F480558

General Info

Members Datasets Scaffolds Average Seq Length
781 279 1562 145

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100742719|Ga0075428_1007427192
Length 158
Sequence MKTFDREVAVGMILLLGIATLIYISLNLGQLSFGQTQGYTVQAEFPNAGGLQSGAVVELAGVEIGRVASVVLTDTYHARVTPRILPTIALQEDSRAAIKSKGLIGERYVEISPGKGTTRLLSGGTLRETEAPVDIQEVITKFIFGNVESDKDTSNEIQ

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
208 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
211 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
212 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.51
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 12.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100742719 3300006844 Bacteria 1044
2 JGI25406J46586_10004698 3300003203 Bacteria 6352
3 JGI26129J50193_1006315 3300003349 Bacteria 851
4 JGI26145J50221_1026949 3300003371 Bacteria 576
5 JGI26141J51220_1000095 3300003503 Bacteria 4190
6 JGI25405J52794_10042571 3300003911 Bacteria 962
7 JGI25405J52794_10097880 3300003911 Bacteria 653
8 Ga0058860_12164544 3300004801 Unclassified 1317
9 Ga0058862_12056882 3300004803 Unclassified 716
10 Ga0065715_10093024 3300005293 Bacteria 4836
11 Ga0065707_10129178 3300005295 Bacteria 1952
12 Ga0065707_10347831 3300005295 Bacteria 923
13 Ga0070676_10001500 3300005328 Bacteria 11821
14 Ga0070690_100193288 3300005330 Bacteria 1412
15 Ga0070690_100204626 3300005330 Bacteria 1375
16 Ga0070670_100000834 3300005331 Bacteria 24076
17 Ga0070677_10009689 3300005333 Bacteria 3273
18 Ga0068869_100009224 3300005334 Bacteria 6393
19 Ga0068869_100020440 3300005334 Bacteria 4540
20 Ga0070680_100027757 3300005336 Bacteria 4535
21 Ga0070680_100097369 3300005336 Bacteria 2439
22 Ga0070680_100108200 3300005336 Bacteria 2312
23 Ga0070680_101456166 3300005336 Unclassified 593
24 Ga0070682_100001491 3300005337 Bacteria 13126
25 Ga0068868_100034320 3300005338 Bacteria 3916
26 Ga0070660_100001585 3300005339 Bacteria 15638
27 Ga0070689_100192488 3300005340 Unclassified 1661
28 Ga0070689_100218089 3300005340 Bacteria 1564
29 Ga0070689_100453033 3300005340 Bacteria 1092
30 Ga0070691_10013343 3300005341 Bacteria 3763
31 Ga0070691_10037511 3300005341 Bacteria 2287
32 Ga0070687_100016082 3300005343 Bacteria 3402
33 Ga0070661_100001145 3300005344 Bacteria 18674
34 Ga0070692_10000252 3300005345 Bacteria 14791
35 Ga0070692_10011552 3300005345 Bacteria 4057
36 Ga0070692_10082134 3300005345 Bacteria 1737
37 Ga0070668_100100120 3300005347 Bacteria 2296
38 Ga0070668_101226311 3300005347 Unclassified 680
39 Ga0070669_100182416 3300005353 Bacteria 1643
40 Ga0070669_100382401 3300005353 Bacteria 1148
41 Ga0070669_101748882 3300005353 Unclassified 542
42 Ga0070675_100029894 3300005354 Bacteria 4396
43 Ga0070673_100059335 3300005364 Bacteria 3028
44 Ga0070688_100358677 3300005365 Bacteria 1069
45 Ga0070659_100000266 3300005366 Bacteria 41307
46 Ga0070703_10054951 3300005406 Bacteria 1285
47 Ga0070703_10061173 3300005406 Bacteria 1232
48 Ga0070709_10299011 3300005434 Bacteria 1175
49 Ga0070713_101153946 3300005436 Unclassified 749
50 Ga0070701_10024171 3300005438 Bacteria 2937
51 Ga0070711_100053660 3300005439 Bacteria 2779
52 Ga0070705_100000965 3300005440 Bacteria 16103
53 Ga0070705_100002946 3300005440 Bacteria 8416
54 Ga0070705_100022333 3300005440 Bacteria 3380
55 Ga0070705_100132566 3300005440 Bacteria 1628
56 Ga0070700_100072262 3300005441 Bacteria 2205
57 Ga0070700_100186878 3300005441 Bacteria 1446
58 Ga0070700_100581823 3300005441 Bacteria 874
59 Ga0070700_100745943 3300005441 Unclassified 783
60 Ga0070694_100002931 3300005444 Bacteria 10143
61 Ga0070694_100004289 3300005444 Bacteria 8582
62 Ga0070694_100016184 3300005444 Bacteria 4693
63 Ga0070694_101631467 3300005444 Bacteria 548
64 Ga0070708_100005544 3300005445 Bacteria 10003
65 Ga0070708_100052144 3300005445 Bacteria 3626
66 Ga0070708_100057635 3300005445 Bacteria 3459
67 Ga0070708_100124941 3300005445 Bacteria 2377
68 Ga0070708_100155315 3300005445 Bacteria 2130
69 Ga0070708_100225931 3300005445 Bacteria 1756
70 Ga0070708_100253962 3300005445 Bacteria 1652
71 Ga0070708_100372942 3300005445 Bacteria 1345
72 Ga0070708_100526139 3300005445 Bacteria 1115
73 Ga0070708_100694897 3300005445 Bacteria 958
74 Ga0070663_100003501 3300005455 Bacteria 9063
75 Ga0070662_100019501 3300005457 Bacteria 4605
76 Ga0070662_100026148 3300005457 Bacteria 4040
77 Ga0070662_100032573 3300005457 Bacteria 3663
78 Ga0070662_100302482 3300005457 Bacteria 1300
79 Ga0070681_10021732 3300005458 Bacteria 6434
80 Ga0068867_100000208 3300005459 Bacteria 39249
81 Ga0068867_100025689 3300005459 Bacteria 4227
82 Ga0068867_100368006 3300005459 Unclassified 1204
83 Ga0070706_100005646 3300005467 Bacteria 11904
84 Ga0070706_100013124 3300005467 Bacteria 7663
85 Ga0070706_100046277 3300005467 Bacteria 4017
86 Ga0070706_100096178 3300005467 Bacteria 2749
87 Ga0070706_100109517 3300005467 Bacteria 2570
88 Ga0070706_100205598 3300005467 Bacteria 1839
89 Ga0070706_100241972 3300005467 Bacteria 1685
90 Ga0070706_100245726 3300005467 Bacteria 1671
91 Ga0070707_100001238 3300005468 Bacteria 25069
92 Ga0070707_100044894 3300005468 Bacteria 4231
93 Ga0070707_100057255 3300005468 Bacteria 3739
94 Ga0070707_100112275 3300005468 Bacteria 2643
95 Ga0070707_100132403 3300005468 Bacteria 2425
96 Ga0070707_100177305 3300005468 Bacteria 2077
97 Ga0070707_100729871 3300005468 Bacteria 954
98 Ga0070698_100002302 3300005471 Bacteria 21143
99 Ga0070698_100017756 3300005471 Bacteria 7493
100 Ga0070698_100054885 3300005471 Bacteria 4043
101 Ga0070698_100062267 3300005471 Bacteria 3764
102 Ga0070698_100135180 3300005471 Bacteria 2420
103 Ga0070698_100137293 3300005471 Bacteria 2399
104 Ga0070698_100143927 3300005471 Unclassified 2334
105 Ga0070698_100922077 3300005471 Bacteria 819
106 Ga0070699_100012467 3300005518 Bacteria 7336
107 Ga0070699_100016357 3300005518 Bacteria 6370
108 Ga0070699_100016824 3300005518 Bacteria 6278
109 Ga0070699_100031407 3300005518 Bacteria 4584
110 Ga0070699_100049285 3300005518 Bacteria 3645
111 Ga0070699_100173626 3300005518 Bacteria 1910
112 Ga0070699_100209952 3300005518 Bacteria 1733
113 Ga0070699_100849026 3300005518 Unclassified 836
114 Ga0070699_101054086 3300005518 Bacteria 746
115 Ga0070679_100000501 3300005530 Bacteria 33375
116 Ga0070684_100099241 3300005535 Bacteria 2598
117 Ga0070697_100001546 3300005536 Bacteria 17513
118 Ga0070697_100004431 3300005536 Bacteria 10784
119 Ga0070697_100008167 3300005536 Bacteria 8170
120 Ga0070697_100166455 3300005536 Bacteria 1864
121 Ga0070697_100191819 3300005536 Bacteria 1734
122 Ga0070697_100223199 3300005536 Bacteria 1606
123 Ga0070697_100485259 3300005536 Bacteria 1079
124 Ga0070697_100556695 3300005536 Bacteria 1006
125 Ga0070697_100570198 3300005536 Bacteria 993
126 Ga0068853_100000406 3300005539 Bacteria 29583
127 Ga0070672_100653811 3300005543 Unclassified 918
128 Ga0070672_100672621 3300005543 Unclassified 905
129 Ga0070686_100220873 3300005544 Unclassified 1369
130 Ga0070695_100000369 3300005545 Bacteria 23044
131 Ga0070695_100002154 3300005545 Bacteria 11282
132 Ga0070695_100007153 3300005545 Bacteria 6616
133 Ga0070695_100026836 3300005545 Bacteria 3565
134 Ga0070695_100197275 3300005545 Bacteria 1436
135 Ga0070695_100209357 3300005545 Bacteria 1399
136 Ga0070695_100620361 3300005545 Bacteria 851
137 Ga0070696_100000668 3300005546 Bacteria 21928
138 Ga0070696_100014999 3300005546 Bacteria 5203
139 Ga0070696_100054077 3300005546 Bacteria 2797
