F480527
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 780 | 373 | 771 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0198780|Ga0373925_0198780_161_931 |
| Length | 256 |
| Sequence | LTEKSSYDKASDENANHEQCIMTAGVQGITEADIANYLANTPGFFERHAELLGSVQLTSPHGQRAVSLQERQMEMLRDKIRGLEGKIIEMIRYGQDNVGIADRLHRWTRALMLTQEPAELPAVLVRELMHQFMIPQAGIRVWGAAAPFAAIDFAQPVSDDVKLFAGSLSQPYCGVNSGFEASQWLADPAGAKSMALIPLRASAAEGSEASAVPAFGMLVLASPDPTRYTADMGTEFLSRIGDIAGAALSRLLPVRT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 9 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 12 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 109 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 214 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 221 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 250 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 251 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 255 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 256 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 257 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 258 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 259 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 317 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 318 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 319 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 328 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 329 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 330 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 337 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 346 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 349 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 351 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 352 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 353 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 354 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 355 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 356 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 357 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 358 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 359 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 360 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 361 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 362 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 364 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 366 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 367 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 369 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 371 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 373 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 0 |
| Isolates | 1.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.67 |
| Nodule | 0.26 |
| Rhizoplane | 2.18 |
| Rhizosphere | 74.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10022958 | 3300001979 | Bacteria | 2138 |
| 2 | JGI25156J39149_1009411 | 3300002705 | Bacteria | 2378 |
| 3 | JGI25154J39366_1002401 | 3300002738 | Bacteria | 4901 |
| 4 | JGI25157J39369_1000192 | 3300002741 | Bacteria | 51783 |
| 5 | JGI25153J46596_10000372 | 3300003215 | Bacteria | 30744 |
| 6 | JGI25153J46596_10000699 | 3300003215 | Bacteria | 20504 |
| 7 | rootH1_10011472 | 3300003316 | Bacteria | 4808 |
| 8 | rootH1_10013103 | 3300003316 | Bacteria | 5540 |
| 9 | rootH1_10013116 | 3300003316 | Bacteria | 1174 |
| 10 | rootH2_10039876 | 3300003320 | Bacteria | 2290 |
| 11 | rootL2_10000675 | 3300003322 | Bacteria | 5604 |
| 12 | rootH1_10061484 | 3300003323 | Bacteria | 3934 |
| 13 | Ga0055533_1000045 | 3300003756 | Bacteria | 223637 |
| 14 | Ga0055525_1000054 | 3300003759 | Bacteria | 216523 |
| 15 | Ga0055525_1000651 | 3300003759 | Bacteria | 13569 |
| 16 | Ga0055535_1000098 | 3300003761 | Bacteria | 94622 |
| 17 | Ga0055529_1000143 | 3300003763 | Bacteria | 101808 |
| 18 | Ga0055526_1005640 | 3300003771 | Bacteria | 7122 |
| 19 | Ga0055524_1000160 | 3300003775 | Bacteria | 78345 |
| 20 | Ga0055524_1000950 | 3300003775 | Bacteria | 18399 |
| 21 | Ga0055530_10003900 | 3300003791 | Bacteria | 8129 |
| 22 | Ga0055540_1000280 | 3300003792 | Bacteria | 45825 |
| 23 | Ga0055540_1009952 | 3300003792 | Bacteria | 3213 |
| 24 | Ga0055531_10002844 | 3300003794 | Bacteria | 11319 |
| 25 | Ga0065165_1004009 | 3300005262 | Bacteria | 9617 |
| 26 | Ga0065715_10147911 | 3300005293 | Bacteria | 1765 |
| 27 | Ga0065715_10349191 | 3300005293 | Bacteria | 954 |
| 28 | Ga0070658_10077281 | 3300005327 | Bacteria | 2730 |
| 29 | Ga0070658_10107688 | 3300005327 | Bacteria | 2306 |
| 30 | Ga0070658_10153919 | 3300005327 | Bacteria | 1926 |
| 31 | Ga0070676_10010008 | 3300005328 | Bacteria | 5132 |
| 32 | Ga0070676_10014014 | 3300005328 | Bacteria | 4400 |
| 33 | Ga0070676_10091251 | 3300005328 | Bacteria | 1866 |
| 34 | Ga0070676_10128991 | 3300005328 | Bacteria | 1597 |
| 35 | Ga0070676_10169820 | 3300005328 | Bacteria | 1410 |
| 36 | Ga0070683_100034533 | 3300005329 | Bacteria | 4621 |
| 37 | Ga0070670_100019136 | 3300005331 | Bacteria | 5871 |
| 38 | Ga0070670_100019379 | 3300005331 | Bacteria | 5837 |
| 39 | Ga0070670_100030882 | 3300005331 | Bacteria | 4614 |
| 40 | Ga0070670_100045584 | 3300005331 | Bacteria | 3770 |
| 41 | Ga0070670_100047852 | 3300005331 | Bacteria | 3680 |
| 42 | Ga0070670_100186374 | 3300005331 | Bacteria | 1802 |
| 43 | Ga0070670_100254154 | 3300005331 | Bacteria | 1531 |
| 44 | Ga0070670_100535604 | 3300005331 | Bacteria | 1044 |
| 45 | Ga0070677_10000759 | 3300005333 | Bacteria | 10739 |
| 46 | Ga0068869_100000889 | 3300005334 | Bacteria | 17243 |
| 47 | Ga0068869_100008007 | 3300005334 | Bacteria | 6788 |
| 48 | Ga0068869_100013610 | 3300005334 | Bacteria | 5415 |
| 49 | Ga0068869_100297764 | 3300005334 | Bacteria | 1302 |
| 50 | Ga0070666_10004101 | 3300005335 | Bacteria | 8845 |
| 51 | Ga0070666_10079620 | 3300005335 | Bacteria | 2238 |
| 52 | Ga0070680_100033882 | 3300005336 | Bacteria | 4119 |
| 53 | Ga0068868_100047268 | 3300005338 | Bacteria | 3372 |
| 54 | Ga0068868_100059605 | 3300005338 | Bacteria | 3020 |
| 55 | Ga0068868_100125332 | 3300005338 | Bacteria | 2098 |
| 56 | Ga0068868_100405159 | 3300005338 | Bacteria | 1178 |
| 57 | Ga0070660_100022340 | 3300005339 | Bacteria | 4677 |
| 58 | Ga0070660_100031686 | 3300005339 | Bacteria | 3973 |
| 59 | Ga0070660_100138820 | 3300005339 | Bacteria | 1949 |
| 60 | Ga0070660_100158755 | 3300005339 | Bacteria | 1821 |
| 61 | Ga0070689_100204952 | 3300005340 | Bacteria | 1612 |
| 62 | Ga0070689_100300132 | 3300005340 | Bacteria | 1337 |
| 63 | Ga0070687_100003516 | 3300005343 | Bacteria | 6097 |
| 64 | Ga0070687_100028705 | 3300005343 | Bacteria | 2701 |
| 65 | Ga0070661_100001313 | 3300005344 | Bacteria | 17442 |
| 66 | Ga0070661_100076006 | 3300005344 | Bacteria | 2475 |
| 67 | Ga0070661_100127022 | 3300005344 | Bacteria | 1913 |
| 68 | Ga0070668_100062512 | 3300005347 | Bacteria | 2885 |
| 69 | Ga0070669_100009268 | 3300005353 | Bacteria | 7013 |
| 70 | Ga0070669_100028795 | 3300005353 | Bacteria | 4001 |
| 71 | Ga0070675_100000818 | 3300005354 | Bacteria | 21944 |
| 72 | Ga0070675_100025340 | 3300005354 | Bacteria | 4755 |
| 73 | Ga0070675_100030054 | 3300005354 | Bacteria | 4383 |
| 74 | Ga0070675_100090425 | 3300005354 | Bacteria | 2564 |
| 75 | Ga0070675_100182009 | 3300005354 | Bacteria | 1817 |
| 76 | Ga0070671_100003782 | 3300005355 | Bacteria | 11876 |
| 77 | Ga0070671_100012912 | 3300005355 | Bacteria | 6732 |
| 78 | Ga0070671_100054523 | 3300005355 | Bacteria | 3324 |
| 79 | Ga0070671_100238578 | 3300005355 | Bacteria | 1543 |
| 80 | Ga0070671_100249870 | 3300005355 | Bacteria | 1506 |
| 81 | Ga0070671_100262645 | 3300005355 | Bacteria | 1467 |
| 82 | Ga0070671_100263664 | 3300005355 | Bacteria | 1464 |
| 83 | Ga0070674_100004034 | 3300005356 | Bacteria | 8326 |
| 84 | Ga0070674_100025932 | 3300005356 | Bacteria | 3822 |
| 85 | Ga0070674_100046579 | 3300005356 | Bacteria | 2967 |
| 86 | Ga0070673_100107302 | 3300005364 | Bacteria | 2310 |
| 87 | Ga0070673_100113674 | 3300005364 | Bacteria | 2248 |
