11_2052_c1
1426 nmdc:mga04h51_1501_c1
1427 nmdc:mga04h51_312293_c1
1428 nmdc:mga07m45_156808_c1
1429 nmdc:mga05p37_5161_c1
1430 nmdc:mga09592_237704_c1
1431 nmdc:mga0sz30_30327_c1
1432 Ga0495601_0008658
1433 Ga0495612_0086778
1434 Ga0500610_0060495
1435 Ga0500635_0000668
1436 Ga0500635_0271834
1437 Ga0495655_0211332
1438 Ga0495619_0033451
1439 Ga0495619_0033872
1440 Ga0500578_0057615
1441 Ga0500578_0134918
1442 Ga0500647_0285797
1443 Ga0500583_0065722
1444 Ga0500583_0084407
1445 Ga0500583_0364142
1446 Ga0500651_0140657
1447 Ga0500566_0012041
1448 Ga0500641_0041936
1449 Ga0500650_0236364
1450 Ga0500654_047066
1451 Ga0500660_048922
1452 Ga0500553_095001
1453 Ga0500556_0000972
1454 Ga0500556_0248689
1455 Ga0500558_226084
1456 Ga0500560_096532
1457 Ga0500560_276697
1458 Ga0500562_000664
1459 Ga0500572_106979
1460 Ga0500593_045541
1461 Ga0500594_0019000
1462 Ga0500628_004401
1463 Ga0500652_001663
1464 Ga0500655_007644
1465 Ga0500658_0013764
1466 Ga0500559_0000267
1467 Ga0500561_0000925
1468 Ga0500573_0040943
1469 Ga0500573_0186478
1470 Ga0500573_0298807
1471 Ga0500579_055102
1472 Ga0500600_0029849
1473 Ga0500616_0010508
1474 Ga0500616_0061858
1475 Ga0500624_010546
1476 Ga0500633_0002958
1477 Ga0500634_0046269
1478 Ga0501084_0009201
1479 Ga0587098_013179
1480 Ga0587106_049867
1481 Ga0587067_035372
1482 Ga0587068_028813
1483 Ga0501082_0006857
1484 Ga0466962_0028070
1485 2537900231
1486 2585311236
1487 2585311876
1488 2616693506
1489 2643997798
1490 2644266478
1491 2644438037
1492 2644631925
1493 2775658807
1494 2785339895
1495 2785372827
1496 2786675149
1497 2793977318
1498 2808829599
1499 2808845180
1500 2808850771
1501 2808876703
1502 2808898215
1503 2808914775
1504 2812318704
1505 2812354519
1506 2831937717
1507 2852636140
1508 2857740906
1509 2862283200
1510 2862385710
1511 2862576750
1512 2863410105
1513 2867428868
1514 2868095546
1515 2877677866
1516 2899376518
1517 2904501486
1518 2904778114
1519 2912716129
1520 2919035460
1521 2919055020
1522 2919471012
1523 2919539324
1524 2932427876
1525 2933422358
1526 2939601885
1527 2939650318
1528 2939677746
1529 2945923174
1530 2945945129
1531 2945959092
1532 2946041113
1533 2946071148
1534 2946079045
1535 2947225586
1536 2954009760
1537 2954382654
1538 2954680226
1539 2954683925
1540 2954693476
1541 2954708570
1542 2954713142
1543 2954723102
1544 2954738727
1545 2954742009
1546 2954757585
1547 2954760987
1548 2990065458
1549 2997455097
1550 2997601242
1551 3006501707
1552 8003873696
1553 8008564126
1554 8008581973
1555 8047903486
1556 8048133336
1557 8048356744
1558 8048379076
1559 8048388181
1560 8048410858
1561 8054108629
1562 8054734112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

17

144

0.86

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

20

151

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9111 3 143
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.8814 3 143
3ir3-assembly1.cif.gz_B crystal structure of human 3-hydroxyacyl-thioester dehydratase 2 (htd2) 0.8076 15 141
3fzx-assembly1.cif.gz_A-2 crystal structure of a putative exported protein with ymcc-like fold (bf2203) from bacteroides fragilis nctc 9343 at 2.22 a resolution 0.8056 101 144
4xy5-assembly1.cif.gz_A crystal structure of mutant (asp52ala) hypothetical thioesterase protein sp_1851 from streptococcus pneumoniae tigr4 0.7972 20 143
ID Description Score Start End Superfamily
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8977 3 143 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8749 4 144 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8685 3 143 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8468 4 144 3.10.129.10
4gwhA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8412 89 143 2.40.160.210
ID Description Score Start End GO Terms
AF-A0A3D3UIU8-F1-model_v4 Dehydratase 0.9839 78 144
AF-A0A6J7MXR6-F1-model_v4 Unannotated protein 0.9739 63 145
AF-A0A6L6ESY3-F1-model_v4 Dehydratase 0.9735 55 145
AF-A0A524NTT2-F1-model_v4 Dehydratase 0.9699 77 144
AF-A0A2V9Z8F8-F1-model_v4 MaoC-like domain-containing protein 0.9688 69 145

Map