F480527

General Info

Members Datasets Scaffolds Average Seq Length
780 373 771 230

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0198780|Ga0373925_0198780_161_931
Length 256
Sequence LTEKSSYDKASDENANHEQCIMTAGVQGITEADIANYLANTPGFFERHAELLGSVQLTSPHGQRAVSLQERQMEMLRDKIRGLEGKIIEMIRYGQDNVGIADRLHRWTRALMLTQEPAELPAVLVRELMHQFMIPQAGIRVWGAAAPFAAIDFAQPVSDDVKLFAGSLSQPYCGVNSGFEASQWLADPAGAKSMALIPLRASAAEGSEASAVPAFGMLVLASPDPTRYTADMGTEFLSRIGDIAGAALSRLLPVRT

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
109 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
202 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
210 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
213 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
214 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
250 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
251 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
252 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
253 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
254 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
255 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
260 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
265 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
296 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
302 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
319 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
328 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
329 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
330 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
338 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
339 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
349 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
350 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
351 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
352 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
353 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
354 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
355 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
356 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
357 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
358 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
359 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
360 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
361 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
362 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
363 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
366 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
367 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
368 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
369 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
370 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
371 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
372 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
373 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0.26
Rhizoplane 2.18
Rhizosphere 74.1
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022958 3300001979 Bacteria 2138
2 JGI25156J39149_1009411 3300002705 Bacteria 2378
3 JGI25154J39366_1002401 3300002738 Bacteria 4901
4 JGI25157J39369_1000192 3300002741 Bacteria 51783
5 JGI25153J46596_10000372 3300003215 Bacteria 30744
6 JGI25153J46596_10000699 3300003215 Bacteria 20504
7 rootH1_10011472 3300003316 Bacteria 4808
8 rootH1_10013103 3300003316 Bacteria 5540
9 rootH1_10013116 3300003316 Bacteria 1174
10 rootH2_10039876 3300003320 Bacteria 2290
11 rootL2_10000675 3300003322 Bacteria 5604
12 rootH1_10061484 3300003323 Bacteria 3934
13 Ga0055533_1000045 3300003756 Bacteria 223637
14 Ga0055525_1000054 3300003759 Bacteria 216523
15 Ga0055525_1000651 3300003759 Bacteria 13569
16 Ga0055535_1000098 3300003761 Bacteria 94622
17 Ga0055529_1000143 3300003763 Bacteria 101808
18 Ga0055526_1005640 3300003771 Bacteria 7122
19 Ga0055524_1000160 3300003775 Bacteria 78345
20 Ga0055524_1000950 3300003775 Bacteria 18399
21 Ga0055530_10003900 3300003791 Bacteria 8129
22 Ga0055540_1000280 3300003792 Bacteria 45825
23 Ga0055540_1009952 3300003792 Bacteria 3213
24 Ga0055531_10002844 3300003794 Bacteria 11319
25 Ga0065165_1004009 3300005262 Bacteria 9617
26 Ga0065715_10147911 3300005293 Bacteria 1765
27 Ga0065715_10349191 3300005293 Bacteria 954
28 Ga0070658_10077281 3300005327 Bacteria 2730
29 Ga0070658_10107688 3300005327 Bacteria 2306
30 Ga0070658_10153919 3300005327 Bacteria 1926
31 Ga0070676_10010008 3300005328 Bacteria 5132
32 Ga0070676_10014014 3300005328 Bacteria 4400
33 Ga0070676_10091251 3300005328 Bacteria 1866
34 Ga0070676_10128991 3300005328 Bacteria 1597
35 Ga0070676_10169820 3300005328 Bacteria 1410
36 Ga0070683_100034533 3300005329 Bacteria 4621
37 Ga0070670_100019136 3300005331 Bacteria 5871
38 Ga0070670_100019379 3300005331 Bacteria 5837
39 Ga0070670_100030882 3300005331 Bacteria 4614
40 Ga0070670_100045584 3300005331 Bacteria 3770
41 Ga0070670_100047852 3300005331 Bacteria 3680
42 Ga0070670_100186374 3300005331 Bacteria 1802
43 Ga0070670_100254154 3300005331 Bacteria 1531
44 Ga0070670_100535604 3300005331 Bacteria 1044
45 Ga0070677_10000759 3300005333 Bacteria 10739
46 Ga0068869_100000889 3300005334 Bacteria 17243
47 Ga0068869_100008007 3300005334 Bacteria 6788
48 Ga0068869_100013610 3300005334 Bacteria 5415
49 Ga0068869_100297764 3300005334 Bacteria 1302
50 Ga0070666_10004101 3300005335 Bacteria 8845
51 Ga0070666_10079620 3300005335 Bacteria 2238
52 Ga0070680_100033882 3300005336 Bacteria 4119
53 Ga0068868_100047268 3300005338 Bacteria 3372
54 Ga0068868_100059605 3300005338 Bacteria 3020
55 Ga0068868_100125332 3300005338 Bacteria 2098
56 Ga0068868_100405159 3300005338 Bacteria 1178
57 Ga0070660_100022340 3300005339 Bacteria 4677
58 Ga0070660_100031686 3300005339 Bacteria 3973
59 Ga0070660_100138820 3300005339 Bacteria 1949
60 Ga0070660_100158755 3300005339 Bacteria 1821
61 Ga0070689_100204952 3300005340 Bacteria 1612
62 Ga0070689_100300132 3300005340 Bacteria 1337
63 Ga0070687_100003516 3300005343 Bacteria 6097
64 Ga0070687_100028705 3300005343 Bacteria 2701
65 Ga0070661_100001313 3300005344 Bacteria 17442
66 Ga0070661_100076006 3300005344 Bacteria 2475
67 Ga0070661_100127022 3300005344 Bacteria 1913
68 Ga0070668_100062512 3300005347 Bacteria 2885
69 Ga0070669_100009268 3300005353 Bacteria 7013
70 Ga0070669_100028795 3300005353 Bacteria 4001
71 Ga0070675_100000818 3300005354 Bacteria 21944
72 Ga0070675_100025340 3300005354 Bacteria 4755
73 Ga0070675_100030054 3300005354 Bacteria 4383
74 Ga0070675_100090425 3300005354 Bacteria 2564
75 Ga0070675_100182009 3300005354 Bacteria 1817
76 Ga0070671_100003782 3300005355 Bacteria 11876
77 Ga0070671_100012912 3300005355 Bacteria 6732
78 Ga0070671_100054523 3300005355 Bacteria 3324
79 Ga0070671_100238578 3300005355 Bacteria 1543
80 Ga0070671_100249870 3300005355 Bacteria 1506
81 Ga0070671_100262645 3300005355 Bacteria 1467
82 Ga0070671_100263664 3300005355 Bacteria 1464
83 Ga0070674_100004034 3300005356 Bacteria 8326
84 Ga0070674_100025932 3300005356 Bacteria 3822
85 Ga0070674_100046579 3300005356 Bacteria 2967
86 Ga0070673_100107302 3300005364 Bacteria 2310
87 Ga0070673_100113674 3300005364 Bacteria 2248
88 Ga0070673_100129097 3300005364 Bacteria 2118
89 Ga0070673_100161420 3300005364 Bacteria 1906
90 Ga0070688_100137898 3300005365 Bacteria 1654
91 Ga0070688_100433881 3300005365 Bacteria 979
92 Ga0070659_100000505 3300005366 Bacteria 28646
93 Ga0070659_100031327 3300005366 Bacteria 4118
94 Ga0070659_100123333 3300005366 Bacteria 2100
95 Ga0070659_100128068 3300005366 Bacteria 2060
96 Ga0070659_100456570 3300005366 Bacteria 1084
97 Ga0070667_100000294 3300005367 Bacteria 56218
98 Ga0070667_100004788 3300005367 Bacteria 11336
99 Ga0070667_100079621 3300005367 Bacteria 2801
100 Ga0070667_100501443 3300005367 Bacteria 1113
101 Ga0070667_100537420 3300005367 Bacteria 1073
102 Ga0070700_100145165 3300005441 Bacteria 1617
103 Ga0070663_100019028 3300005455 Bacteria 4516
104 Ga0070663_100039279 3300005455 Bacteria 3306
105 Ga0070678_100002094 3300005456 Bacteria 10817
106 Ga0070678_100003402 3300005456 Bacteria 8870
107 Ga0070678_100127087 3300005456 Bacteria 2020
108 Ga0070662_100002604 3300005457 Bacteria 11127
109 Ga0068867_100001003 3300005459 Bacteria 19259
110 Ga0068867_100021775 3300005459 Bacteria 4576
111 Ga0068867_100068989 3300005459 Bacteria 2639
112 Ga0068867_100320216 3300005459 Bacteria 1284
113 Ga0068867_100705789 3300005459 Bacteria 891
114 Ga0070685_10414707 3300005466 Bacteria 936
115 Ga0070706_100003188 3300005467 Bacteria 16188
116 Ga0070707_100110514 3300005468 Bacteria 2666
117 Ga0070707_100882552 3300005468 Bacteria 859
118 Ga0070698_100036226 3300005471 Bacteria 5099
119 Ga0070679_100015678 3300005530 Bacteria 7286
120 Ga0070684_100035060 3300005535 Bacteria 4292
121 Ga0070684_100203446 3300005535 Bacteria 1804
122 Ga0070684_100342907 3300005535 Bacteria 1374
123 Ga0068853_100047481 3300005539 Bacteria 3684
124 Ga0068853_100206676 3300005539 Bacteria 1788
125 Ga0068853_100600002 3300005539 Bacteria 1046
126 Ga0070672_100002951 3300005543 Bacteria 10949
127 Ga0070672_100009151 3300005543 Bacteria 6814
128 Ga0070672_100088865 3300005543 Bacteria 2488
129 Ga0070672_100105092 3300005543 Bacteria 2295
130 Ga0070672_100119204 3300005543 Bacteria 2158
131 Ga0070693_100009780 3300005547 Bacteria 4780
132 Ga0070693_100077070 3300005547 Bacteria 1977
133 Ga0070693_100239923 3300005547 Bacteria 1197
134 Ga0070665_100049986 3300005548 Bacteria 4195
135 Ga0070665_100629731 3300005548 Bacteria 1086
136 Ga0068855_100009714 3300005563 Bacteria 11611
137 Ga0068855_100129349 3300005563 Bacteria 2885
138 Ga0070664_100005281 3300005564 Bacteria 10367
139 Ga0070664_100013261 3300005564 Bacteria 6713
140 Ga0070664_100129554 3300005564 Bacteria 2215
141 Ga0070664_100215014 3300005564 Bacteria 1718
142 Ga0068857_100003374 3300005577 Bacteria 13292
143 Ga0068857_100027213 3300005577 Bacteria 5043
144 Ga0068857_100187250 3300005577 Bacteria 1885
145 Ga0068857_100266420 3300005577 Bacteria 1574
146 Ga0068854_100017645 3300005578 Bacteria 4779
147 Ga0068854_100027116 3300005578 Bacteria 3946
148 Ga0068856_100002916 3300005614 Bacteria 17515
149 Ga0068856_100024316 3300005614 Bacteria 5894
150 Ga0068856_100026468 3300005614 Bacteria 5657
151 Ga0070702_100155912 3300005615 Bacteria 1471
152 Ga0070702_100462975 3300005615 Bacteria 922
153 Ga0068852_100009725 3300005616 Bacteria 7145
154 Ga0068852_100030734 3300005616 Bacteria 4426
155 Ga0068852_100054632 3300005616 Bacteria 3443
156 Ga0068852_100173764 3300005616 Bacteria 2021
157 Ga0068852_100191114 3300005616 Bacteria 1932
158 Ga0068859_100004410 3300005617 Bacteria 14353
159 Ga0068859_100127837 3300005617 Bacteria 2611
160 Ga0068864_100016598 3300005618 Bacteria 6131
161 Ga0068864_100049956 3300005618 Bacteria 3599
162 Ga0068864_100084658 3300005618 Bacteria 2786
163 Ga0068861_100003026 3300005719 Bacteria 11104
164 Ga0068861_100023609 3300005719 Bacteria 4438
165 Ga0068851_10024199 3300005834 Bacteria 2972