| 88 | Ga0070673_100129097 | 3300005364 | Bacteria | 2118 |
| 89 | Ga0070673_100161420 | 3300005364 | Bacteria | 1906 |
| 90 | Ga0070688_100137898 | 3300005365 | Bacteria | 1654 |
| 91 | Ga0070688_100433881 | 3300005365 | Bacteria | 979 |
| 92 | Ga0070659_100000505 | 3300005366 | Bacteria | 28646 |
| 93 | Ga0070659_100031327 | 3300005366 | Bacteria | 4118 |
| 94 | Ga0070659_100123333 | 3300005366 | Bacteria | 2100 |
| 95 | Ga0070659_100128068 | 3300005366 | Bacteria | 2060 |
| 96 | Ga0070659_100456570 | 3300005366 | Bacteria | 1084 |
| 97 | Ga0070667_100000294 | 3300005367 | Bacteria | 56218 |
| 98 | Ga0070667_100004788 | 3300005367 | Bacteria | 11336 |
| 99 | Ga0070667_100079621 | 3300005367 | Bacteria | 2801 |
| 100 | Ga0070667_100501443 | 3300005367 | Bacteria | 1113 |
| 101 | Ga0070667_100537420 | 3300005367 | Bacteria | 1073 |
| 102 | Ga0070700_100145165 | 3300005441 | Bacteria | 1617 |
| 103 | Ga0070663_100019028 | 3300005455 | Bacteria | 4516 |
| 104 | Ga0070663_100039279 | 3300005455 | Bacteria | 3306 |
| 105 | Ga0070678_100002094 | 3300005456 | Bacteria | 10817 |
| 106 | Ga0070678_100003402 | 3300005456 | Bacteria | 8870 |
| 107 | Ga0070678_100127087 | 3300005456 | Bacteria | 2020 |
| 108 | Ga0070662_100002604 | 3300005457 | Bacteria | 11127 |
| 109 | Ga0068867_100001003 | 3300005459 | Bacteria | 19259 |
| 110 | Ga0068867_100021775 | 3300005459 | Bacteria | 4576 |
| 111 | Ga0068867_100068989 | 3300005459 | Bacteria | 2639 |
| 112 | Ga0068867_100320216 | 3300005459 | Bacteria | 1284 |
| 113 | Ga0068867_100705789 | 3300005459 | Bacteria | 891 |
| 114 | Ga0070685_10414707 | 3300005466 | Bacteria | 936 |
| 115 | Ga0070706_100003188 | 3300005467 | Bacteria | 16188 |
| 116 | Ga0070707_100110514 | 3300005468 | Bacteria | 2666 |
| 117 | Ga0070707_100882552 | 3300005468 | Bacteria | 859 |
| 118 | Ga0070698_100036226 | 3300005471 | Bacteria | 5099 |
| 119 | Ga0070679_100015678 | 3300005530 | Bacteria | 7286 |
| 120 | Ga0070684_100035060 | 3300005535 | Bacteria | 4292 |
| 121 | Ga0070684_100203446 | 3300005535 | Bacteria | 1804 |
| 122 | Ga0070684_100342907 | 3300005535 | Bacteria | 1374 |
| 123 | Ga0068853_100047481 | 3300005539 | Bacteria | 3684 |
| 124 | Ga0068853_100206676 | 3300005539 | Bacteria | 1788 |
| 125 | Ga0068853_100600002 | 3300005539 | Bacteria | 1046 |
| 126 | Ga0070672_100002951 | 3300005543 | Bacteria | 10949 |
| 127 | Ga0070672_100009151 | 3300005543 | Bacteria | 6814 |
| 128 | Ga0070672_100088865 | 3300005543 | Bacteria | 2488 |
| 129 | Ga0070672_100105092 | 3300005543 | Bacteria | 2295 |
| 130 | Ga0070672_100119204 | 3300005543 | Bacteria | 2158 |
| 131 | Ga0070693_100009780 | 3300005547 | Bacteria | 4780 |
| 132 | Ga0070693_100077070 | 3300005547 | Bacteria | 1977 |
| 133 | Ga0070693_100239923 | 3300005547 | Bacteria | 1197 |
| 134 | Ga0070665_100049986 | 3300005548 | Bacteria | 4195 |
| 135 | Ga0070665_100629731 | 3300005548 | Bacteria | 1086 |
| 136 | Ga0068855_100009714 | 3300005563 | Bacteria | 11611 |
| 137 | Ga0068855_100129349 | 3300005563 | Bacteria | 2885 |
| 138 | Ga0070664_100005281 | 3300005564 | Bacteria | 10367 |
| 139 | Ga0070664_100013261 | 3300005564 | Bacteria | 6713 |
| 140 | Ga0070664_100129554 | 3300005564 | Bacteria | 2215 |
| 141 | Ga0070664_100215014 | 3300005564 | Bacteria | 1718 |
| 142 | Ga0068857_100003374 | 3300005577 | Bacteria | 13292 |
| 143 | Ga0068857_100027213 | 3300005577 | Bacteria | 5043 |
| 144 | Ga0068857_100187250 | 3300005577 | Bacteria | 1885 |
| 145 | Ga0068857_100266420 | 3300005577 | Bacteria | 1574 |
| 146 | Ga0068854_100017645 | 3300005578 | Bacteria | 4779 |
| 147 | Ga0068854_100027116 | 3300005578 | Bacteria | 3946 |
| 148 | Ga0068856_100002916 | 3300005614 | Bacteria | 17515 |
| 149 | Ga0068856_100024316 | 3300005614 | Bacteria | 5894 |
| 150 | Ga0068856_100026468 | 3300005614 | Bacteria | 5657 |
| 151 | Ga0070702_100155912 | 3300005615 | Bacteria | 1471 |
| 152 | Ga0070702_100462975 | 3300005615 | Bacteria | 922 |
| 153 | Ga0068852_100009725 | 3300005616 | Bacteria | 7145 |
| 154 | Ga0068852_100030734 | 3300005616 | Bacteria | 4426 |
| 155 | Ga0068852_100054632 | 3300005616 | Bacteria | 3443 |
| 156 | Ga0068852_100173764 | 3300005616 | Bacteria | 2021 |
| 157 | Ga0068852_100191114 | 3300005616 | Bacteria | 1932 |
| 158 | Ga0068859_100004410 | 3300005617 | Bacteria | 14353 |
| 159 | Ga0068859_100127837 | 3300005617 | Bacteria | 2611 |
| 160 | Ga0068864_100016598 | 3300005618 | Bacteria | 6131 |
| 161 | Ga0068864_100049956 | 3300005618 | Bacteria | 3599 |
| 162 | Ga0068864_100084658 | 3300005618 | Bacteria | 2786 |
| 163 | Ga0068861_100003026 | 3300005719 | Bacteria | 11104 |
| 164 | Ga0068861_100023609 | 3300005719 | Bacteria | 4438 |
| 165 | Ga0068851_10024199 | 3300005834 | Bacteria | 2972 |
| 166 | Ga0068851_10039128 | 3300005834 | Bacteria | 2381 |
| 167 | Ga0068851_10116026 | 3300005834 | Bacteria | 1435 |
| 168 | Ga0068851_10206479 | 3300005834 | Bacteria | 1098 |
| 169 | Ga0068851_10227890 | 3300005834 | Bacteria | 1049 |
| 170 | Ga0068870_10063283 | 3300005840 | Bacteria | 1995 |
| 171 | Ga0068870_10216166 | 3300005840 | Bacteria | 1171 |
| 172 | Ga0068863_100001702 | 3300005841 | Bacteria | 21786 |
| 173 | Ga0068863_100027398 | 3300005841 | Bacteria | 5435 |
| 174 | Ga0068863_100354863 | 3300005841 | Bacteria | 1428 |
| 175 | Ga0068858_100004719 | 3300005842 | Bacteria | 13344 |
| 176 | Ga0068858_100030332 | 3300005842 | Bacteria | 5021 |
| 177 | Ga0068860_100002478 | 3300005843 | Bacteria | 19367 |
| 178 | Ga0068860_100028345 | 3300005843 | Bacteria | 5389 |
| 179 | Ga0068860_100263404 | 3300005843 | Bacteria | 1681 |
| 180 | Ga0068860_100743685 | 3300005843 | Bacteria | 992 |
| 181 | Ga0068862_100055835 | 3300005844 | Bacteria | 3383 |
| 182 | Ga0075368_10001585 | 3300006042 | Bacteria | 7303 |
| 183 | Ga0075368_10071519 | 3300006042 | Bacteria | 1401 |
| 184 | Ga0075362_10004323 | 3300006177 | Bacteria | 5085 |
| 185 | Ga0075362_10015052 | 3300006177 | Bacteria | 3138 |
| 186 | Ga0075367_10006326 | 3300006178 | Bacteria | 5972 |
| 187 | Ga0075367_10006549 | 3300006178 | Bacteria | 5894 |
| 188 | Ga0075367_10009705 | 3300006178 | Bacteria | 5043 |
| 189 | Ga0075367_10065416 | 3300006178 | Bacteria | 2177 |
| 190 | Ga0075369_10000429 | 3300006186 | Bacteria | 12770 |
| 191 | Ga0075366_10006781 | 3300006195 | Bacteria | 6292 |
| 192 | Ga0075366_10010537 | 3300006195 | Bacteria | 5191 |
| 193 | Ga0075366_10010792 | 3300006195 | Bacteria | 5137 |
| 194 | Ga0075366_10028467 | 3300006195 | Bacteria | 3279 |
| 195 | Ga0075366_10043913 | 3300006195 | Bacteria | 2648 |
| 196 | Ga0075366_10178965 | 3300006195 | Bacteria | 1288 |
| 197 | Ga0097621_100026939 | 3300006237 | Bacteria | 4515 |
| 198 | Ga0097621_100047802 | 3300006237 | Bacteria | 3468 |
| 199 | Ga0097621_100070853 | 3300006237 | Bacteria | 2879 |
| 200 | Ga0075370_10002430 | 3300006353 | Bacteria | 8635 |
| 201 | Ga0075370_10005964 | 3300006353 | Bacteria | 6099 |
| 202 | Ga0075370_10011503 | 3300006353 | Bacteria | 4653 |
| 203 | Ga0075370_10032738 | 3300006353 | Bacteria | 2907 |
| 204 | Ga0075370_10033655 | 3300006353 | Bacteria | 2870 |
| 205 | Ga0075370_10044344 | 3300006353 | Bacteria | 2514 |
| 206 | Ga0075370_10063543 | 3300006353 | Bacteria | 2105 |
| 207 | Ga0075370_10065556 | 3300006353 | Bacteria | 2071 |
| 208 | Ga0068871_100036870 | 3300006358 | Bacteria | 3895 |
| 209 | Ga0068871_100102167 | 3300006358 | Bacteria | 2403 |
| 210 | Ga0068871_100109101 | 3300006358 | Bacteria | 2326 |
| 211 | Ga0068871_100140856 | 3300006358 | Bacteria | 2051 |
| 212 | Ga0068871_100247924 | 3300006358 | Bacteria | 1550 |
| 213 | Ga0068871_100353045 | 3300006358 | Bacteria | 1301 |
| 214 | Ga0068871_100812235 | 3300006358 | Bacteria | 863 |
| 215 | Ga0075429_100002105 | 3300006880 | Bacteria | 16618 |
| 216 | Ga0068865_100062584 | 3300006881 | Bacteria | 2612 |
| 217 | Ga0068865_100086682 | 3300006881 | Bacteria | 2261 |
| 218 | Ga0097620_100004410 | 3300006931 | Bacteria | 14353 |
| 219 | Ga0097620_100127837 | 3300006931 | Bacteria | 2611 |
| 220 | Ga0079104_1000053 | 3300006946 | Bacteria | 168604 |