140 Ga0070693_100000885 3300005547 Bacteria 13314
141 Ga0070693_100013354 3300005547 Bacteria 4182
142 Ga0070704_100000149 3300005549 Bacteria 26803
143 Ga0070704_100101044 3300005549 Bacteria 2173
144 Ga0070704_100127457 3300005549 Bacteria 1966
145 Ga0070704_100171618 3300005549 Bacteria 1726
146 Ga0070704_100572873 3300005549 Bacteria 989
147 Ga0068855_100000225 3300005563 Bacteria 72196
148 Ga0068855_100821973 3300005563 Bacteria 986
149 Ga0070664_100003368 3300005564 Bacteria 12919
150 Ga0068857_100003810 3300005577 Bacteria 12696
151 Ga0068857_100029876 3300005577 Bacteria 4810
152 Ga0068854_100000842 3300005578 Bacteria 18361
153 Ga0068854_100377507 3300005578 Bacteria 1167
154 Ga0068856_100001327 3300005614 Bacteria 26047
155 Ga0070702_100663592 3300005615 Bacteria 790
156 Ga0070702_100922926 3300005615 Unclassified 685
157 Ga0068852_100286711 3300005616 Bacteria 1589
158 Ga0068859_100113756 3300005617 Bacteria 2770
159 Ga0068864_100026621 3300005618 Bacteria 4877
160 Ga0068864_100317284 3300005618 Bacteria 1463
161 Ga0068861_100002763 3300005719 Bacteria 11510
162 Ga0068861_100278944 3300005719 Bacteria 1438
163 Ga0068861_100545332 3300005719 Bacteria 1056
164 Ga0068861_101250429 3300005719 Bacteria 720
165 Ga0068870_10000153 3300005840 Bacteria 24175
166 Ga0068863_100023259 3300005841 Bacteria 5921
167 Ga0068863_100341303 3300005841 Bacteria 1457
168 Ga0068863_100852715 3300005841 Bacteria 910
169 Ga0068858_100534440 3300005842 Unclassified 1134
170 Ga0068860_100047698 3300005843 Bacteria 4082
171 Ga0068860_100155635 3300005843 Bacteria 2203
172 Ga0068860_100666519 3300005843 Bacteria 1049
173 Ga0068862_100003669 3300005844 Bacteria 13126
174 Ga0068862_100032049 3300005844 Bacteria 4440
175 Ga0068862_100032252 3300005844 Bacteria 4426
176 Ga0068862_100922568 3300005844 Bacteria 860
177 Ga0081455_10000411 3300005937 Bacteria 56303
178 Ga0081455_10000474 3300005937 Bacteria 52046
179 Ga0081455_10115200 3300005937 Bacteria 2128
180 Ga0081455_10162862 3300005937 Bacteria 1708
181 Ga0081538_10006047 3300005981 Bacteria 10755
182 Ga0081538_10011204 3300005981 Bacteria 7283
183 Ga0081540_1003299 3300005983 Bacteria 12801
184 Ga0081539_10000005 3300005985 Bacteria 549026
185 Ga0081539_10006981 3300005985 Bacteria 10490
186 Ga0075432_10088653 3300006058 Bacteria 1130
187 Ga0075432_10215402 3300006058 Unclassified 766
188 Ga0070716_100065032 3300006173 Bacteria 2122
189 Ga0070712_100639855 3300006175 Bacteria 903
190 Ga0075427_10016077 3300006194 Bacteria 1160
191 Ga0068871_100133843 3300006358 Bacteria 2104
192 Ga0075428_100000351 3300006844 Bacteria 45775
193 Ga0075428_100042026 3300006844 Bacteria 5027
194 Ga0075428_100051469 3300006844 Bacteria 4516
195 Ga0075428_100071163 3300006844 Unclassified 3801
196 Ga0075428_100146295 3300006844 Bacteria 2568
197 Ga0075428_100189729 3300006844 Bacteria 2223
198 Ga0075428_100290521 3300006844 Bacteria 1758
199 Ga0075428_100329256 3300006844 Bacteria 1641
200 Ga0075428_100337422 3300006844 Bacteria 1619
201 Ga0075428_100494762 3300006844 Bacteria 1308
202 Ga0075428_100542409 3300006844 Bacteria 1243
203 Ga0075428_101514625 3300006844 Bacteria 702
204 Ga0075428_101611292 3300006844 Bacteria 679
205 Ga0075430_100019339 3300006846 Bacteria 5791
206 Ga0075430_100040341 3300006846 Bacteria 3952
207 Ga0075430_100115517 3300006846 Unclassified 2236
208 Ga0075430_100126140 3300006846 Bacteria 2133
209 Ga0075431_100000389 3300006847 Bacteria 35220
210 Ga0075431_100002321 3300006847 Bacteria 18273
211 Ga0075431_100017061 3300006847 Bacteria 7376
212 Ga0075431_100036341 3300006847 Bacteria 5073
213 Ga0075431_100077114 3300006847 Bacteria 3440
214 Ga0075431_100190661 3300006847 Bacteria 2100
215 Ga0075431_100301314 3300006847 Bacteria 1619
216 Ga0075431_100404237 3300006847 Bacteria 1366
217 Ga0075431_100412218 3300006847 Bacteria 1351
218 Ga0075431_100417351 3300006847 Bacteria 1341
219 Ga0075431_100647465 3300006847 Bacteria 1037
220 Ga0075431_101377819 3300006847 Unclassified 665
221 Ga0075431_101821868 3300006847 Unclassified 565
222 Ga0075433_10000462 3300006852 Bacteria 26409
223 Ga0075433_10003435 3300006852 Bacteria 12222
224 Ga0075433_10022331 3300006852 Bacteria 5310
225 Ga0075433_10032125 3300006852 Bacteria 4494
226 Ga0075433_10034240 3300006852 Bacteria 4360
227 Ga0075433_10074786 3300006852 Bacteria 2981
228 Ga0075433_10086183 3300006852 Bacteria 2773
229 Ga0075433_10103423 3300006852 Bacteria 2523
230 Ga0075433_10156954 3300006852 Bacteria 2024
231 Ga0075433_10170468 3300006852 Bacteria 1937
232 Ga0075433_10469500 3300006852 Bacteria 1108
233 Ga0075433_11433982 3300006852 Unclassified 597
234 Ga0075434_100000880 3300006871 Bacteria 24013
235 Ga0075434_100025519 3300006871 Bacteria 5782
236 Ga0075434_100027841 3300006871 Bacteria 5549
237 Ga0075434_100030733 3300006871 Bacteria 5291
238 Ga0075434_100055150 3300006871 Bacteria 3949
239 Ga0075434_100065048 3300006871 Bacteria 3632
240 Ga0075434_100072576 3300006871 Bacteria 3434
241 Ga0075434_100172103 3300006871 Unclassified 2185
242 Ga0075434_100192966 3300006871 Bacteria 2057
243 Ga0075434_100197792 3300006871 Bacteria 2030
244 Ga0075434_100381424 3300006871 Bacteria 1430
245 Ga0075434_100661361 3300006871 Bacteria 1063
246 Ga0075429_100001351 3300006880 Bacteria 20036
247 Ga0075429_100021170 3300006880 Bacteria 5638
248 Ga0075429_100023699 3300006880 Bacteria 5326
249 Ga0075429_100091660 3300006880 Bacteria 2651
250 Ga0075429_100133108 3300006880 Unclassified 2175
251 Ga0075429_100229512 3300006880 Bacteria 1626
252 Ga0075429_100303072 3300006880 Bacteria 1399
253 Ga0075429_100475818 3300006880 Bacteria 1094
254 Ga0075429_100515184 3300006880 Unclassified 1048
255 Ga0075429_100616529 3300006880 Bacteria 951
256 Ga0075429_101009354 3300006880 Bacteria 727
257 Ga0075429_101366987 3300006880 Bacteria 617
258 Ga0068865_100226611 3300006881 Bacteria 1464
259 Ga0075436_100039355 3300006914 Bacteria 3263
260 Ga0075436_100313024 3300006914 Bacteria 1127
261 Ga0075436_100320320 3300006914 Bacteria 1114
262 Ga0097620_100113754 3300006931 Bacteria 2770
263 Ga0075435_100011140 3300007076 Bacteria 6596
264 Ga0075435_100025618 3300007076 Bacteria 4592
265 Ga0075435_100086588 3300007076 Bacteria 2580
266 Ga0075435_100159014 3300007076 Unclassified 1902
267 Ga0075435_100448978 3300007076 Bacteria 1112
268 Ga0075435_100765617 3300007076 Bacteria 840
269 Ga0075435_100882828 3300007076 Unclassified 779
270 Ga0075435_101345617 3300007076 Bacteria 626
271 Ga0099794_10000982 3300007265 Bacteria 9618
272 Ga0099794_10034056 3300007265 Bacteria 2397
273 Ga0099794_10073798 3300007265 Bacteria 1675
274 Ga0111539_10000425 3300009094 Bacteria 52971
275 Ga0111539_10002112 3300009094 Bacteria 26570
276 Ga0111539_10015749 3300009094 Bacteria 9395
277 Ga0111539_10053266 3300009094 Unclassified 4816
278 Ga0111539_10175089 3300009094 Bacteria 2506
279 Ga0111539_10706977 3300009094 Bacteria 1173
280 Ga0105245_10130991 3300009098 Unclassified 2352
281 Ga0105245_10225629 3300009098 Bacteria 1810
282 Ga0105245_11004537 3300009098 Bacteria 879
283 Ga0114129_10000660 3300009147 Bacteria 43218
284 Ga0114129_10001117 3300009147 Bacteria 35426
285 Ga0114129_10003394 3300009147 Bacteria 22371
286 Ga0114129_10012883 3300009147 Bacteria 11900
287 Ga0114129_10013856 3300009147 Bacteria 11488
288 Ga0114129_10032664 3300009147 Bacteria 7354
289 Ga0114129_10055151 3300009147 Bacteria 5571
290 Ga0114129_10095897 3300009147 Bacteria 4107
