F480554

General Info

Members Datasets Scaffolds Average Seq Length
781 366 1562 142

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100255797|Ga0070679_1002557972
Length 147
Sequence MNETTVTTPNELEIRVERVFDAPRAHVFSIWTDPQLIPEWWGDGTVVEEMDVRAGGSYRFRTAYGLVEGEFREVDPPERLVQTFQNHLQTLEFEDLGGEQTKLTQTMRFATTAERDTTMQYGVEEGARGGFARIDAGLQRLEVIRNG

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
96 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
97 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
98 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
174 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
214 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
217 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
218 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
219 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
220 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
221 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
222 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
223 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
235 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
236 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
274 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
281 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
285 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
292 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
356 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 2.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 6.4
Rhizosphere 93.09
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100255797 3300005530 Bacteria 1707
2 JGI24747J21853_1007247 3300001978 Unclassified 1064
3 JGI24749J21850_1014492 3300002076 Unclassified 1106
4 JGI24744J21845_10002767 3300002077 Unclassified 3581
5 JGI24742J22300_10011032 3300002244 Unclassified 1498
6 JGI25406J46586_10098674 3300003203 Unclassified 873
7 JGI25404J52841_10134222 3300003659 Unclassified 524
8 Ga0070658_10010014 3300005327 Bacteria 7614
9 Ga0070658_10031015 3300005327 Bacteria 4292
10 Ga0070658_10311673 3300005327 Bacteria 1343
11 Ga0070676_10257159 3300005328 Bacteria 1168
12 Ga0070683_100084983 3300005329 Bacteria 2965
13 Ga0070690_100202611 3300005330 Bacteria 1382
14 Ga0068869_100218714 3300005334 Bacteria 1509
15 Ga0068869_100811028 3300005334 Bacteria 805
16 Ga0070680_101846937 3300005336 Bacteria 524
17 Ga0070682_100006239 3300005337 Bacteria 6685
18 Ga0070682_100132180 3300005337 Bacteria 1691
19 Ga0070682_100849880 3300005337 Bacteria 746
20 Ga0068868_100010866 3300005338 Bacteria 6606
21 Ga0068868_100029484 3300005338 Bacteria 4201
22 Ga0068868_101420885 3300005338 Bacteria 648
23 Ga0068868_102439837 3300005338 Bacteria 500
24 Ga0070660_100009852 3300005339 Bacteria 6740
25 Ga0070660_100123361 3300005339 Bacteria 2069
26 Ga0070660_100194328 3300005339 Bacteria 1644
27 Ga0070660_100581470 3300005339 Bacteria 935
28 Ga0070689_100002533 3300005340 Bacteria 11969
29 Ga0070691_10076739 3300005341 Bacteria 1630
30 Ga0070691_10229736 3300005341 Bacteria 987
31 Ga0070691_10231975 3300005341 Bacteria 983
32 Ga0070661_100180977 3300005344 Bacteria 1604
33 Ga0070692_10016258 3300005345 Bacteria 3538
34 Ga0070692_10025776 3300005345 Bacteria 2901
35 Ga0070692_10249563 3300005345 Bacteria 1062
36 Ga0070668_100048441 3300005347 Bacteria 3268
37 Ga0070669_100082485 3300005353 Bacteria 2397
38 Ga0070669_100101963 3300005353 Bacteria 2166
39 Ga0070675_100271317 3300005354 Bacteria 1489
40 Ga0070675_101801248 3300005354 Bacteria 565
41 Ga0070671_100162779 3300005355 Bacteria 1886
42 Ga0070671_100450340 3300005355 Bacteria 1104
43 Ga0070674_100004775 3300005356 Bacteria 7764
44 Ga0070674_100011295 3300005356 Bacteria 5433
45 Ga0070674_100090357 3300005356 Bacteria 2209
46 Ga0070674_100648060 3300005356 Bacteria 897
47 Ga0070673_100086160 3300005364 Bacteria 2559
48 Ga0070688_100129160 3300005365 Bacteria 1702
49 Ga0070688_100133872 3300005365 Bacteria 1676
50 Ga0070659_100013105 3300005366 Bacteria 6166
51 Ga0070659_100081606 3300005366 Bacteria 2583
52 Ga0070659_100280352 3300005366 Bacteria 1386
53 Ga0070703_10144665 3300005406 Bacteria 887
54 Ga0070709_10003132 3300005434 Bacteria 8871
55 Ga0070709_10744168 3300005434 Bacteria 766
56 Ga0070714_100272881 3300005435 Bacteria 1569
57 Ga0070714_100819950 3300005435 Bacteria 901
58 Ga0070713_100081146 3300005436 Bacteria 2767
59 Ga0070713_100415313 3300005436 Bacteria 1259
60 Ga0070710_10001597 3300005437 Bacteria 10691
61 Ga0070710_10166185 3300005437 Bacteria 1372
62 Ga0070710_10297332 3300005437 Bacteria 1053
63 Ga0070701_10000911 3300005438 Bacteria 10702
64 Ga0070711_100005382 3300005439 Bacteria 7656
65 Ga0070711_100016507 3300005439 Bacteria 4691
66 Ga0070711_100178681 3300005439 Bacteria 1624
67 Ga0070711_100906768 3300005439 Bacteria 752
68 Ga0070705_100018646 3300005440 Bacteria 3640
69 Ga0070705_100356261 3300005440 Bacteria 1069
70 Ga0070700_100010779 3300005441 Bacteria 5052
71 Ga0070700_100087974 3300005441 Bacteria 2021
72 Ga0070700_101740833 3300005441 Bacteria 536
73 Ga0070694_100087273 3300005444 Bacteria 2182
74 Ga0070694_100201590 3300005444 Bacteria 1483
75 Ga0070694_100329378 3300005444 Bacteria 1177
76 Ga0070678_100000298 3300005456 Bacteria 23008
77 Ga0070678_100456950 3300005456 Bacteria 1119
78 Ga0070662_100057234 3300005457 Bacteria 2833
79 Ga0070662_100085197 3300005457 Bacteria 2361
80 Ga0070662_100249345 3300005457 Bacteria 1427
81 Ga0070662_100264482 3300005457 Bacteria 1387
82 Ga0070681_10021893 3300005458 Bacteria 6411
83 Ga0070681_10087075 3300005458 Bacteria 3077
84 Ga0070681_10095494 3300005458 Bacteria 2921
85 Ga0068867_100002281 3300005459 Bacteria 13492
86 Ga0068867_100067778 3300005459 Bacteria 2662
87 Ga0068867_100146039 3300005459 Bacteria 1854
88 Ga0070685_10000447 3300005466 Bacteria 24052
89 Ga0070685_10002987 3300005466 Bacteria 8639
90 Ga0070706_100041574 3300005467 Bacteria 4243
91 Ga0070706_101301486 3300005467 Bacteria 667
92 Ga0070698_101855944 3300005471 Bacteria 555
93 Ga0070699_100039845 3300005518 Bacteria 4068
94 Ga0070679_100060649 3300005530 Bacteria 3769
95 Ga0070679_100064395 3300005530 Bacteria 3654
96 Ga0070679_100485509 3300005530 Bacteria 1179
97 Ga0070684_100054751 3300005535 Bacteria 3476
98 Ga0070684_100293596 3300005535 Bacteria 1491
99 Ga0070684_101106002 3300005535 Bacteria 745
100 Ga0070697_100092336 3300005536 Bacteria 2504
101 Ga0068853_100089301 3300005539 Bacteria 2706
102 Ga0070672_100467895 3300005543 Bacteria 1087
103 Ga0070686_100025046 3300005544 Bacteria 3584
104 Ga0070686_100285484 3300005544 Bacteria 1219
105 Ga0070695_100049725 3300005545 Bacteria 2684
106 Ga0070695_100066827 3300005545 Bacteria 2344
107 Ga0070695_100200927 3300005545 Bacteria 1424
108 Ga0070695_100216559 3300005545 Bacteria 1378
109 Ga0070695_100631715 3300005545 Bacteria 844
110 Ga0070696_100034907 3300005546 Bacteria 3462
111 Ga0070696_100105045 3300005546 Bacteria 2028
112 Ga0070696_100116635 3300005546 Bacteria 1928
113 Ga0070696_100468716 3300005546 Bacteria 997
114 Ga0070696_100800679 3300005546 Bacteria 775
115 Ga0070696_100906276 3300005546 Bacteria 732
116 Ga0070693_100090191 3300005547 Bacteria 1846
117 Ga0070693_100168802 3300005547 Bacteria 1399
118 Ga0070693_100474436 3300005547 Bacteria 883