| 221 | Ga0105240_10064095 | 3300009093 | Bacteria | 4567 |
| 222 | Ga0105240_10072064 | 3300009093 | Bacteria | 4271 |
| 223 | Ga0105240_10236407 | 3300009093 | Bacteria | 2120 |
| 224 | Ga0111539_10414203 | 3300009094 | Bacteria | 1569 |
| 225 | Ga0105245_10060858 | 3300009098 | Bacteria | 3402 |
| 226 | Ga0105245_10221090 | 3300009098 | Bacteria | 1827 |
| 227 | Ga0114129_10041079 | 3300009147 | Bacteria | 6519 |
| 228 | Ga0105243_10011524 | 3300009148 | Bacteria | 6691 |
| 229 | Ga0105243_10059091 | 3300009148 | Bacteria | 3059 |
| 230 | Ga0105243_10093018 | 3300009148 | Bacteria | 2487 |
| 231 | Ga0105243_10099110 | 3300009148 | Bacteria | 2415 |
| 232 | Ga0105241_10039332 | 3300009174 | Bacteria | 3568 |
| 233 | Ga0105241_10304265 | 3300009174 | Bacteria | 1369 |
| 234 | Ga0105241_10591764 | 3300009174 | Bacteria | 1001 |
| 235 | Ga0105242_10150962 | 3300009176 | Bacteria | 2026 |
| 236 | Ga0105248_10049549 | 3300009177 | Bacteria | 4711 |
| 237 | Ga0105248_10220221 | 3300009177 | Bacteria | 2137 |
| 238 | Ga0105248_10229301 | 3300009177 | Bacteria | 2091 |
| 239 | Ga0105237_10018091 | 3300009545 | Bacteria | 7299 |
| 240 | Ga0105237_10129214 | 3300009545 | Bacteria | 2521 |
| 241 | Ga0105237_10208900 | 3300009545 | Bacteria | 1952 |
| 242 | Ga0105237_10557436 | 3300009545 | Bacteria | 1153 |
| 243 | Ga0105238_10034370 | 3300009551 | Bacteria | 5158 |
| 244 | Ga0105238_10148910 | 3300009551 | Bacteria | 2316 |
| 245 | Ga0105238_10491394 | 3300009551 | Bacteria | 1227 |
| 246 | Ga0105249_10027507 | 3300009553 | Bacteria | 5131 |
| 247 | Ga0105239_10039921 | 3300010375 | Bacteria | 5142 |
| 248 | Ga0105239_10249173 | 3300010375 | Bacteria | 1995 |
| 249 | Ga0105239_10353583 | 3300010375 | Bacteria | 1659 |
| 250 | Ga0105239_10994595 | 3300010375 | Bacteria | 964 |
| 251 | Ga0105246_10548100 | 3300011119 | Bacteria | 991 |
| 252 | Ga0105246_10612925 | 3300011119 | Bacteria | 942 |
| 253 | Ga0157315_1011222 | 3300012508 | Bacteria | 805 |
| 254 | Ga0157338_1011212 | 3300012515 | Bacteria | 918 |
| 255 | Ga0157373_10057699 | 3300013100 | Bacteria | 2753 |
| 256 | Ga0157373_10362906 | 3300013100 | Bacteria | 1034 |
| 257 | Ga0157369_10021757 | 3300013105 | Bacteria | 7172 |
| 258 | Ga0157369_10351196 | 3300013105 | Bacteria | 1531 |
| 259 | Ga0157374_10266447 | 3300013296 | Bacteria | 1689 |
| 260 | Ga0157374_10572633 | 3300013296 | Bacteria | 1138 |
| 261 | Ga0157378_10261535 | 3300013297 | Bacteria | 1661 |
| 262 | Ga0157378_10458511 | 3300013297 | Bacteria | 1266 |
| 263 | Ga0163162_10001148 | 3300013306 | Bacteria | 24691 |
| 264 | Ga0157372_10320684 | 3300013307 | Bacteria | 1804 |
| 265 | Ga0157372_10441962 | 3300013307 | Bacteria | 1516 |
| 266 | Ga0157375_10003901 | 3300013308 | Bacteria | 12932 |
| 267 | Ga0157375_10081629 | 3300013308 | Bacteria | 3274 |
| 268 | Ga0157375_11358396 | 3300013308 | Bacteria | 836 |
| 269 | Ga0163163_10446821 | 3300014325 | Bacteria | 1353 |
| 270 | Ga0163163_10501588 | 3300014325 | Bacteria | 1275 |
| 271 | Ga0157380_10003166 | 3300014326 | Bacteria | 11230 |
| 272 | Ga0157380_10009964 | 3300014326 | Bacteria | 6819 |
| 273 | Ga0157380_10643560 | 3300014326 | Bacteria | 1056 |
| 274 | Ga0157377_10000132 | 3300014745 | Bacteria | 47931 |
| 275 | Ga0157377_10490916 | 3300014745 | Bacteria | 856 |
| 276 | Ga0157379_10005217 | 3300014968 | Bacteria | 11157 |
| 277 | Ga0157379_10042908 | 3300014968 | Bacteria | 4039 |
| 278 | Ga0157379_10083586 | 3300014968 | Bacteria | 2861 |
| 279 | Ga0157379_10115768 | 3300014968 | Bacteria | 2410 |
| 280 | Ga0157379_10446499 | 3300014968 | Bacteria | 1193 |
| 281 | Ga0157376_10054658 | 3300014969 | Bacteria | 3330 |
| 282 | Ga0157376_10459278 | 3300014969 | Bacteria | 1244 |
| 283 | Ga0157376_10930250 | 3300014969 | Bacteria | 889 |
| 284 | Ga0182007_10014416 | 3300015262 | Bacteria | 2980 |
| 285 | Ga0163161_10008277 | 3300017792 | Bacteria | 7196 |
| 286 | Ga0163161_10074083 | 3300017792 | Bacteria | 2496 |
| 287 | Ga0213872_10000318 | 3300021361 | Bacteria | 41064 |
| 288 | Ga0213872_10005163 | 3300021361 | Bacteria | 6761 |
| 289 | Ga0213872_10095899 | 3300021361 | Bacteria | 1324 |
| 290 | Ga0209674_100073 | 3300025226 | Bacteria | 223689 |
| 291 | Ga0209563_100061 | 3300025230 | Bacteria | 274295 |
| 292 | Ga0209563_100075 | 3300025230 | Bacteria | 216575 |
| 293 | Ga0207427_100611 | 3300025231 | Bacteria | 17760 |
| 294 | Ga0209258_100202 | 3300025242 | Bacteria | 121896 |
| 295 | Ga0209258_100941 | 3300025242 | Bacteria | 14133 |
| 296 | Ga0207425_1000717 | 3300025245 | Bacteria | 17832 |
| 297 | Ga0209646_1000258 | 3300025246 | Bacteria | 51783 |
| 298 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 299 | Ga0209677_100120 | 3300025253 | Bacteria | 80505 |
| 300 | Ga0209677_100633 | 3300025253 | Bacteria | 18825 |
| 301 | Ga0209677_101238 | 3300025253 | Bacteria | 11550 |
| 302 | Ga0209148_1004607 | 3300025254 | Bacteria | 3347 |
| 303 | Ga0209759_1000034 | 3300025256 | Bacteria | 271209 |
| 304 | Ga0209759_1000427 | 3300025256 | Bacteria | 51284 |
| 305 | Ga0209759_1000900 | 3300025256 | Bacteria | 22212 |
| 306 | Ga0209129_1000185 | 3300025258 | Bacteria | 86854 |
| 307 | Ga0209129_1020044 | 3300025258 | Bacteria | 1251 |
| 308 | Ga0209455_1000181 | 3300025272 | Bacteria | 101875 |
| 309 | Ga0209673_1005894 | 3300025273 | Bacteria | 6058 |
| 310 | Ga0209675_1004911 | 3300025291 | Bacteria | 5773 |
| 311 | Ga0209564_1000349 | 3300025295 | Bacteria | 86861 |
| 312 | Ga0209758_1000339 | 3300025297 | Bacteria | 86850 |
| 313 | Ga0209758_1001209 | 3300025297 | Bacteria | 32513 |
| 314 | Ga0209050_1000357 | 3300025298 | Bacteria | 88084 |
| 315 | Ga0209050_1001841 | 3300025298 | Bacteria | 20549 |
| 316 | Ga0209256_1000045 | 3300025299 | Bacteria | 325506 |
| 317 | Ga0209256_1013854 | 3300025299 | Bacteria | 2959 |
| 318 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 319 | Ga0209051_1002249 | 3300025303 | Bacteria | 14189 |
| 320 | Ga0209257_1000315 | 3300025304 | Bacteria | 102293 |
| 321 | Ga0207697_10014102 | 3300025315 | Bacteria | 3325 |
| 322 | Ga0207697_10018319 | 3300025315 | Bacteria | 2873 |
| 323 | Ga0207656_10006100 | 3300025321 | Bacteria | 4315 |
| 324 | Ga0207656_10015084 | 3300025321 | Bacteria | 2987 |
| 325 | Ga0207656_10078023 | 3300025321 | Bacteria | 1484 |
| 326 | Ga0207656_10119346 | 3300025321 | Bacteria | 1226 |
| 327 | Ga0207682_10001172 | 3300025893 | Bacteria | 12163 |
| 328 | Ga0207682_10056581 | 3300025893 | Bacteria | 1633 |
| 329 | Ga0207688_10058647 | 3300025901 | Bacteria | 2166 |
| 330 | Ga0207688_10212655 | 3300025901 | Bacteria | 1162 |
| 331 | Ga0207680_10004315 | 3300025903 | Bacteria | 6741 |
| 332 | Ga0207699_10572926 | 3300025906 | Bacteria | 820 |
| 333 | Ga0207645_10005551 | 3300025907 | Bacteria | 9129 |
| 334 | Ga0207645_10008207 | 3300025907 | Bacteria | 7302 |
| 335 | Ga0207645_10014430 | 3300025907 | Bacteria | 5287 |
| 336 | Ga0207643_10130470 | 3300025908 | Bacteria | 1495 |
| 337 | Ga0207705_10125397 | 3300025909 | Bacteria | 1908 |
| 338 | Ga0207705_10155318 | 3300025909 | Bacteria | 1716 |
| 339 | Ga0207684_10004160 | 3300025910 | Bacteria | 13756 |
| 340 | Ga0207654_10071738 | 3300025911 | Bacteria | 2060 |
| 341 | Ga0207654_10368197 | 3300025911 | Bacteria | 993 |
| 342 | Ga0207707_10557887 | 3300025912 | Bacteria | 973 |
| 343 | Ga0207695_10005833 | 3300025913 | Bacteria | 16193 |
| 344 | Ga0207695_10069686 | 3300025913 | Bacteria | 3597 |
| 345 | Ga0207695_10264468 | 3300025913 | Bacteria | 1617 |
| 346 | Ga0207695_10492502 | 3300025913 | Bacteria | 1108 |
| 347 | Ga0207671_10003773 | 3300025914 | Bacteria | 14891 |
| 348 | Ga0207671_10030236 | 3300025914 | Bacteria | 4040 |
| 349 | Ga0207660_10040424 | 3300025917 | Bacteria | 3265 |
| 350 | Ga0207660_10426181 | 3300025917 | Bacteria | 1071 |
| 351 | Ga0207662_10005227 | 3300025918 | Bacteria | 6891 |
| 352 | Ga0207662_10043314 | 3300025918 | Bacteria | 2655 |
| 353 | Ga0207657_10026522 | 3300025919 | Bacteria | 5322 |
| 354 | Ga0207657_10048270 | 3300025919 | Bacteria | 3717 |
| 355 | Ga0207657_10194781 | 3300025919 | Bacteria | 1633 |
| 356 | Ga0207657_10535710 | 3300025919 | Bacteria | 916 |