291 Ga0114129_10161560 3300009147 Bacteria 3060
292 Ga0114129_10247875 3300009147 Bacteria 2392
293 Ga0114129_10418474 3300009147 Bacteria 1763
294 Ga0114129_10772570 3300009147 Bacteria 1228
295 Ga0114129_11034879 3300009147 Bacteria 1032
296 Ga0114129_11099477 3300009147 Bacteria 995
297 Ga0114129_11491893 3300009147 Bacteria 831
298 Ga0114129_11789202 3300009147 Bacteria 747
299 Ga0114129_12152709 3300009147 Unclassified 672
300 Ga0114129_12468938 3300009147 Unclassified 622
301 Ga0114129_12784276 3300009147 Bacteria 582
302 Ga0105243_10022129 3300009148 Bacteria 4831
303 Ga0105243_10024941 3300009148 Bacteria 4565
304 Ga0105243_10031651 3300009148 Bacteria 4079
305 Ga0105243_10410424 3300009148 Bacteria 1260
306 Ga0105241_10000965 3300009174 Bacteria 21744
307 Ga0105241_10010051 3300009174 Bacteria 6946
308 Ga0105241_10042842 3300009174 Bacteria 3428
309 Ga0105241_10742786 3300009174 Bacteria 899
310 Ga0105242_10015239 3300009176 Bacteria 5970
311 Ga0105242_10452595 3300009176 Bacteria 1210
312 Ga0105248_10368432 3300009177 Bacteria 1617
313 Ga0105237_10034324 3300009545 Bacteria 5138
314 Ga0105249_10041847 3300009553 Bacteria 4165
315 Ga0105249_10275074 3300009553 Bacteria 1679
316 Ga0105249_10480417 3300009553 Bacteria 1285
317 Ga0105239_11142585 3300010375 Unclassified 897
318 Ga0105246_10427158 3300011119 Bacteria 1107
319 Ga0157373_10003794 3300013100 Bacteria 11427
320 Ga0157371_10050090 3300013102 Bacteria 2967
321 Ga0157370_10592796 3300013104 Unclassified 1015
322 Ga0157369_10029005 3300013105 Bacteria 6119
323 Ga0157369_11417549 3300013105 Unclassified 707
324 Ga0157369_12103524 3300013105 Unclassified 572
325 Ga0157378_10219451 3300013297 Bacteria 1807
326 Ga0157378_10846843 3300013297 Bacteria 942
327 Ga0157378_11951090 3300013297 Unclassified 637
328 Ga0163162_10025147 3300013306 Bacteria 5884
329 Ga0163162_10184937 3300013306 Bacteria 2210
330 Ga0163162_11117395 3300013306 Bacteria 893
331 Ga0163162_11493006 3300013306 Unclassified 770
332 Ga0163162_12488410 3300013306 Bacteria 595
333 Ga0157372_10000105 3300013307 Bacteria 88007
334 Ga0157372_10060850 3300013307 Bacteria 4226
335 Ga0157375_10289630 3300013308 Unclassified 1801
336 Ga0157375_10374119 3300013308 Bacteria 1591
337 Ga0157375_10454685 3300013308 Bacteria 1446
338 Ga0157380_10026068 3300014326 Bacteria 4438
339 Ga0157379_10492139 3300014968 Bacteria 1136
340 Ga0163161_10120105 3300017792 Bacteria 1974
341 Ga0163161_10595039 3300017792 Unclassified 911
342 Ga0206356_11517812 3300020070 Unclassified 1643
343 Ga0207653_10013374 3300025885 Bacteria 2570
344 Ga0207653_10050195 3300025885 Bacteria 1387
345 Ga0207682_10005602 3300025893 Bacteria 5106
346 Ga0207688_10042555 3300025901 Bacteria 2529
347 Ga0207647_10094750 3300025904 Bacteria 1778
348 Ga0207685_10145920 3300025905 Bacteria 1066
349 Ga0207699_10049651 3300025906 Bacteria 2471
350 Ga0207645_10003526 3300025907 Bacteria 11842
351 Ga0207643_10000036 3300025908 Bacteria 89740
352 Ga0207643_10077491 3300025908 Bacteria 1922
353 Ga0207684_10000332 3300025910 Bacteria 65844
354 Ga0207684_10005411 3300025910 Bacteria 11784
355 Ga0207684_10008772 3300025910 Bacteria 8977
356 Ga0207684_10010397 3300025910 Bacteria 8193
357 Ga0207684_10031547 3300025910 Bacteria 4507
358 Ga0207684_10089763 3300025910 Unclassified 2618
359 Ga0207684_10135065 3300025910 Bacteria 2118
360 Ga0207684_10163248 3300025910 Bacteria 1919
361 Ga0207684_10317347 3300025910 Bacteria 1343
362 Ga0207684_10509522 3300025910 Bacteria 1031
363 Ga0207654_10008523 3300025911 Bacteria 5189
364 Ga0207654_10301239 3300025911 Bacteria 1090
365 Ga0207654_10740108 3300025911 Bacteria 708
366 Ga0207707_10000156 3300025912 Bacteria 71453
367 Ga0207695_11400520 3300025913 Unclassified 579
368 Ga0207671_10046723 3300025914 Bacteria 3203
369 Ga0207693_10235171 3300025915 Bacteria 1439
370 Ga0207663_10379616 3300025916 Bacteria 1076
371 Ga0207660_10000666 3300025917 Bacteria 22928
372 Ga0207660_10024956 3300025917 Bacteria 4052
373 Ga0207660_10096249 3300025917 Bacteria 2204
374 Ga0207660_10540946 3300025917 Bacteria 947
375 Ga0207662_10010343 3300025918 Bacteria 5151
376 Ga0207657_10000179 3300025919 Bacteria 65724
377 Ga0207649_10000844 3300025920 Bacteria 19682
378 Ga0207652_10002909 3300025921 Bacteria 14329
379 Ga0207646_10000250 3300025922 Bacteria 73162
380 Ga0207646_10002313 3300025922 Bacteria 22604
381 Ga0207646_10052173 3300025922 Bacteria 3659
382 Ga0207646_10206320 3300025922 Bacteria 1775
383 Ga0207646_10353308 3300025922 Bacteria 1328
384 Ga0207646_10657200 3300025922 Bacteria 939
385 Ga0207646_11814559 3300025922 Unclassified 521
386 Ga0207681_10047018 3300025923 Bacteria 2904
387 Ga0207681_10130488 3300025923 Bacteria 1857
388 Ga0207681_10376387 3300025923 Bacteria 1142
389 Ga0207650_10010684 3300025925 Bacteria 6307
390 Ga0207659_10021263 3300025926 Bacteria 4304
391 Ga0207690_10001279 3300025932 Bacteria 15897
392 Ga0207690_11297043 3300025932 Unclassified 608
393 Ga0207706_10019176 3300025933 Bacteria 6151
394 Ga0207706_10042822 3300025933 Bacteria 4012
395 Ga0207706_10047082 3300025933 Bacteria 3816
396 Ga0207706_10732531 3300025933 Bacteria 843
397 Ga0207686_10014844 3300025934 Bacteria 4347
398 Ga0207686_10479735 3300025934 Bacteria 961
399 Ga0207709_10114045 3300025935 Bacteria 1813
400 Ga0207709_10480736 3300025935 Bacteria 966
401 Ga0207709_10499466 3300025935 Unclassified 949
402 Ga0207709_11490088 3300025935 Bacteria 561
403 Ga0207670_10175047 3300025936 Bacteria 1612
404 Ga0207670_10237337 3300025936 Bacteria 1403
405 Ga0207669_10600275 3300025937 Bacteria 895
406 Ga0207704_10233915 3300025938 Bacteria 1368
407 Ga0207665_10005861 3300025939 Bacteria 8174
408 Ga0207691_10174736 3300025940 Bacteria 1879
409 Ga0207691_10618602 3300025940 Unclassified 916
410 Ga0207689_10004130 3300025942 Bacteria 13193
411 Ga0207689_10029344 3300025942 Bacteria 4595
412 Ga0207689_10107804 3300025942 Bacteria 2289
413 Ga0207679_10001024 3300025945 Bacteria 17868
414 Ga0207667_10001215 3300025949 Bacteria 32242
415 Ga0207667_10806785 3300025949 Unclassified 935
416 Ga0207651_10076995 3300025960 Bacteria 2386
417 Ga0207712_10070128 3300025961 Bacteria 2517
418 Ga0207712_10154088 3300025961 Bacteria 1778
419 Ga0207712_10183273 3300025961 Bacteria 1646
420 Ga0207668_10072970 3300025972 Bacteria 2458
421 Ga0207668_12000697 3300025972 Unclassified 522
422 Ga0207640_10000981 3300025981 Bacteria 15829
423 Ga0207640_10466699 3300025981 Bacteria 1044
424 Ga0207677_10019150 3300026023 Bacteria 4126
425 Ga0207703_10442969 3300026035 Unclassified 1212
426 Ga0207639_10002750 3300026041 Bacteria 11809
427 Ga0207678_10013566 3300026067 Bacteria 7154
428 Ga0207708_10044678 3300026075 Bacteria 3376
429 Ga0207708_10078837 3300026075 Bacteria 2530
430 Ga0207708_10171359 3300026075 Bacteria 1719
431 Ga0207708_10332633 3300026075 Bacteria 1242
432 Ga0207702_10000995 3300026078 Bacteria 29036
433 Ga0207641_10029291 3300026088 Bacteria 4551
434 Ga0207641_10118512 3300026088 Bacteria 2358
435 Ga0207641_10856476 3300026088 Unclassified 901
436 Ga0207648_10002492 3300026089 Bacteria 19758
437 Ga0207648_10020501 3300026089 Bacteria 5952
438 Ga0207648_10336388 3300026089 Bacteria 1359
439 Ga0207676_10144767 3300026095 Bacteria 2039
440 Ga0207676_10687857 3300026095 Bacteria 990
441 Ga0207674_10001156 3300026116 Bacteria 34221
442 Ga0207674_10034374 3300026116 Bacteria 5300
443 Ga0207675_100008369 3300026118 Bacteria 9748