119 Ga0070704_100006657 3300005549 Bacteria 6827
120 Ga0070704_100047803 3300005549 Bacteria 2992
121 Ga0068855_100274790 3300005563 Bacteria 1872
122 Ga0068855_100288918 3300005563 Bacteria 1818
123 Ga0068855_100369662 3300005563 Bacteria 1576
124 Ga0070664_101105706 3300005564 Bacteria 746
125 Ga0070664_101240890 3300005564 Bacteria 704
126 Ga0068854_100033291 3300005578 Bacteria 3592
127 Ga0068856_100015136 3300005614 Bacteria 7451
128 Ga0068856_100145291 3300005614 Bacteria 2379
129 Ga0068856_100412436 3300005614 Bacteria 1371
130 Ga0070702_100010697 3300005615 Bacteria 4532
131 Ga0070702_100093762 3300005615 Bacteria 1826
132 Ga0068852_100002120 3300005616 Bacteria 13586
133 Ga0068852_100578486 3300005616 Bacteria 1126
134 Ga0068859_100894209 3300005617 Bacteria 973
135 Ga0068864_100398778 3300005618 Bacteria 1307
136 Ga0068864_101028489 3300005618 Bacteria 818
137 Ga0068864_101648116 3300005618 Bacteria 646
138 Ga0068866_10003034 3300005718 Bacteria 6928
139 Ga0068866_10404241 3300005718 Bacteria 882
140 Ga0068866_10527625 3300005718 Bacteria 786
141 Ga0068861_100078542 3300005719 Bacteria 2578
142 Ga0068861_100110413 3300005719 Bacteria 2203
143 Ga0068861_100465497 3300005719 Bacteria 1136
144 Ga0068863_100250954 3300005841 Bacteria 1709
145 Ga0068858_100230101 3300005842 Bacteria 1757
146 Ga0068858_101213279 3300005842 Bacteria 742
147 Ga0068860_100178293 3300005843 Bacteria 2054
148 Ga0068862_100169158 3300005844 Bacteria 1956
149 Ga0081455_10005176 3300005937 Bacteria 14357
150 Ga0081455_10029269 3300005937 Bacteria 5022
151 Ga0081455_10297307 3300005937 Bacteria 1160
152 Ga0081540_1001617 3300005983 Bacteria 19187
153 Ga0081540_1007353 3300005983 Bacteria 7869
154 Ga0081540_1020995 3300005983 Bacteria 3907
155 Ga0081539_10000249 3300005985 Bacteria 125691
156 Ga0081539_10009325 3300005985 Bacteria 8235
157 Ga0070717_10387744 3300006028 Bacteria 1253
158 Ga0070717_10609212 3300006028 Bacteria 991
159 Ga0070715_10018743 3300006163 Bacteria 2643
160 Ga0070715_10747408 3300006163 Bacteria 589
161 Ga0070716_100243073 3300006173 Bacteria 1222
162 Ga0070716_100781292 3300006173 Bacteria 737
163 Ga0070712_100010423 3300006175 Bacteria 5864
164 Ga0070712_100099379 3300006175 Bacteria 2147
165 Ga0097621_100012262 3300006237 Bacteria 6343
166 Ga0097621_100854167 3300006237 Bacteria 846
167 Ga0097621_100872579 3300006237 Bacteria 837
168 Ga0075433_10007855 3300006852 Bacteria 8482
169 Ga0075434_100024229 3300006871 Bacteria 5931
170 Ga0075434_101841595 3300006871 Bacteria 612
171 Ga0075429_101462448 3300006880 Bacteria 595
172 Ga0068865_100003159 3300006881 Bacteria 9864
173 Ga0068865_100105433 3300006881 Bacteria 2071
174 Ga0068865_100461881 3300006881 Bacteria 1052
175 Ga0068865_101570102 3300006881 Unclassified 591
176 Ga0097620_100894190 3300006931 Bacteria 973
177 Ga0105240_10003539 3300009093 Bacteria 24224
178 Ga0105240_10113618 3300009093 Bacteria 3272
179 Ga0111539_10083490 3300009094 Bacteria 3756
180 Ga0111539_10325710 3300009094 Bacteria 1788
181 Ga0111539_10338527 3300009094 Bacteria 1751
182 Ga0105245_10014619 3300009098 Bacteria 6835
183 Ga0105245_10020835 3300009098 Bacteria 5747
184 Ga0105245_10067647 3300009098 Bacteria 3235
185 Ga0105245_10507620 3300009098 Bacteria 1223
186 Ga0105245_10938467 3300009098 Bacteria 908
187 Ga0105245_11640002 3300009098 Bacteria 695
188 Ga0114129_10111797 3300009147 Bacteria 3769
189 Ga0105243_10002101 3300009148 Bacteria 16849
190 Ga0105243_10096160 3300009148 Bacteria 2450
191 Ga0105243_10229801 3300009148 Bacteria 1645
192 Ga0105243_10238210 3300009148 Bacteria 1618
193 Ga0105243_10797071 3300009148 Bacteria 931
194 Ga0105241_10322303 3300009174 Bacteria 1333
195 Ga0105242_10003124 3300009176 Bacteria 12921
196 Ga0105242_10045231 3300009176 Bacteria 3567
197 Ga0105248_10036341 3300009177 Bacteria 5508
198 Ga0105248_10896304 3300009177 Bacteria 1001
199 Ga0105248_11036598 3300009177 Bacteria 927
200 Ga0105237_10553290 3300009545 Bacteria 1157
201 Ga0105237_10624040 3300009545 Bacteria 1085
202 Ga0105237_12250818 3300009545 Bacteria 555
203 Ga0105238_10309355 3300009551 Bacteria 1565
204 Ga0105249_10007650 3300009553 Bacteria 9418
205 Ga0105249_10016021 3300009553 Bacteria 6644
206 Ga0105249_10366382 3300009553 Bacteria 1463
207 Ga0105239_10007916 3300010375 Bacteria 12151
208 Ga0105239_10298384 3300010375 Bacteria 1814
209 Ga0105239_10437373 3300010375 Bacteria 1483
210 Ga0157336_1015904 3300012477 Bacteria 633
211 Ga0157346_1009527 3300012480 Bacteria 689
212 Ga0157335_1003494 3300012492 Bacteria 1012
213 Ga0157345_1028348 3300012498 Bacteria 613
214 Ga0157373_10168910 3300013100 Bacteria 1539
215 Ga0157373_10284989 3300013100 Bacteria 1171
216 Ga0157371_11244176 3300013102 Bacteria 575
217 Ga0157370_10133718 3300013104 Bacteria 2313
218 Ga0157369_10021425 3300013105 Bacteria 7230
219 Ga0157369_10307738 3300013105 Bacteria 1648
220 Ga0157369_10430659 3300013105 Bacteria 1367
221 Ga0157374_10001932 3300013296 Bacteria 17377
222 Ga0157374_10360493 3300013296 Bacteria 1446
223 Ga0157374_11983877 3300013296 Bacteria 608
224 Ga0157378_10006911 3300013297 Bacteria 9908
225 Ga0157378_10798543 3300013297 Bacteria 969
226 Ga0163162_10126888 3300013306 Bacteria 2658
227 Ga0163162_10220663 3300013306 Bacteria 2026
228 Ga0163162_10269338 3300013306 Bacteria 1835
229 Ga0163162_10459604 3300013306 Bacteria 1405
230 Ga0163162_10636944 3300013306 Bacteria 1190
231 Ga0163162_11525609 3300013306 Bacteria 761
232 Ga0157372_10041522 3300013307 Bacteria 5087
233 Ga0157372_10349386 3300013307 Bacteria 1723
234 Ga0157372_10664886 3300013307 Bacteria 1213
235 Ga0157375_10014052 3300013308 Bacteria 7141
236 Ga0157375_10034932 3300013308 Bacteria 4794
237 Ga0157375_10149657 3300013308 Bacteria 2469
238 Ga0157375_12657882 3300013308 Bacteria 598
239 Ga0157380_10362448 3300014326 Bacteria 1361
240 Ga0157380_10375854 3300014326 Bacteria 1339
241 Ga0157377_10001693 3300014745 Bacteria 9609
242 Ga0157377_10448040 3300014745 Bacteria 890
243 Ga0157376_10005356 3300014969 Bacteria 8964
244 Ga0157376_10407073 3300014969 Bacteria 1317
245 Ga0197907_11136786 3300020069 Bacteria 2629
246 Ga0197907_11388276 3300020069 Bacteria 2376
247 Ga0206356_10414775 3300020070 Bacteria 984
248 Ga0206356_10418925 3300020070 Bacteria 5905
249 Ga0206356_10895144 3300020070 Bacteria 815
250 Ga0206356_10933505 3300020070 Bacteria 1279
251 Ga0206349_1647817 3300020075 Bacteria 829
252 Ga0206350_10540349 3300020080 Bacteria 935
253 Ga0206354_10989077 3300020081 Bacteria 1676
254 Ga0206353_11184902 3300020082 Bacteria 2958
255 Ga0207692_10145536 3300025898 Bacteria 1352
256 Ga0207642_10071066 3300025899 Bacteria 1656
257 Ga0207642_10187847 3300025899 Bacteria 1131
258 Ga0207688_10167942 3300025901 Bacteria 1303
259 Ga0207680_10373878 3300025903 Bacteria 1004
260 Ga0207685_10009199 3300025905 Bacteria 2858
261 Ga0207685_10569991 3300025905 Unclassified 604
262 Ga0207699_10231823 3300025906 Bacteria 1265
263 Ga0207699_10296913 3300025906 Bacteria 1127
264 Ga0207699_10725675 3300025906 Bacteria 728
265 Ga0207645_10484515 3300025907 Bacteria 837
266 Ga0207705_10205211 3300025909 Bacteria 1494
267 Ga0207705_10758561 3300025909 Bacteria 754
268 Ga0207684_10184259 3300025910 Bacteria 1800
269 Ga0207684_11528999 3300025910 Bacteria 542
270 Ga0207654_10333098 3300025911 Bacteria 1041