| 357 | Ga0207649_10003219 | 3300025920 | Bacteria | 8942 |
| 358 | Ga0207649_10045734 | 3300025920 | Bacteria | 2685 |
| 359 | Ga0207652_10147881 | 3300025921 | Bacteria | 2103 |
| 360 | Ga0207646_10379050 | 3300025922 | Bacteria | 1278 |
| 361 | Ga0207681_10000420 | 3300025923 | Bacteria | 29486 |
| 362 | Ga0207681_10003758 | 3300025923 | Bacteria | 9434 |
| 363 | Ga0207681_10105650 | 3300025923 | Bacteria | 2039 |
| 364 | Ga0207694_10137055 | 3300025924 | Bacteria | 1966 |
| 365 | Ga0207694_10219033 | 3300025924 | Bacteria | 1552 |
| 366 | Ga0207650_10000553 | 3300025925 | Bacteria | 30415 |
| 367 | Ga0207650_10001006 | 3300025925 | Bacteria | 21205 |
| 368 | Ga0207650_10006632 | 3300025925 | Bacteria | 7895 |
| 369 | Ga0207650_10072259 | 3300025925 | Bacteria | 2597 |
| 370 | Ga0207650_10599503 | 3300025925 | Bacteria | 926 |
| 371 | Ga0207659_10001264 | 3300025926 | Bacteria | 15136 |
| 372 | Ga0207659_10163835 | 3300025926 | Bacteria | 1748 |
| 373 | Ga0207687_10597826 | 3300025927 | Bacteria | 929 |
| 374 | Ga0207644_10004604 | 3300025931 | Bacteria | 8973 |
| 375 | Ga0207644_10010359 | 3300025931 | Bacteria | 6145 |
| 376 | Ga0207644_10047378 | 3300025931 | Bacteria | 3067 |
| 377 | Ga0207644_10058804 | 3300025931 | Bacteria | 2779 |
| 378 | Ga0207644_10060948 | 3300025931 | Bacteria | 2731 |
| 379 | Ga0207644_10086148 | 3300025931 | Bacteria | 2332 |
| 380 | Ga0207690_10005140 | 3300025932 | Bacteria | 7723 |
| 381 | Ga0207690_10101686 | 3300025932 | Bacteria | 2054 |
| 382 | Ga0207706_10000785 | 3300025933 | Bacteria | 32843 |
| 383 | Ga0207706_10004957 | 3300025933 | Bacteria | 12440 |
| 384 | Ga0207706_10006354 | 3300025933 | Bacteria | 10978 |
| 385 | Ga0207686_10120723 | 3300025934 | Bacteria | 1783 |
| 386 | Ga0207709_10004700 | 3300025935 | Bacteria | 7853 |
| 387 | Ga0207709_10116075 | 3300025935 | Bacteria | 1799 |
| 388 | Ga0207669_10000881 | 3300025937 | Bacteria | 12700 |
| 389 | Ga0207669_10005731 | 3300025937 | Bacteria | 5603 |
| 390 | Ga0207704_10002359 | 3300025938 | Bacteria | 8487 |
| 391 | Ga0207704_10283536 | 3300025938 | Bacteria | 1260 |
| 392 | Ga0207665_10701336 | 3300025939 | Bacteria | 796 |
| 393 | Ga0207691_10005520 | 3300025940 | Bacteria | 12219 |
| 394 | Ga0207691_10006646 | 3300025940 | Bacteria | 11158 |
| 395 | Ga0207691_10105709 | 3300025940 | Bacteria | 2507 |
| 396 | Ga0207691_10122141 | 3300025940 | Bacteria | 2307 |
| 397 | Ga0207691_10133998 | 3300025940 | Bacteria | 2187 |
| 398 | Ga0207691_10177718 | 3300025940 | Bacteria | 1861 |
| 399 | Ga0207691_10265719 | 3300025940 | Bacteria | 1478 |
| 400 | Ga0207711_10031000 | 3300025941 | Bacteria | 4511 |
| 401 | Ga0207711_10098508 | 3300025941 | Bacteria | 2583 |
| 402 | Ga0207711_10202331 | 3300025941 | Bacteria | 1812 |
| 403 | Ga0207689_10000415 | 3300025942 | Bacteria | 39864 |
| 404 | Ga0207689_10005097 | 3300025942 | Bacteria | 11818 |
| 405 | Ga0207689_10017327 | 3300025942 | Bacteria | 6097 |
| 406 | Ga0207689_10079217 | 3300025942 | Bacteria | 2700 |
| 407 | Ga0207689_10176566 | 3300025942 | Bacteria | 1761 |
| 408 | Ga0207661_10188114 | 3300025944 | Bacteria | 1808 |
| 409 | Ga0207679_10000863 | 3300025945 | Bacteria | 19395 |
| 410 | Ga0207679_10040109 | 3300025945 | Bacteria | 3349 |
| 411 | Ga0207679_10235186 | 3300025945 | Bacteria | 1549 |
| 412 | Ga0207667_10004262 | 3300025949 | Bacteria | 17553 |
| 413 | Ga0207667_10071909 | 3300025949 | Bacteria | 3596 |
| 414 | Ga0207667_10462279 | 3300025949 | Bacteria | 1289 |
| 415 | Ga0207651_10039143 | 3300025960 | Bacteria | 3123 |
| 416 | Ga0207651_10073631 | 3300025960 | Bacteria | 2429 |
| 417 | Ga0207651_10187737 | 3300025960 | Bacteria | 1646 |
| 418 | Ga0207651_10528123 | 3300025960 | Bacteria | 1023 |
| 419 | Ga0207712_10080041 | 3300025961 | Bacteria | 2375 |
| 420 | Ga0207668_10002852 | 3300025972 | Bacteria | 10131 |
| 421 | Ga0207668_10023934 | 3300025972 | Bacteria | 3935 |
| 422 | Ga0207668_10520400 | 3300025972 | Bacteria | 1026 |
| 423 | Ga0207640_10006820 | 3300025981 | Bacteria | 6281 |
| 424 | Ga0207640_10291132 | 3300025981 | Bacteria | 1287 |
| 425 | Ga0207658_10000212 | 3300025986 | Bacteria | 60851 |
| 426 | Ga0207658_10046494 | 3300025986 | Bacteria | 3170 |
| 427 | Ga0207658_10244154 | 3300025986 | Bacteria | 1523 |
| 428 | Ga0207677_10008469 | 3300026023 | Bacteria | 5749 |
| 429 | Ga0207677_10010172 | 3300026023 | Bacteria | 5315 |
| 430 | Ga0207677_10329585 | 3300026023 | Bacteria | 1272 |
| 431 | Ga0207703_10006037 | 3300026035 | Bacteria | 9692 |
| 432 | Ga0207703_10038758 | 3300026035 | Bacteria | 3806 |
| 433 | Ga0207639_10183700 | 3300026041 | Bacteria | 1781 |
| 434 | Ga0207639_10291274 | 3300026041 | Bacteria | 1440 |
| 435 | Ga0207639_10504839 | 3300026041 | Bacteria | 1105 |
| 436 | Ga0207678_10014014 | 3300026067 | Bacteria | 7048 |
| 437 | Ga0207678_10016179 | 3300026067 | Bacteria | 6548 |
| 438 | Ga0207678_10048953 | 3300026067 | Bacteria | 3652 |
| 439 | Ga0207678_10106729 | 3300026067 | Bacteria | 2389 |
| 440 | Ga0207702_10002432 | 3300026078 | Bacteria | 17664 |
| 441 | Ga0207702_10044569 | 3300026078 | Bacteria | 3729 |
| 442 | Ga0207702_10069777 | 3300026078 | Bacteria | 3022 |
| 443 | Ga0207641_10001060 | 3300026088 | Bacteria | 27782 |
| 444 | Ga0207641_10114800 | 3300026088 | Bacteria | 2393 |
| 445 | Ga0207641_10153694 | 3300026088 | Bacteria | 2086 |
| 446 | Ga0207641_10212175 | 3300026088 | Bacteria | 1791 |
| 447 | Ga0207648_10001573 | 3300026089 | Bacteria | 25016 |
| 448 | Ga0207648_10002514 | 3300026089 | Bacteria | 19686 |
| 449 | Ga0207648_10033577 | 3300026089 | Bacteria | 4525 |
| 450 | Ga0207648_10094691 | 3300026089 | Bacteria | 2612 |
| 451 | Ga0207676_10011359 | 3300026095 | Bacteria | 6366 |
| 452 | Ga0207676_10014988 | 3300026095 | Bacteria | 5586 |
| 453 | Ga0207676_10035803 | 3300026095 | Bacteria | 3771 |
| 454 | Ga0207674_10014124 | 3300026116 | Bacteria | 8823 |
| 455 | Ga0207674_10025976 | 3300026116 | Bacteria | 6232 |
| 456 | Ga0207674_10038054 | 3300026116 | Bacteria | 4998 |
| 457 | Ga0207674_10104114 | 3300026116 | Bacteria | 2817 |
| 458 | Ga0207674_10167295 | 3300026116 | Bacteria | 2152 |
| 459 | Ga0207674_10642573 | 3300026116 | Bacteria | 1025 |
| 460 | Ga0207675_100000177 | 3300026118 | Bacteria | 57433 |
| 461 | Ga0207675_100001432 | 3300026118 | Bacteria | 23904 |
| 462 | Ga0207675_100049790 | 3300026118 | Bacteria | 3909 |
| 463 | Ga0207675_100072299 | 3300026118 | Bacteria | 3226 |
| 464 | Ga0207675_100314949 | 3300026118 | Bacteria | 1527 |
| 465 | Ga0207675_100488909 | 3300026118 | Bacteria | 1224 |
| 466 | Ga0207683_10005398 | 3300026121 | Bacteria | 10953 |
| 467 | Ga0207683_10009410 | 3300026121 | Bacteria | 8325 |
| 468 | Ga0207683_10078252 | 3300026121 | Bacteria | 2930 |
| 469 | Ga0207683_10696260 | 3300026121 | Bacteria | 942 |
| 470 | Ga0207698_10011410 | 3300026142 | Bacteria | 5761 |
| 471 | Ga0207698_10240806 | 3300026142 | Bacteria | 1649 |
| 472 | Ga0207698_10294526 | 3300026142 | Bacteria | 1508 |
| 473 | Ga0207698_10873773 | 3300026142 | Bacteria | 905 |
| 474 | Ga0207698_10901723 | 3300026142 | Bacteria | 891 |
| 475 | Ga0209281_1000147 | 3300027111 | Bacteria | 168586 |
| 476 | Ga0209971_1066260 | 3300027682 | Bacteria | 876 |
| 477 | Ga0209813_10003672 | 3300027866 | Bacteria | 3611 |
| 478 | Ga0209974_10025020 | 3300027876 | Bacteria | 1976 |
| 479 | Ga0268266_10013661 | 3300028379 | Bacteria | 6993 |
| 480 | Ga0268266_10197823 | 3300028379 | Bacteria | 1838 |
| 481 | Ga0268266_10206996 | 3300028379 | Bacteria | 1798 |
| 482 | Ga0268265_10051554 | 3300028380 | Bacteria | 3106 |
| 483 | Ga0268264_10001043 | 3300028381 | Bacteria | 27736 |
| 484 | Ga0268264_10028673 | 3300028381 | Bacteria | 4555 |
| 485 | Ga0268264_10079473 | 3300028381 | Bacteria | 2798 |
| 486 | Ga0265319_1092906 | 3300028563 | Bacteria | 951 |
| 487 | Ga0265336_10000556 | 3300028666 | Bacteria | 21237 |
| 488 | Ga0307517_10241977 | 3300028786 | Bacteria | 1069 |
| 489 | Ga0307515_10000096 | 3300028794 | Bacteria | 206366 |
| 490 | Ga0307515_10010714 | 3300028794 | Bacteria | 17519 |
| 491 | Ga0307515_10014894 | 3300028794 | Bacteria | 14373 |