166 Ga0068851_10039128 3300005834 Bacteria 2381
167 Ga0068851_10116026 3300005834 Bacteria 1435
168 Ga0068851_10206479 3300005834 Bacteria 1098
169 Ga0068851_10227890 3300005834 Bacteria 1049
170 Ga0068870_10063283 3300005840 Bacteria 1995
171 Ga0068870_10216166 3300005840 Bacteria 1171
172 Ga0068863_100001702 3300005841 Bacteria 21786
173 Ga0068863_100027398 3300005841 Bacteria 5435
174 Ga0068863_100354863 3300005841 Bacteria 1428
175 Ga0068858_100004719 3300005842 Bacteria 13344
176 Ga0068858_100030332 3300005842 Bacteria 5021
177 Ga0068860_100002478 3300005843 Bacteria 19367
178 Ga0068860_100028345 3300005843 Bacteria 5389
179 Ga0068860_100263404 3300005843 Bacteria 1681
180 Ga0068860_100743685 3300005843 Bacteria 992
181 Ga0068862_100055835 3300005844 Bacteria 3383
182 Ga0075368_10001585 3300006042 Bacteria 7303
183 Ga0075368_10071519 3300006042 Bacteria 1401
184 Ga0075362_10004323 3300006177 Bacteria 5085
185 Ga0075362_10015052 3300006177 Bacteria 3138
186 Ga0075367_10006326 3300006178 Bacteria 5972
187 Ga0075367_10006549 3300006178 Bacteria 5894
188 Ga0075367_10009705 3300006178 Bacteria 5043
189 Ga0075367_10065416 3300006178 Bacteria 2177
190 Ga0075369_10000429 3300006186 Bacteria 12770
191 Ga0075366_10006781 3300006195 Bacteria 6292
192 Ga0075366_10010537 3300006195 Bacteria 5191
193 Ga0075366_10010792 3300006195 Bacteria 5137
194 Ga0075366_10028467 3300006195 Bacteria 3279
195 Ga0075366_10043913 3300006195 Bacteria 2648
196 Ga0075366_10178965 3300006195 Bacteria 1288
197 Ga0097621_100026939 3300006237 Bacteria 4515
198 Ga0097621_100047802 3300006237 Bacteria 3468
199 Ga0097621_100070853 3300006237 Bacteria 2879
200 Ga0075370_10002430 3300006353 Bacteria 8635
201 Ga0075370_10005964 3300006353 Bacteria 6099
202 Ga0075370_10011503 3300006353 Bacteria 4653
203 Ga0075370_10032738 3300006353 Bacteria 2907
204 Ga0075370_10033655 3300006353 Bacteria 2870
205 Ga0075370_10044344 3300006353 Bacteria 2514
206 Ga0075370_10063543 3300006353 Bacteria 2105
207 Ga0075370_10065556 3300006353 Bacteria 2071
208 Ga0068871_100036870 3300006358 Bacteria 3895
209 Ga0068871_100102167 3300006358 Bacteria 2403
210 Ga0068871_100109101 3300006358 Bacteria 2326
211 Ga0068871_100140856 3300006358 Bacteria 2051
212 Ga0068871_100247924 3300006358 Bacteria 1550
213 Ga0068871_100353045 3300006358 Bacteria 1301
214 Ga0068871_100812235 3300006358 Bacteria 863
215 Ga0075429_100002105 3300006880 Bacteria 16618
216 Ga0068865_100062584 3300006881 Bacteria 2612
217 Ga0068865_100086682 3300006881 Bacteria 2261
218 Ga0097620_100004410 3300006931 Bacteria 14353
219 Ga0097620_100127837 3300006931 Bacteria 2611
220 Ga0079104_1000053 3300006946 Bacteria 168604
221 Ga0105240_10064095 3300009093 Bacteria 4567
222 Ga0105240_10072064 3300009093 Bacteria 4271
223 Ga0105240_10236407 3300009093 Bacteria 2120
224 Ga0111539_10414203 3300009094 Bacteria 1569
225 Ga0105245_10060858 3300009098 Bacteria 3402
226 Ga0105245_10221090 3300009098 Bacteria 1827
227 Ga0114129_10041079 3300009147 Bacteria 6519
228 Ga0105243_10011524 3300009148 Bacteria 6691
229 Ga0105243_10059091 3300009148 Bacteria 3059
230 Ga0105243_10093018 3300009148 Bacteria 2487
231 Ga0105243_10099110 3300009148 Bacteria 2415
232 Ga0105241_10039332 3300009174 Bacteria 3568
233 Ga0105241_10304265 3300009174 Bacteria 1369
234 Ga0105241_10591764 3300009174 Bacteria 1001
235 Ga0105242_10150962 3300009176 Bacteria 2026
236 Ga0105248_10049549 3300009177 Bacteria 4711
237 Ga0105248_10220221 3300009177 Bacteria 2137
238 Ga0105248_10229301 3300009177 Bacteria 2091
239 Ga0105237_10018091 3300009545 Bacteria 7299
240 Ga0105237_10129214 3300009545 Bacteria 2521
241 Ga0105237_10208900 3300009545 Bacteria 1952
242 Ga0105237_10557436 3300009545 Bacteria 1153
243 Ga0105238_10034370 3300009551 Bacteria 5158
244 Ga0105238_10148910 3300009551 Bacteria 2316
245 Ga0105238_10491394 3300009551 Bacteria 1227
246 Ga0105249_10027507 3300009553 Bacteria 5131
247 Ga0105239_10039921 3300010375 Bacteria 5142
248 Ga0105239_10249173 3300010375 Bacteria 1995
249 Ga0105239_10353583 3300010375 Bacteria 1659
250 Ga0105239_10994595 3300010375 Bacteria 964
251 Ga0105246_10548100 3300011119 Bacteria 991
252 Ga0105246_10612925 3300011119 Bacteria 942
253 Ga0157315_1011222 3300012508 Bacteria 805
254 Ga0157338_1011212 3300012515 Bacteria 918
255 Ga0157373_10057699 3300013100 Bacteria 2753
256 Ga0157373_10362906 3300013100 Bacteria 1034
257 Ga0157369_10021757 3300013105 Bacteria 7172
258 Ga0157369_10351196 3300013105 Bacteria 1531
259 Ga0157374_10266447 3300013296 Bacteria 1689
260 Ga0157374_10572633 3300013296 Bacteria 1138
261 Ga0157378_10261535 3300013297 Bacteria 1661
262 Ga0157378_10458511 3300013297 Bacteria 1266
263 Ga0163162_10001148 3300013306 Bacteria 24691
264 Ga0157372_10320684 3300013307 Bacteria 1804
265 Ga0157372_10441962 3300013307 Bacteria 1516
266 Ga0157375_10003901 3300013308 Bacteria 12932
267 Ga0157375_10081629 3300013308 Bacteria 3274
268 Ga0157375_11358396 3300013308 Bacteria 836
269 Ga0163163_10446821 3300014325 Bacteria 1353
270 Ga0163163_10501588 3300014325 Bacteria 1275
271 Ga0157380_10003166 3300014326 Bacteria 11230
272 Ga0157380_10009964 3300014326 Bacteria 6819
273 Ga0157380_10643560 3300014326 Bacteria 1056
274 Ga0157377_10000132 3300014745 Bacteria 47931
275 Ga0157377_10490916 3300014745 Bacteria 856
276 Ga0157379_10005217 3300014968 Bacteria 11157
277 Ga0157379_10042908 3300014968 Bacteria 4039
278 Ga0157379_10083586 3300014968 Bacteria 2861
279 Ga0157379_10115768 3300014968 Bacteria 2410
280 Ga0157379_10446499 3300014968 Bacteria 1193
281 Ga0157376_10054658 3300014969 Bacteria 3330
282 Ga0157376_10459278 3300014969 Bacteria 1244
283 Ga0157376_10930250 3300014969 Bacteria 889
284 Ga0182007_10014416 3300015262 Bacteria 2980
285 Ga0163161_10008277 3300017792 Bacteria 7196
286 Ga0163161_10074083 3300017792 Bacteria 2496
287 Ga0213872_10000318 3300021361 Bacteria 41064
288 Ga0213872_10005163 3300021361 Bacteria 6761
289 Ga0213872_10095899 3300021361 Bacteria 1324
290 Ga0209674_100073 3300025226 Bacteria 223689
291 Ga0209563_100061 3300025230 Bacteria 274295
292 Ga0209563_100075 3300025230 Bacteria 216575
293 Ga0207427_100611 3300025231 Bacteria 17760
294 Ga0209258_100202 3300025242 Bacteria 121896
295 Ga0209258_100941 3300025242 Bacteria 14133
296 Ga0207425_1000717 3300025245 Bacteria 17832
297 Ga0209646_1000258 3300025246 Bacteria 51783
298 Ga0209026_1000011 3300025250 Bacteria 507291
299 Ga0209677_100120 3300025253 Bacteria 80505
300 Ga0209677_100633 3300025253 Bacteria 18825
301 Ga0209677_101238 3300025253 Bacteria 11550
302 Ga0209148_1004607 3300025254 Bacteria 3347
303 Ga0209759_1000034 3300025256 Bacteria 271209
304 Ga0209759_1000427 3300025256 Bacteria 51284
305 Ga0209759_1000900 3300025256 Bacteria 22212
306 Ga0209129_1000185 3300025258 Bacteria 86854
307 Ga0209129_1020044 3300025258 Bacteria 1251
308 Ga0209455_1000181 3300025272 Bacteria 101875
309 Ga0209673_1005894 3300025273 Bacteria 6058
310 Ga0209675_1004911 3300025291 Bacteria 5773
311 Ga0209564_1000349 3300025295 Bacteria 86861
312 Ga0209758_1000339 3300025297 Bacteria 86850
313 Ga0209758_1001209 3300025297 Bacteria 32513
314 Ga0209050_1000357 3300025298 Bacteria 88084
315 Ga0209050_1001841 3300025298 Bacteria 20549
316 Ga0209256_1000045 3300025299 Bacteria 325506
317 Ga0209256_1013854 3300025299 Bacteria 2959
318 Ga0209051_1000004 3300025303 Bacteria 1155596
319 Ga0209051_1002249 3300025303 Bacteria 14189
320 Ga0209257_1000315 3300025304 Bacteria 102293
321 Ga0207697_10014102 3300025315 Bacteria 3325
322 Ga0207697_10018319 3300025315 Bacteria 2873
323 Ga0207656_10006100 3300025321 Bacteria 4315
324 Ga0207656_10015084 3300025321 Bacteria 2987
325 Ga0207656_10078023 3300025321 Bacteria 1484
326 Ga0207656_10119346 3300025321 Bacteria 1226
327 Ga0207682_10001172 3300025893 Bacteria 12163
328 Ga0207682_10056581 3300025893 Bacteria 1633
329 Ga0207688_10058647 3300025901 Bacteria 2166
330 Ga0207688_10212655 3300025901 Bacteria 1162
331 Ga0207680_10004315 3300025903 Bacteria 6741
332 Ga0207699_10572926 3300025906 Bacteria 820
333 Ga0207645_10005551 3300025907 Bacteria 9129
334 Ga0207645_10008207 3300025907 Bacteria 7302
335 Ga0207645_10014430 3300025907 Bacteria 5287
336 Ga0207643_10130470 3300025908 Bacteria 1495
337 Ga0207705_10125397 3300025909 Bacteria 1908
338 Ga0207705_10155318 3300025909 Bacteria 1716
339 Ga0207684_10004160 3300025910 Bacteria 13756
340 Ga0207654_10071738 3300025911 Bacteria 2060
341 Ga0207654_10368197 3300025911 Bacteria 993
342 Ga0207707_10557887 3300025912 Bacteria 973
343 Ga0207695_10005833 3300025913 Bacteria 16193
344 Ga0207695_10069686 3300025913 Bacteria 3597
345 Ga0207695_10264468 3300025913 Bacteria 1617
346 Ga0207695_10492502 3300025913 Bacteria 1108
347 Ga0207671_10003773 3300025914 Bacteria 14891
348 Ga0207671_10030236 3300025914 Bacteria 4040
349 Ga0207660_10040424 3300025917 Bacteria 3265
350 Ga0207660_10426181 3300025917 Bacteria 1071
351 Ga0207662_10005227 3300025918 Bacteria 6891
352 Ga0207662_10043314 3300025918 Bacteria 2655
353 Ga0207657_10026522 3300025919 Bacteria 5322
354 Ga0207657_10048270 3300025919 Bacteria 3717
355 Ga0207657_10194781 3300025919 Bacteria 1633
356 Ga0207657_10535710 3300025919 Bacteria 916
357 Ga0207649_10003219 3300025920 Bacteria 8942
358 Ga0207649_10045734 3300025920 Bacteria 2685
359 Ga0207652_10147881 3300025921 Bacteria 2103
360 Ga0207646_10379050 3300025922 Bacteria 1278
361 Ga0207681_10000420 3300025923 Bacteria 29486
362 Ga0207681_10003758 3300025923 Bacteria 9434
363 Ga0207681_10105650 3300025923 Bacteria 2039
364 Ga0207694_10137055 3300025924 Bacteria 1966
365 Ga0207694_10219033 3300025924 Bacteria 1552
366 Ga0207650_10000553 3300025925 Bacteria 30415
367 Ga0207650_10001006 3300025925 Bacteria 21205
368 Ga0207650_10006632 3300025925 Bacteria 7895
369 Ga0207650_10072259 3300025925 Bacteria 2597
370 Ga0207650_10599503 3300025925 Bacteria 926
371 Ga0207659_10001264 3300025926 Bacteria 15136
372 Ga0207659_10163835 3300025926 Bacteria 1748
373 Ga0207687_10597826 3300025927 Bacteria 929
374 Ga0207644_10004604 3300025931 Bacteria 8973
375 Ga0207644_10010359 3300025931 Bacteria 6145
376 Ga0207644_10047378 3300025931 Bacteria 3067
377 Ga0207644_10058804 3300025931 Bacteria 2779
378 Ga0207644_10060948 3300025931 Bacteria 2731
379 Ga0207644_10086148 3300025931 Bacteria 2332
380 Ga0207690_10005140 3300025932 Bacteria 7723
381 Ga0207690_10101686 3300025932 Bacteria 2054
382 Ga0207706_10000785 3300025933 Bacteria 32843
383 Ga0207706_10004957 3300025933 Bacteria 12440
384 Ga0207706_10006354 3300025933 Bacteria 10978
385 Ga0207686_10120723 3300025934 Bacteria 1783
386 Ga0207709_10004700 3300025935 Bacteria 7853
387 Ga0207709_10116075 3300025935 Bacteria 1799
388 Ga0207669_10000881 3300025937 Bacteria 12700
389 Ga0207669_10005731 3300025937 Bacteria 5603
390 Ga0207704_10002359 3300025938 Bacteria 8487
391 Ga0207704_10283536 3300025938 Bacteria 1260
392 Ga0207665_10701336 3300025939 Bacteria 796
393 Ga0207691_10005520 3300025940 Bacteria 12219
394 Ga0207691_10006646 3300025940 Bacteria 11158
395 Ga0207691_10105709 3300025940 Bacteria 2507
396 Ga0207691_10122141 3300025940 Bacteria 2307