271 Ga0207707_10390904 3300025912 Bacteria 1195
272 Ga0207707_10671688 3300025912 Bacteria 872
273 Ga0207695_10088950 3300025913 Bacteria 3107
274 Ga0207695_10222293 3300025913 Bacteria 1795
275 Ga0207693_10007175 3300025915 Bacteria 9179
276 Ga0207693_10009461 3300025915 Bacteria 7938
277 Ga0207693_10808515 3300025915 Bacteria 722
278 Ga0207693_11012651 3300025915 Unclassified 634
279 Ga0207663_10092229 3300025916 Bacteria 2013
280 Ga0207663_10306017 3300025916 Bacteria 1189
281 Ga0207663_10354798 3300025916 Bacteria 1111
282 Ga0207663_10364389 3300025916 Bacteria 1097
283 Ga0207660_10015071 3300025917 Bacteria 5096
284 Ga0207660_10136279 3300025917 Bacteria 1873
285 Ga0207662_10091054 3300025918 Bacteria 1876
286 Ga0207662_10918879 3300025918 Unclassified 620
287 Ga0207657_10004070 3300025919 Bacteria 15518
288 Ga0207657_10073499 3300025919 Bacteria 2889
289 Ga0207657_10235615 3300025919 Bacteria 1463
290 Ga0207649_10169969 3300025920 Bacteria 1517
291 Ga0207649_11419504 3300025920 Bacteria 549
292 Ga0207652_10053670 3300025921 Archaea 3462
293 Ga0207652_10099937 3300025921 Bacteria 2561
294 Ga0207652_10340249 3300025921 Bacteria 1354
295 Ga0207652_10764724 3300025921 Bacteria 859
296 Ga0207681_10153612 3300025923 Bacteria 1728
297 Ga0207659_10147119 3300025926 Bacteria 1836
298 Ga0207659_10232698 3300025926 Bacteria 1487
299 Ga0207687_10006705 3300025927 Bacteria 7597
300 Ga0207687_10013272 3300025927 Bacteria 5378
301 Ga0207687_10210897 3300025927 Bacteria 1524
302 Ga0207687_10256490 3300025927 Bacteria 1392
303 Ga0207687_10437396 3300025927 Bacteria 1082
304 Ga0207687_10508957 3300025927 Bacteria 1006
305 Ga0207700_10306428 3300025928 Bacteria 1373
306 Ga0207700_10404236 3300025928 Bacteria 1197
307 Ga0207700_10857923 3300025928 Bacteria 812
308 Ga0207664_10035662 3300025929 Bacteria 3840
309 Ga0207664_10065806 3300025929 Bacteria 2903
310 Ga0207664_10153832 3300025929 Bacteria 1956
311 Ga0207664_10354172 3300025929 Bacteria 1300
312 Ga0207664_10385981 3300025929 Bacteria 1244
313 Ga0207644_10108335 3300025931 Bacteria 2097
314 Ga0207706_10010028 3300025933 Bacteria 8680
315 Ga0207706_10235701 3300025933 Bacteria 1600
316 Ga0207686_10078108 3300025934 Bacteria 2151
317 Ga0207686_10175654 3300025934 Bacteria 1514
318 Ga0207686_10209159 3300025934 Bacteria 1401
319 Ga0207709_10003145 3300025935 Bacteria 9924
320 Ga0207709_10313122 3300025935 Bacteria 1172
321 Ga0207670_10065235 3300025936 Bacteria 2498
322 Ga0207669_10134075 3300025937 Bacteria 1707
323 Ga0207669_10159763 3300025937 Bacteria 1590
324 Ga0207669_10390084 3300025937 Bacteria 1087
325 Ga0207669_11176748 3300025937 Bacteria 649
326 Ga0207704_10004679 3300025938 Bacteria 6274
327 Ga0207704_10776279 3300025938 Bacteria 799
328 Ga0207704_10780049 3300025938 Bacteria 797
329 Ga0207691_10021097 3300025940 Bacteria 6154
330 Ga0207691_10658986 3300025940 Bacteria 884
331 Ga0207711_10587231 3300025941 Bacteria 1039
332 Ga0207711_10723760 3300025941 Bacteria 928
333 Ga0207689_10731539 3300025942 Bacteria 835
334 Ga0207661_10280387 3300025944 Bacteria 1489
335 Ga0207661_10457704 3300025944 Bacteria 1163
336 Ga0207661_10549292 3300025944 Bacteria 1058
337 Ga0207667_10092086 3300025949 Bacteria 3131
338 Ga0207667_10205708 3300025949 Bacteria 2018
339 Ga0207667_10243170 3300025949 Bacteria 1841
340 Ga0207667_10375308 3300025949 Bacteria 1449
341 Ga0207667_10508909 3300025949 Bacteria 1221
342 Ga0207668_10919441 3300025972 Bacteria 779
343 Ga0207668_11532746 3300025972 Bacteria 601
344 Ga0207658_11838861 3300025986 Bacteria 552
345 Ga0207677_10019873 3300026023 Bacteria 4066
346 Ga0207677_10037758 3300026023 Bacteria 3160
347 Ga0207677_10053014 3300026023 Bacteria 2759
348 Ga0207703_10303686 3300026035 Bacteria 1456
349 Ga0207639_10237607 3300026041 Bacteria 1583
350 Ga0207678_10007751 3300026067 Bacteria 9486
351 Ga0207708_10007367 3300026075 Bacteria 8132
352 Ga0207708_10203561 3300026075 Bacteria 1580
353 Ga0207708_10514035 3300026075 Bacteria 1005
354 Ga0207702_10096592 3300026078 Bacteria 2599
355 Ga0207702_10123845 3300026078 Bacteria 2317
356 Ga0207702_10246574 3300026078 Bacteria 1675
357 Ga0207648_10010532 3300026089 Bacteria 8756
358 Ga0207648_10085014 3300026089 Bacteria 2760
359 Ga0207648_10101086 3300026089 Bacteria 2527
360 Ga0207648_10202316 3300026089 Bacteria 1761
361 Ga0207648_10209194 3300026089 Bacteria 1731
362 Ga0207648_10303568 3300026089 Bacteria 1432
363 Ga0207676_10330735 3300026095 Bacteria 1402
364 Ga0207676_11022645 3300026095 Bacteria 815
365 Ga0207675_100011038 3300026118 Bacteria 8461
366 Ga0207675_100015239 3300026118 Bacteria 7171
367 Ga0207675_100805329 3300026118 Bacteria 953
368 Ga0207683_10000598 3300026121 Bacteria 33267
369 Ga0207683_10031896 3300026121 Bacteria 4575
370 Ga0207683_10562022 3300026121 Bacteria 1055
371 Ga0207698_10024518 3300026142 Bacteria 4236
372 Ga0207698_10334928 3300026142 Bacteria 1423
373 Ga0210000_1039469 3300027462 Bacteria 747
374 Ga0209983_1067332 3300027665 Bacteria 795
375 Ga0268264_10160254 3300028381 Bacteria 2026
376 Ga0265319_1012200 3300028563 Bacteria 3482
377 Ga0265319_1015651 3300028563 Bacteria 2934
378 Ga0265319_1104184 3300028563 Bacteria 889
379 Ga0265334_10001413 3300028573 Bacteria 11545
380 Ga0265318_10000629 3300028577 Bacteria 24327
381 Ga0265323_10025688 3300028653 Bacteria 2226
382 Ga0265322_10020174 3300028654 Bacteria 1910
383 Ga0265322_10122156 3300028654 Bacteria 742
384 Ga0265336_10021126 3300028666 Bacteria 2083
385 Ga0265338_10005535 3300028800 Bacteria 16442
386 Ga0265338_10110024 3300028800 Bacteria 2221
387 Ga0265338_10908302 3300028800 Bacteria 599
388 Ga0265324_10030406 3300029957 Bacteria 1895
389 Ga0316178_1082349 3300030735 Bacteria 1209
390 Ga0265330_10013635 3300031235 Bacteria 3785
391 Ga0265332_10015556 3300031238 Bacteria 3359
392 Ga0265328_10051774 3300031239 Bacteria 1507
393 Ga0265325_10001477 3300031241 Bacteria 16563
394 Ga0265329_10053038 3300031242 Bacteria 1289
395 Ga0265340_10013995 3300031247 Bacteria 4202
396 Ga0265339_10037405 3300031249 Bacteria 2712
397 Ga0265331_10105768 3300031250 Bacteria 1292
398 Ga0265327_10018097 3300031251 Bacteria 4382
399 Ga0265327_10169313 3300031251 Bacteria 1004
400 Ga0265327_10386880 3300031251 Bacteria 608
401 Ga0265316_10012394 3300031344 Bacteria 7649
402 Ga0265313_10028573 3300031595 Bacteria 2895
403 Ga0265314_10079793 3300031711 Bacteria 2162
404 Ga0265342_10015521 3300031712 Bacteria 5007
405 Ga0307412_11436877 3300031911 Bacteria 625
406 Ga0307409_100305611 3300031995 Bacteria 1482
407 Ga0307409_101836907 3300031995 Bacteria 635
408 Ga0307415_100306289 3300032126 Bacteria 1318
409 Ga0307415_102552523 3300032126 Bacteria 504
410 Ga0373945_0578745 3300035116 Bacteria 506
411 Ga0373956_0536246 3300035119 Bacteria 559
412 Ga0373957_0013000 3300035120 Bacteria 2816
413 Ga0373957_0146164 3300035120 Bacteria 969
414 Ga0373943_0004832 3300035170 Bacteria 6092
415 Ga0373943_0315709 3300035170 Bacteria 890
416 Ga0373946_0118734 3300035171 Bacteria 1205
417 Ga0373955_0125975 3300035172 Bacteria 1492
418 Ga0373931_0998495 3300035691 Bacteria 566
419 Ga0373927_0327360 3300035695 Bacteria 1009
420 Ga0373927_1010587 3300035695 Bacteria 549
421 Ga0373933_0145732 3300035724 Bacteria 1497
422 Ga0373947_0004492 3300035725 Bacteria 8186