| 492 | Ga0307515_10018130 | 3300028794 | Bacteria | 12769 |
| 493 | Ga0307515_10144057 | 3300028794 | Bacteria | 2536 |
| 494 | Ga0307515_10283962 | 3300028794 | Bacteria | 1359 |
| 495 | Ga0307515_10301318 | 3300028794 | Bacteria | 1287 |
| 496 | Ga0265324_10006457 | 3300029957 | Bacteria | 4886 |
| 497 | Ga0307512_10056018 | 3300030522 | Bacteria | 3101 |
| 498 | Ga0307512_10202173 | 3300030522 | Bacteria | 1073 |
| 499 | Ga0265328_10005721 | 3300031239 | Bacteria | 5311 |
| 500 | Ga0265328_10009070 | 3300031239 | Bacteria | 4064 |
| 501 | Ga0265327_10000364 | 3300031251 | Bacteria | 86161 |
| 502 | Ga0265316_10000069 | 3300031344 | Bacteria | 104235 |
| 503 | Ga0307513_10019952 | 3300031456 | Bacteria | 7962 |
| 504 | Ga0307513_10035096 | 3300031456 | Bacteria | 5617 |
| 505 | Ga0307513_10363045 | 3300031456 | Bacteria | 1192 |
| 506 | Ga0307509_10001003 | 3300031507 | Bacteria | 48532 |
| 507 | Ga0307509_10001647 | 3300031507 | Bacteria | 37422 |
| 508 | Ga0307509_10029240 | 3300031507 | Bacteria | 6119 |
| 509 | Ga0307509_10052681 | 3300031507 | Bacteria | 4343 |
| 510 | Ga0307408_100062879 | 3300031548 | Bacteria | 2714 |
| 511 | Ga0307408_100067279 | 3300031548 | Bacteria | 2634 |
| 512 | Ga0307408_100203466 | 3300031548 | Bacteria | 1604 |
| 513 | Ga0307408_100250327 | 3300031548 | Bacteria | 1461 |
| 514 | Ga0307508_10000028 | 3300031616 | Bacteria | 168639 |
| 515 | Ga0307508_10001377 | 3300031616 | Bacteria | 27383 |
| 516 | Ga0307514_10084421 | 3300031649 | Bacteria | 2337 |
| 517 | Ga0307514_10171056 | 3300031649 | Bacteria | 1419 |
| 518 | Ga0307516_10000155 | 3300031730 | Bacteria | 85605 |
| 519 | Ga0307516_10000329 | 3300031730 | Bacteria | 61772 |
| 520 | Ga0307516_10002006 | 3300031730 | Bacteria | 27820 |
| 521 | Ga0307516_10043796 | 3300031730 | Bacteria | 4433 |
| 522 | Ga0307516_10044489 | 3300031730 | Bacteria | 4392 |
| 523 | Ga0307405_10014639 | 3300031731 | Bacteria | 4224 |
| 524 | Ga0307405_10057608 | 3300031731 | Bacteria | 2442 |
| 525 | Ga0307405_10606909 | 3300031731 | Bacteria | 894 |
| 526 | Ga0307413_10069721 | 3300031824 | Bacteria | 2207 |
| 527 | Ga0307413_10530766 | 3300031824 | Bacteria | 951 |
| 528 | Ga0307413_10606630 | 3300031824 | Bacteria | 897 |
| 529 | Ga0307410_10023773 | 3300031852 | Bacteria | 3817 |
| 530 | Ga0307410_10227855 | 3300031852 | Bacteria | 1437 |
| 531 | Ga0307406_10012755 | 3300031901 | Bacteria | 4796 |
| 532 | Ga0307406_10349285 | 3300031901 | Bacteria | 1155 |
| 533 | Ga0307407_10084147 | 3300031903 | Bacteria | 1932 |
| 534 | Ga0307412_10427002 | 3300031911 | Bacteria | 1085 |
| 535 | Ga0307412_10490123 | 3300031911 | Bacteria | 1021 |
| 536 | Ga0307412_10561092 | 3300031911 | Bacteria | 961 |
| 537 | Ga0307412_10671413 | 3300031911 | Bacteria | 886 |
| 538 | Ga0307409_100000528 | 3300031995 | Bacteria | 16509 |
| 539 | Ga0307409_100054964 | 3300031995 | Bacteria | 3070 |
| 540 | Ga0307416_100002866 | 3300032002 | Bacteria | 10042 |
| 541 | Ga0307414_10011356 | 3300032004 | Bacteria | 5219 |
| 542 | Ga0307414_10086897 | 3300032004 | Bacteria | 2309 |
| 543 | Ga0307414_10136911 | 3300032004 | Bacteria | 1911 |
| 544 | Ga0307411_10054197 | 3300032005 | Bacteria | 2632 |
| 545 | Ga0307415_100000956 | 3300032126 | Bacteria | 13308 |
| 546 | Ga0307510_10001817 | 3300033180 | Bacteria | 23867 |
| 547 | Ga0307510_10025655 | 3300033180 | Bacteria | 6791 |
| 548 | Ga0307510_10033774 | 3300033180 | Bacteria | 5740 |
| 549 | Ga0373953_0069024 | 3300035117 | Bacteria | 1456 |
| 550 | Ga0373946_0093539 | 3300035171 | Bacteria | 1336 |
| 551 | Ga0373946_0174756 | 3300035171 | Bacteria | 1016 |
| 552 | Ga0373955_0020437 | 3300035172 | Bacteria | 3329 |
| 553 | Ga0373931_0055367 | 3300035691 | Bacteria | 2122 |
| 554 | Ga0373931_0080247 | 3300035691 | Bacteria | 1799 |
| 555 | Ga0373931_0132866 | 3300035691 | Bacteria | 1434 |
| 556 | Ga0373935_0086846 | 3300035692 | Bacteria | 2042 |
| 557 | Ga0373927_0099187 | 3300035695 | Bacteria | 1894 |
| 558 | Ga0373933_0244365 | 3300035724 | Bacteria | 1155 |
| 559 | Ga0373937_0030441 | 3300036401 | Bacteria | 4889 |
| 560 | Ga0373937_0160248 | 3300036401 | Bacteria | 2109 |
| 561 | Ga0373937_0600022 | 3300036401 | Bacteria | 1045 |
| 562 | Ga0373925_0027592 | 3300037068 | Bacteria | 4156 |
| 563 | Ga0373925_0053738 | 3300037068 | Bacteria | 3012 |
| 564 | Ga0373925_0198780 | 3300037068 | Bacteria | 1593 |
| 565 | Ga0373925_0409372 | 3300037068 | Bacteria | 1107 |
| 566 | Ga0395899_0479437 | 3300037312 | Bacteria | 810 |
| 567 | Ga0395898_0001191 | 3300037466 | Bacteria | 39411 |
| 568 | Ga0395898_0513608 | 3300037466 | Bacteria | 1139 |
| 569 | Ga0395905_0000181 | 3300037471 | Bacteria | 100569 |
| 570 | Ga0395905_0132272 | 3300037471 | Bacteria | 2346 |
| 571 | Ga0395905_0314630 | 3300037471 | Bacteria | 1454 |
| 572 | Ga0395905_0448879 | 3300037471 | Bacteria | 1187 |
| 573 | Ga0436361_0237820 | 3300039447 | Bacteria | 8279 |
| 574 | Ga0436361_0647097 | 3300039447 | Bacteria | 1264 |
| 575 | Ga0436361_0653054 | 3300039447 | Bacteria | 18423 |
| 576 | Ga0436361_0781207 | 3300039447 | Bacteria | 33568 |
| 577 | Ga0436363_0216572 | 3300039450 | Bacteria | 5088 |
| 578 | Ga0439438_035551 | 3300041405 | Bacteria | 1309 |
| 579 | Ga0439466_0118362 | 3300041411 | Bacteria | 819 |
| 580 | Ga0451797_1056911 | 3300041453 | Bacteria | 886 |
| 581 | Ga0451798_0835857 | 3300041458 | Bacteria | 817 |
| 582 | Ga0451800_1601736 | 3300041459 | Bacteria | 1067 |
| 583 | Ga0451804_0244073 | 3300041463 | Bacteria | 1072 |
| 584 | Ga0439449_0069645 | 3300042007 | Bacteria | 1297 |
| 585 | Ga0451577_0001773 | 3300042876 | Bacteria | 27757 |
| 586 | Ga0451577_0007365 | 3300042876 | Bacteria | 10803 |
| 587 | Ga0451577_0010640 | 3300042876 | Bacteria | 8766 |
| 588 | Ga0451577_0109276 | 3300042876 | Bacteria | 2473 |
| 589 | Ga0466969_0079166 | 3300044656 | Bacteria | 1571 |
| 590 | Ga0466972_0005822 | 3300044658 | Bacteria | 6180 |
| 591 | Ga0466972_0006098 | 3300044658 | Bacteria | 6054 |
| 592 | Ga0466972_0015489 | 3300044658 | Bacteria | 3811 |
| 593 | Ga0466977_0011985 | 3300044666 | Bacteria | 5022 |
| 594 | Ga0466965_0017284 | 3300044683 | Bacteria | 3446 |
| 595 | Ga0466965_0095387 | 3300044683 | Bacteria | 1517 |
| 596 | Ga0466966_0006064 | 3300044684 | Bacteria | 7981 |
| 597 | Ga0466963_0021472 | 3300044694 | Bacteria | 4073 |
| 598 | Ga0466963_0260644 | 3300044694 | Bacteria | 1217 |
| 599 | Ga0453684_0027068 | 3300044712 | Bacteria | 8243 |
| 600 | Ga0453684_0118372 | 3300044712 | Bacteria | 3204 |
| 601 | Ga0453684_0262653 | 3300044712 | Bacteria | 1977 |
| 602 | Ga0453684_0344616 | 3300044712 | Bacteria | 1681 |
| 603 | Ga0453684_0649690 | 3300044712 | Bacteria | 1151 |
| 604 | Ga0466971_0100547 | 3300044719 | Bacteria | 1328 |
| 605 | Ga0466968_0020050 | 3300044735 | Bacteria | 2695 |
| 606 | Ga0466970_0098737 | 3300044765 | Bacteria | 1589 |
| 607 | Ga0466970_0192146 | 3300044765 | Bacteria | 1134 |
| 608 | Ga0466957_0117145 | 3300044842 | Bacteria | 1695 |
| 609 | Ga0466960_0151398 | 3300044901 | Bacteria | 1239 |
| 610 | Ga0466959_0050980 | 3300045049 | Bacteria | 3037 |
| 611 | Ga0451576_0102995 | 3300045051 | Bacteria | 2969 |
| 612 | Ga0451576_0292348 | 3300045051 | Bacteria | 1703 |
| 613 | Ga0451576_0624441 | 3300045051 | Bacteria | 1132 |
| 614 | Ga0466958_0111000 | 3300045836 | Bacteria | 1711 |
| 615 | Ga0466967_0189251 | 3300045976 | Bacteria | 1944 |
| 616 | Ga0495592_0000734 | 3300046454 | Bacteria | 22835 |
| 617 | Ga0495638_0272965 | 3300046460 | Bacteria | 922 |
| 618 | Ga0495653_0364154 | 3300046463 | Bacteria | 927 |
| 619 | Ga0495650_0021380 | 3300046471 | Bacteria | 3129 |
| 620 | Ga0495580_0092157 | 3300046472 | Bacteria | 2109 |
| 621 | Ga0495605_0034108 | 3300046474 | Bacteria | 2579 |
| 622 | Ga0495585_0027045 | 3300046492 | Bacteria | 3275 |
| 623 | Ga0495606_0012250 | 3300046507 | Bacteria | 6898 |
| 624 | Ga0495606_0095178 | 3300046507 | Bacteria | 1824 |
| 625 | Ga0495606_0146821 | 3300046507 | Bacteria | 1388 |
| 626 | Ga0495608_0076717 | 3300046511 | Bacteria | 2176 |
| 627 | Ga0495608_0217425 | 3300046511 | Bacteria | 1200 |