444 Ga0207675_100163575 3300026118 Bacteria 2124
445 Ga0207675_101262679 3300026118 Unclassified 759
446 Ga0209967_1016795 3300027364 Bacteria 1053
447 Ga0209981_1044853 3300027378 Bacteria 664
448 Ga0209996_1011252 3300027395 Bacteria 1193
449 Ga0209984_1001336 3300027424 Bacteria 2660
450 Ga0210000_1008610 3300027462 Bacteria 1497
451 Ga0209995_1002640 3300027471 Bacteria 2840
452 Ga0209968_1001021 3300027526 Bacteria 4306
453 Ga0209999_1004365 3300027543 Bacteria 2544
454 Ga0209982_1002349 3300027552 Bacteria 2658
455 Ga0209970_1004221 3300027614 Bacteria 2392
456 Ga0210002_1016249 3300027617 Bacteria 1177
457 Ga0209983_1023046 3300027665 Bacteria 1307
458 Ga0209588_1016869 3300027671 Bacteria 2259
459 Ga0209588_1019261 3300027671 Bacteria 2129
460 Ga0209588_1027595 3300027671 Bacteria 1807
461 Ga0209588_1031139 3300027671 Bacteria 1706
462 Ga0209971_1000109 3300027682 Bacteria 24208
463 Ga0209971_1079892 3300027682 Bacteria 796
464 Ga0209966_1000202 3300027695 Bacteria 24693
465 Ga0209998_10000001 3300027717 Bacteria 203589
466 Ga0209974_10002052 3300027876 Bacteria 7353
467 Ga0209974_10124905 3300027876 Bacteria 914
468 Ga0207428_10000168 3300027907 Bacteria 91128
469 Ga0207428_10000533 3300027907 Bacteria 45350
470 Ga0207428_10003953 3300027907 Bacteria 14214
471 Ga0207428_10032723 3300027907 Unclassified 4276
472 Ga0207428_10191571 3300027907 Bacteria 1541
473 Ga0268265_10004862 3300028380 Bacteria 9262
474 Ga0268265_10006656 3300028380 Bacteria 7820
475 Ga0268265_10011604 3300028380 Bacteria 5958
476 Ga0268265_10109186 3300028380 Bacteria 2254
477 Ga0268265_10159736 3300028380 Bacteria 1913
478 Ga0268265_10574180 3300028380 Bacteria 1074
479 Ga0268264_10018825 3300028381 Bacteria 5647
480 Ga0268264_10085496 3300028381 Bacteria 2707
481 Ga0268264_10450217 3300028381 Bacteria 1247
482 Ga0265338_10206027 3300028800 Unclassified 1480
483 Ga0265332_10024360 3300031238 Bacteria 2663
484 Ga0265329_10001472 3300031242 Bacteria 11294
485 Ga0265316_10277662 3300031344 Unclassified 1225
486 Ga0307408_100546195 3300031548 Bacteria 1022
487 Ga0316579_10180064 3300031691 Bacteria 1022
488 Ga0316579_10427794 3300031691 Unclassified 640
489 Ga0265314_10000360 3300031711 Bacteria 63287
490 Ga0316577_10011151 3300031733 Bacteria 4864
491 Ga0307410_10139056 3300031852 Bacteria 1794
492 Ga0307409_100774082 3300031995 Bacteria 965
493 Ga0307415_101875877 3300032126 Unclassified 581
494 Ga0316593_10016996 3300032168 Bacteria 2213
495 Ga0373948_0073559 3300034817 Bacteria 770
496 Ga0373948_0162013 3300034817 Unclassified 565
497 Ga0373959_0041969 3300034820 Unclassified 963
498 Ga0373940_0001171 3300035088 Bacteria 4602
499 Ga0373940_0092428 3300035088 Bacteria 908
500 Ga0373949_0006841 3300035090 Bacteria 2505
501 Ga0373951_0066058 3300035091 Bacteria 914
502 Ga0373939_0043383 3300035114 Bacteria 1364
503 Ga0373961_0024604 3300035241 Bacteria 1630
504 Ga0373962_0100403 3300035242 Unclassified 902
505 Ga0373931_0068084 3300035691 Bacteria 1937
506 Ga0316582_0055579 3300036647 Bacteria 2523
507 Ga0316582_0091901 3300036647 Bacteria 1999
508 Ga0316584_0354135 3300036712 Bacteria 1053
509 Ga0395905_0399701 3300037471 Bacteria 1269
510 Ga0242420_027972 3300038996 Bacteria 1036
511 Ga0439437_006287 3300042000 Bacteria 1315
512 Ga0439441_026282 3300042001 Bacteria 1104
513 Ga0439448_0007591 3300042005 Bacteria 3148
514 Ga0439458_0000488 3300042157 Bacteria 10163
515 Ga0439435_0005062 3300042436 Bacteria 2878
516 Ga0439459_0000943 3300042438 Bacteria 4102
517 Ga0439464_0004311 3300042439 Bacteria 3636
518 Ga0439460_0000798 3300042461 Bacteria 7132
519 Ga0451577_0001922 3300042876 Bacteria 26280
520 Ga0451577_0006024 3300042876 Bacteria 12209
521 Ga0451577_0038056 3300042876 Bacteria 4328
522 Ga0451577_0068743 3300042876 Bacteria 3158
523 Ga0451577_0474126 3300042876 Bacteria 1136
524 Ga0451577_1217417 3300042876 Bacteria 671
525 Ga0453683_0005387 3300044673 Bacteria 8939
526 Ga0453683_0008352 3300044673 Bacteria 6951
527 Ga0453683_0033156 3300044673 Bacteria 3257
528 Ga0453683_0086494 3300044673 Bacteria 1964
529 Ga0453684_0014723 3300044712 Bacteria 12469
530 Ga0453684_0049390 3300044712 Bacteria 5549
531 Ga0453684_0053729 3300044712 Bacteria 5255
532 Ga0453684_0523373 3300044712 Bacteria 1310
533 Ga0453684_1930138 3300044712 Bacteria 597
534 Ga0451576_0010573 3300045051 Bacteria 10570
535 Ga0451576_0025381 3300045051 Bacteria 6383
536 Ga0451576_0026741 3300045051 Bacteria 6203
537 Ga0451576_0032236 3300045051 Bacteria 5583
538 Ga0451576_0137652 3300045051 Bacteria 2547
539 Ga0451576_0215399 3300045051 Bacteria 2005
540 Ga0451576_0332101 3300045051 Unclassified 1591
541 Ga0451576_0351856 3300045051 Bacteria 1542
542 Ga0495580_0002930 3300046472 Bacteria 14658
543 Ga0495580_0228155 3300046472 Bacteria 1279
544 Ga0495580_0320543 3300046472 Bacteria 1053
545 Ga0495584_0267411 3300046491 Bacteria 869
546 Ga0495585_0423502 3300046492 Bacteria 639
547 Ga0495642_0030101 3300046528 Bacteria 2171
548 Ga0495642_0098464 3300046528 Bacteria 1243
549 Ga0495642_0103763 3300046528 Bacteria 1212
550 Ga0495669_0066736 3300046684 Bacteria 1634
551 Ga0495670_0303072 3300046691 Bacteria 856
552 Ga0495636_0118648 3300047318 Bacteria 1169
553 Ga0496102_0686042 3300048905 Unclassified 947
554 Ga0496110_0738314 3300048913 Unclassified 887
555 Ga0496112_0508967 3300048915 Unclassified 1139
556 Ga0496115_0741576 3300048918 Unclassified 769
557 Ga0501298_093612 3300049521 Bacteria 677
558 Ga0501299_151061 3300049522 Unclassified 586
559 Ga0501031_0165816 3300049568 Bacteria 1444
560 Ga0501032_0078582 3300049569 Bacteria 2197
561 Ga0501032_0081156 3300049569 Bacteria 2158
562 Ga0501032_0984562 3300049569 Unclassified 530
563 Ga0501033_0014526 3300049570 Bacteria 5978
564 Ga0501033_0399686 3300049570 Unclassified 958
565 Ga0501036_0003060 3300049572 Bacteria 13324
566 Ga0501036_0143397 3300049572 Bacteria 2015
567 Ga0501037_0102325 3300049573 Bacteria 2066
568 Ga0501037_0171268 3300049573 Unclassified 1543
569 Ga0501038_0006013 3300049574 Bacteria 11228
570 Ga0501038_0169269 3300049574 Bacteria 1770
571 Ga0501038_0343275 3300049574 Unclassified 1164
572 Ga0501038_0498813 3300049574 Bacteria 931
573 Ga0501039_0000785 3300049575 Bacteria 22811
574 Ga0501039_0098673 3300049575 Unclassified 2279
575 Ga0501039_0100397 3300049575 Bacteria 2258
576 Ga0501039_0139495 3300049575 Bacteria 1904
577 Ga0501040_0000177 3300049576 Bacteria 36246
578 Ga0501040_0070967 3300049576 Bacteria 2404
579 Ga0501040_0140757 3300049576 Bacteria 1699
580 Ga0501040_0439754 3300049576 Unclassified 938
581 Ga0501040_0607151 3300049576 Bacteria 790
582 Ga0501041_0000046 3300049577 Bacteria 42763
583 Ga0501041_0000354 3300049577 Bacteria 22685
584 Ga0501041_0088092 3300049577 Bacteria 1916
585 Ga0501042_0000005 3300049578 Bacteria 65451
586 Ga0501042_0029313 3300049578 Bacteria 3881
587 Ga0501042_0285500 3300049578 Bacteria 1192
588 Ga0501042_0790067 3300049578 Bacteria 691
589 Ga0501043_0436594 3300049579 Bacteria 986
590 Ga0501043_0516046 3300049579 Bacteria 891
591 Ga0501046_0000373 3300049580 Bacteria 45356
592 Ga0501046_0003084 3300049580 Bacteria 15388
593 Ga0501046_0113257 3300049580 Bacteria 2071
594 Ga0501046_0210725 3300049580 Bacteria 1443
595 Ga0501046_0399215 3300049580 Bacteria 993
596 Ga0501047_0028363 3300049581 Bacteria 5396
597 Ga0501048_0002848 3300049582 Bacteria 13203
598 Ga0501048_0105621 3300049582 Unclassified 1987