397 Ga0207691_10133998 3300025940 Bacteria 2187
398 Ga0207691_10177718 3300025940 Bacteria 1861
399 Ga0207691_10265719 3300025940 Bacteria 1478
400 Ga0207711_10031000 3300025941 Bacteria 4511
401 Ga0207711_10098508 3300025941 Bacteria 2583
402 Ga0207711_10202331 3300025941 Bacteria 1812
403 Ga0207689_10000415 3300025942 Bacteria 39864
404 Ga0207689_10005097 3300025942 Bacteria 11818
405 Ga0207689_10017327 3300025942 Bacteria 6097
406 Ga0207689_10079217 3300025942 Bacteria 2700
407 Ga0207689_10176566 3300025942 Bacteria 1761
408 Ga0207661_10188114 3300025944 Bacteria 1808
409 Ga0207679_10000863 3300025945 Bacteria 19395
410 Ga0207679_10040109 3300025945 Bacteria 3349
411 Ga0207679_10235186 3300025945 Bacteria 1549
412 Ga0207667_10004262 3300025949 Bacteria 17553
413 Ga0207667_10071909 3300025949 Bacteria 3596
414 Ga0207667_10462279 3300025949 Bacteria 1289
415 Ga0207651_10039143 3300025960 Bacteria 3123
416 Ga0207651_10073631 3300025960 Bacteria 2429
417 Ga0207651_10187737 3300025960 Bacteria 1646
418 Ga0207651_10528123 3300025960 Bacteria 1023
419 Ga0207712_10080041 3300025961 Bacteria 2375
420 Ga0207668_10002852 3300025972 Bacteria 10131
421 Ga0207668_10023934 3300025972 Bacteria 3935
422 Ga0207668_10520400 3300025972 Bacteria 1026
423 Ga0207640_10006820 3300025981 Bacteria 6281
424 Ga0207640_10291132 3300025981 Bacteria 1287
425 Ga0207658_10000212 3300025986 Bacteria 60851
426 Ga0207658_10046494 3300025986 Bacteria 3170
427 Ga0207658_10244154 3300025986 Bacteria 1523
428 Ga0207677_10008469 3300026023 Bacteria 5749
429 Ga0207677_10010172 3300026023 Bacteria 5315
430 Ga0207677_10329585 3300026023 Bacteria 1272
431 Ga0207703_10006037 3300026035 Bacteria 9692
432 Ga0207703_10038758 3300026035 Bacteria 3806
433 Ga0207639_10183700 3300026041 Bacteria 1781
434 Ga0207639_10291274 3300026041 Bacteria 1440
435 Ga0207639_10504839 3300026041 Bacteria 1105
436 Ga0207678_10014014 3300026067 Bacteria 7048
437 Ga0207678_10016179 3300026067 Bacteria 6548
438 Ga0207678_10048953 3300026067 Bacteria 3652
439 Ga0207678_10106729 3300026067 Bacteria 2389
440 Ga0207702_10002432 3300026078 Bacteria 17664
441 Ga0207702_10044569 3300026078 Bacteria 3729
442 Ga0207702_10069777 3300026078 Bacteria 3022
443 Ga0207641_10001060 3300026088 Bacteria 27782
444 Ga0207641_10114800 3300026088 Bacteria 2393
445 Ga0207641_10153694 3300026088 Bacteria 2086
446 Ga0207641_10212175 3300026088 Bacteria 1791
447 Ga0207648_10001573 3300026089 Bacteria 25016
448 Ga0207648_10002514 3300026089 Bacteria 19686
449 Ga0207648_10033577 3300026089 Bacteria 4525
450 Ga0207648_10094691 3300026089 Bacteria 2612
451 Ga0207676_10011359 3300026095 Bacteria 6366
452 Ga0207676_10014988 3300026095 Bacteria 5586
453 Ga0207676_10035803 3300026095 Bacteria 3771
454 Ga0207674_10014124 3300026116 Bacteria 8823
455 Ga0207674_10025976 3300026116 Bacteria 6232
456 Ga0207674_10038054 3300026116 Bacteria 4998
457 Ga0207674_10104114 3300026116 Bacteria 2817
458 Ga0207674_10167295 3300026116 Bacteria 2152
459 Ga0207674_10642573 3300026116 Bacteria 1025
460 Ga0207675_100000177 3300026118 Bacteria 57433
461 Ga0207675_100001432 3300026118 Bacteria 23904
462 Ga0207675_100049790 3300026118 Bacteria 3909
463 Ga0207675_100072299 3300026118 Bacteria 3226
464 Ga0207675_100314949 3300026118 Bacteria 1527
465 Ga0207675_100488909 3300026118 Bacteria 1224
466 Ga0207683_10005398 3300026121 Bacteria 10953
467 Ga0207683_10009410 3300026121 Bacteria 8325
468 Ga0207683_10078252 3300026121 Bacteria 2930
469 Ga0207683_10696260 3300026121 Bacteria 942
470 Ga0207698_10011410 3300026142 Bacteria 5761
471 Ga0207698_10240806 3300026142 Bacteria 1649
472 Ga0207698_10294526 3300026142 Bacteria 1508
473 Ga0207698_10873773 3300026142 Bacteria 905
474 Ga0207698_10901723 3300026142 Bacteria 891
475 Ga0209281_1000147 3300027111 Bacteria 168586
476 Ga0209971_1066260 3300027682 Bacteria 876
477 Ga0209813_10003672 3300027866 Bacteria 3611
478 Ga0209974_10025020 3300027876 Bacteria 1976
479 Ga0268266_10013661 3300028379 Bacteria 6993
480 Ga0268266_10197823 3300028379 Bacteria 1838
481 Ga0268266_10206996 3300028379 Bacteria 1798
482 Ga0268265_10051554 3300028380 Bacteria 3106
483 Ga0268264_10001043 3300028381 Bacteria 27736
484 Ga0268264_10028673 3300028381 Bacteria 4555
485 Ga0268264_10079473 3300028381 Bacteria 2798
486 Ga0265319_1092906 3300028563 Bacteria 951
487 Ga0265336_10000556 3300028666 Bacteria 21237
488 Ga0307517_10241977 3300028786 Bacteria 1069
489 Ga0307515_10000096 3300028794 Bacteria 206366
490 Ga0307515_10010714 3300028794 Bacteria 17519
491 Ga0307515_10014894 3300028794 Bacteria 14373
492 Ga0307515_10018130 3300028794 Bacteria 12769
493 Ga0307515_10144057 3300028794 Bacteria 2536
494 Ga0307515_10283962 3300028794 Bacteria 1359
495 Ga0307515_10301318 3300028794 Bacteria 1287
496 Ga0265324_10006457 3300029957 Bacteria 4886
497 Ga0307512_10056018 3300030522 Bacteria 3101
498 Ga0307512_10202173 3300030522 Bacteria 1073
499 Ga0265328_10005721 3300031239 Bacteria 5311
500 Ga0265328_10009070 3300031239 Bacteria 4064
501 Ga0265327_10000364 3300031251 Bacteria 86161
502 Ga0265316_10000069 3300031344 Bacteria 104235
503 Ga0307513_10019952 3300031456 Bacteria 7962
504 Ga0307513_10035096 3300031456 Bacteria 5617
505 Ga0307513_10363045 3300031456 Bacteria 1192
506 Ga0307509_10001003 3300031507 Bacteria 48532
507 Ga0307509_10001647 3300031507 Bacteria 37422
508 Ga0307509_10029240 3300031507 Bacteria 6119
509 Ga0307509_10052681 3300031507 Bacteria 4343
510 Ga0307408_100062879 3300031548 Bacteria 2714
511 Ga0307408_100067279 3300031548 Bacteria 2634
512 Ga0307408_100203466 3300031548 Bacteria 1604
513 Ga0307408_100250327 3300031548 Bacteria 1461
514 Ga0307508_10000028 3300031616 Bacteria 168639
515 Ga0307508_10001377 3300031616 Bacteria 27383
516 Ga0307514_10084421 3300031649 Bacteria 2337
517 Ga0307514_10171056 3300031649 Bacteria 1419
518 Ga0307516_10000155 3300031730 Bacteria 85605
519 Ga0307516_10000329 3300031730 Bacteria 61772
520 Ga0307516_10002006 3300031730 Bacteria 27820
521 Ga0307516_10043796 3300031730 Bacteria 4433
522 Ga0307516_10044489 3300031730 Bacteria 4392
523 Ga0307405_10014639 3300031731 Bacteria 4224
524 Ga0307405_10057608 3300031731 Bacteria 2442
525 Ga0307405_10606909 3300031731 Bacteria 894
526 Ga0307413_10069721 3300031824 Bacteria 2207
527 Ga0307413_10530766 3300031824 Bacteria 951
528 Ga0307413_10606630 3300031824 Bacteria 897
529 Ga0307410_10023773 3300031852 Bacteria 3817
530 Ga0307410_10227855 3300031852 Bacteria 1437
531 Ga0307406_10012755 3300031901 Bacteria 4796
532 Ga0307406_10349285 3300031901 Bacteria 1155
533 Ga0307407_10084147 3300031903 Bacteria 1932
534 Ga0307412_10427002 3300031911 Bacteria 1085
535 Ga0307412_10490123 3300031911 Bacteria 1021
536 Ga0307412_10561092 3300031911 Bacteria 961
537 Ga0307412_10671413 3300031911 Bacteria 886
538 Ga0307409_100000528 3300031995 Bacteria 16509
539 Ga0307409_100054964 3300031995 Bacteria 3070
540 Ga0307416_100002866 3300032002 Bacteria 10042
541 Ga0307414_10011356 3300032004 Bacteria 5219
542 Ga0307414_10086897 3300032004 Bacteria 2309
543 Ga0307414_10136911 3300032004 Bacteria 1911
544 Ga0307411_10054197 3300032005 Bacteria 2632
545 Ga0307415_100000956 3300032126 Bacteria 13308
546 Ga0307510_10001817 3300033180 Bacteria 23867
547 Ga0307510_10025655 3300033180 Bacteria 6791
548 Ga0307510_10033774 3300033180 Bacteria 5740
549 Ga0373953_0069024 3300035117 Bacteria 1456
550 Ga0373946_0093539 3300035171 Bacteria 1336
551 Ga0373946_0174756 3300035171 Bacteria 1016
552 Ga0373955_0020437 3300035172 Bacteria 3329
553 Ga0373931_0055367 3300035691 Bacteria 2122
554 Ga0373931_0080247 3300035691 Bacteria 1799
555 Ga0373931_0132866 3300035691 Bacteria 1434
556 Ga0373935_0086846 3300035692 Bacteria 2042
557 Ga0373927_0099187 3300035695 Bacteria 1894
558 Ga0373933_0244365 3300035724 Bacteria 1155
559 Ga0373937_0030441 3300036401 Bacteria 4889
560 Ga0373937_0160248 3300036401 Bacteria 2109
561 Ga0373937_0600022 3300036401 Bacteria 1045
562 Ga0373925_0027592 3300037068 Bacteria 4156
563 Ga0373925_0053738 3300037068 Bacteria 3012
564 Ga0373925_0198780 3300037068 Bacteria 1593
565 Ga0373925_0409372 3300037068 Bacteria 1107
566 Ga0395899_0479437 3300037312 Bacteria 810
567 Ga0395898_0001191 3300037466 Bacteria 39411
568 Ga0395898_0513608 3300037466 Bacteria 1139
569 Ga0395905_0000181 3300037471 Bacteria 100569
570 Ga0395905_0132272 3300037471 Bacteria 2346
571 Ga0395905_0314630 3300037471 Bacteria 1454
572 Ga0395905_0448879 3300037471 Bacteria 1187
573 Ga0436361_0237820 3300039447 Bacteria 8279
574 Ga0436361_0647097 3300039447 Bacteria 1264
575 Ga0436361_0653054 3300039447 Bacteria 18423
576 Ga0436361_0781207 3300039447 Bacteria 33568
577 Ga0436363_0216572 3300039450 Bacteria 5088
578 Ga0439438_035551 3300041405 Bacteria 1309
579 Ga0439466_0118362 3300041411 Bacteria 819
580 Ga0451797_1056911 3300041453 Bacteria 886
581 Ga0451798_0835857 3300041458 Bacteria 817
582 Ga0451800_1601736 3300041459 Bacteria 1067
583 Ga0451804_0244073 3300041463 Bacteria 1072
584 Ga0439449_0069645 3300042007 Bacteria 1297
585 Ga0451577_0001773 3300042876 Bacteria 27757
586 Ga0451577_0007365 3300042876 Bacteria 10803
587 Ga0451577_0010640 3300042876 Bacteria 8766
588 Ga0451577_0109276 3300042876 Bacteria 2473
589 Ga0466969_0079166 3300044656 Bacteria 1571
590 Ga0466972_0005822 3300044658 Bacteria 6180
591 Ga0466972_0006098 3300044658 Bacteria 6054
592 Ga0466972_0015489 3300044658 Bacteria 3811
593 Ga0466977_0011985 3300044666 Bacteria 5022
594 Ga0466965_0017284 3300044683 Bacteria 3446
595 Ga0466965_0095387 3300044683 Bacteria 1517
596 Ga0466966_0006064 3300044684 Bacteria 7981
597 Ga0466963_0021472 3300044694 Bacteria 4073
598 Ga0466963_0260644 3300044694 Bacteria 1217
599 Ga0453684_0027068 3300044712 Bacteria 8243
600 Ga0453684_0118372 3300044712 Bacteria 3204
601 Ga0453684_0262653 3300044712 Bacteria 1977
602 Ga0453684_0344616 3300044712 Bacteria 1681
603 Ga0453684_0649690 3300044712 Bacteria 1151
604 Ga0466971_0100547 3300044719 Bacteria 1328
605 Ga0466968_0020050 3300044735 Bacteria 2695
606 Ga0466970_0098737 3300044765 Bacteria 1589
607 Ga0466970_0192146 3300044765 Bacteria 1134
608 Ga0466957_0117145 3300044842 Bacteria 1695
609 Ga0466960_0151398 3300044901 Bacteria 1239
610 Ga0466959_0050980 3300045049 Bacteria 3037
611 Ga0451576_0102995 3300045051 Bacteria 2969
612 Ga0451576_0292348 3300045051 Bacteria 1703
613 Ga0451576_0624441 3300045051 Bacteria 1132
614 Ga0466958_0111000 3300045836 Bacteria 1711
615 Ga0466967_0189251 3300045976 Bacteria 1944
616 Ga0495592_0000734 3300046454 Bacteria 22835
617 Ga0495638_0272965 3300046460 Bacteria 922
618 Ga0495653_0364154 3300046463 Bacteria 927
619 Ga0495650_0021380 3300046471 Bacteria 3129
620 Ga0495580_0092157 3300046472 Bacteria 2109
621 Ga0495605_0034108 3300046474 Bacteria 2579
622 Ga0495585_0027045 3300046492 Bacteria 3275
623 Ga0495606_0012250 3300046507 Bacteria 6898
624 Ga0495606_0095178 3300046507 Bacteria 1824
625 Ga0495606_0146821 3300046507 Bacteria 1388
626 Ga0495608_0076717 3300046511 Bacteria 2176
627 Ga0495608_0217425 3300046511 Bacteria 1200
628 Ga0495608_0373996 3300046511 Bacteria 874