423 Ga0373937_0000989 3300036401 Bacteria 24140
424 Ga0373937_0108707 3300036401 Bacteria 2578
425 Ga0373937_1110511 3300036401 Bacteria 739
426 Ga0373925_0245003 3300037068 Bacteria 1436
427 Ga0373925_1153427 3300037068 Bacteria 637
428 Ga0395899_0018980 3300037312 Bacteria 5225
429 Ga0395899_0033879 3300037312 Bacteria 3835
430 Ga0395900_0008294 3300037418 Bacteria 10691
431 Ga0395900_0008296 3300037418 Bacteria 10690
432 Ga0395900_0062643 3300037418 Bacteria 3823
433 Ga0395900_0092498 3300037418 Bacteria 3107
434 Ga0395900_0164899 3300037418 Bacteria 2258
435 Ga0395900_0461916 3300037418 Bacteria 1224
436 Ga0395900_0484359 3300037418 Bacteria 1189
437 Ga0395898_0012349 3300037466 Bacteria 8834
438 Ga0395898_0030535 3300037466 Bacteria 5392
439 Ga0395898_0033027 3300037466 Bacteria 5165
440 Ga0395898_0933763 3300037466 Bacteria 805
441 Ga0395905_0018702 3300037471 Bacteria 6572
442 Ga0395905_0046389 3300037471 Bacteria 4074
443 Ga0395905_0158871 3300037471 Bacteria 2125
444 Ga0395905_1222890 3300037471 Bacteria 655
445 Ga0395901_0004228 3300038443 Bacteria 14476
446 Ga0395901_0094145 3300038443 Bacteria 3137
447 Ga0395901_0113668 3300038443 Bacteria 2843
448 Ga0395901_0162831 3300038443 Bacteria 2342
449 Ga0395901_0704326 3300038443 Bacteria 1007
450 Ga0436365_0121854 3300039437 Bacteria 1246
451 Ga0436362_1078061 3300039453 Bacteria 1056
452 Ga0439453_0120703 3300041408 Bacteria 601
453 Ga0451804_0288450 3300041463 Bacteria 611
454 Ga0451853_0516119 3300041512 Bacteria 1097
455 Ga0451853_4071529 3300041512 Unclassified 806
456 Ga0439448_0083483 3300042005 Bacteria 1074
457 Ga0439448_0111125 3300042005 Bacteria 936
458 Ga0439450_053035 3300042008 Bacteria 967
459 Ga0439456_103048 3300042013 Bacteria 647
460 Ga0439462_0036533 3300042015 Bacteria 1307
461 Ga0450888_070280 3300042126 Bacteria 526
462 Ga0439435_0097144 3300042436 Bacteria 902
463 Ga0439464_0063750 3300042439 Bacteria 1082
464 Ga0439460_0255246 3300042461 Bacteria 607
465 Ga0466972_0034382 3300044658 Bacteria 2484
466 Ga0466963_0027782 3300044694 Bacteria 3627
467 Ga0466963_0029684 3300044694 Bacteria 3522
468 Ga0466964_0380278 3300044706 Bacteria 733
469 Ga0466968_0067580 3300044735 Bacteria 1550
470 Ga0466959_0542409 3300045049 Bacteria 785
471 Ga0466958_0289002 3300045836 Bacteria 1051
472 Ga0466967_0028281 3300045976 Bacteria 4679
473 Ga0466967_0116403 3300045976 Bacteria 2462
474 Ga0466967_0232508 3300045976 Bacteria 1756
475 Ga0466967_0319298 3300045976 Bacteria 1497
476 Ga0466967_1093773 3300045976 Bacteria 794
477 Ga0466967_1725860 3300045976 Bacteria 623
478 Ga0495592_0000368 3300046454 Bacteria 35552
479 Ga0495592_0056583 3300046454 Bacteria 2898
480 Ga0495592_0104109 3300046454 Bacteria 2018
481 Ga0495592_0208462 3300046454 Bacteria 1314
482 Ga0495592_0330261 3300046454 Bacteria 983
483 Ga0495603_0000747 3300046455 Bacteria 18566
484 Ga0495603_0025900 3300046455 Bacteria 3545
485 Ga0495629_0053356 3300046459 Bacteria 2829
486 Ga0495641_0001759 3300046461 Bacteria 18009
487 Ga0495651_0001115 3300046462 Bacteria 20765
488 Ga0495651_0039520 3300046462 Bacteria 3672
489 Ga0495651_0121311 3300046462 Bacteria 1920
490 Ga0495651_0397402 3300046462 Bacteria 901
491 Ga0495653_0031135 3300046463 Bacteria 4242
492 Ga0495580_0046129 3300046472 Bacteria 3094
493 Ga0495580_0221191 3300046472 Bacteria 1301
494 Ga0495582_0032961 3300046473 Bacteria 2846
495 Ga0495582_0131519 3300046473 Bacteria 1414
496 Ga0495605_0191824 3300046474 Bacteria 894
497 Ga0495605_0204508 3300046474 Bacteria 859
498 Ga0495639_0110742 3300046475 Bacteria 1303
499 Ga0495639_0136000 3300046475 Bacteria 1179
500 Ga0495639_0741152 3300046475 Bacteria 508
501 Ga0495662_0023641 3300046476 Bacteria 2967
502 Ga0495664_0089739 3300046477 Bacteria 1848
503 Ga0495664_0202274 3300046477 Bacteria 1203
504 Ga0495664_0276741 3300046477 Bacteria 1014
505 Ga0495584_0045183 3300046491 Bacteria 2222
506 Ga0495585_0337856 3300046492 Bacteria 734
507 Ga0495585_0436980 3300046492 Bacteria 627
508 Ga0495594_0001154 3300046499 Bacteria 13808
509 Ga0495583_0188546 3300046506 Bacteria 842
510 Ga0495608_0004604 3300046511 Bacteria 9846
511 Ga0495608_0007943 3300046511 Bacteria 7456
512 Ga0495608_0014454 3300046511 Bacteria 5476
513 Ga0495618_0006848 3300046514 Bacteria 6906
514 Ga0495618_0054004 3300046514 Bacteria 2541
515 Ga0495620_0104675 3300046515 Bacteria 1126
516 Ga0495628_0000650 3300046516 Bacteria 31811
517 Ga0495628_0063623 3300046516 Bacteria 2890
518 Ga0495628_0077423 3300046516 Bacteria 2587
519 Ga0495628_0525431 3300046516 Bacteria 852
520 Ga0495630_0008480 3300046517 Bacteria 7378
521 Ga0495630_0063774 3300046517 Bacteria 2768
522 Ga0495666_0060558 3300046526 Bacteria 1809
523 Ga0495642_0365987 3300046528 Bacteria 634
524 Ga0495652_0018343 3300046529 Bacteria 6240
525 Ga0495652_0055902 3300046529 Bacteria 3354
526 Ga0495652_0127140 3300046529 Bacteria 2023
527 Ga0495652_0335802 3300046529 Bacteria 1087
528 Ga0495652_0346199 3300046529 Bacteria 1066
529 Ga0495652_0352273 3300046529 Bacteria 1054
530 Ga0495652_1017563 3300046529 Bacteria 541
531 Ga0495652_1135809 3300046529 Bacteria 506
532 Ga0495665_0044521 3300046531 Bacteria 2358
533 Ga0495665_0201431 3300046531 Bacteria 1032
534 Ga0495665_0370221 3300046531 Bacteria 729
535 Ga0495665_0468204 3300046531 Bacteria 636
536 Ga0495640_0008963 3300046533 Bacteria 7813
537 Ga0495640_0322861 3300046533 Bacteria 956
538 Ga0495640_0379324 3300046533 Bacteria 870
539 Ga0495586_0072432 3300046535 Bacteria 1884
540 Ga0495587_0000469 3300046536 Bacteria 27940
541 Ga0495587_0023055 3300046536 Bacteria 3828
542 Ga0495587_0088831 3300046536 Bacteria 1787
543 Ga0495598_0294038 3300046537 Bacteria 613
544 Ga0495609_0037410 3300046538 Bacteria 2189
545 Ga0495621_0158089 3300046539 Bacteria 895
546 Ga0495645_0000456 3300046543 Bacteria 28144
547 Ga0495645_0116519 3300046543 Bacteria 1885
548 Ga0495645_0173047 3300046543 Bacteria 1485
549 Ga0495667_0004125 3300046559 Bacteria 9768
550 Ga0495667_0057319 3300046559 Bacteria 2560
551 Ga0495667_0077433 3300046559 Bacteria 2163
552 Ga0495667_0726317 3300046559 Bacteria 615
553 Ga0495656_0015713 3300046615 Bacteria 2863
554 Ga0495656_0085873 3300046615 Bacteria 1430
555 Ga0495668_0225610 3300046616 Bacteria 1026
556 Ga0495634_0171039 3300046642 Bacteria 1365
557 Ga0495635_0069739 3300046663 Bacteria 2410
558 Ga0495635_0160505 3300046663 Bacteria 1530
559 Ga0495659_0049680 3300046664 Bacteria 1524
560 Ga0495588_0000321 3300046674 Bacteria 32004
561 Ga0495588_0307176 3300046674 Bacteria 835
562 Ga0495588_0435176 3300046674 Bacteria 688
563 Ga0495657_0017983 3300046675 Bacteria 5125
564 Ga0495657_0027311 3300046675 Bacteria 4030
565 Ga0495657_0331209 3300046675 Bacteria 903
566 Ga0495657_0460085 3300046675 Bacteria 744
567 Ga0495599_0000660 3300046678 Bacteria 19504
568 Ga0495599_0060479 3300046678 Bacteria 2368
569 Ga0495623_0000123 3300046679 Bacteria 47116
570 Ga0495623_0008490 3300046679 Bacteria 6672
571 Ga0495646_0001321 3300046680 Bacteria 14651
572 Ga0495646_0054496 3300046680 Bacteria 2405
573 Ga0495647_0200287 3300046681 Bacteria 875
574 Ga0495669_0216184 3300046684 Bacteria 918
575 Ga0495613_0078144 3300046689 Bacteria 2408
576 Ga0495624_0028404 3300046690 Bacteria 3656
577 Ga0495624_0301739 3300046690 Bacteria 966
578 Ga0495589_0137300 3300046794 Bacteria 1172