599 Ga0501048_0123408 3300049582 Bacteria 1831
600 Ga0501048_0135290 3300049582 Bacteria 1742
601 Ga0501067_0187806 3300049583 Bacteria 1151
602 Ga0501068_0002743 3300049584 Bacteria 9364
603 Ga0501068_0018979 3300049584 Bacteria 3986
604 Ga0501068_0054992 3300049584 Bacteria 2411
605 Ga0501068_0537497 3300049584 Unclassified 759
606 Ga0501070_1112159 3300049586 Unclassified 609
607 Ga0501071_0009225 3300049587 Bacteria 6560
608 Ga0501071_0055882 3300049587 Bacteria 2850
609 Ga0501072_0000073 3300049588 Bacteria 72845
610 Ga0501072_0063806 3300049588 Bacteria 2906
611 Ga0501072_0100257 3300049588 Bacteria 2302
612 Ga0501072_0207110 3300049588 Unclassified 1563
613 Ga0501072_0217062 3300049588 Bacteria 1524
614 Ga0501072_0292568 3300049588 Unclassified 1295
615 Ga0501072_0349226 3300049588 Bacteria 1174
616 Ga0501073_0043337 3300049589 Unclassified 3173
617 Ga0501074_0002492 3300049590 Bacteria 12830
618 Ga0501074_0032991 3300049590 Bacteria 3752
619 Ga0501074_0266215 3300049590 Bacteria 1218
620 Ga0501074_0666487 3300049590 Unclassified 735
621 Ga0501075_0002927 3300049591 Bacteria 11449
622 Ga0501075_0052236 3300049591 Bacteria 3073
623 Ga0501075_0068551 3300049591 Bacteria 2680
624 Ga0501075_0076532 3300049591 Bacteria 2531
625 Ga0501075_0186437 3300049591 Bacteria 1582
626 Ga0501075_0199285 3300049591 Bacteria 1527
627 Ga0501075_0268857 3300049591 Bacteria 1299
628 Ga0501075_0332339 3300049591 Unclassified 1158
629 Ga0501075_0441456 3300049591 Bacteria 992
630 Ga0501075_0802932 3300049591 Bacteria 716
631 Ga0501076_0000235 3300049592 Bacteria 33834
632 Ga0501076_0015365 3300049592 Bacteria 5786
633 Ga0501076_0078519 3300049592 Bacteria 2649
634 Ga0501076_0104958 3300049592 Bacteria 2280
635 Ga0501076_0804209 3300049592 Bacteria 776
636 Ga0501077_0000059 3300049593 Bacteria 55812
637 Ga0501077_0011416 3300049593 Bacteria 5547
638 Ga0501077_0122129 3300049593 Unclassified 1651
639 Ga0501077_0217080 3300049593 Bacteria 1215
640 Ga0501077_0337860 3300049593 Unclassified 961
641 Ga0501077_0661601 3300049593 Bacteria 671
642 Ga0501079_0000186 3300049741 Bacteria 35569
643 Ga0501079_0001033 3300049741 Bacteria 19305
644 Ga0501079_0005778 3300049741 Bacteria 9247
645 Ga0501079_0046374 3300049741 Bacteria 3354
646 Ga0501079_0155378 3300049741 Bacteria 1783
647 Ga0501079_0280914 3300049741 Bacteria 1302
648 Ga0501079_0410821 3300049741 Bacteria 1062
649 Ga0501079_0625031 3300049741 Unclassified 848
650 Ga0501080_0004756 3300049742 Bacteria 12109
651 Ga0501080_0077698 3300049742 Bacteria 3087
652 Ga0501080_0290326 3300049742 Bacteria 1485
653 Ga0501080_0359851 3300049742 Unclassified 1313
654 Ga0501080_0528254 3300049742 Bacteria 1052
655 Ga0501080_1015780 3300049742 Bacteria 719
656 Ga0501080_1610189 3300049742 Unclassified 550
657 Ga0501081_0000073 3300049743 Bacteria 39082
658 Ga0501081_0000301 3300049743 Bacteria 26437
659 Ga0501081_0007780 3300049743 Bacteria 6949
660 Ga0501081_0013545 3300049743 Bacteria 5362
661 Ga0501081_0040856 3300049743 Bacteria 3175
662 Ga0501081_0796727 3300049743 Archaea 711
663 Ga0501081_1105648 3300049743 Unclassified 600
664 Ga0501083_0003728 3300049744 Bacteria 10700
665 Ga0501083_0006611 3300049744 Bacteria 8229
666 Ga0501083_0307267 3300049744 Bacteria 1031
667 Ga0501035_0948497 3300049822 Bacteria 679
668 Ga0501044_1306746 3300049823 Unclassified 592
669 Ga0501045_0000056 3300049824 Bacteria 51152
670 Ga0501045_0038209 3300049824 Bacteria 3491
671 Ga0501045_0102767 3300049824 Bacteria 2116
672 Ga0501045_0115845 3300049824 Bacteria 1988
673 Ga0501045_0120892 3300049824 Bacteria 1945
674 Ga0501045_0379176 3300049824 Bacteria 1053
675 nmdc:mga05p37_10528_c1 3300050507 Bacteria 10968
676 nmdc:mga05p37_10744_c1 3300050507 Bacteria 10867
677 nmdc:mga05p37_14297_c1 3300050507 Bacteria 9531
678 nmdc:mga05p37_1515364_c1 3300050507 Bacteria 667
679 nmdc:mga05p37_1765643_c1 3300050507 Unclassified 599
680 nmdc:mga05p37_215784_c1 3300050507 Bacteria 2318
681 nmdc:mga05p37_240326_c1 3300050507 Bacteria 2178
682 nmdc:mga05p37_259164_c1 3300050507 Bacteria 2082
683 nmdc:mga05p37_33348_c1 3300050507 Bacteria 6307
684 nmdc:mga05p37_40498_c1 3300050507 Bacteria 5722
685 nmdc:mga05p37_42870_c1 3300050507 Bacteria 5562
686 nmdc:mga05p37_50028_c1 3300050507 Bacteria 5140
687 nmdc:mga05p37_68568_c1 3300050507 Bacteria 4362
688 nmdc:mga05p37_783605_c1 3300050507 Bacteria 1046
689 nmdc:mga05p37_798875_c1 3300050507 Bacteria 1033
690 nmdc:mga05p37_9735_c1 3300050507 Bacteria 11396
691 nmdc:mga05p37_9880_c1 3300050507 Bacteria 11322
692 nmdc:mga09592_244813_c1 3300050508 Bacteria 1554
693 nmdc:mga09592_24895_c1 3300050508 Bacteria 4950
694 nmdc:mga09592_270855_c1 3300050508 Bacteria 1473
695 nmdc:mga09592_29534_c1 3300050508 Bacteria 4559
696 nmdc:mga09592_59423_c1 3300050508 Bacteria 3232
697 nmdc:mga09592_62260_c1 3300050508 Unclassified 3156
698 nmdc:mga09592_692982_c1 3300050508 Bacteria 867
699 nmdc:mga09592_755419_c1 3300050508 Bacteria 825
700 nmdc:mga09592_83936_c1 3300050508 Bacteria 2716
701 nmdc:mga09592_84805_c1 3300050508 Bacteria 2702
702 nmdc:mga0qj67_47311_c1 3300050509 Unclassified 3398
703 nmdc:mga0qj67_530796_c1 3300050509 Bacteria 945
704 nmdc:mga0qj67_70517_c1 3300050509 Bacteria 2788
705 nmdc:mga0qj67_74029_c1 3300050509 Bacteria 2721
706 nmdc:mga06r32_1296_c1 3300050510 Bacteria 22536
707 nmdc:mga06r32_129796_c1 3300050510 Bacteria 2491
708 nmdc:mga06r32_163020_c1 3300050510 Bacteria 2212
709 nmdc:mga06r32_182074_c1 3300050510 Bacteria 2087
710 nmdc:mga06r32_244156_c1 3300050510 Bacteria 1783
711 nmdc:mga06r32_254165_c1 3300050510 Bacteria 1745
712 nmdc:mga06r32_380762_c1 3300050510 Unclassified 1394
713 nmdc:mga06r32_49358_c1 3300050510 Bacteria 4024
714 nmdc:mga06r32_58991_c1 3300050510 Bacteria 3690
715 nmdc:mga06r32_627810_c1 3300050510 Unclassified 1044
716 nmdc:mga06r32_722442_c1 3300050510 Bacteria 961
717 nmdc:mga06r32_722771_c1 3300050510 Bacteria 960
718 nmdc:mga06r32_728395_c1 3300050510 Bacteria 956
719 nmdc:mga08y16_13074_c1 3300050511 Bacteria 8733
720 nmdc:mga08y16_13428_c1 3300050511 Bacteria 8619
721 nmdc:mga08y16_14323_c1 3300050511 Bacteria 8346
722 nmdc:mga08y16_151058_c1 3300050511 Bacteria 2414
723 nmdc:mga08y16_1946_c1 3300050511 Bacteria 21074
724 nmdc:mga08y16_36489_c1 3300050511 Bacteria 5163
725 nmdc:mga0n895_200083_c1 3300050512 Bacteria 2029
726 nmdc:mga0n895_224480_c1 3300050512 Bacteria 1907
727 nmdc:mga0n895_28987_c1 3300050512 Bacteria 5274
728 nmdc:mga0n895_32510_c1 3300050512 Bacteria 5008
729 nmdc:mga0n895_41553_c1 3300050512 Bacteria 4472
730 nmdc:mga0n895_524405_c1 3300050512 Bacteria 1192
731 nmdc:mga0n895_53026_c1 3300050512 Bacteria 3983
732 nmdc:mga0n895_53125_c1 3300050512 Bacteria 3980
733 nmdc:mga0n895_5836_c1 3300050512 Bacteria 10349
734 nmdc:mga0n895_606409_c1 3300050512 Unclassified 1097
735 nmdc:mga0n895_62750_c1 3300050512 Bacteria 3674
736 nmdc:mga0n895_646109_c1 3300050512 Bacteria 1057
737 nmdc:mga0n895_7042_c1 3300050512 Bacteria 9608
738 nmdc:mga0rr50_1215136_c1 3300050513 Bacteria 640
739 nmdc:mga0rr50_174260_c1 3300050513 Bacteria 1755
740 nmdc:mga0rr50_178305_c1 3300050513 Bacteria 1736
741 nmdc:mga0rr50_277610_c1 3300050513 Unclassified 1398
742 nmdc:mga0rr50_29665_c1 3300050513 Bacteria 3862
743 nmdc:mga0rr50_348031_c1 3300050513 Bacteria 1246
744 nmdc:mga0rr50_473210_c1 3300050513 Bacteria 1064
745 nmdc:mga0rr50_5552_c1 3300050513 Bacteria 7541
746 nmdc:mga0rr50_661151_c1 3300050513 Unclassified 892