629 Ga0495632_0001700 3300046519 Bacteria 17931
630 Ga0495632_0017146 3300046519 Bacteria 4006
631 Ga0495632_0054120 3300046519 Bacteria 1968
632 Ga0495643_0135091 3300046522 Bacteria 1235
633 Ga0495648_0226971 3300046524 Bacteria 917
634 Ga0495648_0264694 3300046524 Bacteria 823
635 Ga0495597_0003790 3300046542 Bacteria 8604
636 Ga0495622_0211726 3300046557 Bacteria 861
637 Ga0495656_0092430 3300046615 Bacteria 1386
638 Ga0495668_0013457 3300046616 Bacteria 4823
639 Ga0495668_0015696 3300046616 Bacteria 4415
640 Ga0495668_0032904 3300046616 Bacteria 2915
641 Ga0495668_0117584 3300046616 Bacteria 1454
642 Ga0495611_0122273 3300046648 Bacteria 1214
643 Ga0495625_0269716 3300046660 Bacteria 1098
644 Ga0495635_0064949 3300046663 Bacteria 2505
645 Ga0495599_0442488 3300046678 Bacteria 770
646 Ga0495646_0096867 3300046680 Bacteria 1696
647 Ga0495658_0096932 3300046683 Bacteria 1755
648 Ga0495658_0109957 3300046683 Bacteria 1656
649 Ga0495669_0023944 3300046684 Bacteria 2660
650 Ga0495671_0111242 3300046692 Bacteria 1338
651 Ga0495649_0000180 3300046694 Bacteria 55086
652 Ga0495649_0108683 3300046694 Bacteria 1471
653 Ga0495589_0075751 3300046794 Bacteria 1641
654 Ga0495676_0101914 3300047321 Bacteria 2122
655 Ga0495680_0096673 3300047322 Bacteria 2205
656 Ga0495687_000890 3300047443 Bacteria 31459
657 Ga0495687_009019 3300047443 Bacteria 5629
658 Ga0495687_014505 3300047443 Bacteria 4052
659 Ga0495677_0093560 3300047445 Bacteria 1134
660 Ga0495673_0096905 3300047469 Bacteria 1198
661 Ga0495686_0004536 3300047472 Bacteria 11381
662 Ga0495686_0005275 3300047472 Bacteria 10257
663 Ga0495686_0083867 3300047472 Bacteria 1943
664 Ga0495686_0088778 3300047472 Bacteria 1879
665 Ga0495686_0137862 3300047472 Bacteria 1442
666 Ga0495626_0054419 3300048091 Bacteria 1837
667 Ga0496102_0001760 3300048905 Bacteria 18852
668 Ga0496102_0569758 3300048905 Bacteria 1055
669 Ga0496104_0107765 3300048907 Bacteria 2670
670 Ga0496105_0466008 3300048908 Bacteria 996
671 Ga0496106_0141839 3300048909 Bacteria 1890
672 Ga0496106_0401041 3300048909 Bacteria 1102
673 Ga0496108_0285627 3300048911 Bacteria 1436
674 Ga0496108_0493932 3300048911 Bacteria 1069
675 Ga0496109_0360169 3300048912 Bacteria 1374
676 Ga0496110_0044294 3300048913 Bacteria 3886
677 Ga0496110_0128718 3300048913 Bacteria 2285
678 Ga0496112_0539277 3300048915 Bacteria 1101
679 Ga0496114_0000554 3300048917 Bacteria 27680
680 Ga0496121_0010106 3300048924 Bacteria 10703
681 Ga0496124_0003631 3300048927 Bacteria 18724
682 Ga0496125_0012783 3300048928 Bacteria 8298
683 Ga0501294_005716 3300049517 Bacteria 1181
684 Ga0501298_004902 3300049521 Bacteria 2129
685 Ga0501032_0036399 3300049569 Bacteria 3359
686 Ga0501034_0148849 3300049571 Bacteria 2317
687 Ga0501041_0504756 3300049577 Bacteria 770
688 Ga0501043_0000002 3300049579 Bacteria 351081
689 Ga0501043_0017885 3300049579 Bacteria 5559
690 Ga0501046_0000008 3300049580 Bacteria 351167
691 Ga0501047_0000003 3300049581 Bacteria 508375
692 Ga0501047_0188868 3300049581 Bacteria 1925
693 Ga0501048_0002164 3300049582 Bacteria 14963
694 Ga0501198_000007 3300049649 Bacteria 129700
695 Ga0501222_000005 3300049662 Bacteria 129724
696 Ga0501252_006255 3300049682 Bacteria 1319
697 Ga0501265_001134 3300049762 Bacteria 3000
698 Ga0501044_0196635 3300049823 Bacteria 1976
699 Ga0501045_0006316 3300049824 Bacteria 8196
700 nmdc:mga03683_10708_c1 3300050489 Bacteria 3295
701 nmdc:mga03683_11731_c1 3300050489 Bacteria 3182
702 nmdc:mga03683_259784_c1 3300050489 Bacteria 808
703 nmdc:mga00v17_49418_c1 3300050491 Bacteria 2551
704 nmdc:mga00v17_97988_c1 3300050491 Bacteria 1848
705 nmdc:mga0yw44_175847_c1 3300050492 Bacteria 1407
706 nmdc:mga0k408_10919_c1 3300050493 Bacteria 4927
707 nmdc:mga0k408_110914_c1 3300050493 Bacteria 1622
708 nmdc:mga0k408_12173_c1 3300050493 Bacteria 4699
709 nmdc:mga0k408_25834_c1 3300050493 Bacteria 3328
710 nmdc:mga0k408_27122_c2 3300050493 Bacteria 2935
711 nmdc:mga0k408_2752_c1 3300050493 Bacteria 9345
712 nmdc:mga0k408_4953_c1 3300050493 Bacteria 7058
713 nmdc:mga0k408_75652_c2 3300050493 Bacteria 1771
714 nmdc:mga0k408_86274_c1 3300050493 Bacteria 1842
715 nmdc:mga06z11_18752_c1 3300050494 Bacteria 3167
716 nmdc:mga06z11_56308_c1 3300050494 Bacteria 2033
717 nmdc:mga04h51_106307_c1 3300050495 Bacteria 1029
718 nmdc:mga04h51_22799_c1 3300050495 Bacteria 1899
719 nmdc:mga07m45_13723_c1 3300050496 Bacteria 4302
720 nmdc:mga07m45_152709_c1 3300050496 Bacteria 1339
721 nmdc:mga07m45_1608_c1 3300050496 Bacteria 10398
722 nmdc:mga07m45_20211_c1 3300050496 Bacteria 3617
723 nmdc:mga07m45_225796_c1 3300050496 Bacteria 1090
724 nmdc:mga07m45_22669_c1 3300050496 Bacteria 3430
725 nmdc:mga07m45_25425_c1 3300050496 Bacteria 3247
726 nmdc:mga07m45_29719_c1 3300050496 Bacteria 3025
727 nmdc:mga07m45_56749_c1 3300050496 Bacteria 2214
728 nmdc:mga09592_28582_c1 3300050508 Bacteria 4633
729 nmdc:mga0qj67_131048_c1 3300050509 Bacteria 2031
730 nmdc:mga08y16_558075_c1 3300050511 Bacteria 1158
731 nmdc:mga0sz30_22155_c1 3300050516 Bacteria 2577
732 Ga0495601_0058433 3300053077 Bacteria 2444
733 Ga0500635_0000029 3300053080 Bacteria 100914
734 Ga0495595_0015382 3300053084 Bacteria 3264
735 Ga0495619_0045623 3300053085 Bacteria 2880
736 Ga0500578_0000311 3300053086 Bacteria 59919
737 Ga0500578_0076324 3300053086 Bacteria 2134
738 Ga0500644_0072836 3300053088 Bacteria 1242
739 Ga0500646_0003723 3300053090 Bacteria 3906
740 Ga0500583_0024103 3300053092 Bacteria 2577
741 Ga0500583_0208174 3300053092 Bacteria 971
742 Ga0500651_0026946 3300053093 Bacteria 3612
743 Ga0500651_0117260 3300053093 Bacteria 1619
744 Ga0500650_0028900 3300053098 Bacteria 2507
745 Ga0500569_090657 3300053109 Bacteria 990
746 Ga0500593_147974 3300053117 Bacteria 915
747 Ga0500594_0001185 3300053118 Bacteria 5625
748 Ga0500608_123485 3300053122 Bacteria 1171
749 Ga0500614_022515 3300053123 Bacteria 1472
750 Ga0500642_0002755 3300053130 Bacteria 5206
751 Ga0500652_000663 3300053131 Bacteria 11691
752 Ga0500655_010539 3300053133 Bacteria 1670
753 Ga0500658_0002762 3300053134 Bacteria 6750
754 Ga0500559_0000133 3300053136 Bacteria 56972
755 Ga0500559_0122603 3300053136 Bacteria 1209
756 Ga0500568_0009517 3300053139 Bacteria 4607
757 Ga0500568_0017650 3300053139 Bacteria 3145
758 Ga0500568_0046502 3300053139 Bacteria 1722
759 Ga0500577_0019302 3300053142 Bacteria 2208
760 Ga0500590_005138 3300053148 Bacteria 6275
761 Ga0500619_000029 3300053154 Bacteria 47803
762 Ga0500619_036256 3300053154 Bacteria 1535
763 Ga0500622_0000307 3300053156 Bacteria 50070
764 Ga0500622_0011091 3300053156 Bacteria 4919
765 Ga0500622_0111327 3300053156 Bacteria 1337
766 Ga0500636_0044245 3300053177 Bacteria 2626
767 Ga0500636_0049964 3300053177 Bacteria 2459
768 Ga0500570_129469 3300053724 Bacteria 963
769 Ga0500645_034488 3300053730 Bacteria 1511
770 Ga0500587_005972 3300053739 Bacteria 1627
771 Ga0590075_018865 3300059424 Bacteria 1709

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025924 Ga0207694_10219033 Ga0207694_102190332 197
2 3300037068 Ga0373925_0053738 Ga0373925_0053738_440_1090 209
3 3300044656 Ga0466969_0079166 Ga0466969_0079166_788_1456 211
4 3300044666 Ga0466977_0011985 Ga0466977_0011985_2379_3047 211
5 3300049579 Ga0501043_0017885 Ga0501043_0017885_4204_4872 211
6 3300009094 Ga0111539_10414203 Ga0111539_104142032 213
7 iso_pu_bacteria 2721755763 2723875855 214
8 3300036401 Ga0373937_0600022 Ga0373937_0600022_110_781 216
9 3300031731 Ga0307405_10606909 Ga0307405_106069092 217
10 3300031911 Ga0307412_10490123 Ga0307412_104901232 217
11 3300028563 Ga0265319_1092906 Ga0265319_10929061 218
12 3300031239 Ga0265328_10005721 Ga0265328_100057215 218
13 3300031239 Ga0265328_10009070 Ga0265328_100090703 218
14 3300031251 Ga0265327_10000364 Ga0265327_100003642 218
15 3300031344 Ga0265316_10000069 Ga0265316_1000006955 218
16 3300037471 Ga0395905_0000181 Ga0395905_0000181_55110_55790 218
17 3300048913 Ga0496110_0044294 Ga0496110_0044294_1527_2210 218
18 3300042876 Ga0451577_0001773 Ga0451577_0001773_23909_24616 219
19 3300031730 Ga0307516_10000329 Ga0307516_1000032945 220
20 3300049577 Ga0501041_0504756 Ga0501041_0504756_32_700 220
21 3300009176 Ga0105242_10150962 Ga0105242_101509622 221
22 3300025912 Ga0207707_10557887 Ga0207707_105578871 221
23 3300037471 Ga0395905_0132272 Ga0395905_0132272_31_714 221
24 3300039447 Ga0436361_0647097 Ga0436361_0647097_448_1131 221
25 3300041405 Ga0439438_035551 Ga0439438_035551_97_786 221
26 3300042007 Ga0439449_0069645 Ga0439449_0069645_156_824 221
27 iso_pu_bacteria 2585428057 2587725998 221
28 iso_pu_bacteria 2585428058 2587735660 221
29 iso_pu_bacteria 2588253510 2588292794 221
30 iso_pu_bacteria 2643221592 2643967901 221
31 iso_pu_bacteria 2643221625 2644143199 221
32 iso_pu_bacteria 2643221648 2644271713 221
33 3300003759 Ga0055525_1000054 Ga0055525_1000054162 222
34 3300005327 Ga0070658_10077281 Ga0070658_100772813 222
35 3300009148 Ga0105243_10059091 Ga0105243_100590912 222
36 3300025230 Ga0209563_100075 Ga0209563_10007534 222
37 3300025253 Ga0209677_101238 Ga0209677_1012388 222
38 3300025935 Ga0207709_10116075 Ga0207709_101160752 222
39 3300031730 Ga0307516_10000155 Ga0307516_1000015564 222
40 3300048911 Ga0496108_0493932 Ga0496108_0493932_353_1027 222
41 3300003316 rootH1_10013116 rootH1_100131162 223
42 3300005293 Ga0065715_10349191 Ga0065715_103491911 223
43 3300005327 Ga0070658_10153919 Ga0070658_101539192 223
44 3300005328 Ga0070676_10091251 Ga0070676_100912512 223
45 3300005331 Ga0070670_100019136 Ga0070670_1000191368 223
46 3300005331 Ga0070670_100019379 Ga0070670_1000193792 223
47 3300005331 Ga0070670_100045584 Ga0070670_1000455843 223
48 3300005331 Ga0070670_100047852 Ga0070670_1000478523 223
49 3300005331 Ga0070670_100186374 Ga0070670_1001863742 223
50 3300005331 Ga0070670_100535604 Ga0070670_1005356041 223
51 3300005334 Ga0068869_100000889 Ga0068869_10000088915 223
52 3300005334 Ga0068869_100297764 Ga0068869_1002977641 223
53 3300005335 Ga0070666_10004101 Ga0070666_100041014 223
54 3300005339 Ga0070660_100158755 Ga0070660_1001587552 223
55 3300005340 Ga0070689_100300132 Ga0070689_1003001322 223
56 3300005343 Ga0070687_100003516 Ga0070687_1000035163 223
57 3300005353 Ga0070669_100009268 Ga0070669_1000092684 223
58 3300005354 Ga0070675_100025340 Ga0070675_1000253402 223
59 3300005355 Ga0070671_100012912 Ga0070671_1000129125 223
60 3300005355 Ga0070671_100054523 Ga0070671_1000545232 223
61 3300005355 Ga0070671_100238578 Ga0070671_1002385782 223
62 3300005355 Ga0070671_100263664 Ga0070671_1002636642 223
63 3300005356 Ga0070674_100004034 Ga0070674_1000040346 223
64 3300005356 Ga0070674_100046579 Ga0070674_1000465793 223
65 3300005364 Ga0070673_100161420 Ga0070673_1001614202 223
66 3300005367 Ga0070667_100000294 Ga0070667_10000029442 223
67 3300005367 Ga0070667_100537420 Ga0070667_1005374202 223
68 3300005441 Ga0070700_100145165 Ga0070700_1001451652 223
69 3300005459 Ga0068867_100001003 Ga0068867_10000100316 223
70 3300005459 Ga0068867_100068989 Ga0068867_1000689892 223
71 3300005459 Ga0068867_100320216 Ga0068867_1003202162 223
72 3300005543 Ga0070672_100009151 Ga0070672_1000091512 223
73 3300005543 Ga0070672_100119204 Ga0070672_1001192043 223