579 Ga0495600_0017735 3300046809 Bacteria 4531
580 Ga0495600_0055943 3300046809 Bacteria 2576
581 Ga0495600_0878181 3300046809 Bacteria 530
582 Ga0495660_0172402 3300046810 Bacteria 1053
583 Ga0495581_0001162 3300047315 Bacteria 14417
584 Ga0495581_0071375 3300047315 Bacteria 2009
585 Ga0495581_0295376 3300047315 Bacteria 947
586 Ga0495604_0001520 3300047317 Bacteria 19087
587 Ga0495604_0088309 3300047317 Bacteria 2306
588 Ga0495604_0405695 3300047317 Bacteria 897
589 Ga0495604_0720711 3300047317 Bacteria 632
590 Ga0495674_0135424 3300047319 Bacteria 2073
591 Ga0495674_0205586 3300047319 Bacteria 1632
592 Ga0495674_0233099 3300047319 Bacteria 1519
593 Ga0495676_0002980 3300047321 Bacteria 15304
594 Ga0495676_0092834 3300047321 Bacteria 2252
595 Ga0495676_0324768 3300047321 Bacteria 1033
596 Ga0495676_0337387 3300047321 Bacteria 1010
597 Ga0495676_0998081 3300047321 Bacteria 534
598 Ga0495680_0004126 3300047322 Bacteria 13968
599 Ga0495680_0006055 3300047322 Bacteria 11307
600 Ga0495680_0022598 3300047322 Bacteria 5239
601 Ga0495675_0001583 3300047444 Bacteria 13729
602 Ga0495675_0040653 3300047444 Bacteria 2963
603 Ga0495677_0097693 3300047445 Bacteria 1110
604 Ga0495684_0022649 3300047471 Bacteria 4832
605 Ga0495684_0261083 3300047471 Bacteria 1256
606 Ga0495602_0011825 3300048088 Bacteria 9011
607 Ga0495602_0048365 3300048088 Bacteria 3823
608 Ga0495602_0316338 3300048088 Bacteria 1137
609 Ga0495602_0401218 3300048088 Bacteria 978
610 Ga0495602_0451109 3300048088 Bacteria 908
611 Ga0495602_0540707 3300048088 Bacteria 809
612 Ga0495602_0554159 3300048088 Bacteria 796
613 Ga0495614_0611900 3300048089 Bacteria 524
614 Ga0495615_0054181 3300048090 Bacteria 1041
615 Ga0495626_0192304 3300048091 Bacteria 841
616 Ga0495626_0334563 3300048091 Bacteria 593
617 Ga0496100_0011944 3300048903 Bacteria 4962
618 Ga0496100_0185087 3300048903 Bacteria 1508
619 Ga0496100_0207615 3300048903 Bacteria 1431
620 Ga0496100_0818055 3300048903 Bacteria 730
621 Ga0496101_0005203 3300048904 Bacteria 8275
622 Ga0496101_0043831 3300048904 Bacteria 3199
623 Ga0496101_0045815 3300048904 Bacteria 3134
624 Ga0496101_0054557 3300048904 Bacteria 2885
625 Ga0496101_1130175 3300048904 Bacteria 615
626 Ga0496102_0032137 3300048905 Bacteria 4714
627 Ga0496103_0007546 3300048906 Bacteria 6482
628 Ga0496103_0261032 3300048906 Bacteria 1115
629 Ga0496104_0004433 3300048907 Bacteria 12228
630 Ga0496104_0009729 3300048907 Bacteria 8570
631 Ga0496104_0377667 3300048907 Bacteria 1330
632 Ga0496105_0002319 3300048908 Bacteria 13794
633 Ga0496105_0010123 3300048908 Bacteria 7406
634 Ga0496106_0000909 3300048909 Bacteria 21550
635 Ga0496106_0024122 3300048909 Bacteria 4522
636 Ga0496106_0061021 3300048909 Bacteria 2859
637 Ga0496106_0124706 3300048909 Bacteria 2015
638 Ga0496106_0229105 3300048909 Bacteria 1483
639 Ga0496107_0004852 3300048910 Bacteria 9134
640 Ga0496107_0073353 3300048910 Bacteria 2489
641 Ga0496108_0004803 3300048911 Bacteria 10901
642 Ga0496108_0039355 3300048911 Bacteria 3941
643 Ga0496108_0949292 3300048911 Bacteria 736
644 Ga0496109_0006124 3300048912 Bacteria 10107
645 Ga0496109_0064643 3300048912 Bacteria 3348
646 Ga0496110_0030426 3300048913 Bacteria 4654
647 Ga0496110_0093550 3300048913 Bacteria 2691
648 Ga0496110_0192771 3300048913 Bacteria 1851
649 Ga0496110_0545272 3300048913 Bacteria 1054
650 Ga0496111_0022105 3300048914 Bacteria 4449
651 Ga0496111_0033667 3300048914 Bacteria 3656
652 Ga0496111_0457228 3300048914 Bacteria 942
653 Ga0496111_0549507 3300048914 Bacteria 848
654 Ga0496112_0000125 3300048915 Bacteria 47606
655 Ga0496112_0023638 3300048915 Bacteria 5876
656 Ga0496112_0159296 3300048915 Bacteria 2224
657 Ga0496113_0023345 3300048916 Bacteria 4386
658 Ga0496114_0006854 3300048917 Bacteria 8975
659 Ga0496114_0009578 3300048917 Bacteria 7691
660 Ga0496114_0076247 3300048917 Bacteria 2825
661 Ga0496114_1065510 3300048917 Bacteria 693
662 Ga0496115_0001970 3300048918 Bacteria 14659
663 Ga0496115_0011428 3300048918 Bacteria 6655
664 Ga0496115_0090821 3300048918 Bacteria 2495
665 Ga0496115_0485552 3300048918 Bacteria 994
666 Ga0501031_0062834 3300049568 Bacteria 2419
667 Ga0501031_0203396 3300049568 Bacteria 1292
668 Ga0501031_0270427 3300049568 Bacteria 1103
669 Ga0501032_0046489 3300049569 Bacteria 2933
670 Ga0501032_0197739 3300049569 Bacteria 1313
671 Ga0501033_0049415 3300049570 Bacteria 3121
672 Ga0501034_1561246 3300049571 Bacteria 533
673 Ga0501036_0011360 3300049572 Bacteria 7370
674 Ga0501036_0249857 3300049572 Bacteria 1486
675 Ga0501036_0285730 3300049572 Bacteria 1380
676 Ga0501036_0289600 3300049572 Bacteria 1370
677 Ga0501037_0049578 3300049573 Bacteria 3074
678 Ga0501037_0443100 3300049573 Bacteria 887
679 Ga0501038_0075465 3300049574 Bacteria 2849
680 Ga0501038_0108384 3300049574 Bacteria 2303
681 Ga0501038_0162986 3300049574 Bacteria 1810
682 Ga0501039_0040208 3300049575 Bacteria 3611
683 Ga0501039_0139759 3300049575 Bacteria 1902
684 Ga0501039_0142227 3300049575 Bacteria 1884
685 Ga0501040_0003194 3300049576 Bacteria 10611
686 Ga0501040_0103011 3300049576 Bacteria 1992
687 Ga0501040_0155379 3300049576 Bacteria 1615
688 Ga0501041_0021493 3300049577 Bacteria 3865
689 Ga0501041_0024094 3300049577 Bacteria 3651
690 Ga0501042_0008393 3300049578 Bacteria 6813
691 Ga0501042_0018629 3300049578 Bacteria 4809
692 Ga0501042_0063943 3300049578 Bacteria 2629
693 Ga0501043_0038125 3300049579 Bacteria 3779
694 Ga0501043_0748820 3300049579 Bacteria 710
695 Ga0501046_0019492 3300049580 Bacteria 5627
696 Ga0501046_0303351 3300049580 Bacteria 1166
697 Ga0501048_0026215 3300049582 Bacteria 4243
698 Ga0501048_0298781 3300049582 Bacteria 1145
699 Ga0501048_0577815 3300049582 Bacteria 806
700 Ga0501067_0032201 3300049583 Bacteria 2910
701 Ga0501068_0001636 3300049584 Bacteria 11963
702 Ga0501068_0292822 3300049584 Bacteria 1041
703 Ga0501069_0009795 3300049585 Bacteria 5065
704 Ga0501069_0023147 3300049585 Unclassified 3385
705 Ga0501069_0471506 3300049585 Bacteria 747
706 Ga0501069_0501424 3300049585 Bacteria 724
707 Ga0501070_0418786 3300049586 Bacteria 1082
708 Ga0501071_0131203 3300049587 Bacteria 1861
709 Ga0501072_0025279 3300049588 Bacteria 4625
710 Ga0501072_0238091 3300049588 Bacteria 1449
711 Ga0501072_0783882 3300049588 Bacteria 747
712 Ga0501073_0039869 3300049589 Bacteria 3326
713 Ga0501073_0658175 3300049589 Bacteria 723
714 Ga0501074_0007630 3300049590 Bacteria 7830
715 Ga0501074_0051853 3300049590 Bacteria 2961
716 Ga0501074_0619598 3300049590 Bacteria 765
717 Ga0501075_0004913 3300049591 Bacteria 9112
718 Ga0501075_0165071 3300049591 Bacteria 1689
719 Ga0501076_0130079 3300049592 Bacteria 2041
720 Ga0501076_0130889 3300049592 Bacteria 2034
721 Ga0501076_0207852 3300049592 Bacteria 1599
722 Ga0501077_0011049 3300049593 Bacteria 5629
723 Ga0501077_0062816 3300049593 Bacteria 2356
724 Ga0501079_0000669 3300049741 Bacteria 22954
725 Ga0501079_0117695 3300049741 Bacteria 2065
726 Ga0501079_0293280 3300049741 Bacteria 1272
727 Ga0501079_0339065 3300049741 Bacteria 1177
728 Ga0501080_0227700 3300049742 Bacteria 1704
729 Ga0501080_0430449 3300049742 Bacteria 1184
730 Ga0501081_0032231 3300049743 Bacteria 3554
731 Ga0501081_0114674 3300049743 Bacteria 1915
732 Ga0501081_0176835 3300049743 Bacteria 1542
733 Ga0501264_022842 3300049761 Bacteria 675