| 628 | Ga0495608_0373996 | 3300046511 | Bacteria | 874 |
| 629 | Ga0495632_0001700 | 3300046519 | Bacteria | 17931 |
| 630 | Ga0495632_0017146 | 3300046519 | Bacteria | 4006 |
| 631 | Ga0495632_0054120 | 3300046519 | Bacteria | 1968 |
| 632 | Ga0495643_0135091 | 3300046522 | Bacteria | 1235 |
| 633 | Ga0495648_0226971 | 3300046524 | Bacteria | 917 |
| 634 | Ga0495648_0264694 | 3300046524 | Bacteria | 823 |
| 635 | Ga0495597_0003790 | 3300046542 | Bacteria | 8604 |
| 636 | Ga0495622_0211726 | 3300046557 | Bacteria | 861 |
| 637 | Ga0495656_0092430 | 3300046615 | Bacteria | 1386 |
| 638 | Ga0495668_0013457 | 3300046616 | Bacteria | 4823 |
| 639 | Ga0495668_0015696 | 3300046616 | Bacteria | 4415 |
| 640 | Ga0495668_0032904 | 3300046616 | Bacteria | 2915 |
| 641 | Ga0495668_0117584 | 3300046616 | Bacteria | 1454 |
| 642 | Ga0495611_0122273 | 3300046648 | Bacteria | 1214 |
| 643 | Ga0495625_0269716 | 3300046660 | Bacteria | 1098 |
| 644 | Ga0495635_0064949 | 3300046663 | Bacteria | 2505 |
| 645 | Ga0495599_0442488 | 3300046678 | Bacteria | 770 |
| 646 | Ga0495646_0096867 | 3300046680 | Bacteria | 1696 |
| 647 | Ga0495658_0096932 | 3300046683 | Bacteria | 1755 |
| 648 | Ga0495658_0109957 | 3300046683 | Bacteria | 1656 |
| 649 | Ga0495669_0023944 | 3300046684 | Bacteria | 2660 |
| 650 | Ga0495671_0111242 | 3300046692 | Bacteria | 1338 |
| 651 | Ga0495649_0000180 | 3300046694 | Bacteria | 55086 |
| 652 | Ga0495649_0108683 | 3300046694 | Bacteria | 1471 |
| 653 | Ga0495589_0075751 | 3300046794 | Bacteria | 1641 |
| 654 | Ga0495676_0101914 | 3300047321 | Bacteria | 2122 |
| 655 | Ga0495680_0096673 | 3300047322 | Bacteria | 2205 |
| 656 | Ga0495687_000890 | 3300047443 | Bacteria | 31459 |
| 657 | Ga0495687_009019 | 3300047443 | Bacteria | 5629 |
| 658 | Ga0495687_014505 | 3300047443 | Bacteria | 4052 |
| 659 | Ga0495677_0093560 | 3300047445 | Bacteria | 1134 |
| 660 | Ga0495673_0096905 | 3300047469 | Bacteria | 1198 |
| 661 | Ga0495686_0004536 | 3300047472 | Bacteria | 11381 |
| 662 | Ga0495686_0005275 | 3300047472 | Bacteria | 10257 |
| 663 | Ga0495686_0083867 | 3300047472 | Bacteria | 1943 |
| 664 | Ga0495686_0088778 | 3300047472 | Bacteria | 1879 |
| 665 | Ga0495686_0137862 | 3300047472 | Bacteria | 1442 |
| 666 | Ga0495626_0054419 | 3300048091 | Bacteria | 1837 |
| 667 | Ga0496102_0001760 | 3300048905 | Bacteria | 18852 |
| 668 | Ga0496102_0569758 | 3300048905 | Bacteria | 1055 |
| 669 | Ga0496104_0107765 | 3300048907 | Bacteria | 2670 |
| 670 | Ga0496105_0466008 | 3300048908 | Bacteria | 996 |
| 671 | Ga0496106_0141839 | 3300048909 | Bacteria | 1890 |
| 672 | Ga0496106_0401041 | 3300048909 | Bacteria | 1102 |
| 673 | Ga0496108_0285627 | 3300048911 | Bacteria | 1436 |
| 674 | Ga0496108_0493932 | 3300048911 | Bacteria | 1069 |
| 675 | Ga0496109_0360169 | 3300048912 | Bacteria | 1374 |
| 676 | Ga0496110_0044294 | 3300048913 | Bacteria | 3886 |
| 677 | Ga0496110_0128718 | 3300048913 | Bacteria | 2285 |
| 678 | Ga0496112_0539277 | 3300048915 | Bacteria | 1101 |
| 679 | Ga0496114_0000554 | 3300048917 | Bacteria | 27680 |
| 680 | Ga0496121_0010106 | 3300048924 | Bacteria | 10703 |
| 681 | Ga0496124_0003631 | 3300048927 | Bacteria | 18724 |
| 682 | Ga0496125_0012783 | 3300048928 | Bacteria | 8298 |
| 683 | Ga0501294_005716 | 3300049517 | Bacteria | 1181 |
| 684 | Ga0501298_004902 | 3300049521 | Bacteria | 2129 |
| 685 | Ga0501032_0036399 | 3300049569 | Bacteria | 3359 |
| 686 | Ga0501034_0148849 | 3300049571 | Bacteria | 2317 |
| 687 | Ga0501041_0504756 | 3300049577 | Bacteria | 770 |
| 688 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 689 | Ga0501043_0017885 | 3300049579 | Bacteria | 5559 |
| 690 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 691 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 692 | Ga0501047_0188868 | 3300049581 | Bacteria | 1925 |
| 693 | Ga0501048_0002164 | 3300049582 | Bacteria | 14963 |
| 694 | Ga0501198_000007 | 3300049649 | Bacteria | 129700 |
| 695 | Ga0501222_000005 | 3300049662 | Bacteria | 129724 |
| 696 | Ga0501252_006255 | 3300049682 | Bacteria | 1319 |
| 697 | Ga0501265_001134 | 3300049762 | Bacteria | 3000 |
| 698 | Ga0501044_0196635 | 3300049823 | Bacteria | 1976 |
| 699 | Ga0501045_0006316 | 3300049824 | Bacteria | 8196 |
| 700 | nmdc:mga03683_10708_c1 | 3300050489 | Bacteria | 3295 |
| 701 | nmdc:mga03683_11731_c1 | 3300050489 | Bacteria | 3182 |
| 702 | nmdc:mga03683_259784_c1 | 3300050489 | Bacteria | 808 |
| 703 | nmdc:mga00v17_49418_c1 | 3300050491 | Bacteria | 2551 |
| 704 | nmdc:mga00v17_97988_c1 | 3300050491 | Bacteria | 1848 |
| 705 | nmdc:mga0yw44_175847_c1 | 3300050492 | Bacteria | 1407 |
| 706 | nmdc:mga0k408_10919_c1 | 3300050493 | Bacteria | 4927 |
| 707 | nmdc:mga0k408_110914_c1 | 3300050493 | Bacteria | 1622 |
| 708 | nmdc:mga0k408_12173_c1 | 3300050493 | Bacteria | 4699 |
| 709 | nmdc:mga0k408_25834_c1 | 3300050493 | Bacteria | 3328 |
| 710 | nmdc:mga0k408_27122_c2 | 3300050493 | Bacteria | 2935 |
| 711 | nmdc:mga0k408_2752_c1 | 3300050493 | Bacteria | 9345 |
| 712 | nmdc:mga0k408_4953_c1 | 3300050493 | Bacteria | 7058 |
| 713 | nmdc:mga0k408_75652_c2 | 3300050493 | Bacteria | 1771 |
| 714 | nmdc:mga0k408_86274_c1 | 3300050493 | Bacteria | 1842 |
| 715 | nmdc:mga06z11_18752_c1 | 3300050494 | Bacteria | 3167 |
| 716 | nmdc:mga06z11_56308_c1 | 3300050494 | Bacteria | 2033 |
| 717 | nmdc:mga04h51_106307_c1 | 3300050495 | Bacteria | 1029 |
| 718 | nmdc:mga04h51_22799_c1 | 3300050495 | Bacteria | 1899 |
| 719 | nmdc:mga07m45_13723_c1 | 3300050496 | Bacteria | 4302 |
| 720 | nmdc:mga07m45_152709_c1 | 3300050496 | Bacteria | 1339 |
| 721 | nmdc:mga07m45_1608_c1 | 3300050496 | Bacteria | 10398 |
| 722 | nmdc:mga07m45_20211_c1 | 3300050496 | Bacteria | 3617 |
| 723 | nmdc:mga07m45_225796_c1 | 3300050496 | Bacteria | 1090 |
| 724 | nmdc:mga07m45_22669_c1 | 3300050496 | Bacteria | 3430 |
| 725 | nmdc:mga07m45_25425_c1 | 3300050496 | Bacteria | 3247 |
| 726 | nmdc:mga07m45_29719_c1 | 3300050496 | Bacteria | 3025 |
| 727 | nmdc:mga07m45_56749_c1 | 3300050496 | Bacteria | 2214 |
| 728 | nmdc:mga09592_28582_c1 | 3300050508 | Bacteria | 4633 |
| 729 | nmdc:mga0qj67_131048_c1 | 3300050509 | Bacteria | 2031 |
| 730 | nmdc:mga08y16_558075_c1 | 3300050511 | Bacteria | 1158 |
| 731 | nmdc:mga0sz30_22155_c1 | 3300050516 | Bacteria | 2577 |
| 732 | Ga0495601_0058433 | 3300053077 | Bacteria | 2444 |
| 733 | Ga0500635_0000029 | 3300053080 | Bacteria | 100914 |
| 734 | Ga0495595_0015382 | 3300053084 | Bacteria | 3264 |
| 735 | Ga0495619_0045623 | 3300053085 | Bacteria | 2880 |
| 736 | Ga0500578_0000311 | 3300053086 | Bacteria | 59919 |
| 737 | Ga0500578_0076324 | 3300053086 | Bacteria | 2134 |
| 738 | Ga0500644_0072836 | 3300053088 | Bacteria | 1242 |
| 739 | Ga0500646_0003723 | 3300053090 | Bacteria | 3906 |
| 740 | Ga0500583_0024103 | 3300053092 | Bacteria | 2577 |
| 741 | Ga0500583_0208174 | 3300053092 | Bacteria | 971 |
| 742 | Ga0500651_0026946 | 3300053093 | Bacteria | 3612 |
| 743 | Ga0500651_0117260 | 3300053093 | Bacteria | 1619 |
| 744 | Ga0500650_0028900 | 3300053098 | Bacteria | 2507 |
| 745 | Ga0500569_090657 | 3300053109 | Bacteria | 990 |
| 746 | Ga0500593_147974 | 3300053117 | Bacteria | 915 |
| 747 | Ga0500594_0001185 | 3300053118 | Bacteria | 5625 |
| 748 | Ga0500608_123485 | 3300053122 | Bacteria | 1171 |
| 749 | Ga0500614_022515 | 3300053123 | Bacteria | 1472 |
| 750 | Ga0500642_0002755 | 3300053130 | Bacteria | 5206 |
| 751 | Ga0500652_000663 | 3300053131 | Bacteria | 11691 |
| 752 | Ga0500655_010539 | 3300053133 | Bacteria | 1670 |
| 753 | Ga0500658_0002762 | 3300053134 | Bacteria | 6750 |
| 754 | Ga0500559_0000133 | 3300053136 | Bacteria | 56972 |
| 755 | Ga0500559_0122603 | 3300053136 | Bacteria | 1209 |
| 756 | Ga0500568_0009517 | 3300053139 | Bacteria | 4607 |
| 757 | Ga0500568_0017650 | 3300053139 | Bacteria | 3145 |
| 758 | Ga0500568_0046502 | 3300053139 | Bacteria | 1722 |
| 759 | Ga0500577_0019302 | 3300053142 | Bacteria | 2208 |
| 760 | Ga0500590_005138 | 3300053148 | Bacteria | 6275 |
| 761 | Ga0500619_000029 | 3300053154 | Bacteria | 47803 |
| 762 | Ga0500619_036256 | 3300053154 | Bacteria | 1535 |