74 3300005547 Ga0070693_100239923 Ga0070693_1002399232 223
75 3300005564 Ga0070664_100129554 Ga0070664_1001295543 223
76 3300005617 Ga0068859_100004410 Ga0068859_1000044106 223
77 3300005618 Ga0068864_100049956 Ga0068864_1000499562 223
78 3300005719 Ga0068861_100003026 Ga0068861_1000030262 223
79 3300005834 Ga0068851_10227890 Ga0068851_102278902 223
80 3300005841 Ga0068863_100001702 Ga0068863_1000017025 223
81 3300005842 Ga0068858_100004719 Ga0068858_1000047194 223
82 3300005843 Ga0068860_100002478 Ga0068860_1000024784 223
83 3300006195 Ga0075366_10178965 Ga0075366_101789652 223
84 3300006881 Ga0068865_100062584 Ga0068865_1000625843 223
85 3300006931 Ga0097620_100004410 Ga0097620_1000044106 223
86 3300009147 Ga0114129_10041079 Ga0114129_100410794 223
87 3300012515 Ga0157338_1011212 Ga0157338_10112122 223
88 3300013296 Ga0157374_10572633 Ga0157374_105726332 223
89 3300013297 Ga0157378_10261535 Ga0157378_102615352 223
90 3300013308 Ga0157375_10081629 Ga0157375_100816293 223
91 3300014326 Ga0157380_10009964 Ga0157380_100099646 223
92 3300014969 Ga0157376_10930250 Ga0157376_109302501 223
93 3300017792 Ga0163161_10008277 Ga0163161_100082777 223
94 3300025315 Ga0207697_10018319 Ga0207697_100183196 223
95 3300025893 Ga0207682_10056581 Ga0207682_100565812 223
96 3300025903 Ga0207680_10004315 Ga0207680_100043154 223
97 3300025907 Ga0207645_10005551 Ga0207645_100055514 223
98 3300025918 Ga0207662_10005227 Ga0207662_100052274 223
99 3300025923 Ga0207681_10000420 Ga0207681_1000042016 223
100 3300025925 Ga0207650_10000553 Ga0207650_1000055315 223
101 3300025931 Ga0207644_10004604 Ga0207644_100046048 223
102 3300025937 Ga0207669_10000881 Ga0207669_100008814 223
103 3300025937 Ga0207669_10005731 Ga0207669_100057315 223
104 3300025938 Ga0207704_10002359 Ga0207704_100023592 223
105 3300025939 Ga0207665_10701336 Ga0207665_107013361 223
106 3300025940 Ga0207691_10122141 Ga0207691_101221412 223
107 3300025940 Ga0207691_10177718 Ga0207691_101777183 223
108 3300025940 Ga0207691_10265719 Ga0207691_102657192 223
109 3300025941 Ga0207711_10031000 Ga0207711_100310002 223
110 3300025941 Ga0207711_10098508 Ga0207711_100985082 223
111 3300025942 Ga0207689_10005097 Ga0207689_100050972 223
112 3300025960 Ga0207651_10528123 Ga0207651_105281232 223
113 3300025961 Ga0207712_10080041 Ga0207712_100800413 223
114 3300025972 Ga0207668_10002852 Ga0207668_100028527 223
115 3300025986 Ga0207658_10000212 Ga0207658_1000021214 223
116 3300026023 Ga0207677_10008469 Ga0207677_100084695 223
117 3300026035 Ga0207703_10006037 Ga0207703_100060374 223
118 3300026041 Ga0207639_10291274 Ga0207639_102912742 223
119 3300026088 Ga0207641_10001060 Ga0207641_1000106012 223
120 3300026088 Ga0207641_10212175 Ga0207641_102121752 223
121 3300026089 Ga0207648_10002514 Ga0207648_1000251416 223
122 3300026089 Ga0207648_10094691 Ga0207648_100946912 223
123 3300026095 Ga0207676_10035803 Ga0207676_100358032 223
124 3300026118 Ga0207675_100001432 Ga0207675_10000143220 223
125 3300026118 Ga0207675_100488909 Ga0207675_1004889092 223
126 3300026142 Ga0207698_10901723 Ga0207698_109017231 223
127 3300028379 Ga0268266_10206996 Ga0268266_102069962 223
128 3300028380 Ga0268265_10051554 Ga0268265_100515542 223
129 3300028381 Ga0268264_10001043 Ga0268264_1000104318 223
130 3300031548 Ga0307408_100067279 Ga0307408_1000672793 223
131 3300031548 Ga0307408_100250327 Ga0307408_1002503272 223
132 3300031649 Ga0307514_10171056 Ga0307514_101710562 223
133 3300031730 Ga0307516_10043796 Ga0307516_100437963 223
134 3300031731 Ga0307405_10014639 Ga0307405_100146391 223
135 3300031824 Ga0307413_10069721 Ga0307413_100697211 223
136 3300031852 Ga0307410_10023773 Ga0307410_100237733 223
137 3300031901 Ga0307406_10012755 Ga0307406_100127552 223
138 3300031903 Ga0307407_10084147 Ga0307407_100841472 223
139 3300031995 Ga0307409_100054964 Ga0307409_1000549642 223
140 3300032004 Ga0307414_10011356 Ga0307414_100113564 223
141 3300032004 Ga0307414_10086897 Ga0307414_100868972 223
142 3300035171 Ga0373946_0174756 Ga0373946_0174756_103_780 223
143 3300041411 Ga0439466_0118362 Ga0439466_0118362_39_734 223
144 3300044712 Ga0453684_0262653 Ga0453684_0262653_69_740 223
145 3300046472 Ga0495580_0092157 Ga0495580_0092157_894_1571 223
146 3300046511 Ga0495608_0217425 Ga0495608_0217425_93_776 223
147 3300046557 Ga0495622_0211726 Ga0495622_0211726_44_727 223
148 3300049571 Ga0501034_0148849 Ga0501034_0148849_254_934 223
149 3300049581 Ga0501047_0188868 Ga0501047_0188868_1190_1870 223
150 3300049649 Ga0501198_000007 Ga0501198_000007_88265_88945 223
151 3300049662 Ga0501222_000005 Ga0501222_000005_40799_41479 223
152 3300053136 Ga0500559_0122603 Ga0500559_0122603_420_1103 223
153 3300059424 Ga0590075_018865 Ga0590075_018865_1020_1694 223
154 iso_pu_bacteria 2643221644 2644248467 223
155 iso_pu_bacteria 2643221654 2644301109 223
156 3300005466 Ga0070685_10414707 Ga0070685_104147071 224
157 3300006353 Ga0075370_10063543 Ga0075370_100635433 224
158 3300012508 Ga0157315_1011222 Ga0157315_10112221 224
159 3300014326 Ga0157380_10643560 Ga0157380_106435602 224
160 3300025906 Ga0207699_10572926 Ga0207699_105729262 224
161 3300026023 Ga0207677_10010172 Ga0207677_100101725 224
162 3300028794 Ga0307515_10000096 Ga0307515_1000009653 224
163 3300028794 Ga0307515_10014894 Ga0307515_100148948 224
164 3300028794 Ga0307515_10144057 Ga0307515_101440573 224
165 3300031456 Ga0307513_10019952 Ga0307513_100199522 224
166 3300031824 Ga0307413_10606630 Ga0307413_106066301 224
167 3300033180 Ga0307510_10001817 Ga0307510_1000181716 224
168 3300035171 Ga0373946_0093539 Ga0373946_0093539_430_1128 224
169 3300035691 Ga0373931_0132866 Ga0373931_0132866_196_885 224
170 3300037068 Ga0373925_0409372 Ga0373925_0409372_407_1096 224
171 3300041459 Ga0451800_1601736 Ga0451800_1601736_112_786 224
172 3300041463 Ga0451804_0244073 Ga0451804_0244073_224_898 224
173 3300042876 Ga0451577_0010640 Ga0451577_0010640_6218_6910 224
174 3300042876 Ga0451577_0109276 Ga0451577_0109276_609_1283 224
175 3300044694 Ga0466963_0260644 Ga0466963_0260644_70_756 224
176 3300044712 Ga0453684_0649690 Ga0453684_0649690_189_881 224
177 3300044842 Ga0466957_0117145 Ga0466957_0117145_887_1573 224
178 3300045051 Ga0451576_0292348 Ga0451576_0292348_668_1342 224
179 3300045051 Ga0451576_0624441 Ga0451576_0624441_319_1047 224
180 3300046492 Ga0495585_0027045 Ga0495585_0027045_482_1168 224
181 3300046507 Ga0495606_0095178 Ga0495606_0095178_31_717 224
182 3300046507 Ga0495606_0146821 Ga0495606_0146821_645_1319 224
183 3300046616 Ga0495668_0032904 Ga0495668_0032904_865_1551 224
184 3300047472 Ga0495686_0004536 Ga0495686_0004536_8515_9207 224
185 3300050496 nmdc:mga07m45_56749_c1 nmdc:mga07m45_56749_c1_1262_1957 224
186 3300053117 Ga0500593_147974 Ga0500593_147974_196_870 224
187 3300002705 JGI25156J39149_1009411 JGI25156J39149_10094113 225
188 3300003215 JGI25153J46596_10000372 JGI25153J46596_1000037220 225
189 3300003215 JGI25153J46596_10000699 JGI25153J46596_100006997 225
190 3300003761 Ga0055535_1000098 Ga0055535_100009883 225
191 3300003763 Ga0055529_1000143 Ga0055529_10001438 225
192 3300003771 Ga0055526_1005640 Ga0055526_10056402 225
193 3300003792 Ga0055540_1009952 Ga0055540_10099522 225
194 3300005262 Ga0065165_1004009 Ga0065165_10040097 225
195 3300005548 Ga0070665_100049986 Ga0070665_1000499863 225
196 3300005841 Ga0068863_100027398 Ga0068863_1000273983 225
197 3300006178 Ga0075367_10006549 Ga0075367_100065494 225
198 3300006195 Ga0075366_10010537 Ga0075366_100105376 225
199 3300006195 Ga0075366_10010792 Ga0075366_100107925 225
200 3300006353 Ga0075370_10005964 Ga0075370_100059643 225
201 3300006353 Ga0075370_10032738 Ga0075370_100327382 225
202 3300006358 Ga0068871_100109101 Ga0068871_1001091011 225
203 3300006880 Ga0075429_100002105 Ga0075429_10000210516 225
204 3300009098 Ga0105245_10221090 Ga0105245_102210902 225
205 3300009545 Ga0105237_10557436 Ga0105237_105574362 225
206 3300013297 Ga0157378_10458511 Ga0157378_104585112 225
207 3300014325 Ga0163163_10446821 Ga0163163_104468212 225
208 3300014968 Ga0157379_10042908 Ga0157379_100429084 225
209 3300014969 Ga0157376_10459278 Ga0157376_104592782 225
210 3300025242 Ga0209258_100202 Ga0209258_1002029 225
211 3300025245 Ga0207425_1000717 Ga0207425_10007174 225
212 3300025254 Ga0209148_1004607 Ga0209148_10046074 225
213 3300025256 Ga0209759_1000427 Ga0209759_100042741 225
214 3300025258 Ga0209129_1000185 Ga0209129_100018531 225
215 3300025258 Ga0209129_1020044 Ga0209129_10200441 225
216 3300025272 Ga0209455_1000181 Ga0209455_10001819 225
217 3300025273 Ga0209673_1005894 Ga0209673_10058945 225
218 3300025295 Ga0209564_1000349 Ga0209564_100034931 225
219 3300025297 Ga0209758_1000339 Ga0209758_100033950 225
220 3300025297 Ga0209758_1001209 Ga0209758_100120919 225
221 3300025298 Ga0209050_1000357 Ga0209050_100035788 225
222 3300025299 Ga0209256_1013854 Ga0209256_10138542 225
223 3300025303 Ga0209051_1002249 Ga0209051_100224912 225
224 3300025931 Ga0207644_10047378 Ga0207644_100473782 225
225 3300026088 Ga0207641_10114800 Ga0207641_101148003 225
226 3300026095 Ga0207676_10014988 Ga0207676_100149883 225
227 3300026121 Ga0207683_10696260 Ga0207683_106962601 225
228 3300027876 Ga0209974_10025020 Ga0209974_100250202 225
229 3300028379 Ga0268266_10013661 Ga0268266_100136619 225
230 3300028666 Ga0265336_10000556 Ga0265336_1000055612 225
231 3300028794 Ga0307515_10018130 Ga0307515_100181305 225
232 3300029957 Ga0265324_10006457 Ga0265324_100064574 225
233 3300030522 Ga0307512_10056018 Ga0307512_100560183 225
234 3300030522 Ga0307512_10202173 Ga0307512_102021732 225
235 3300031456 Ga0307513_10363045 Ga0307513_103630451 225
236 3300031507 Ga0307509_10001003 Ga0307509_100010035 225
237 3300031507 Ga0307509_10001647 Ga0307509_1000164718 225
238 3300031507 Ga0307509_10029240 Ga0307509_100292402 225
239 3300031507 Ga0307509_10052681 Ga0307509_100526812 225
240 3300031616 Ga0307508_10000028 Ga0307508_1000002891 225
241 3300031616 Ga0307508_10001377 Ga0307508_1000137712 225
242 3300031649 Ga0307514_10084421 Ga0307514_100844213 225
243 3300031911 Ga0307412_10561092 Ga0307412_105610922 225
244 3300033180 Ga0307510_10025655 Ga0307510_100256555 225
245 3300033180 Ga0307510_10033774 Ga0307510_100337744 225
246 3300036401 Ga0373937_0030441 Ga0373937_0030441_1705_2382 225
247 3300041453 Ga0451797_1056911 Ga0451797_1056911_70_747 225
248 3300041458 Ga0451798_0835857 Ga0451798_0835857_62_739 225
249 3300044712 Ga0453684_0027068 Ga0453684_0027068_4472_5149 225
250 3300044712 Ga0453684_0344616 Ga0453684_0344616_739_1416 225
251 3300044735 Ga0466968_0020050 Ga0466968_0020050_695_1390 225
252 3300045051 Ga0451576_0102995 Ga0451576_0102995_1626_2309 225
253 3300046454 Ga0495592_0000734 Ga0495592_0000734_1208_1906 225
254 3300046460 Ga0495638_0272965 Ga0495638_0272965_78_755 225
255 3300046511 Ga0495608_0373996 Ga0495608_0373996_39_731 225
256 3300046519 Ga0495632_0001700 Ga0495632_0001700_861_1538 225
257 3300046519 Ga0495632_0054120 Ga0495632_0054120_167_859 225
258 3300046524 Ga0495648_0264694 Ga0495648_0264694_19_711 225
259 3300046616 Ga0495668_0117584 Ga0495668_0117584_195_872 225
260 3300046683 Ga0495658_0096932 Ga0495658_0096932_1025_1717 225