734 Ga0501035_0057529 3300049822 Bacteria 3466
735 Ga0501045_0005563 3300049824 Bacteria 8716
736 Ga0501045_0104784 3300049824 Bacteria 2095
737 Ga0501045_0769033 3300049824 Bacteria 709
738 nmdc:mga05p37_525069_c1 3300050507 Bacteria 1353
739 nmdc:mga05p37_57989_c1 3300050507 Bacteria 4768
740 nmdc:mga05p37_677688_c1 3300050507 Bacteria 1150
741 nmdc:mga05p37_993977_c1 3300050507 Bacteria 892
742 nmdc:mga09592_619259_c1 3300050508 Bacteria 926
743 nmdc:mga08y16_270698_c1 3300050511 Bacteria 1753
744 nmdc:mga0n895_1129709_c1 3300050512 Bacteria 760
745 nmdc:mga0n895_1279328_c1 3300050512 Bacteria 705
746 nmdc:mga0rr50_8434_c1 3300050513 Bacteria 6416
747 nmdc:mga08x19_156260_c1 3300050514 Bacteria 1547
748 nmdc:mga08x19_5982_c1 3300050514 Bacteria 7194
749 nmdc:mga0a205_26434_c1 3300050515 Bacteria 5535
750 nmdc:mga0a205_690997_c1 3300050515 Bacteria 870
751 Ga0495601_0000612 3300053077 Bacteria 18978
752 Ga0495601_0057334 3300053077 Bacteria 2468
753 Ga0495601_0197119 3300053077 Bacteria 1316
754 Ga0495601_0255340 3300053077 Bacteria 1144
755 Ga0495612_0080054 3300053078 Bacteria 1372
756 Ga0495612_0337757 3300053078 Bacteria 679
757 Ga0495655_0036818 3300053083 Bacteria 1225
758 Ga0495595_0022383 3300053084 Bacteria 2775
759 Ga0495595_0033115 3300053084 Bacteria 2330
760 Ga0495619_0016842 3300053085 Bacteria 4628
761 Ga0495619_0391322 3300053085 Bacteria 960
762 Ga0500566_0451464 3300053094 Bacteria 563
763 Ga0501084_1024753 3300054114 Bacteria 693
764 Ga0590071_015323 3300059421 Bacteria 1798
765 Ga0590077_018030 3300059426 Bacteria 1488
766 Ga0587084_078723 3300059477 Bacteria 635
767 Ga0587084_154841 3300059477 Bacteria 506
768 Ga0587073_0241916 3300059492 Bacteria 562
769 Ga0587083_0083667 3300059505 Bacteria 765
770 Ga0587083_0265134 3300059505 Unclassified 517
771 Ga0587088_061557 3300059508 Bacteria 762
772 Ga0587125_024306 3300059607 Bacteria 737
773 Ga0587099_021514 3300059622 Bacteria 731
774 Ga0587078_062303 3300059646 Bacteria 568
775 Ga0587118_26071 3300059657 Bacteria 501
776 Ga0501082_0004693 3300060353 Bacteria 11915
777 Ga0501082_0564677 3300060353 Bacteria 995
778 Ga0466962_0379965 3300061719 Bacteria 705
779 Ga0530510_0034371 3300061734 Bacteria 3651
780 Ga0530510_0105389 3300061734 Bacteria 2063
781 Ga0530510_0160622 3300061734 Bacteria 1662
782 Ga0070679_100255797
783 JGI24747J21853_1007247
784 JGI24749J21850_1014492
785 JGI24744J21845_10002767
786 JGI24742J22300_10011032
787 JGI25406J46586_10098674
788 JGI25404J52841_10134222
789 Ga0070658_10010014
790 Ga0070658_10031015
791 Ga0070658_10311673
792 Ga0070676_10257159
793 Ga0070683_100084983
794 Ga0070690_100202611
795 Ga0068869_100218714
796 Ga0068869_100811028
797 Ga0070680_101846937
798 Ga0070682_100006239
799 Ga0070682_100132180
800 Ga0070682_100849880
801 Ga0068868_100010866
802 Ga0068868_100029484
803 Ga0068868_101420885
804 Ga0068868_102439837
805 Ga0070660_100009852
806 Ga0070660_100123361
807 Ga0070660_100194328
808 Ga0070660_100581470
809 Ga0070689_100002533
810 Ga0070691_10076739
811 Ga0070691_10229736
812 Ga0070691_10231975
813 Ga0070661_100180977
814 Ga0070692_10016258
815 Ga0070692_10025776
816 Ga0070692_10249563
817 Ga0070668_100048441
818 Ga0070669_100082485
819 Ga0070669_100101963
820 Ga0070675_100271317
821 Ga0070675_101801248
822 Ga0070671_100162779
823 Ga0070671_100450340
824 Ga0070674_100004775
825 Ga0070674_100011295
826 Ga0070674_100090357
827 Ga0070674_100648060
828 Ga0070673_100086160
829 Ga0070688_100129160
830 Ga0070688_100133872
831 Ga0070659_100013105
832 Ga0070659_100081606
833 Ga0070659_100280352
834 Ga0070703_10144665
835 Ga0070709_10003132
836 Ga0070709_10744168
837 Ga0070714_100272881
838 Ga0070714_100819950
839 Ga0070713_100081146
840 Ga0070713_100415313
841 Ga0070710_10001597
842 Ga0070710_10166185
843 Ga0070710_10297332
844 Ga0070701_10000911
845 Ga0070711_100005382
846 Ga0070711_100016507
847 Ga0070711_100178681
848 Ga0070711_100906768
849 Ga0070705_100018646
850 Ga0070705_100356261
851 Ga0070700_100010779
852 Ga0070700_100087974
853 Ga0070700_101740833
854 Ga0070694_100087273
855 Ga0070694_100201590
856 Ga0070694_100329378
857 Ga0070678_100000298
858 Ga0070678_100456950
859 Ga0070662_100057234
860 Ga0070662_100085197
861 Ga0070662_100249345
862 Ga0070662_100264482
863 Ga0070681_10021893
864 Ga0070681_10087075
865 Ga0070681_10095494
866 Ga0068867_100002281
867 Ga0068867_100067778
868 Ga0068867_100146039
869 Ga0070685_10000447
870 Ga0070685_10002987
871 Ga0070706_100041574
872 Ga0070706_101301486
873 Ga0070698_101855944
874 Ga0070699_100039845
875 Ga0070679_100060649
876 Ga0070679_100064395
877 Ga0070679_100485509
878 Ga0070684_100054751
879 Ga0070684_100293596
880 Ga0070684_101106002
881 Ga0070697_100092336
882 Ga0068853_100089301
883 Ga0070672_100467895
884 Ga0070686_100025046
885 Ga0070686_100285484
886 Ga0070695_100049725
887 Ga0070695_100066827
888 Ga0070695_100200927
889 Ga0070695_100216559
890 Ga0070695_100631715
891 Ga0070696_100034907
892 Ga0070696_100105045
893 Ga0070696_100116635
894 Ga0070696_100468716
895 Ga0070696_100800679
896 Ga0070696_100906276
897 Ga0070693_100090191
898 Ga0070693_100168802
899 Ga0070693_100474436
900 Ga0070704_100006657
901 Ga0070704_100047803
902 Ga0068855_100274790
903 Ga0068855_100288918
904 Ga0068855_100369662
905 Ga0070664_101105706
906 Ga0070664_101240890
907 Ga0068854_100033291
908 Ga0068856_100015136
909 Ga0068856_100145291
910 Ga0068856_100412436
911 Ga0070702_100010697
912 Ga0070702_100093762
913 Ga0068852_100002120
914 Ga0068852_100578486
915 Ga0068859_100894209
916 Ga0068864_100398778
917 Ga0068864_101028489
918 Ga0068864_101648116
919 Ga0068866_10003034
920 Ga0068866_10404241
921 Ga0068866_10527625
922 Ga0068861_100078542
923 Ga0068861_100110413
924 Ga0068861_100465497
925 Ga0068863_100250954
926 Ga0068858_100230101
927 Ga0068858_101213279
928 Ga0068860_100178293
929 Ga0068862_100169158
930 Ga0081455_10005176
931 Ga0081455_10029269
932 Ga0081455_10297307
933 Ga0081540_1001617
934 Ga0081540_1007353
935 Ga0081540_1020995
936 Ga0081539_10000249
937 Ga0081539_10009325
938 Ga0070717_10387744
939 Ga0070717_10609212
940 Ga0070715_10018743
941 Ga0070715_10747408
942 Ga0070716_100243073
943 Ga0070716_100781292
944 Ga0070712_100010423
945 Ga0070712_100099379
946 Ga0097621_100012262
947 Ga0097621_100854167
948 Ga0097621_100872579
949 Ga0075433_10007855
950 Ga0075434_100024229
951 Ga0075434_101841595
952 Ga0075429_101462448
953 Ga0068865_100003159
954 Ga0068865_100105433
955 Ga0068865_100461881
956 Ga0068865_101570102
957 Ga0097620_100894190
958 Ga0105240_10003539
959 Ga0105240_10113618
960 Ga0111539_10083490
961 Ga0111539_10325710
962 Ga0111539_10338527
963 Ga0105245_10014619
964 Ga0105245_10020835
965 Ga0105245_10067647
966 Ga0105245_10507620
967 Ga0105245_10938467
968 Ga0105245_11640002
969 Ga0114129_10111797
970 Ga0105243_10002101
971 Ga0105243_10096160
972 Ga0105243_10229801
973 Ga0105243_10238210
974 Ga0105243_10797071
975 Ga0105241_10322303
976 Ga0105242_10003124
977 Ga0105242_10045231
978 Ga0105248_10036341
979 Ga0105248_10896304
980 Ga0105248_11036598
981 Ga0105237_10553290
982 Ga0105237_10624040
983 Ga0105237_12250818
984 Ga0105238_10309355
985 Ga0105249_10007650
986 Ga0105249_10016021
987 Ga0105249_10366382
988 Ga0105239_10007916
989 Ga0105239_10298384
990 Ga0105239_10437373
991 Ga0157336_1015904