747 nmdc:mga0rr50_662528_c1 3300050513 Unclassified 891
748 nmdc:mga08x19_22214_c1 3300050514 Bacteria 3928
749 nmdc:mga08x19_289415_c1 3300050514 Unclassified 1136
750 nmdc:mga08x19_3764_c1 3300050514 Bacteria 9026
751 nmdc:mga08x19_60441_c1 3300050514 Bacteria 2454
752 nmdc:mga08x19_655064_c1 3300050514 Unclassified 745
753 nmdc:mga08x19_96792_c1 3300050514 Bacteria 1954
754 nmdc:mga0a205_100507_c1 3300050515 Bacteria 2791
755 nmdc:mga0a205_1007688_c1 3300050515 Bacteria 680
756 nmdc:mga0a205_114982_c1 3300050515 Bacteria 2589
757 nmdc:mga0a205_15154_c1 3300050515 Bacteria 7201
758 nmdc:mga0a205_159_c1 3300050515 Bacteria 44286
759 nmdc:mga0a205_1853_c1 3300050515 Bacteria 18293
760 nmdc:mga0a205_27122_c1 3300050515 Bacteria 5469
761 nmdc:mga0a205_2802_c1 3300050515 Bacteria 15424
762 nmdc:mga0a205_31771_c1 3300050515 Bacteria 5061
763 nmdc:mga0a205_6026_c1 3300050515 Bacteria 10937
764 nmdc:mga0a205_72542_c1 3300050515 Bacteria 3326
765 nmdc:mga0a205_93596_c1 3300050515 Bacteria 1839
766 Ga0501084_0000563 3300054114 Bacteria 28396
767 Ga0501084_0011130 3300054114 Bacteria 7451
768 Ga0501084_0026922 3300054114 Bacteria 4803
769 Ga0501084_0493880 3300054114 Bacteria 1034
770 Ga0501084_0594366 3300054114 Unclassified 935
771 Ga0590077_054480 3300059426 Unclassified 901
772 Ga0501082_0000414 3300060353 Bacteria 37743
773 Ga0501082_0000881 3300060353 Bacteria 26526
774 Ga0501082_0019325 3300060353 Bacteria 5872
775 Ga0501082_0034213 3300060353 Bacteria 4383
776 Ga0501082_0172075 3300060353 Unclassified 1883
777 Ga0530510_0000205 3300061734 Bacteria 36339
778 Ga0530510_0032539 3300061734 Bacteria 3753
779 Ga0530510_0033934 3300061734 Bacteria 3675
780 Ga0530510_0085316 3300061734 Bacteria 2300
781 Ga0530510_0133227 3300061734 Bacteria 1829
782 Ga0075428_100742719
783 JGI25406J46586_10004698
784 JGI26129J50193_1006315
785 JGI26145J50221_1026949
786 JGI26141J51220_1000095
787 JGI25405J52794_10042571
788 JGI25405J52794_10097880
789 Ga0058860_12164544
790 Ga0058862_12056882
791 Ga0065715_10093024
792 Ga0065707_10129178
793 Ga0065707_10347831
794 Ga0070676_10001500
795 Ga0070690_100193288
796 Ga0070690_100204626
797 Ga0070670_100000834
798 Ga0070677_10009689
799 Ga0068869_100009224
800 Ga0068869_100020440
801 Ga0070680_100027757
802 Ga0070680_100097369
803 Ga0070680_100108200
804 Ga0070680_101456166
805 Ga0070682_100001491
806 Ga0068868_100034320
807 Ga0070660_100001585
808 Ga0070689_100192488
809 Ga0070689_100218089
810 Ga0070689_100453033
811 Ga0070691_10013343
812 Ga0070691_10037511
813 Ga0070687_100016082
814 Ga0070661_100001145
815 Ga0070692_10000252
816 Ga0070692_10011552
817 Ga0070692_10082134
818 Ga0070668_100100120
819 Ga0070668_101226311
820 Ga0070669_100182416
821 Ga0070669_100382401
822 Ga0070669_101748882
823 Ga0070675_100029894
824 Ga0070673_100059335
825 Ga0070688_100358677
826 Ga0070659_100000266
827 Ga0070703_10054951
828 Ga0070703_10061173
829 Ga0070709_10299011
830 Ga0070713_101153946
831 Ga0070701_10024171
832 Ga0070711_100053660
833 Ga0070705_100000965
834 Ga0070705_100002946
835 Ga0070705_100022333
836 Ga0070705_100132566
837 Ga0070700_100072262
838 Ga0070700_100186878
839 Ga0070700_100581823
840 Ga0070700_100745943
841 Ga0070694_100002931
842 Ga0070694_100004289
843 Ga0070694_100016184
844 Ga0070694_101631467
845 Ga0070708_100005544
846 Ga0070708_100052144
847 Ga0070708_100057635
848 Ga0070708_100124941
849 Ga0070708_100155315
850 Ga0070708_100225931
851 Ga0070708_100253962
852 Ga0070708_100372942
853 Ga0070708_100526139
854 Ga0070708_100694897
855 Ga0070663_100003501
856 Ga0070662_100019501
857 Ga0070662_100026148
858 Ga0070662_100032573
859 Ga0070662_100302482
860 Ga0070681_10021732
861 Ga0068867_100000208
862 Ga0068867_100025689
863 Ga0068867_100368006
864 Ga0070706_100005646
865 Ga0070706_100013124
866 Ga0070706_100046277
867 Ga0070706_100096178
868 Ga0070706_100109517
869 Ga0070706_100205598
870 Ga0070706_100241972
871 Ga0070706_100245726
872 Ga0070707_100001238
873 Ga0070707_100044894
874 Ga0070707_100057255
875 Ga0070707_100112275
876 Ga0070707_100132403
877 Ga0070707_100177305
878 Ga0070707_100729871
879 Ga0070698_100002302
880 Ga0070698_100017756
881 Ga0070698_100054885
882 Ga0070698_100062267
883 Ga0070698_100135180
884 Ga0070698_100137293
885 Ga0070698_100143927
886 Ga0070698_100922077
887 Ga0070699_100012467
888 Ga0070699_100016357
889 Ga0070699_100016824
890 Ga0070699_100031407
891 Ga0070699_100049285
892 Ga0070699_100173626
893 Ga0070699_100209952
894 Ga0070699_100849026
895 Ga0070699_101054086
896 Ga0070679_100000501
897 Ga0070684_100099241
898 Ga0070697_100001546
899 Ga0070697_100004431
900 Ga0070697_100008167
901 Ga0070697_100166455
902 Ga0070697_100191819
903 Ga0070697_100223199
904 Ga0070697_100485259
905 Ga0070697_100556695
906 Ga0070697_100570198
907 Ga0068853_100000406
908 Ga0070672_100653811
909 Ga0070672_100672621
910 Ga0070686_100220873
911 Ga0070695_100000369
912 Ga0070695_100002154
913 Ga0070695_100007153
914 Ga0070695_100026836
915 Ga0070695_100197275
916 Ga0070695_100209357
917 Ga0070695_100620361
918 Ga0070696_100000668
919 Ga0070696_100014999
920 Ga0070696_100054077
921 Ga0070693_100000885
922 Ga0070693_100013354
923 Ga0070704_100000149
924 Ga0070704_100101044
925 Ga0070704_100127457
926 Ga0070704_100171618
927 Ga0070704_100572873
928 Ga0068855_100000225
929 Ga0068855_100821973
930 Ga0070664_100003368
931 Ga0068857_100003810
932 Ga0068857_100029876
933 Ga0068854_100000842
934 Ga0068854_100377507
935 Ga0068856_100001327
936 Ga0070702_100663592
937 Ga0070702_100922926
938 Ga0068852_100286711
939 Ga0068859_100113756
940 Ga0068864_100026621
941 Ga0068864_100317284
942 Ga0068861_100002763
943 Ga0068861_100278944
944 Ga0068861_100545332
945 Ga0068861_101250429
946 Ga0068870_10000153
947 Ga0068863_100023259
948 Ga0068863_100341303
949 Ga0068863_100852715
950 Ga0068858_100534440
951 Ga0068860_100047698
952 Ga0068860_100155635
953 Ga0068860_100666519
954 Ga0068862_100003669
955 Ga0068862_100032049
956 Ga0068862_100032252
957 Ga0068862_100922568
958 Ga0081455_10000411
959 Ga0081455_10000474
960 Ga0081455_10115200
961 Ga0081455_10162862
962 Ga0081538_10006047
963 Ga0081538_10011204
964 Ga0081540_1003299
965 Ga0081539_10000005
966 Ga0081539_10006981
967 Ga0075432_10088653
968 Ga0075432_10215402
969 Ga0070716_100065032
970 Ga0070712_100639855
971 Ga0075427_10016077
972 Ga0068871_100133843
973 Ga0075428_100000351
974 Ga0075428_100042026
975 Ga0075428_100051469
976 Ga0075428_100071163
977 Ga0075428_100146295
978 Ga0075428_100189729
979 Ga0075428_100290521
980 Ga0075428_100329256
981 Ga0075428_100337422
982 Ga0075428_100494762
983 Ga0075428_100542409
984 Ga0075428_101514625
985 Ga0075428_101611292
986 Ga0075430_100019339
987 Ga0075430_100040341
988 Ga0075430_100115517
989 Ga0075430_100126140
990 Ga0075431_100000389
991 Ga0075431_100002321
992 Ga0075431_100017061
993 Ga0075431_100036341
994 Ga0075431_100077114
995 Ga0075431_100190661
996 Ga0075431_100301314
997 Ga0075431_100404237
998 Ga0075431_100412218
999 Ga0075431_100417351
1000 Ga0075431_100647465
1001 Ga0075431_101377819
1002 Ga0075431_101821868
1003 Ga0075433_10000462
1004 Ga0075433_10003435
1005 Ga0075433_10022331
1006 Ga0075433_10032125
1007 Ga0075433_10034240
1008 Ga0075433_10074786
1009 Ga0075433_10086183
1010 Ga0075433_10103423
1011 Ga0075433_10156954
1012 Ga0075433_10170468
1013 Ga0075433_10469500
1014 Ga0075433_11433982
1015 Ga0075434_100000880
1016 Ga0075434_100025519
1017 Ga0075434_100027841