261 3300047321 Ga0495676_0101914 Ga0495676_0101914_755_1447 225
262 3300047472 Ga0495686_0088778 Ga0495686_0088778_672_1364 225
263 3300048905 Ga0496102_0001760 Ga0496102_0001760_7509_8186 225
264 3300048909 Ga0496106_0401041 Ga0496106_0401041_161_838 225
265 3300048917 Ga0496114_0000554 Ga0496114_0000554_19783_20460 225
266 3300049682 Ga0501252_006255 Ga0501252_006255_316_993 225
267 3300050489 nmdc:mga03683_11731_c1 nmdc:mga03683_11731_c1_918_1598 225
268 3300050489 nmdc:mga03683_259784_c1 nmdc:mga03683_259784_c1_44_721 225
269 3300050493 nmdc:mga0k408_10919_c1 nmdc:mga0k408_10919_c1_2672_3349 225
270 3300050493 nmdc:mga0k408_25834_c1 nmdc:mga0k408_25834_c1_326_1003 225
271 3300050493 nmdc:mga0k408_2752_c1 nmdc:mga0k408_2752_c1_3053_3733 225
272 3300050496 nmdc:mga07m45_152709_c1 nmdc:mga07m45_152709_c1_41_733 225
273 3300050496 nmdc:mga07m45_20211_c1 nmdc:mga07m45_20211_c1_1039_1716 225
274 3300050508 nmdc:mga09592_28582_c1 nmdc:mga09592_28582_c1_1815_2495 225
275 3300050509 nmdc:mga0qj67_131048_c1 nmdc:mga0qj67_131048_c1_134_814 225
276 3300053086 Ga0500578_0000311 Ga0500578_0000311_55142_55819 225
277 3300053088 Ga0500644_0072836 Ga0500644_0072836_376_1074 225
278 3300053090 Ga0500646_0003723 Ga0500646_0003723_220_897 225
279 3300053092 Ga0500583_0024103 Ga0500583_0024103_1611_2303 225
280 3300053092 Ga0500583_0208174 Ga0500583_0208174_195_872 225
281 3300053093 Ga0500651_0026946 Ga0500651_0026946_2181_2858 225
282 3300053093 Ga0500651_0117260 Ga0500651_0117260_250_948 225
283 3300053098 Ga0500650_0028900 Ga0500650_0028900_190_867 225
284 3300053109 Ga0500569_090657 Ga0500569_090657_37_714 225
285 3300053118 Ga0500594_0001185 Ga0500594_0001185_2298_2996 225
286 3300053123 Ga0500614_022515 Ga0500614_022515_35_733 225
287 3300053130 Ga0500642_0002755 Ga0500642_0002755_2049_2726 225
288 3300053131 Ga0500652_000663 Ga0500652_000663_3750_4427 225
289 3300053133 Ga0500655_010539 Ga0500655_010539_208_885 225
290 3300053136 Ga0500559_0000133 Ga0500559_0000133_12216_12914 225
291 3300053139 Ga0500568_0017650 Ga0500568_0017650_629_1306 225
292 3300053139 Ga0500568_0046502 Ga0500568_0046502_602_1300 225
293 3300053142 Ga0500577_0019302 Ga0500577_0019302_818_1495 225
294 3300053148 Ga0500590_005138 Ga0500590_005138_1926_2615 225
295 3300053154 Ga0500619_036256 Ga0500619_036256_113_811 225
296 3300053156 Ga0500622_0000307 Ga0500622_0000307_41977_42654 225
297 3300053156 Ga0500622_0011091 Ga0500622_0011091_3487_4185 225
298 3300053156 Ga0500622_0111327 Ga0500622_0111327_504_1181 225
299 3300053177 Ga0500636_0044245 Ga0500636_0044245_1582_2280 225
300 3300053724 Ga0500570_129469 Ga0500570_129469_151_828 225
301 3300053739 Ga0500587_005972 Ga0500587_005972_159_857 225
302 3300002738 JGI25154J39366_1002401 JGI25154J39366_10024012 226
303 3300002741 JGI25157J39369_1000192 JGI25157J39369_100019212 226
304 3300003316 rootH1_10013103 rootH1_100131036 226
305 3300003320 rootH2_10039876 rootH2_100398762 226
306 3300003323 rootH1_10061484 rootH1_100614842 226
307 3300005327 Ga0070658_10107688 Ga0070658_101076882 226
308 3300005338 Ga0068868_100405159 Ga0068868_1004051592 226
309 3300005339 Ga0070660_100138820 Ga0070660_1001388202 226
310 3300005364 Ga0070673_100113674 Ga0070673_1001136743 226
311 3300005365 Ga0070688_100137898 Ga0070688_1001378982 226
312 3300005366 Ga0070659_100128068 Ga0070659_1001280683 226
313 3300005367 Ga0070667_100501443 Ga0070667_1005014432 226
314 3300005456 Ga0070678_100127087 Ga0070678_1001270872 226
315 3300005467 Ga0070706_100003188 Ga0070706_10000318811 226
316 3300005468 Ga0070707_100110514 Ga0070707_1001105143 226
317 3300005471 Ga0070698_100036226 Ga0070698_1000362264 226
318 3300005535 Ga0070684_100203446 Ga0070684_1002034461 226
319 3300005539 Ga0068853_100206676 Ga0068853_1002066762 226
320 3300005563 Ga0068855_100009714 Ga0068855_10000971413 226
321 3300005577 Ga0068857_100003374 Ga0068857_10000337416 226
322 3300005578 Ga0068854_100027116 Ga0068854_1000271162 226
323 3300005614 Ga0068856_100002916 Ga0068856_10000291614 226
324 3300005616 Ga0068852_100054632 Ga0068852_1000546325 226
325 3300005843 Ga0068860_100743685 Ga0068860_1007436852 226
326 3300006042 Ga0075368_10071519 Ga0075368_100715192 226
327 3300006195 Ga0075366_10028467 Ga0075366_100284672 226
328 3300006195 Ga0075366_10043913 Ga0075366_100439132 226
329 3300006353 Ga0075370_10011503 Ga0075370_100115032 226
330 3300006358 Ga0068871_100353045 Ga0068871_1003530452 226
331 3300009093 Ga0105240_10236407 Ga0105240_102364072 226
332 3300009148 Ga0105243_10099110 Ga0105243_100991102 226
333 3300009174 Ga0105241_10039332 Ga0105241_100393323 226
334 3300009545 Ga0105237_10208900 Ga0105237_102089002 226
335 3300009551 Ga0105238_10148910 Ga0105238_101489102 226
336 3300010375 Ga0105239_10249173 Ga0105239_102491732 226
337 3300011119 Ga0105246_10612925 Ga0105246_106129252 226
338 3300013105 Ga0157369_10021757 Ga0157369_100217572 226
339 3300014745 Ga0157377_10490916 Ga0157377_104909161 226
340 3300015262 Ga0182007_10014416 Ga0182007_100144164 226
341 3300021361 Ga0213872_10000318 Ga0213872_1000031821 226
342 3300025231 Ga0207427_100611 Ga0207427_10061115 226
343 3300025242 Ga0209258_100941 Ga0209258_10094110 226
344 3300025246 Ga0209646_1000258 Ga0209646_100025812 226
345 3300025250 Ga0209026_1000011 Ga0209026_1000011440 226
346 3300025253 Ga0209677_100633 Ga0209677_10063317 226
347 3300025256 Ga0209759_1000034 Ga0209759_100003436 226
348 3300025256 Ga0209759_1000900 Ga0209759_100090014 226
349 3300025910 Ga0207684_10004160 Ga0207684_100041604 226
350 3300025911 Ga0207654_10071738 Ga0207654_100717382 226
351 3300025913 Ga0207695_10005833 Ga0207695_100058332 226
352 3300025913 Ga0207695_10069686 Ga0207695_100696862 226
353 3300025919 Ga0207657_10194781 Ga0207657_101947812 226
354 3300025921 Ga0207652_10147881 Ga0207652_101478812 226
355 3300025924 Ga0207694_10137055 Ga0207694_101370552 226
356 3300025927 Ga0207687_10597826 Ga0207687_105978262 226
357 3300025934 Ga0207686_10120723 Ga0207686_101207232 226
358 3300025942 Ga0207689_10079217 Ga0207689_100792171 226
359 3300025949 Ga0207667_10004262 Ga0207667_1000426218 226
360 3300025960 Ga0207651_10039143 Ga0207651_100391434 226
361 3300025981 Ga0207640_10006820 Ga0207640_100068204 226
362 3300026023 Ga0207677_10329585 Ga0207677_103295852 226
363 3300026078 Ga0207702_10002432 Ga0207702_1000243214 226
364 3300026116 Ga0207674_10014124 Ga0207674_100141243 226
365 3300026118 Ga0207675_100049790 Ga0207675_1000497905 226
366 3300026121 Ga0207683_10078252 Ga0207683_100782522 226
367 3300027866 Ga0209813_10003672 Ga0209813_100036722 226
368 3300031824 Ga0307413_10530766 Ga0307413_105307662 226
369 3300035691 Ga0373931_0080247 Ga0373931_0080247_336_1028 226
370 3300037312 Ga0395899_0479437 Ga0395899_0479437_14_706 226
371 3300037466 Ga0395898_0513608 Ga0395898_0513608_289_981 226
372 3300037471 Ga0395905_0448879 Ga0395905_0448879_301_993 226
373 3300039447 Ga0436361_0781207 Ga0436361_0781207_7006_7713 226
374 3300044658 Ga0466972_0005822 Ga0466972_0005822_3090_3773 226
375 3300044683 Ga0466965_0095387 Ga0466965_0095387_381_1064 226
376 3300046471 Ga0495650_0021380 Ga0495650_0021380_1052_1744 226
377 3300047472 Ga0495686_0005275 Ga0495686_0005275_539_1231 226
378 3300050493 nmdc:mga0k408_27122_c2 nmdc:mga0k408_27122_c2_1828_2520 226
379 3300050494 nmdc:mga06z11_18752_c1 nmdc:mga06z11_18752_c1_374_1060 226
380 3300050495 nmdc:mga04h51_106307_c1 nmdc:mga04h51_106307_c1_83_769 226
381 3300050496 nmdc:mga07m45_22669_c1 nmdc:mga07m45_22669_c1_2242_2934 226
382 3300053080 Ga0500635_0000029 Ga0500635_0000029_30280_30975 226
383 3300003756 Ga0055533_1000045 Ga0055533_1000045167 227
384 3300003759 Ga0055525_1000651 Ga0055525_10006518 227
385 3300003775 Ga0055524_1000160 Ga0055524_100016072 227
386 3300003775 Ga0055524_1000950 Ga0055524_10009507 227
387 3300003791 Ga0055530_10003900 Ga0055530_100039005 227
388 3300003792 Ga0055540_1000280 Ga0055540_100028017 227
389 3300003794 Ga0055531_10002844 Ga0055531_100028444 227
390 3300005293 Ga0065715_10147911 Ga0065715_101479112 227
391 3300005328 Ga0070676_10014014 Ga0070676_100140142 227
392 3300005328 Ga0070676_10128991 Ga0070676_101289912 227
393 3300005329 Ga0070683_100034533 Ga0070683_1000345334 227
394 3300005331 Ga0070670_100030882 Ga0070670_1000308822 227
395 3300005331 Ga0070670_100254154 Ga0070670_1002541542 227
396 3300005333 Ga0070677_10000759 Ga0070677_100007597 227
397 3300005334 Ga0068869_100008007 Ga0068869_1000080072 227
398 3300005336 Ga0070680_100033882 Ga0070680_1000338824 227
399 3300005338 Ga0068868_100059605 Ga0068868_1000596053 227
400 3300005339 Ga0070660_100022340 Ga0070660_1000223403 227
401 3300005339 Ga0070660_100031686 Ga0070660_1000316862 227
402 3300005340 Ga0070689_100204952 Ga0070689_1002049521 227
403 3300005343 Ga0070687_100028705 Ga0070687_1000287052 227
404 3300005344 Ga0070661_100001313 Ga0070661_10000131312 227
405 3300005344 Ga0070661_100076006 Ga0070661_1000760063 227
406 3300005344 Ga0070661_100127022 Ga0070661_1001270222 227
407 3300005347 Ga0070668_100062512 Ga0070668_1000625123 227
408 3300005353 Ga0070669_100028795 Ga0070669_1000287953 227
409 3300005354 Ga0070675_100000818 Ga0070675_1000008188 227
410 3300005354 Ga0070675_100030054 Ga0070675_1000300542 227
411 3300005354 Ga0070675_100182009 Ga0070675_1001820092 227
412 3300005355 Ga0070671_100003782 Ga0070671_1000037824 227
413 3300005355 Ga0070671_100249870 Ga0070671_1002498702 227
414 3300005355 Ga0070671_100262645 Ga0070671_1002626452 227
415 3300005356 Ga0070674_100025932 Ga0070674_1000259324 227
416 3300005364 Ga0070673_100129097 Ga0070673_1001290972 227
417 3300005365 Ga0070688_100433881 Ga0070688_1004338812 227
418 3300005366 Ga0070659_100000505 Ga0070659_10000050513 227
419 3300005366 Ga0070659_100031327 Ga0070659_1000313272 227
420 3300005366 Ga0070659_100123333 Ga0070659_1001233332 227
421 3300005366 Ga0070659_100456570 Ga0070659_1004565702 227
422 3300005367 Ga0070667_100004788 Ga0070667_10000478811 227
423 3300005367 Ga0070667_100079621 Ga0070667_1000796212 227
424 3300005455 Ga0070663_100039279 Ga0070663_1000392792 227
425 3300005456 Ga0070678_100002094 Ga0070678_1000020946 227
426 3300005456 Ga0070678_100003402 Ga0070678_1000034024 227
427 3300005459 Ga0068867_100705789 Ga0068867_1007057891 227
428 3300005530 Ga0070679_100015678 Ga0070679_1000156783 227
429 3300005535 Ga0070684_100035060 Ga0070684_1000350602 227
430 3300005535 Ga0070684_100342907 Ga0070684_1003429072 227
431 3300005539 Ga0068853_100047481 Ga0068853_1000474813 227
432 3300005543 Ga0070672_100002951 Ga0070672_1000029517 227
433 3300005543 Ga0070672_100088865 Ga0070672_1000888652 227
434 3300005543 Ga0070672_100105092 Ga0070672_1001050922 227
435 3300005547 Ga0070693_100009780 Ga0070693_1000097802 227
436 3300005547 Ga0070693_100077070 Ga0070693_1000770702 227
437 3300005548 Ga0070665_100629731 Ga0070665_1006297312 227
438 3300005564 Ga0070664_100005281 Ga0070664_1000052816 227
439 3300005564 Ga0070664_100013261 Ga0070664_1000132615 227
440 3300005564 Ga0070664_100215014 Ga0070664_1002150142 227
441 3300005577 Ga0068857_100266420 Ga0068857_1002664202 227