992 Ga0157346_1009527
993 Ga0157335_1003494
994 Ga0157345_1028348
995 Ga0157373_10168910
996 Ga0157373_10284989
997 Ga0157371_11244176
998 Ga0157370_10133718
999 Ga0157369_10021425
1000 Ga0157369_10307738
1001 Ga0157369_10430659
1002 Ga0157374_10001932
1003 Ga0157374_10360493
1004 Ga0157374_11983877
1005 Ga0157378_10006911
1006 Ga0157378_10798543
1007 Ga0163162_10126888
1008 Ga0163162_10220663
1009 Ga0163162_10269338
1010 Ga0163162_10459604
1011 Ga0163162_10636944
1012 Ga0163162_11525609
1013 Ga0157372_10041522
1014 Ga0157372_10349386
1015 Ga0157372_10664886
1016 Ga0157375_10014052
1017 Ga0157375_10034932
1018 Ga0157375_10149657
1019 Ga0157375_12657882
1020 Ga0157380_10362448
1021 Ga0157380_10375854
1022 Ga0157377_10001693
1023 Ga0157377_10448040
1024 Ga0157376_10005356
1025 Ga0157376_10407073
1026 Ga0197907_11136786
1027 Ga0197907_11388276
1028 Ga0206356_10414775
1029 Ga0206356_10418925
1030 Ga0206356_10895144
1031 Ga0206356_10933505
1032 Ga0206349_1647817
1033 Ga0206350_10540349
1034 Ga0206354_10989077
1035 Ga0206353_11184902
1036 Ga0207692_10145536
1037 Ga0207642_10071066
1038 Ga0207642_10187847
1039 Ga0207688_10167942
1040 Ga0207680_10373878
1041 Ga0207685_10009199
1042 Ga0207685_10569991
1043 Ga0207699_10231823
1044 Ga0207699_10296913
1045 Ga0207699_10725675
1046 Ga0207645_10484515
1047 Ga0207705_10205211
1048 Ga0207705_10758561
1049 Ga0207684_10184259
1050 Ga0207684_11528999
1051 Ga0207654_10333098
1052 Ga0207707_10390904
1053 Ga0207707_10671688
1054 Ga0207695_10088950
1055 Ga0207695_10222293
1056 Ga0207693_10007175
1057 Ga0207693_10009461
1058 Ga0207693_10808515
1059 Ga0207693_11012651
1060 Ga0207663_10092229
1061 Ga0207663_10306017
1062 Ga0207663_10354798
1063 Ga0207663_10364389
1064 Ga0207660_10015071
1065 Ga0207660_10136279
1066 Ga0207662_10091054
1067 Ga0207662_10918879
1068 Ga0207657_10004070
1069 Ga0207657_10073499
1070 Ga0207657_10235615
1071 Ga0207649_10169969
1072 Ga0207649_11419504
1073 Ga0207652_10053670
1074 Ga0207652_10099937
1075 Ga0207652_10340249
1076 Ga0207652_10764724
1077 Ga0207681_10153612
1078 Ga0207659_10147119
1079 Ga0207659_10232698
1080 Ga0207687_10006705
1081 Ga0207687_10013272
1082 Ga0207687_10210897
1083 Ga0207687_10256490
1084 Ga0207687_10437396
1085 Ga0207687_10508957
1086 Ga0207700_10306428
1087 Ga0207700_10404236
1088 Ga0207700_10857923
1089 Ga0207664_10035662
1090 Ga0207664_10065806
1091 Ga0207664_10153832
1092 Ga0207664_10354172
1093 Ga0207664_10385981
1094 Ga0207644_10108335
1095 Ga0207706_10010028
1096 Ga0207706_10235701
1097 Ga0207686_10078108
1098 Ga0207686_10175654
1099 Ga0207686_10209159
1100 Ga0207709_10003145
1101 Ga0207709_10313122
1102 Ga0207670_10065235
1103 Ga0207669_10134075
1104 Ga0207669_10159763
1105 Ga0207669_10390084
1106 Ga0207669_11176748
1107 Ga0207704_10004679
1108 Ga0207704_10776279
1109 Ga0207704_10780049
1110 Ga0207691_10021097
1111 Ga0207691_10658986
1112 Ga0207711_10587231
1113 Ga0207711_10723760
1114 Ga0207689_10731539
1115 Ga0207661_10280387
1116 Ga0207661_10457704
1117 Ga0207661_10549292
1118 Ga0207667_10092086
1119 Ga0207667_10205708
1120 Ga0207667_10243170
1121 Ga0207667_10375308
1122 Ga0207667_10508909
1123 Ga0207668_10919441
1124 Ga0207668_11532746
1125 Ga0207658_11838861
1126 Ga0207677_10019873
1127 Ga0207677_10037758
1128 Ga0207677_10053014
1129 Ga0207703_10303686
1130 Ga0207639_10237607
1131 Ga0207678_10007751
1132 Ga0207708_10007367
1133 Ga0207708_10203561
1134 Ga0207708_10514035
1135 Ga0207702_10096592
1136 Ga0207702_10123845
1137 Ga0207702_10246574
1138 Ga0207648_10010532
1139 Ga0207648_10085014
1140 Ga0207648_10101086
1141 Ga0207648_10202316
1142 Ga0207648_10209194
1143 Ga0207648_10303568
1144 Ga0207676_10330735
1145 Ga0207676_11022645
1146 Ga0207675_100011038
1147 Ga0207675_100015239
1148 Ga0207675_100805329
1149 Ga0207683_10000598
1150 Ga0207683_10031896
1151 Ga0207683_10562022
1152 Ga0207698_10024518
1153 Ga0207698_10334928
1154 Ga0210000_1039469
1155 Ga0209983_1067332
1156 Ga0268264_10160254
1157 Ga0265319_1012200
1158 Ga0265319_1015651
1159 Ga0265319_1104184
1160 Ga0265334_10001413
1161 Ga0265318_10000629
1162 Ga0265323_10025688
1163 Ga0265322_10020174
1164 Ga0265322_10122156
1165 Ga0265336_10021126
1166 Ga0265338_10005535
1167 Ga0265338_10110024
1168 Ga0265338_10908302
1169 Ga0265324_10030406
1170 Ga0316178_1082349
1171 Ga0265330_10013635
1172 Ga0265332_10015556
1173 Ga0265328_10051774
1174 Ga0265325_10001477
1175 Ga0265329_10053038
1176 Ga0265340_10013995
1177 Ga0265339_10037405
1178 Ga0265331_10105768
1179 Ga0265327_10018097
1180 Ga0265327_10169313
1181 Ga0265327_10386880
1182 Ga0265316_10012394
1183 Ga0265313_10028573
1184 Ga0265314_10079793
1185 Ga0265342_10015521
1186 Ga0307412_11436877
1187 Ga0307409_100305611
1188 Ga0307409_101836907
1189 Ga0307415_100306289
1190 Ga0307415_102552523
1191 Ga0373945_0578745
1192 Ga0373956_0536246
1193 Ga0373957_0013000
1194 Ga0373957_0146164
1195 Ga0373943_0004832
1196 Ga0373943_0315709
1197 Ga0373946_0118734
1198 Ga0373955_0125975
1199 Ga0373931_0998495
1200 Ga0373927_0327360
1201 Ga0373927_1010587
1202 Ga0373933_0145732
1203 Ga0373947_0004492
1204 Ga0373937_0000989
1205 Ga0373937_0108707
1206 Ga0373937_1110511
1207 Ga0373925_0245003
1208 Ga0373925_1153427
1209 Ga0395899_0018980
1210 Ga0395899_0033879
1211 Ga0395900_0008294
1212 Ga0395900_0008296
1213 Ga0395900_0062643
1214 Ga0395900_0092498
1215 Ga0395900_0164899
1216 Ga0395900_0461916
1217 Ga0395900_0484359
1218 Ga0395898_0012349
1219 Ga0395898_0030535
1220 Ga0395898_0033027
1221 Ga0395898_0933763
1222 Ga0395905_0018702
1223 Ga0395905_0046389
1224 Ga0395905_0158871
1225 Ga0395905_1222890
1226 Ga0395901_0004228
1227 Ga0395901_0094145
1228 Ga0395901_0113668
1229 Ga0395901_0162831
1230 Ga0395901_0704326
1231 Ga0436365_0121854
1232 Ga0436362_1078061
1233 Ga0439453_0120703
1234 Ga0451804_0288450
1235 Ga0451853_0516119
1236 Ga0451853_4071529
1237 Ga0439448_0083483
1238 Ga0439448_0111125
1239 Ga0439450_053035
1240 Ga0439456_103048
1241 Ga0439462_0036533
1242 Ga0450888_070280
1243 Ga0439435_0097144
1244 Ga0439464_0063750
1245 Ga0439460_0255246
1246 Ga0466972_0034382
1247 Ga0466963_0027782
1248 Ga0466963_0029684
1249 Ga0466964_0380278
1250 Ga0466968_0067580
1251 Ga0466959_0542409
1252 Ga0466958_0289002
1253 Ga0466967_0028281
1254 Ga0466967_0116403
1255 Ga0466967_0232508
1256 Ga0466967_0319298
1257 Ga0466967_1093773
1258 Ga0466967_1725860
1259 Ga0495592_0000368
1260 Ga0495592_0056583
1261 Ga0495592_0104109
1262 Ga0495592_0208462
1263 Ga0495592_0330261
1264 Ga0495603_0000747
1265 Ga0495603_0025900
1266 Ga0495629_0053356
1267 Ga0495641_0001759
1268 Ga0495651_0001115
1269 Ga0495651_0039520
1270 Ga0495651_0121311
1271 Ga0495651_0397402
1272 Ga0495653_0031135
1273 Ga0495580_0046129
1274 Ga0495580_0221191
1275 Ga0495582_0032961
1276 Ga0495582_0131519
1277 Ga0495605_0191824
1278 Ga0495605_0204508
1279 Ga0495639_0110742
1280 Ga0495639_0136000
1281 Ga0495639_0741152
1282 Ga0495662_0023641
1283 Ga0495664_0089739
1284 Ga0495664_0202274
1285 Ga0495664_0276741
1286 Ga0495584_0045183
1287 Ga0495585_0337856
1288 Ga0495585_0436980
1289 Ga0495594_0001154
1290 Ga0495583_0188546
1291 Ga0495608_0004604
1292 Ga0495608_0007943
1293 Ga0495608_0014454
1294 Ga0495618_0006848
1295 Ga0495618_0054004
1296 Ga0495620_0104675
1297 Ga0495628_0000650
1298 Ga0495628_0063623
1299 Ga0495628_0077423
1300 Ga0495628_0525431