1018 Ga0075434_100030733
1019 Ga0075434_100055150
1020 Ga0075434_100065048
1021 Ga0075434_100072576
1022 Ga0075434_100172103
1023 Ga0075434_100192966
1024 Ga0075434_100197792
1025 Ga0075434_100381424
1026 Ga0075434_100661361
1027 Ga0075429_100001351
1028 Ga0075429_100021170
1029 Ga0075429_100023699
1030 Ga0075429_100091660
1031 Ga0075429_100133108
1032 Ga0075429_100229512
1033 Ga0075429_100303072
1034 Ga0075429_100475818
1035 Ga0075429_100515184
1036 Ga0075429_100616529
1037 Ga0075429_101009354
1038 Ga0075429_101366987
1039 Ga0068865_100226611
1040 Ga0075436_100039355
1041 Ga0075436_100313024
1042 Ga0075436_100320320
1043 Ga0097620_100113754
1044 Ga0075435_100011140
1045 Ga0075435_100025618
1046 Ga0075435_100086588
1047 Ga0075435_100159014
1048 Ga0075435_100448978
1049 Ga0075435_100765617
1050 Ga0075435_100882828
1051 Ga0075435_101345617
1052 Ga0099794_10000982
1053 Ga0099794_10034056
1054 Ga0099794_10073798
1055 Ga0111539_10000425
1056 Ga0111539_10002112
1057 Ga0111539_10015749
1058 Ga0111539_10053266
1059 Ga0111539_10175089
1060 Ga0111539_10706977
1061 Ga0105245_10130991
1062 Ga0105245_10225629
1063 Ga0105245_11004537
1064 Ga0114129_10000660
1065 Ga0114129_10001117
1066 Ga0114129_10003394
1067 Ga0114129_10012883
1068 Ga0114129_10013856
1069 Ga0114129_10032664
1070 Ga0114129_10055151
1071 Ga0114129_10095897
1072 Ga0114129_10161560
1073 Ga0114129_10247875
1074 Ga0114129_10418474
1075 Ga0114129_10772570
1076 Ga0114129_11034879
1077 Ga0114129_11099477
1078 Ga0114129_11491893
1079 Ga0114129_11789202
1080 Ga0114129_12152709
1081 Ga0114129_12468938
1082 Ga0114129_12784276
1083 Ga0105243_10022129
1084 Ga0105243_10024941
1085 Ga0105243_10031651
1086 Ga0105243_10410424
1087 Ga0105241_10000965
1088 Ga0105241_10010051
1089 Ga0105241_10042842
1090 Ga0105241_10742786
1091 Ga0105242_10015239
1092 Ga0105242_10452595
1093 Ga0105248_10368432
1094 Ga0105237_10034324
1095 Ga0105249_10041847
1096 Ga0105249_10275074
1097 Ga0105249_10480417
1098 Ga0105239_11142585
1099 Ga0105246_10427158
1100 Ga0157373_10003794
1101 Ga0157371_10050090
1102 Ga0157370_10592796
1103 Ga0157369_10029005
1104 Ga0157369_11417549
1105 Ga0157369_12103524
1106 Ga0157378_10219451
1107 Ga0157378_10846843
1108 Ga0157378_11951090
1109 Ga0163162_10025147
1110 Ga0163162_10184937
1111 Ga0163162_11117395
1112 Ga0163162_11493006
1113 Ga0163162_12488410
1114 Ga0157372_10000105
1115 Ga0157372_10060850
1116 Ga0157375_10289630
1117 Ga0157375_10374119
1118 Ga0157375_10454685
1119 Ga0157380_10026068
1120 Ga0157379_10492139
1121 Ga0163161_10120105
1122 Ga0163161_10595039
1123 Ga0206356_11517812
1124 Ga0207653_10013374
1125 Ga0207653_10050195
1126 Ga0207682_10005602
1127 Ga0207688_10042555
1128 Ga0207647_10094750
1129 Ga0207685_10145920
1130 Ga0207699_10049651
1131 Ga0207645_10003526
1132 Ga0207643_10000036
1133 Ga0207643_10077491
1134 Ga0207684_10000332
1135 Ga0207684_10005411
1136 Ga0207684_10008772
1137 Ga0207684_10010397
1138 Ga0207684_10031547
1139 Ga0207684_10089763
1140 Ga0207684_10135065
1141 Ga0207684_10163248
1142 Ga0207684_10317347
1143 Ga0207684_10509522
1144 Ga0207654_10008523
1145 Ga0207654_10301239
1146 Ga0207654_10740108
1147 Ga0207707_10000156
1148 Ga0207695_11400520
1149 Ga0207671_10046723
1150 Ga0207693_10235171
1151 Ga0207663_10379616
1152 Ga0207660_10000666
1153 Ga0207660_10024956
1154 Ga0207660_10096249
1155 Ga0207660_10540946
1156 Ga0207662_10010343
1157 Ga0207657_10000179
1158 Ga0207649_10000844
1159 Ga0207652_10002909
1160 Ga0207646_10000250
1161 Ga0207646_10002313
1162 Ga0207646_10052173
1163 Ga0207646_10206320
1164 Ga0207646_10353308
1165 Ga0207646_10657200
1166 Ga0207646_11814559
1167 Ga0207681_10047018
1168 Ga0207681_10130488
1169 Ga0207681_10376387
1170 Ga0207650_10010684
1171 Ga0207659_10021263
1172 Ga0207690_10001279
1173 Ga0207690_11297043
1174 Ga0207706_10019176
1175 Ga0207706_10042822
1176 Ga0207706_10047082
1177 Ga0207706_10732531
1178 Ga0207686_10014844
1179 Ga0207686_10479735
1180 Ga0207709_10114045
1181 Ga0207709_10480736
1182 Ga0207709_10499466
1183 Ga0207709_11490088
1184 Ga0207670_10175047
1185 Ga0207670_10237337
1186 Ga0207669_10600275
1187 Ga0207704_10233915
1188 Ga0207665_10005861
1189 Ga0207691_10174736
1190 Ga0207691_10618602
1191 Ga0207689_10004130
1192 Ga0207689_10029344
1193 Ga0207689_10107804
1194 Ga0207679_10001024
1195 Ga0207667_10001215
1196 Ga0207667_10806785
1197 Ga0207651_10076995
1198 Ga0207712_10070128
1199 Ga0207712_10154088
1200 Ga0207712_10183273
1201 Ga0207668_10072970
1202 Ga0207668_12000697
1203 Ga0207640_10000981
1204 Ga0207640_10466699
1205 Ga0207677_10019150
1206 Ga0207703_10442969
1207 Ga0207639_10002750
1208 Ga0207678_10013566
1209 Ga0207708_10044678
1210 Ga0207708_10078837
1211 Ga0207708_10171359
1212 Ga0207708_10332633
1213 Ga0207702_10000995
1214 Ga0207641_10029291
1215 Ga0207641_10118512
1216 Ga0207641_10856476
1217 Ga0207648_10002492
1218 Ga0207648_10020501
1219 Ga0207648_10336388
1220 Ga0207676_10144767
1221 Ga0207676_10687857
1222 Ga0207674_10001156
1223 Ga0207674_10034374
1224 Ga0207675_100008369
1225 Ga0207675_100163575
1226 Ga0207675_101262679
1227 Ga0209967_1016795
1228 Ga0209981_1044853
1229 Ga0209996_1011252
1230 Ga0209984_1001336
1231 Ga0210000_1008610
1232 Ga0209995_1002640
1233 Ga0209968_1001021
1234 Ga0209999_1004365
1235 Ga0209982_1002349
1236 Ga0209970_1004221
1237 Ga0210002_1016249
1238 Ga0209983_1023046
1239 Ga0209588_1016869
1240 Ga0209588_1019261
1241 Ga0209588_1027595
1242 Ga0209588_1031139
1243 Ga0209971_1000109
1244 Ga0209971_1079892
1245 Ga0209966_1000202
1246 Ga0209998_10000001
1247 Ga0209974_10002052
1248 Ga0209974_10124905
1249 Ga0207428_10000168
1250 Ga0207428_10000533
1251 Ga0207428_10003953
1252 Ga0207428_10032723
1253 Ga0207428_10191571
1254 Ga0268265_10004862
1255 Ga0268265_10006656
1256 Ga0268265_10011604
1257 Ga0268265_10109186
1258 Ga0268265_10159736
1259 Ga0268265_10574180
1260 Ga0268264_10018825
1261 Ga0268264_10085496
1262 Ga0268264_10450217
1263 Ga0265338_10206027
1264 Ga0265332_10024360
1265 Ga0265329_10001472
1266 Ga0265316_10277662
1267 Ga0307408_100546195
1268 Ga0316579_10180064
1269 Ga0316579_10427794
1270 Ga0265314_10000360
1271 Ga0316577_10011151
1272 Ga0307410_10139056
1273 Ga0307409_100774082
1274 Ga0307415_101875877
1275 Ga0316593_10016996
1276 Ga0373948_0073559
1277 Ga0373948_0162013
1278 Ga0373959_0041969
1279 Ga0373940_0001171
1280 Ga0373940_0092428
1281 Ga0373949_0006841
1282 Ga0373951_0066058
1283 Ga0373939_0043383
1284 Ga0373961_0024604
1285 Ga0373962_0100403
1286 Ga0373931_0068084
1287 Ga0316582_0055579
1288 Ga0316582_0091901
1289 Ga0316584_0354135
1290 Ga0395905_0399701
1291 Ga0242420_027972
1292 Ga0439437_006287
1293 Ga0439441_026282
1294 Ga0439448_0007591
1295 Ga0439458_0000488
1296 Ga0439435_0005062
1297 Ga0439459_0000943
1298 Ga0439464_0004311
1299 Ga0439460_0000798
1300 Ga0451577_0001922
1301 Ga0451577_0006024
1302 Ga0451577_0038056
1303 Ga0451577_0068743
1304 Ga0451577_0474126
1305 Ga0451577_1217417
1306 Ga0453683_0005387
1307 Ga0453683_0008352
1308 Ga0453683_0033156
1309 Ga0453683_0086494
1310 Ga0453684_0014723
1311 Ga0453684_0049390
1312 Ga0453684_0053729
1313 Ga0453684_0523373
1314 Ga0453684_1930138
1315 Ga0451576_0010573
1316 Ga0451576_0025381
1317 Ga0451576_0026741
1318 Ga0451576_0032236
1319 Ga0451576_0137652
1320 Ga0451576_0215399
1321 Ga0451576_0332101
1322 Ga0451576_0351856
1323 Ga0495580_0002930
1324 Ga0495580_0228155
1325 Ga0495580_0320543
1326 Ga0495584_0267411
1327 Ga0495585_0423502
1328 Ga0495642_0030101