| 763 | Ga0500622_0000307 | 3300053156 | Bacteria | 50070 |
| 764 | Ga0500622_0011091 | 3300053156 | Bacteria | 4919 |
| 765 | Ga0500622_0111327 | 3300053156 | Bacteria | 1337 |
| 766 | Ga0500636_0044245 | 3300053177 | Bacteria | 2626 |
| 767 | Ga0500636_0049964 | 3300053177 | Bacteria | 2459 |
| 768 | Ga0500570_129469 | 3300053724 | Bacteria | 963 |
| 769 | Ga0500645_034488 | 3300053730 | Bacteria | 1511 |
| 770 | Ga0500587_005972 | 3300053739 | Bacteria | 1627 |
| 771 | Ga0590075_018865 | 3300059424 | Bacteria | 1709 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025924 | Ga0207694_10219033 | Ga0207694_102190332 | 197 |
| 2 | 3300037068 | Ga0373925_0053738 | Ga0373925_0053738_440_1090 | 209 |
| 3 | 3300044656 | Ga0466969_0079166 | Ga0466969_0079166_788_1456 | 211 |
| 4 | 3300044666 | Ga0466977_0011985 | Ga0466977_0011985_2379_3047 | 211 |
| 5 | 3300049579 | Ga0501043_0017885 | Ga0501043_0017885_4204_4872 | 211 |
| 6 | 3300009094 | Ga0111539_10414203 | Ga0111539_104142032 | 213 |
| 7 | iso_pu_bacteria | 2721755763 | 2723875855 | 214 |
| 8 | 3300036401 | Ga0373937_0600022 | Ga0373937_0600022_110_781 | 216 |
| 9 | 3300031731 | Ga0307405_10606909 | Ga0307405_106069092 | 217 |
| 10 | 3300031911 | Ga0307412_10490123 | Ga0307412_104901232 | 217 |
| 11 | 3300028563 | Ga0265319_1092906 | Ga0265319_10929061 | 218 |
| 12 | 3300031239 | Ga0265328_10005721 | Ga0265328_100057215 | 218 |
| 13 | 3300031239 | Ga0265328_10009070 | Ga0265328_100090703 | 218 |
| 14 | 3300031251 | Ga0265327_10000364 | Ga0265327_100003642 | 218 |
| 15 | 3300031344 | Ga0265316_10000069 | Ga0265316_1000006955 | 218 |
| 16 | 3300037471 | Ga0395905_0000181 | Ga0395905_0000181_55110_55790 | 218 |
| 17 | 3300048913 | Ga0496110_0044294 | Ga0496110_0044294_1527_2210 | 218 |
| 18 | 3300042876 | Ga0451577_0001773 | Ga0451577_0001773_23909_24616 | 219 |
| 19 | 3300031730 | Ga0307516_10000329 | Ga0307516_1000032945 | 220 |
| 20 | 3300049577 | Ga0501041_0504756 | Ga0501041_0504756_32_700 | 220 |
| 21 | 3300009176 | Ga0105242_10150962 | Ga0105242_101509622 | 221 |
| 22 | 3300025912 | Ga0207707_10557887 | Ga0207707_105578871 | 221 |
| 23 | 3300037471 | Ga0395905_0132272 | Ga0395905_0132272_31_714 | 221 |
| 24 | 3300039447 | Ga0436361_0647097 | Ga0436361_0647097_448_1131 | 221 |
| 25 | 3300041405 | Ga0439438_035551 | Ga0439438_035551_97_786 | 221 |
| 26 | 3300042007 | Ga0439449_0069645 | Ga0439449_0069645_156_824 | 221 |
| 27 | iso_pu_bacteria | 2585428057 | 2587725998 | 221 |
| 28 | iso_pu_bacteria | 2585428058 | 2587735660 | 221 |
| 29 | iso_pu_bacteria | 2588253510 | 2588292794 | 221 |
| 30 | iso_pu_bacteria | 2643221592 | 2643967901 | 221 |
| 31 | iso_pu_bacteria | 2643221625 | 2644143199 | 221 |
| 32 | iso_pu_bacteria | 2643221648 | 2644271713 | 221 |
| 33 | 3300003759 | Ga0055525_1000054 | Ga0055525_1000054162 | 222 |
| 34 | 3300005327 | Ga0070658_10077281 | Ga0070658_100772813 | 222 |
| 35 | 3300009148 | Ga0105243_10059091 | Ga0105243_100590912 | 222 |
| 36 | 3300025230 | Ga0209563_100075 | Ga0209563_10007534 | 222 |
| 37 | 3300025253 | Ga0209677_101238 | Ga0209677_1012388 | 222 |
| 38 | 3300025935 | Ga0207709_10116075 | Ga0207709_101160752 | 222 |
| 39 | 3300031730 | Ga0307516_10000155 | Ga0307516_1000015564 | 222 |
| 40 | 3300048911 | Ga0496108_0493932 | Ga0496108_0493932_353_1027 | 222 |
| 41 | 3300003316 | rootH1_10013116 | rootH1_100131162 | 223 |
| 42 | 3300005293 | Ga0065715_10349191 | Ga0065715_103491911 | 223 |
| 43 | 3300005327 | Ga0070658_10153919 | Ga0070658_101539192 | 223 |
| 44 | 3300005328 | Ga0070676_10091251 | Ga0070676_100912512 | 223 |
| 45 | 3300005331 | Ga0070670_100019136 | Ga0070670_1000191368 | 223 |
| 46 | 3300005331 | Ga0070670_100019379 | Ga0070670_1000193792 | 223 |
| 47 | 3300005331 | Ga0070670_100045584 | Ga0070670_1000455843 | 223 |
| 48 | 3300005331 | Ga0070670_100047852 | Ga0070670_1000478523 | 223 |
| 49 | 3300005331 | Ga0070670_100186374 | Ga0070670_1001863742 | 223 |
| 50 | 3300005331 | Ga0070670_100535604 | Ga0070670_1005356041 | 223 |
| 51 | 3300005334 | Ga0068869_100000889 | Ga0068869_10000088915 | 223 |
| 52 | 3300005334 | Ga0068869_100297764 | Ga0068869_1002977641 | 223 |
| 53 | 3300005335 | Ga0070666_10004101 | Ga0070666_100041014 | 223 |
| 54 | 3300005339 | Ga0070660_100158755 | Ga0070660_1001587552 | 223 |
| 55 | 3300005340 | Ga0070689_100300132 | Ga0070689_1003001322 | 223 |
| 56 | 3300005343 | Ga0070687_100003516 | Ga0070687_1000035163 | 223 |
| 57 | 3300005353 | Ga0070669_100009268 | Ga0070669_1000092684 | 223 |
| 58 | 3300005354 | Ga0070675_100025340 | Ga0070675_1000253402 | 223 |
| 59 | 3300005355 | Ga0070671_100012912 | Ga0070671_1000129125 | 223 |
| 60 | 3300005355 | Ga0070671_100054523 | Ga0070671_1000545232 | 223 |
| 61 | 3300005355 | Ga0070671_100238578 | Ga0070671_1002385782 | 223 |
| 62 | 3300005355 | Ga0070671_100263664 | Ga0070671_1002636642 | 223 |
| 63 | 3300005356 | Ga0070674_100004034 | Ga0070674_1000040346 | 223 |
| 64 | 3300005356 | Ga0070674_100046579 | Ga0070674_1000465793 | 223 |
| 65 | 3300005364 | Ga0070673_100161420 | Ga0070673_1001614202 | 223 |
| 66 | 3300005367 | Ga0070667_100000294 | Ga0070667_10000029442 | 223 |
| 67 | 3300005367 | Ga0070667_100537420 | Ga0070667_1005374202 | 223 |
| 68 | 3300005441 | Ga0070700_100145165 | Ga0070700_1001451652 | 223 |
| 69 | 3300005459 | Ga0068867_100001003 | Ga0068867_10000100316 | 223 |
| 70 | 3300005459 | Ga0068867_100068989 | Ga0068867_1000689892 | 223 |
| 71 | 3300005459 | Ga0068867_100320216 | Ga0068867_1003202162 | 223 |
| 72 | 3300005543 | Ga0070672_100009151 | Ga0070672_1000091512 | 223 |
| 73 | 3300005543 | Ga0070672_100119204 | Ga0070672_1001192043 | 223 |
| 74 | 3300005547 | Ga0070693_100239923 | Ga0070693_1002399232 | 223 |
| 75 | 3300005564 | Ga0070664_100129554 | Ga0070664_1001295543 | 223 |
| 76 | 3300005617 | Ga0068859_100004410 | Ga0068859_1000044106 | 223 |
| 77 | 3300005618 | Ga0068864_100049956 | Ga0068864_1000499562 | 223 |
| 78 | 3300005719 | Ga0068861_100003026 | Ga0068861_1000030262 | 223 |
| 79 | 3300005834 | Ga0068851_10227890 | Ga0068851_102278902 | 223 |
| 80 | 3300005841 | Ga0068863_100001702 | Ga0068863_1000017025 | 223 |
| 81 | 3300005842 | Ga0068858_100004719 | Ga0068858_1000047194 | 223 |
| 82 | 3300005843 | Ga0068860_100002478 | Ga0068860_1000024784 | 223 |
| 83 | 3300006195 | Ga0075366_10178965 | Ga0075366_101789652 | 223 |
| 84 | 3300006881 | Ga0068865_100062584 | Ga0068865_1000625843 | 223 |
| 85 | 3300006931 | Ga0097620_100004410 | Ga0097620_1000044106 | 223 |
| 86 | 3300009147 | Ga0114129_10041079 | Ga0114129_100410794 | 223 |
| 87 | 3300012515 | Ga0157338_1011212 | Ga0157338_10112122 | 223 |
| 88 | 3300013296 | Ga0157374_10572633 | Ga0157374_105726332 | 223 |
| 89 | 3300013297 | Ga0157378_10261535 | Ga0157378_102615352 | 223 |
| 90 | 3300013308 | Ga0157375_10081629 | Ga0157375_100816293 | 223 |
| 91 | 3300014326 | Ga0157380_10009964 | Ga0157380_100099646 | 223 |
| 92 | 3300014969 | Ga0157376_10930250 | Ga0157376_109302501 | 223 |
| 93 | 3300017792 | Ga0163161_10008277 | Ga0163161_100082777 | 223 |
| 94 | 3300025315 | Ga0207697_10018319 | Ga0207697_100183196 | 223 |
| 95 | 3300025893 | Ga0207682_10056581 | Ga0207682_100565812 | 223 |
| 96 | 3300025903 | Ga0207680_10004315 | Ga0207680_100043154 | 223 |
| 97 | 3300025907 | Ga0207645_10005551 | Ga0207645_100055514 | 223 |
| 98 | 3300025918 | Ga0207662_10005227 | Ga0207662_100052274 | 223 |
| 99 | 3300025923 | Ga0207681_10000420 | Ga0207681_1000042016 | 223 |
| 100 | 3300025925 | Ga0207650_10000553 | Ga0207650_1000055315 | 223 |
| 101 | 3300025931 | Ga0207644_10004604 | Ga0207644_100046048 | 223 |
| 102 | 3300025937 | Ga0207669_10000881 | Ga0207669_100008814 | 223 |
| 103 | 3300025937 | Ga0207669_10005731 | Ga0207669_100057315 | 223 |
| 104 | 3300025938 | Ga0207704_10002359 | Ga0207704_100023592 | 223 |
| 105 | 3300025939 | Ga0207665_10701336 | Ga0207665_107013361 | 223 |
| 106 | 3300025940 | Ga0207691_10122141 | Ga0207691_101221412 | 223 |
| 107 | 3300025940 | Ga0207691_10177718 | Ga0207691_101777183 | 223 |
| 108 | 3300025940 | Ga0207691_10265719 | Ga0207691_102657192 | 223 |