1301 Ga0495630_0008480
1302 Ga0495630_0063774
1303 Ga0495666_0060558
1304 Ga0495642_0365987
1305 Ga0495652_0018343
1306 Ga0495652_0055902
1307 Ga0495652_0127140
1308 Ga0495652_0335802
1309 Ga0495652_0346199
1310 Ga0495652_0352273
1311 Ga0495652_1017563
1312 Ga0495652_1135809
1313 Ga0495665_0044521
1314 Ga0495665_0201431
1315 Ga0495665_0370221
1316 Ga0495665_0468204
1317 Ga0495640_0008963
1318 Ga0495640_0322861
1319 Ga0495640_0379324
1320 Ga0495586_0072432
1321 Ga0495587_0000469
1322 Ga0495587_0023055
1323 Ga0495587_0088831
1324 Ga0495598_0294038
1325 Ga0495609_0037410
1326 Ga0495621_0158089
1327 Ga0495645_0000456
1328 Ga0495645_0116519
1329 Ga0495645_0173047
1330 Ga0495667_0004125
1331 Ga0495667_0057319
1332 Ga0495667_0077433
1333 Ga0495667_0726317
1334 Ga0495656_0015713
1335 Ga0495656_0085873
1336 Ga0495668_0225610
1337 Ga0495634_0171039
1338 Ga0495635_0069739
1339 Ga0495635_0160505
1340 Ga0495659_0049680
1341 Ga0495588_0000321
1342 Ga0495588_0307176
1343 Ga0495588_0435176
1344 Ga0495657_0017983
1345 Ga0495657_0027311
1346 Ga0495657_0331209
1347 Ga0495657_0460085
1348 Ga0495599_0000660
1349 Ga0495599_0060479
1350 Ga0495623_0000123
1351 Ga0495623_0008490
1352 Ga0495646_0001321
1353 Ga0495646_0054496
1354 Ga0495647_0200287
1355 Ga0495669_0216184
1356 Ga0495613_0078144
1357 Ga0495624_0028404
1358 Ga0495624_0301739
1359 Ga0495589_0137300
1360 Ga0495600_0017735
1361 Ga0495600_0055943
1362 Ga0495600_0878181
1363 Ga0495660_0172402
1364 Ga0495581_0001162
1365 Ga0495581_0071375
1366 Ga0495581_0295376
1367 Ga0495604_0001520
1368 Ga0495604_0088309
1369 Ga0495604_0405695
1370 Ga0495604_0720711
1371 Ga0495674_0135424
1372 Ga0495674_0205586
1373 Ga0495674_0233099
1374 Ga0495676_0002980
1375 Ga0495676_0092834
1376 Ga0495676_0324768
1377 Ga0495676_0337387
1378 Ga0495676_0998081
1379 Ga0495680_0004126
1380 Ga0495680_0006055
1381 Ga0495680_0022598
1382 Ga0495675_0001583
1383 Ga0495675_0040653
1384 Ga0495677_0097693
1385 Ga0495684_0022649
1386 Ga0495684_0261083
1387 Ga0495602_0011825
1388 Ga0495602_0048365
1389 Ga0495602_0316338
1390 Ga0495602_0401218
1391 Ga0495602_0451109
1392 Ga0495602_0540707
1393 Ga0495602_0554159
1394 Ga0495614_0611900
1395 Ga0495615_0054181
1396 Ga0495626_0192304
1397 Ga0495626_0334563
1398 Ga0496100_0011944
1399 Ga0496100_0185087
1400 Ga0496100_0207615
1401 Ga0496100_0818055
1402 Ga0496101_0005203
1403 Ga0496101_0043831
1404 Ga0496101_0045815
1405 Ga0496101_0054557
1406 Ga0496101_1130175
1407 Ga0496102_0032137
1408 Ga0496103_0007546
1409 Ga0496103_0261032
1410 Ga0496104_0004433
1411 Ga0496104_0009729
1412 Ga0496104_0377667
1413 Ga0496105_0002319
1414 Ga0496105_0010123
1415 Ga0496106_0000909
1416 Ga0496106_0024122
1417 Ga0496106_0061021
1418 Ga0496106_0124706
1419 Ga0496106_0229105
1420 Ga0496107_0004852
1421 Ga0496107_0073353
1422 Ga0496108_0004803
1423 Ga0496108_0039355
1424 Ga0496108_0949292
1425 Ga0496109_0006124
1426 Ga0496109_0064643
1427 Ga0496110_0030426
1428 Ga0496110_0093550
1429 Ga0496110_0192771
1430 Ga0496110_0545272
1431 Ga0496111_0022105
1432 Ga0496111_0033667
1433 Ga0496111_0457228
1434 Ga0496111_0549507
1435 Ga0496112_0000125
1436 Ga0496112_0023638
1437 Ga0496112_0159296
1438 Ga0496113_0023345
1439 Ga0496114_0006854
1440 Ga0496114_0009578
1441 Ga0496114_0076247
1442 Ga0496114_1065510
1443 Ga0496115_0001970
1444 Ga0496115_0011428
1445 Ga0496115_0090821
1446 Ga0496115_0485552
1447 Ga0501031_0062834
1448 Ga0501031_0203396
1449 Ga0501031_0270427
1450 Ga0501032_0046489
1451 Ga0501032_0197739
1452 Ga0501033_0049415
1453 Ga0501034_1561246
1454 Ga0501036_0011360
1455 Ga0501036_0249857
1456 Ga0501036_0285730
1457 Ga0501036_0289600
1458 Ga0501037_0049578
1459 Ga0501037_0443100
1460 Ga0501038_0075465
1461 Ga0501038_0108384
1462 Ga0501038_0162986
1463 Ga0501039_0040208
1464 Ga0501039_0139759
1465 Ga0501039_0142227
1466 Ga0501040_0003194
1467 Ga0501040_0103011
1468 Ga0501040_0155379
1469 Ga0501041_0021493
1470 Ga0501041_0024094
1471 Ga0501042_0008393
1472 Ga0501042_0018629
1473 Ga0501042_0063943
1474 Ga0501043_0038125
1475 Ga0501043_0748820
1476 Ga0501046_0019492
1477 Ga0501046_0303351
1478 Ga0501048_0026215
1479 Ga0501048_0298781
1480 Ga0501048_0577815
1481 Ga0501067_0032201
1482 Ga0501068_0001636
1483 Ga0501068_0292822
1484 Ga0501069_0009795
1485 Ga0501069_0023147
1486 Ga0501069_0471506
1487 Ga0501069_0501424
1488 Ga0501070_0418786
1489 Ga0501071_0131203
1490 Ga0501072_0025279
1491 Ga0501072_0238091
1492 Ga0501072_0783882
1493 Ga0501073_0039869
1494 Ga0501073_0658175
1495 Ga0501074_0007630
1496 Ga0501074_0051853
1497 Ga0501074_0619598
1498 Ga0501075_0004913
1499 Ga0501075_0165071
1500 Ga0501076_0130079
1501 Ga0501076_0130889
1502 Ga0501076_0207852
1503 Ga0501077_0011049
1504 Ga0501077_0062816
1505 Ga0501079_0000669
1506 Ga0501079_0117695
1507 Ga0501079_0293280
1508 Ga0501079_0339065
1509 Ga0501080_0227700
1510 Ga0501080_0430449
1511 Ga0501081_0032231
1512 Ga0501081_0114674
1513 Ga0501081_0176835
1514 Ga0501264_022842
1515 Ga0501035_0057529
1516 Ga0501045_0005563
1517 Ga0501045_0104784
1518 Ga0501045_0769033
1519 nmdc:mga05p37_525069_c1
1520 nmdc:mga05p37_57989_c1
1521 nmdc:mga05p37_677688_c1
1522 nmdc:mga05p37_993977_c1
1523 nmdc:mga09592_619259_c1
1524 nmdc:mga08y16_270698_c1
1525 nmdc:mga0n895_1129709_c1
1526 nmdc:mga0n895_1279328_c1
1527 nmdc:mga0rr50_8434_c1
1528 nmdc:mga08x19_156260_c1
1529 nmdc:mga08x19_5982_c1
1530 nmdc:mga0a205_26434_c1
1531 nmdc:mga0a205_690997_c1
1532 Ga0495601_0000612
1533 Ga0495601_0057334
1534 Ga0495601_0197119
1535 Ga0495601_0255340
1536 Ga0495612_0080054
1537 Ga0495612_0337757
1538 Ga0495655_0036818
1539 Ga0495595_0022383
1540 Ga0495595_0033115
1541 Ga0495619_0016842
1542 Ga0495619_0391322
1543 Ga0500566_0451464
1544 Ga0501084_1024753
1545 Ga0590071_015323
1546 Ga0590077_018030
1547 Ga0587084_078723
1548 Ga0587084_154841
1549 Ga0587073_0241916
1550 Ga0587083_0083667
1551 Ga0587083_0265134
1552 Ga0587088_061557
1553 Ga0587125_024306
1554 Ga0587099_021514
1555 Ga0587078_062303
1556 Ga0587118_26071
1557 Ga0501082_0004693
1558 Ga0501082_0564677
1559 Ga0466962_0379965
1560 Ga0530510_0034371
1561 Ga0530510_0105389
1562 Ga0530510_0160622

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

21

139

0.83

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

11

142

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8982 3 139
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8946 5 140
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8935 3 140
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.8855 11 142
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.8842 1 141
ID Description Score Start End Superfamily
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8922 3 144 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8745 3 144 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8628 3 139 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8514 3 140 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8512 5 137 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A538LD78-F1-model_v4 Polyketide cyclase 0.9949 1 141
AF-A0A538LD78-F1-model_v4 Polyketide cyclase 0.9811 1 141
AF-A0A518AGI0-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.942 11 141
AF-A0A536HVU1-F1-model_v4 ATPase 0.9415 2 139
AF-A0A535DZ70-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9396 2 141 GO:0003700

Map