442 3300005578 Ga0068854_100017645 Ga0068854_1000176454 227
443 3300005614 Ga0068856_100024316 Ga0068856_1000243165 227
444 3300005614 Ga0068856_100026468 Ga0068856_1000264682 227
445 3300005615 Ga0070702_100155912 Ga0070702_1001559122 227
446 3300005615 Ga0070702_100462975 Ga0070702_1004629751 227
447 3300005616 Ga0068852_100173764 Ga0068852_1001737642 227
448 3300005617 Ga0068859_100127837 Ga0068859_1001278373 227
449 3300005618 Ga0068864_100016598 Ga0068864_1000165982 227
450 3300005618 Ga0068864_100084658 Ga0068864_1000846582 227
451 3300005719 Ga0068861_100023609 Ga0068861_1000236093 227
452 3300005834 Ga0068851_10024199 Ga0068851_100241992 227
453 3300005834 Ga0068851_10039128 Ga0068851_100391282 227
454 3300005834 Ga0068851_10206479 Ga0068851_102064792 227
455 3300005840 Ga0068870_10063283 Ga0068870_100632832 227
456 3300005841 Ga0068863_100354863 Ga0068863_1003548632 227
457 3300005842 Ga0068858_100030332 Ga0068858_1000303324 227
458 3300005843 Ga0068860_100028345 Ga0068860_1000283454 227
459 3300005843 Ga0068860_100263404 Ga0068860_1002634042 227
460 3300005844 Ga0068862_100055835 Ga0068862_1000558353 227
461 3300006237 Ga0097621_100026939 Ga0097621_1000269394 227
462 3300006237 Ga0097621_100047802 Ga0097621_1000478022 227
463 3300006237 Ga0097621_100070853 Ga0097621_1000708534 227
464 3300006358 Ga0068871_100036870 Ga0068871_1000368702 227
465 3300006358 Ga0068871_100102167 Ga0068871_1001021673 227
466 3300006358 Ga0068871_100140856 Ga0068871_1001408562 227
467 3300006358 Ga0068871_100247924 Ga0068871_1002479242 227
468 3300006358 Ga0068871_100812235 Ga0068871_1008122352 227
469 3300006881 Ga0068865_100086682 Ga0068865_1000866822 227
470 3300006931 Ga0097620_100127837 Ga0097620_1001278373 227
471 3300006946 Ga0079104_1000053 Ga0079104_1000053108 227
472 3300009098 Ga0105245_10060858 Ga0105245_100608582 227
473 3300009148 Ga0105243_10093018 Ga0105243_100930183 227
474 3300009177 Ga0105248_10049549 Ga0105248_100495492 227
475 3300009177 Ga0105248_10220221 Ga0105248_102202212 227
476 3300009177 Ga0105248_10229301 Ga0105248_102293012 227
477 3300009551 Ga0105238_10034370 Ga0105238_100343704 227
478 3300009551 Ga0105238_10491394 Ga0105238_104913941 227
479 3300009553 Ga0105249_10027507 Ga0105249_100275072 227
480 3300010375 Ga0105239_10994595 Ga0105239_109945952 227
481 3300013100 Ga0157373_10057699 Ga0157373_100576993 227
482 3300013100 Ga0157373_10362906 Ga0157373_103629062 227
483 3300013105 Ga0157369_10351196 Ga0157369_103511962 227
484 3300013296 Ga0157374_10266447 Ga0157374_102664472 227
485 3300013306 Ga0163162_10001148 Ga0163162_100011488 227
486 3300013307 Ga0157372_10320684 Ga0157372_103206842 227
487 3300013307 Ga0157372_10441962 Ga0157372_104419622 227
488 3300013308 Ga0157375_10003901 Ga0157375_100039018 227
489 3300013308 Ga0157375_11358396 Ga0157375_113583961 227
490 3300014326 Ga0157380_10003166 Ga0157380_100031665 227
491 3300014968 Ga0157379_10005217 Ga0157379_100052178 227
492 3300014968 Ga0157379_10083586 Ga0157379_100835863 227
493 3300014968 Ga0157379_10115768 Ga0157379_101157682 227
494 3300014968 Ga0157379_10446499 Ga0157379_104464991 227
495 3300014969 Ga0157376_10054658 Ga0157376_100546582 227
496 3300017792 Ga0163161_10074083 Ga0163161_100740833 227
497 3300025226 Ga0209674_100073 Ga0209674_100073167 227
498 3300025230 Ga0209563_100061 Ga0209563_10006163 227
499 3300025253 Ga0209677_100120 Ga0209677_10012024 227
500 3300025291 Ga0209675_1004911 Ga0209675_10049112 227
501 3300025298 Ga0209050_1001841 Ga0209050_10018415 227
502 3300025299 Ga0209256_1000045 Ga0209256_1000045145 227
503 3300025303 Ga0209051_1000004 Ga0209051_10000041054 227
504 3300025304 Ga0209257_1000315 Ga0209257_100031519 227
505 3300025315 Ga0207697_10014102 Ga0207697_100141021 227
506 3300025321 Ga0207656_10006100 Ga0207656_100061002 227
507 3300025321 Ga0207656_10015084 Ga0207656_100150843 227
508 3300025321 Ga0207656_10119346 Ga0207656_101193461 227
509 3300025893 Ga0207682_10001172 Ga0207682_100011725 227
510 3300025901 Ga0207688_10058647 Ga0207688_100586472 227
511 3300025901 Ga0207688_10212655 Ga0207688_102126552 227
512 3300025907 Ga0207645_10008207 Ga0207645_100082075 227
513 3300025908 Ga0207643_10130470 Ga0207643_101304702 227
514 3300025909 Ga0207705_10125397 Ga0207705_101253972 227
515 3300025909 Ga0207705_10155318 Ga0207705_101553182 227
516 3300025913 Ga0207695_10492502 Ga0207695_104925022 227
517 3300025917 Ga0207660_10040424 Ga0207660_100404242 227
518 3300025917 Ga0207660_10426181 Ga0207660_104261812 227
519 3300025918 Ga0207662_10043314 Ga0207662_100433142 227
520 3300025919 Ga0207657_10026522 Ga0207657_100265222 227
521 3300025919 Ga0207657_10048270 Ga0207657_100482704 227
522 3300025920 Ga0207649_10003219 Ga0207649_100032191 227
523 3300025920 Ga0207649_10045734 Ga0207649_100457343 227
524 3300025923 Ga0207681_10003758 Ga0207681_100037583 227
525 3300025923 Ga0207681_10105650 Ga0207681_101056502 227
526 3300025925 Ga0207650_10001006 Ga0207650_1000100619 227
527 3300025925 Ga0207650_10006632 Ga0207650_100066326 227
528 3300025925 Ga0207650_10072259 Ga0207650_100722593 227
529 3300025926 Ga0207659_10001264 Ga0207659_100012648 227
530 3300025931 Ga0207644_10010359 Ga0207644_100103594 227
531 3300025931 Ga0207644_10058804 Ga0207644_100588043 227
532 3300025931 Ga0207644_10060948 Ga0207644_100609483 227
533 3300025931 Ga0207644_10086148 Ga0207644_100861482 227
534 3300025932 Ga0207690_10005140 Ga0207690_100051402 227
535 3300025932 Ga0207690_10101686 Ga0207690_101016862 227
536 3300025933 Ga0207706_10006354 Ga0207706_100063544 227
537 3300025940 Ga0207691_10005520 Ga0207691_100055204 227
538 3300025940 Ga0207691_10105709 Ga0207691_101057092 227
539 3300025940 Ga0207691_10133998 Ga0207691_101339982 227
540 3300025941 Ga0207711_10202331 Ga0207711_102023312 227
541 3300025942 Ga0207689_10000415 Ga0207689_1000041521 227
542 3300025944 Ga0207661_10188114 Ga0207661_101881142 227
543 3300025945 Ga0207679_10000863 Ga0207679_100008634 227
544 3300025945 Ga0207679_10040109 Ga0207679_100401093 227
545 3300025945 Ga0207679_10235186 Ga0207679_102351862 227
546 3300025949 Ga0207667_10071909 Ga0207667_100719094 227
547 3300025960 Ga0207651_10073631 Ga0207651_100736312 227
548 3300025972 Ga0207668_10023934 Ga0207668_100239344 227
549 3300025972 Ga0207668_10520400 Ga0207668_105204001 227
550 3300025981 Ga0207640_10291132 Ga0207640_102911321 227
551 3300025986 Ga0207658_10046494 Ga0207658_100464943 227
552 3300025986 Ga0207658_10244154 Ga0207658_102441542 227
553 3300026035 Ga0207703_10038758 Ga0207703_100387583 227
554 3300026041 Ga0207639_10183700 Ga0207639_101837002 227
555 3300026041 Ga0207639_10504839 Ga0207639_105048391 227
556 3300026067 Ga0207678_10048953 Ga0207678_100489533 227
557 3300026067 Ga0207678_10106729 Ga0207678_101067292 227
558 3300026078 Ga0207702_10044569 Ga0207702_100445692 227
559 3300026078 Ga0207702_10069777 Ga0207702_100697774 227
560 3300026088 Ga0207641_10153694 Ga0207641_101536942 227
561 3300026095 Ga0207676_10011359 Ga0207676_100113595 227
562 3300026116 Ga0207674_10104114 Ga0207674_101041142 227
563 3300026116 Ga0207674_10167295 Ga0207674_101672952 227
564 3300026118 Ga0207675_100000177 Ga0207675_10000017743 227
565 3300026118 Ga0207675_100072299 Ga0207675_1000722992 227
566 3300026121 Ga0207683_10005398 Ga0207683_100053986 227
567 3300026121 Ga0207683_10009410 Ga0207683_100094104 227
568 3300026142 Ga0207698_10240806 Ga0207698_102408062 227
569 3300026142 Ga0207698_10294526 Ga0207698_102945262 227
570 3300027111 Ga0209281_1000147 Ga0209281_1000147108 227
571 3300027682 Ga0209971_1066260 Ga0209971_10662602 227
572 3300028379 Ga0268266_10197823 Ga0268266_101978232 227
573 3300028381 Ga0268264_10028673 Ga0268264_100286732 227
574 3300028381 Ga0268264_10079473 Ga0268264_100794733 227
575 3300028794 Ga0307515_10010714 Ga0307515_100107147 227
576 3300031548 Ga0307408_100062879 Ga0307408_1000628792 227
577 3300031731 Ga0307405_10057608 Ga0307405_100576082 227
578 3300031852 Ga0307410_10227855 Ga0307410_102278552 227
579 3300031901 Ga0307406_10349285 Ga0307406_103492852 227
580 3300031911 Ga0307412_10427002 Ga0307412_104270022 227
581 3300031911 Ga0307412_10671413 Ga0307412_106714132 227
582 3300031995 Ga0307409_100000528 Ga0307409_10000052818 227
583 3300032002 Ga0307416_100002866 Ga0307416_10000286611 227
584 3300032004 Ga0307414_10136911 Ga0307414_101369112 227
585 3300032005 Ga0307411_10054197 Ga0307411_100541972 227
586 3300032126 Ga0307415_100000956 Ga0307415_10000095613 227
587 3300035117 Ga0373953_0069024 Ga0373953_0069024_327_1031 227
588 3300035172 Ga0373955_0020437 Ga0373955_0020437_2155_2859 227
589 3300035691 Ga0373931_0055367 Ga0373931_0055367_900_1625 227
590 3300035692 Ga0373935_0086846 Ga0373935_0086846_353_1057 227
591 3300035695 Ga0373927_0099187 Ga0373927_0099187_595_1299 227
592 3300035724 Ga0373933_0244365 Ga0373933_0244365_77_781 227
593 3300036401 Ga0373937_0160248 Ga0373937_0160248_948_1652 227
594 3300037068 Ga0373925_0027592 Ga0373925_0027592_2655_3359 227
595 3300037068 Ga0373925_0198780 Ga0373925_0198780_161_931 227
596 3300039450 Ga0436363_0216572 Ga0436363_0216572_2665_3369 227
597 3300046463 Ga0495653_0364154 Ga0495653_0364154_11_715 227
598 3300046507 Ga0495606_0012250 Ga0495606_0012250_5927_6628 227
599 3300046511 Ga0495608_0076717 Ga0495608_0076717_57_761 227
600 3300046524 Ga0495648_0226971 Ga0495648_0226971_51_752 227
601 3300046615 Ga0495656_0092430 Ga0495656_0092430_516_1220 227
602 3300046616 Ga0495668_0013457 Ga0495668_0013457_562_1263 227
603 3300046663 Ga0495635_0064949 Ga0495635_0064949_1016_1720 227
604 3300046678 Ga0495599_0442488 Ga0495599_0442488_35_739 227
605 3300046680 Ga0495646_0096867 Ga0495646_0096867_676_1389 227
606 3300046683 Ga0495658_0109957 Ga0495658_0109957_204_908 227
607 3300046684 Ga0495669_0023944 Ga0495669_0023944_1089_1790 227
608 3300046692 Ga0495671_0111242 Ga0495671_0111242_157_864 227
609 3300046694 Ga0495649_0000180 Ga0495649_0000180_21196_21897 227
610 3300046794 Ga0495589_0075751 Ga0495589_0075751_84_785 227
611 3300047322 Ga0495680_0096673 Ga0495680_0096673_1197_1901 227
612 3300047472 Ga0495686_0083867 Ga0495686_0083867_656_1354 227
613 3300048905 Ga0496102_0569758 Ga0496102_0569758_192_917 227
614 3300048907 Ga0496104_0107765 Ga0496104_0107765_1901_2626 227
615 3300048908 Ga0496105_0466008 Ga0496105_0466008_227_931 227
616 3300048909 Ga0496106_0141839 Ga0496106_0141839_797_1495 227
617 3300048911 Ga0496108_0285627 Ga0496108_0285627_65_790 227
618 3300048912 Ga0496109_0360169 Ga0496109_0360169_179_883 227
619 3300048913 Ga0496110_0128718 Ga0496110_0128718_833_1558 227
620 3300048915 Ga0496112_0539277 Ga0496112_0539277_64_762 227
621 3300050493 nmdc:mga0k408_86274_c1 nmdc:mga0k408_86274_c1_178_861 227
622 3300050511 nmdc:mga08y16_558075_c1 nmdc:mga08y16_558075_c1_85_810 227
623 3300053077 Ga0495601_0058433 Ga0495601_0058433_530_1234 227
624 3300053084 Ga0495595_0015382 Ga0495595_0015382_720_1424 227
625 3300053085 Ga0495619_0045623 Ga0495619_0045623_1531_2235 227
626 3300053086 Ga0500578_0076324 Ga0500578_0076324_505_1203 227
627 3300053122 Ga0500608_123485 Ga0500608_123485_179_880 227
628 3300053177 Ga0500636_0049964 Ga0500636_0049964_777_1478 227