1329 Ga0495642_0098464
1330 Ga0495642_0103763
1331 Ga0495669_0066736
1332 Ga0495670_0303072
1333 Ga0495636_0118648
1334 Ga0496102_0686042
1335 Ga0496110_0738314
1336 Ga0496112_0508967
1337 Ga0496115_0741576
1338 Ga0501298_093612
1339 Ga0501299_151061
1340 Ga0501031_0165816
1341 Ga0501032_0078582
1342 Ga0501032_0081156
1343 Ga0501032_0984562
1344 Ga0501033_0014526
1345 Ga0501033_0399686
1346 Ga0501036_0003060
1347 Ga0501036_0143397
1348 Ga0501037_0102325
1349 Ga0501037_0171268
1350 Ga0501038_0006013
1351 Ga0501038_0169269
1352 Ga0501038_0343275
1353 Ga0501038_0498813
1354 Ga0501039_0000785
1355 Ga0501039_0098673
1356 Ga0501039_0100397
1357 Ga0501039_0139495
1358 Ga0501040_0000177
1359 Ga0501040_0070967
1360 Ga0501040_0140757
1361 Ga0501040_0439754
1362 Ga0501040_0607151
1363 Ga0501041_0000046
1364 Ga0501041_0000354
1365 Ga0501041_0088092
1366 Ga0501042_0000005
1367 Ga0501042_0029313
1368 Ga0501042_0285500
1369 Ga0501042_0790067
1370 Ga0501043_0436594
1371 Ga0501043_0516046
1372 Ga0501046_0000373
1373 Ga0501046_0003084
1374 Ga0501046_0113257
1375 Ga0501046_0210725
1376 Ga0501046_0399215
1377 Ga0501047_0028363
1378 Ga0501048_0002848
1379 Ga0501048_0105621
1380 Ga0501048_0123408
1381 Ga0501048_0135290
1382 Ga0501067_0187806
1383 Ga0501068_0002743
1384 Ga0501068_0018979
1385 Ga0501068_0054992
1386 Ga0501068_0537497
1387 Ga0501070_1112159
1388 Ga0501071_0009225
1389 Ga0501071_0055882
1390 Ga0501072_0000073
1391 Ga0501072_0063806
1392 Ga0501072_0100257
1393 Ga0501072_0207110
1394 Ga0501072_0217062
1395 Ga0501072_0292568
1396 Ga0501072_0349226
1397 Ga0501073_0043337
1398 Ga0501074_0002492
1399 Ga0501074_0032991
1400 Ga0501074_0266215
1401 Ga0501074_0666487
1402 Ga0501075_0002927
1403 Ga0501075_0052236
1404 Ga0501075_0068551
1405 Ga0501075_0076532
1406 Ga0501075_0186437
1407 Ga0501075_0199285
1408 Ga0501075_0268857
1409 Ga0501075_0332339
1410 Ga0501075_0441456
1411 Ga0501075_0802932
1412 Ga0501076_0000235
1413 Ga0501076_0015365
1414 Ga0501076_0078519
1415 Ga0501076_0104958
1416 Ga0501076_0804209
1417 Ga0501077_0000059
1418 Ga0501077_0011416
1419 Ga0501077_0122129
1420 Ga0501077_0217080
1421 Ga0501077_0337860
1422 Ga0501077_0661601
1423 Ga0501079_0000186
1424 Ga0501079_0001033
1425 Ga0501079_0005778
1426 Ga0501079_0046374
1427 Ga0501079_0155378
1428 Ga0501079_0280914
1429 Ga0501079_0410821
1430 Ga0501079_0625031
1431 Ga0501080_0004756
1432 Ga0501080_0077698
1433 Ga0501080_0290326
1434 Ga0501080_0359851
1435 Ga0501080_0528254
1436 Ga0501080_1015780
1437 Ga0501080_1610189
1438 Ga0501081_0000073
1439 Ga0501081_0000301
1440 Ga0501081_0007780
1441 Ga0501081_0013545
1442 Ga0501081_0040856
1443 Ga0501081_0796727
1444 Ga0501081_1105648
1445 Ga0501083_0003728
1446 Ga0501083_0006611
1447 Ga0501083_0307267
1448 Ga0501035_0948497
1449 Ga0501044_1306746
1450 Ga0501045_0000056
1451 Ga0501045_0038209
1452 Ga0501045_0102767
1453 Ga0501045_0115845
1454 Ga0501045_0120892
1455 Ga0501045_0379176
1456 nmdc:mga05p37_10528_c1
1457 nmdc:mga05p37_10744_c1
1458 nmdc:mga05p37_14297_c1
1459 nmdc:mga05p37_1515364_c1
1460 nmdc:mga05p37_1765643_c1
1461 nmdc:mga05p37_215784_c1
1462 nmdc:mga05p37_240326_c1
1463 nmdc:mga05p37_259164_c1
1464 nmdc:mga05p37_33348_c1
1465 nmdc:mga05p37_40498_c1
1466 nmdc:mga05p37_42870_c1
1467 nmdc:mga05p37_50028_c1
1468 nmdc:mga05p37_68568_c1
1469 nmdc:mga05p37_783605_c1
1470 nmdc:mga05p37_798875_c1
1471 nmdc:mga05p37_9735_c1
1472 nmdc:mga05p37_9880_c1
1473 nmdc:mga09592_244813_c1
1474 nmdc:mga09592_24895_c1
1475 nmdc:mga09592_270855_c1
1476 nmdc:mga09592_29534_c1
1477 nmdc:mga09592_59423_c1
1478 nmdc:mga09592_62260_c1
1479 nmdc:mga09592_692982_c1
1480 nmdc:mga09592_755419_c1
1481 nmdc:mga09592_83936_c1
1482 nmdc:mga09592_84805_c1
1483 nmdc:mga0qj67_47311_c1
1484 nmdc:mga0qj67_530796_c1
1485 nmdc:mga0qj67_70517_c1
1486 nmdc:mga0qj67_74029_c1
1487 nmdc:mga06r32_1296_c1
1488 nmdc:mga06r32_129796_c1
1489 nmdc:mga06r32_163020_c1
1490 nmdc:mga06r32_182074_c1
1491 nmdc:mga06r32_244156_c1
1492 nmdc:mga06r32_254165_c1
1493 nmdc:mga06r32_380762_c1
1494 nmdc:mga06r32_49358_c1
1495 nmdc:mga06r32_58991_c1
1496 nmdc:mga06r32_627810_c1
1497 nmdc:mga06r32_722442_c1
1498 nmdc:mga06r32_722771_c1
1499 nmdc:mga06r32_728395_c1
1500 nmdc:mga08y16_13074_c1
1501 nmdc:mga08y16_13428_c1
1502 nmdc:mga08y16_14323_c1
1503 nmdc:mga08y16_151058_c1
1504 nmdc:mga08y16_1946_c1
1505 nmdc:mga08y16_36489_c1
1506 nmdc:mga0n895_200083_c1
1507 nmdc:mga0n895_224480_c1
1508 nmdc:mga0n895_28987_c1
1509 nmdc:mga0n895_32510_c1
1510 nmdc:mga0n895_41553_c1
1511 nmdc:mga0n895_524405_c1
1512 nmdc:mga0n895_53026_c1
1513 nmdc:mga0n895_53125_c1
1514 nmdc:mga0n895_5836_c1
1515 nmdc:mga0n895_606409_c1
1516 nmdc:mga0n895_62750_c1
1517 nmdc:mga0n895_646109_c1
1518 nmdc:mga0n895_7042_c1
1519 nmdc:mga0rr50_1215136_c1
1520 nmdc:mga0rr50_174260_c1
1521 nmdc:mga0rr50_178305_c1
1522 nmdc:mga0rr50_277610_c1
1523 nmdc:mga0rr50_29665_c1
1524 nmdc:mga0rr50_348031_c1
1525 nmdc:mga0rr50_473210_c1
1526 nmdc:mga0rr50_5552_c1
1527 nmdc:mga0rr50_661151_c1
1528 nmdc:mga0rr50_662528_c1
1529 nmdc:mga08x19_22214_c1
1530 nmdc:mga08x19_289415_c1
1531 nmdc:mga08x19_3764_c1
1532 nmdc:mga08x19_60441_c1
1533 nmdc:mga08x19_655064_c1
1534 nmdc:mga08x19_96792_c1
1535 nmdc:mga0a205_100507_c1
1536 nmdc:mga0a205_1007688_c1
1537 nmdc:mga0a205_114982_c1
1538 nmdc:mga0a205_15154_c1
1539 nmdc:mga0a205_159_c1
1540 nmdc:mga0a205_1853_c1
1541 nmdc:mga0a205_27122_c1
1542 nmdc:mga0a205_2802_c1
1543 nmdc:mga0a205_31771_c1
1544 nmdc:mga0a205_6026_c1
1545 nmdc:mga0a205_72542_c1
1546 nmdc:mga0a205_93596_c1
1547 Ga0501084_0000563
1548 Ga0501084_0011130
1549 Ga0501084_0026922
1550 Ga0501084_0493880
1551 Ga0501084_0594366
1552 Ga0590077_054480
1553 Ga0501082_0000414
1554 Ga0501082_0000881
1555 Ga0501082_0019325
1556 Ga0501082_0034213
1557 Ga0501082_0172075
1558 Ga0530510_0000205
1559 Ga0530510_0032539
1560 Ga0530510_0033934
1561 Ga0530510_0085316
1562 Ga0530510_0133227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02470

MlaD

MlaD protein

37

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uw8-assembly1.cif.gz_B structure of e. coli mce protein mlad, core mce domain 0.9751 39 130
5uw8-assembly1.cif.gz_D structure of e. coli mce protein mlad, core mce domain 0.9723 39 131
5uw8-assembly1.cif.gz_G structure of e. coli mce protein mlad, core mce domain 0.9714 39 131
5uw2-assembly1.cif.gz_A-2 structure of e. coli mce protein mlad, periplasmic domain 0.9355 39 142
5uw2-assembly1.cif.gz_B structure of e. coli mce protein mlad, periplasmic domain 0.9277 39 142
ID Description Score Start End Superfamily
af_O53969_38_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9834 38 113 2.40.50.140
af_O07787_38_113_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9764 40 113 2.40.50.140
af_O07784_38_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9755 39 110 2.40.50.140
af_I6YGB1_43_119_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9699 38 113 2.40.50.140
af_O53968_37_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9675 38 113 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A538AY88-F1-model_v4 MCE family protein 0.947 35 136
AF-A0A0S8CKC2-F1-model_v4 Outer membrane lipid asymmetry maintenance protein MlaD 0.9444 49 146
AF-A0A0S8CKC2-F1-model_v4 Outer membrane lipid asymmetry maintenance protein MlaD 0.9352 49 146
AF-A0A5C5RC11-F1-model_v4 MCE family protein 0.9162 35 145 GO:0005576
AF-A0A2S9FPU7-F1-model_v4 Mammalian cell entry protein 0.9132 37 133 GO:0005576

Map