629 3300053730 Ga0500645_034488 Ga0500645_034488_164_862 227
630 3300003316 rootH1_10011472 rootH1_100114725 228
631 3300003322 rootL2_10000675 rootL2_100006752 228
632 3300005328 Ga0070676_10010008 Ga0070676_100100082 228
633 3300005328 Ga0070676_10169820 Ga0070676_101698202 228
634 3300005334 Ga0068869_100013610 Ga0068869_1000136105 228
635 3300005335 Ga0070666_10079620 Ga0070666_100796202 228
636 3300005338 Ga0068868_100047268 Ga0068868_1000472684 228
637 3300005338 Ga0068868_100125332 Ga0068868_1001253322 228
638 3300005354 Ga0070675_100090425 Ga0070675_1000904252 228
639 3300005364 Ga0070673_100107302 Ga0070673_1001073023 228
640 3300005455 Ga0070663_100019028 Ga0070663_1000190283 228
641 3300005457 Ga0070662_100002604 Ga0070662_1000026047 228
642 3300005459 Ga0068867_100021775 Ga0068867_1000217752 228
643 3300005468 Ga0070707_100882552 Ga0070707_1008825521 228
644 3300005539 Ga0068853_100600002 Ga0068853_1006000022 228
645 3300005577 Ga0068857_100027213 Ga0068857_1000272134 228
646 3300005577 Ga0068857_100187250 Ga0068857_1001872502 228
647 3300005616 Ga0068852_100009725 Ga0068852_1000097252 228
648 3300005616 Ga0068852_100030734 Ga0068852_1000307344 228
649 3300005840 Ga0068870_10216166 Ga0068870_102161662 228
650 3300006042 Ga0075368_10001585 Ga0075368_100015857 228
651 3300006177 Ga0075362_10004323 Ga0075362_100043235 228
652 3300006177 Ga0075362_10015052 Ga0075362_100150523 228
653 3300006178 Ga0075367_10006326 Ga0075367_100063266 228
654 3300006178 Ga0075367_10009705 Ga0075367_100097055 228
655 3300006178 Ga0075367_10065416 Ga0075367_100654163 228
656 3300006186 Ga0075369_10000429 Ga0075369_100004293 228
657 3300006195 Ga0075366_10006781 Ga0075366_100067812 228
658 3300006353 Ga0075370_10002430 Ga0075370_100024305 228
659 3300006353 Ga0075370_10033655 Ga0075370_100336553 228
660 3300006353 Ga0075370_10044344 Ga0075370_100443442 228
661 3300006353 Ga0075370_10065556 Ga0075370_100655562 228
662 3300009093 Ga0105240_10064095 Ga0105240_100640953 228
663 3300009148 Ga0105243_10011524 Ga0105243_100115243 228
664 3300009174 Ga0105241_10304265 Ga0105241_103042652 228
665 3300009545 Ga0105237_10129214 Ga0105237_101292142 228
666 3300010375 Ga0105239_10353583 Ga0105239_103535832 228
667 3300011119 Ga0105246_10548100 Ga0105246_105481002 228
668 3300014745 Ga0157377_10000132 Ga0157377_1000013216 228
669 3300021361 Ga0213872_10005163 Ga0213872_100051633 228
670 3300021361 Ga0213872_10095899 Ga0213872_100958992 228
671 3300025907 Ga0207645_10014430 Ga0207645_100144305 228
672 3300025911 Ga0207654_10368197 Ga0207654_103681972 228
673 3300025914 Ga0207671_10030236 Ga0207671_100302364 228
674 3300025919 Ga0207657_10535710 Ga0207657_105357102 228
675 3300025922 Ga0207646_10379050 Ga0207646_103790502 228
676 3300025925 Ga0207650_10599503 Ga0207650_105995032 228
677 3300025926 Ga0207659_10163835 Ga0207659_101638352 228
678 3300025933 Ga0207706_10000785 Ga0207706_100007855 228
679 3300025933 Ga0207706_10004957 Ga0207706_1000495712 228
680 3300025935 Ga0207709_10004700 Ga0207709_1000470010 228
681 3300025938 Ga0207704_10283536 Ga0207704_102835362 228
682 3300025940 Ga0207691_10006646 Ga0207691_100066462 228
683 3300025942 Ga0207689_10017327 Ga0207689_100173274 228
684 3300025942 Ga0207689_10176566 Ga0207689_101765662 228
685 3300025960 Ga0207651_10187737 Ga0207651_101877372 228
686 3300026067 Ga0207678_10016179 Ga0207678_100161795 228
687 3300026089 Ga0207648_10001573 Ga0207648_1000157310 228
688 3300026089 Ga0207648_10033577 Ga0207648_100335775 228
689 3300026116 Ga0207674_10025976 Ga0207674_100259764 228
690 3300026116 Ga0207674_10038054 Ga0207674_100380544 228
691 3300026116 Ga0207674_10642573 Ga0207674_106425731 228
692 3300026118 Ga0207675_100314949 Ga0207675_1003149492 228
693 3300026142 Ga0207698_10011410 Ga0207698_100114102 228
694 3300026142 Ga0207698_10873773 Ga0207698_108737731 228
695 3300028794 Ga0307515_10301318 Ga0307515_103013182 228
696 3300031456 Ga0307513_10035096 Ga0307513_100350963 228
697 3300031730 Ga0307516_10002006 Ga0307516_1000200620 228
698 3300031730 Ga0307516_10044489 Ga0307516_100444893 228
699 3300037471 Ga0395905_0314630 Ga0395905_0314630_739_1425 228
700 3300039447 Ga0436361_0237820 Ga0436361_0237820_1671_2384 228
701 3300039447 Ga0436361_0653054 Ga0436361_0653054_4565_5278 228
702 3300042876 Ga0451577_0007365 Ga0451577_0007365_7559_8245 228
703 3300044658 Ga0466972_0015489 Ga0466972_0015489_251_940 228
704 3300044765 Ga0466970_0098737 Ga0466970_0098737_816_1505 228
705 3300044901 Ga0466960_0151398 Ga0466960_0151398_205_894 228
706 3300046474 Ga0495605_0034108 Ga0495605_0034108_1702_2394 228
707 3300046519 Ga0495632_0017146 Ga0495632_0017146_3282_3974 228
708 3300046522 Ga0495643_0135091 Ga0495643_0135091_277_972 228
709 3300046542 Ga0495597_0003790 Ga0495597_0003790_4517_5212 228
710 3300046616 Ga0495668_0015696 Ga0495668_0015696_425_1117 228
711 3300046648 Ga0495611_0122273 Ga0495611_0122273_240_932 228
712 3300046660 Ga0495625_0269716 Ga0495625_0269716_237_929 228
713 3300046694 Ga0495649_0108683 Ga0495649_0108683_608_1300 228
714 3300047443 Ga0495687_000890 Ga0495687_000890_10097_10792 228
715 3300047443 Ga0495687_009019 Ga0495687_009019_1778_2470 228
716 3300047443 Ga0495687_014505 Ga0495687_014505_1571_2263 228
717 3300047445 Ga0495677_0093560 Ga0495677_0093560_147_839 228
718 3300047469 Ga0495673_0096905 Ga0495673_0096905_469_1161 228
719 3300047472 Ga0495686_0137862 Ga0495686_0137862_634_1326 228
720 3300048091 Ga0495626_0054419 Ga0495626_0054419_1104_1796 228
721 3300048924 Ga0496121_0010106 Ga0496121_0010106_3294_3986 228
722 3300048927 Ga0496124_0003631 Ga0496124_0003631_3321_4019 228
723 3300048928 Ga0496125_0012783 Ga0496125_0012783_3242_3940 228
724 3300050489 nmdc:mga03683_10708_c1 nmdc:mga03683_10708_c1_2401_3096 228
725 3300050491 nmdc:mga00v17_49418_c1 nmdc:mga00v17_49418_c1_303_998 228
726 3300050491 nmdc:mga00v17_97988_c1 nmdc:mga00v17_97988_c1_643_1338 228
727 3300050492 nmdc:mga0yw44_175847_c1 nmdc:mga0yw44_175847_c1_149_844 228
728 3300050493 nmdc:mga0k408_110914_c1 nmdc:mga0k408_110914_c1_760_1455 228
729 3300050493 nmdc:mga0k408_12173_c1 nmdc:mga0k408_12173_c1_699_1391 228
730 3300050493 nmdc:mga0k408_4953_c1 nmdc:mga0k408_4953_c1_5678_6373 228
731 3300050493 nmdc:mga0k408_75652_c2 nmdc:mga0k408_75652_c2_287_982 228
732 3300050494 nmdc:mga06z11_56308_c1 nmdc:mga06z11_56308_c1_454_1146 228
733 3300050495 nmdc:mga04h51_22799_c1 nmdc:mga04h51_22799_c1_797_1492 228
734 3300050496 nmdc:mga07m45_13723_c1 nmdc:mga07m45_13723_c1_1272_1964 228
735 3300050496 nmdc:mga07m45_1608_c1 nmdc:mga07m45_1608_c1_2781_3473 228
736 3300050496 nmdc:mga07m45_225796_c1 nmdc:mga07m45_225796_c1_73_768 228
737 3300050496 nmdc:mga07m45_25425_c1 nmdc:mga07m45_25425_c1_1964_2656 228
738 3300050496 nmdc:mga07m45_29719_c1 nmdc:mga07m45_29719_c1_1253_1948 228
739 3300050516 nmdc:mga0sz30_22155_c1 nmdc:mga0sz30_22155_c1_1039_1734 228
740 3300053134 Ga0500658_0002762 Ga0500658_0002762_309_1001 228
741 3300053139 Ga0500568_0009517 Ga0500568_0009517_632_1324 228
742 3300001979 JGI24740J21852_10022958 JGI24740J21852_100229582 229
743 3300005563 Ga0068855_100129349 Ga0068855_1001293492 229
744 3300005616 Ga0068852_100191114 Ga0068852_1001911142 229
745 3300005834 Ga0068851_10116026 Ga0068851_101160262 229
746 3300009093 Ga0105240_10072064 Ga0105240_100720643 229
747 3300009174 Ga0105241_10591764 Ga0105241_105917642 229
748 3300009545 Ga0105237_10018091 Ga0105237_100180913 229
749 3300010375 Ga0105239_10039921 Ga0105239_100399213 229
750 3300014325 Ga0163163_10501588 Ga0163163_105015882 229
751 3300025321 Ga0207656_10078023 Ga0207656_100780232 229
752 3300025913 Ga0207695_10264468 Ga0207695_102644681 229
753 3300025914 Ga0207671_10003773 Ga0207671_1000377311 229
754 3300025949 Ga0207667_10462279 Ga0207667_104622792 229
755 3300026067 Ga0207678_10014014 Ga0207678_100140143 229
756 3300028786 Ga0307517_10241977 Ga0307517_102419772 229
757 3300028794 Ga0307515_10283962 Ga0307515_102839622 229
758 3300031548 Ga0307408_100203466 Ga0307408_1002034662 229
759 3300037466 Ga0395898_0001191 Ga0395898_0001191_1760_2464 229
760 3300044658 Ga0466972_0006098 Ga0466972_0006098_2689_3381 229
761 3300044683 Ga0466965_0017284 Ga0466965_0017284_49_741 229
762 3300044684 Ga0466966_0006064 Ga0466966_0006064_333_1034 229
763 3300044694 Ga0466963_0021472 Ga0466963_0021472_97_798 229
764 3300044712 Ga0453684_0118372 Ga0453684_0118372_77_766 229
765 3300044719 Ga0466971_0100547 Ga0466971_0100547_286_987 229
766 3300044765 Ga0466970_0192146 Ga0466970_0192146_355_1056 229
767 3300045049 Ga0466959_0050980 Ga0466959_0050980_1340_2041 229
768 3300045836 Ga0466958_0111000 Ga0466958_0111000_670_1371 229
769 3300045976 Ga0466967_0189251 Ga0466967_0189251_558_1259 229
770 3300049517 Ga0501294_005716 Ga0501294_005716_85_777 229
771 3300049521 Ga0501298_004902 Ga0501298_004902_80_772 229
772 3300049569 Ga0501032_0036399 Ga0501032_0036399_1875_2564 229
773 3300049579 Ga0501043_0000002 Ga0501043_0000002_319611_320300 229
774 3300049580 Ga0501046_0000008 Ga0501046_0000008_319708_320397 229
775 3300049581 Ga0501047_0000003 Ga0501047_0000003_342876_343565 229
776 3300049582 Ga0501048_0002164 Ga0501048_0002164_6113_6802 229
777 3300049762 Ga0501265_001134 Ga0501265_001134_2131_2823 229
778 3300049823 Ga0501044_0196635 Ga0501044_0196635_640_1329 229
779 3300049824 Ga0501045_0006316 Ga0501045_0006316_2361_3050 229
780 3300053154 Ga0500619_000029 Ga0500619_000029_43846_44535 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04340

DUF484

Protein of unknown function, DUF484

23

252

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e98-assembly1.cif.gz_B crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution 0.7746 46 224
3e98-assembly1.cif.gz_B crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution 0.7631 46 224
3jbq-assembly1.cif.gz_G domain organization and conformational plasticity of the g protein effector, pde6 0.723 82 224
3cit-assembly1.cif.gz_B-2 crystal structure of the gaf domain of a putative sensor histidine kinase from pseudomonas syringae pv. tomato 0.6957 73 224
3cit-assembly1.cif.gz_A-2 crystal structure of the gaf domain of a putative sensor histidine kinase from pseudomonas syringae pv. tomato 0.6787 73 224
ID Description Score Start End Superfamily
af_P23305_50_233_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.805 46 227 3.30.450.40
af_P23305_50_233_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7934 46 227 3.30.450.40
af_P37013_4_170_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7683 82 225 3.30.450.40
3e98B00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.755 46 224 3.30.450.40
3e98B00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7439 46 224 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A4Q5VX57-F1-model_v4 deleted 0.9763 85 228
AF-A0A098U0F1-F1-model_v4 deleted 0.9536 95 180
AF-A0A4Q5VHV1-F1-model_v4 deleted 0.9457 62 227
AF-A0A4Q5VX57-F1-model_v4 deleted 0.944 85 228
AF-A0A257P8X0-F1-model_v4 DUF484 family protein 0.9427 141 225

Feature Viewer

pLDDT pTM Quality
87.23 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map