| 109 | 3300025941 | Ga0207711_10031000 | Ga0207711_100310002 | 223 |
| 110 | 3300025941 | Ga0207711_10098508 | Ga0207711_100985082 | 223 |
| 111 | 3300025942 | Ga0207689_10005097 | Ga0207689_100050972 | 223 |
| 112 | 3300025960 | Ga0207651_10528123 | Ga0207651_105281232 | 223 |
| 113 | 3300025961 | Ga0207712_10080041 | Ga0207712_100800413 | 223 |
| 114 | 3300025972 | Ga0207668_10002852 | Ga0207668_100028527 | 223 |
| 115 | 3300025986 | Ga0207658_10000212 | Ga0207658_1000021214 | 223 |
| 116 | 3300026023 | Ga0207677_10008469 | Ga0207677_100084695 | 223 |
| 117 | 3300026035 | Ga0207703_10006037 | Ga0207703_100060374 | 223 |
| 118 | 3300026041 | Ga0207639_10291274 | Ga0207639_102912742 | 223 |
| 119 | 3300026088 | Ga0207641_10001060 | Ga0207641_1000106012 | 223 |
| 120 | 3300026088 | Ga0207641_10212175 | Ga0207641_102121752 | 223 |
| 121 | 3300026089 | Ga0207648_10002514 | Ga0207648_1000251416 | 223 |
| 122 | 3300026089 | Ga0207648_10094691 | Ga0207648_100946912 | 223 |
| 123 | 3300026095 | Ga0207676_10035803 | Ga0207676_100358032 | 223 |
| 124 | 3300026118 | Ga0207675_100001432 | Ga0207675_10000143220 | 223 |
| 125 | 3300026118 | Ga0207675_100488909 | Ga0207675_1004889092 | 223 |
| 126 | 3300026142 | Ga0207698_10901723 | Ga0207698_109017231 | 223 |
| 127 | 3300028379 | Ga0268266_10206996 | Ga0268266_102069962 | 223 |
| 128 | 3300028380 | Ga0268265_10051554 | Ga0268265_100515542 | 223 |
| 129 | 3300028381 | Ga0268264_10001043 | Ga0268264_1000104318 | 223 |
| 130 | 3300031548 | Ga0307408_100067279 | Ga0307408_1000672793 | 223 |
| 131 | 3300031548 | Ga0307408_100250327 | Ga0307408_1002503272 | 223 |
| 132 | 3300031649 | Ga0307514_10171056 | Ga0307514_101710562 | 223 |
| 133 | 3300031730 | Ga0307516_10043796 | Ga0307516_100437963 | 223 |
| 134 | 3300031731 | Ga0307405_10014639 | Ga0307405_100146391 | 223 |
| 135 | 3300031824 | Ga0307413_10069721 | Ga0307413_100697211 | 223 |
| 136 | 3300031852 | Ga0307410_10023773 | Ga0307410_100237733 | 223 |
| 137 | 3300031901 | Ga0307406_10012755 | Ga0307406_100127552 | 223 |
| 138 | 3300031903 | Ga0307407_10084147 | Ga0307407_100841472 | 223 |
| 139 | 3300031995 | Ga0307409_100054964 | Ga0307409_1000549642 | 223 |
| 140 | 3300032004 | Ga0307414_10011356 | Ga0307414_100113564 | 223 |
| 141 | 3300032004 | Ga0307414_10086897 | Ga0307414_100868972 | 223 |
| 142 | 3300035171 | Ga0373946_0174756 | Ga0373946_0174756_103_780 | 223 |
| 143 | 3300041411 | Ga0439466_0118362 | Ga0439466_0118362_39_734 | 223 |
| 144 | 3300044712 | Ga0453684_0262653 | Ga0453684_0262653_69_740 | 223 |
| 145 | 3300046472 | Ga0495580_0092157 | Ga0495580_0092157_894_1571 | 223 |
| 146 | 3300046511 | Ga0495608_0217425 | Ga0495608_0217425_93_776 | 223 |
| 147 | 3300046557 | Ga0495622_0211726 | Ga0495622_0211726_44_727 | 223 |
| 148 | 3300049571 | Ga0501034_0148849 | Ga0501034_0148849_254_934 | 223 |
| 149 | 3300049581 | Ga0501047_0188868 | Ga0501047_0188868_1190_1870 | 223 |
| 150 | 3300049649 | Ga0501198_000007 | Ga0501198_000007_88265_88945 | 223 |
| 151 | 3300049662 | Ga0501222_000005 | Ga0501222_000005_40799_41479 | 223 |
| 152 | 3300053136 | Ga0500559_0122603 | Ga0500559_0122603_420_1103 | 223 |
| 153 | 3300059424 | Ga0590075_018865 | Ga0590075_018865_1020_1694 | 223 |
| 154 | iso_pu_bacteria | 2643221644 | 2644248467 | 223 |
| 155 | iso_pu_bacteria | 2643221654 | 2644301109 | 223 |
| 156 | 3300005466 | Ga0070685_10414707 | Ga0070685_104147071 | 224 |
| 157 | 3300006353 | Ga0075370_10063543 | Ga0075370_100635433 | 224 |
| 158 | 3300012508 | Ga0157315_1011222 | Ga0157315_10112221 | 224 |
| 159 | 3300014326 | Ga0157380_10643560 | Ga0157380_106435602 | 224 |
| 160 | 3300025906 | Ga0207699_10572926 | Ga0207699_105729262 | 224 |
| 161 | 3300026023 | Ga0207677_10010172 | Ga0207677_100101725 | 224 |
| 162 | 3300028794 | Ga0307515_10000096 | Ga0307515_1000009653 | 224 |
| 163 | 3300028794 | Ga0307515_10014894 | Ga0307515_100148948 | 224 |
| 164 | 3300028794 | Ga0307515_10144057 | Ga0307515_101440573 | 224 |
| 165 | 3300031456 | Ga0307513_10019952 | Ga0307513_100199522 | 224 |
| 166 | 3300031824 | Ga0307413_10606630 | Ga0307413_106066301 | 224 |
| 167 | 3300033180 | Ga0307510_10001817 | Ga0307510_1000181716 | 224 |
| 168 | 3300035171 | Ga0373946_0093539 | Ga0373946_0093539_430_1128 | 224 |
| 169 | 3300035691 | Ga0373931_0132866 | Ga0373931_0132866_196_885 | 224 |
| 170 | 3300037068 | Ga0373925_0409372 | Ga0373925_0409372_407_1096 | 224 |
| 171 | 3300041459 | Ga0451800_1601736 | Ga0451800_1601736_112_786 | 224 |
| 172 | 3300041463 | Ga0451804_0244073 | Ga0451804_0244073_224_898 | 224 |
| 173 | 3300042876 | Ga0451577_0010640 | Ga0451577_0010640_6218_6910 | 224 |
| 174 | 3300042876 | Ga0451577_0109276 | Ga0451577_0109276_609_1283 | 224 |
| 175 | 3300044694 | Ga0466963_0260644 | Ga0466963_0260644_70_756 | 224 |
| 176 | 3300044712 | Ga0453684_0649690 | Ga0453684_0649690_189_881 | 224 |
| 177 | 3300044842 | Ga0466957_0117145 | Ga0466957_0117145_887_1573 | 224 |
| 178 | 3300045051 | Ga0451576_0292348 | Ga0451576_0292348_668_1342 | 224 |
| 179 | 3300045051 | Ga0451576_0624441 | Ga0451576_0624441_319_1047 | 224 |
| 180 | 3300046492 | Ga0495585_0027045 | Ga0495585_0027045_482_1168 | 224 |
| 181 | 3300046507 | Ga0495606_0095178 | Ga0495606_0095178_31_717 | 224 |
| 182 | 3300046507 | Ga0495606_0146821 | Ga0495606_0146821_645_1319 | 224 |
| 183 | 3300046616 | Ga0495668_0032904 | Ga0495668_0032904_865_1551 | 224 |
| 184 | 3300047472 | Ga0495686_0004536 | Ga0495686_0004536_8515_9207 | 224 |
| 185 | 3300050496 | nmdc:mga07m45_56749_c1 | nmdc:mga07m45_56749_c1_1262_1957 | 224 |
| 186 | 3300053117 | Ga0500593_147974 | Ga0500593_147974_196_870 | 224 |
| 187 | 3300002705 | JGI25156J39149_1009411 | JGI25156J39149_10094113 | 225 |
| 188 | 3300003215 | JGI25153J46596_10000372 | JGI25153J46596_1000037220 | 225 |
| 189 | 3300003215 | JGI25153J46596_10000699 | JGI25153J46596_100006997 | 225 |
| 190 | 3300003761 | Ga0055535_1000098 | Ga0055535_100009883 | 225 |
| 191 | 3300003763 | Ga0055529_1000143 | Ga0055529_10001438 | 225 |
| 192 | 3300003771 | Ga0055526_1005640 | Ga0055526_10056402 | 225 |
| 193 | 3300003792 | Ga0055540_1009952 | Ga0055540_10099522 | 225 |
| 194 | 3300005262 | Ga0065165_1004009 | Ga0065165_10040097 | 225 |
| 195 | 3300005548 | Ga0070665_100049986 | Ga0070665_1000499863 | 225 |
| 196 | 3300005841 | Ga0068863_100027398 | Ga0068863_1000273983 | 225 |
| 197 | 3300006178 | Ga0075367_10006549 | Ga0075367_100065494 | 225 |
| 198 | 3300006195 | Ga0075366_10010537 | Ga0075366_100105376 | 225 |
| 199 | 3300006195 | Ga0075366_10010792 | Ga0075366_100107925 | 225 |
| 200 | 3300006353 | Ga0075370_10005964 | Ga0075370_100059643 | 225 |
| 201 | 3300006353 | Ga0075370_10032738 | Ga0075370_100327382 | 225 |
| 202 | 3300006358 | Ga0068871_100109101 | Ga0068871_1001091011 | 225 |
| 203 | 3300006880 | Ga0075429_100002105 | Ga0075429_10000210516 | 225 |
| 204 | 3300009098 | Ga0105245_10221090 | Ga0105245_102210902 | 225 |
| 205 | 3300009545 | Ga0105237_10557436 | Ga0105237_105574362 | 225 |
| 206 | 3300013297 | Ga0157378_10458511 | Ga0157378_104585112 | 225 |
| 207 | 3300014325 | Ga0163163_10446821 | Ga0163163_104468212 | 225 |
| 208 | 3300014968 | Ga0157379_10042908 | Ga0157379_100429084 | 225 |
| 209 | 3300014969 | Ga0157376_10459278 | Ga0157376_104592782 | 225 |
| 210 | 3300025242 | Ga0209258_100202 | Ga0209258_1002029 | 225 |
| 211 | 3300025245 | Ga0207425_1000717 | Ga0207425_10007174 | 225 |
| 212 | 3300025254 | Ga0209148_1004607 | Ga0209148_10046074 | 225 |
| 213 | 3300025256 | Ga0209759_1000427 | Ga0209759_100042741 | 225 |
| 214 | 3300025258 | Ga0209129_1000185 | Ga0209129_100018531 | 225 |
| 215 | 3300025258 | Ga0209129_1020044 | Ga0209129_10200441 | 225 |
| 216 | 3300025272 | Ga0209455_1000181 | Ga0209455_10001819 | 225 |
| 217 | 3300025273 | Ga0209673_1005894 | Ga0209673_10058945 | 225 |
| 218 | 3300025295 | Ga0209564_1000349 | Ga0209564_100034931 | 225 |
| 219 | 3300025297 | Ga0209758_1000339 | Ga0209758_100033950 | 225 |
| 220 | 3300025297 | Ga0209758_1001209 | Ga0209758_100120919 | 225 |
| 221 | 3300025298 | Ga0209050_1000357 | Ga0209050_100035788 | 225 |
| 222 | 3300025299 | Ga0209256_1013854 | Ga0209256_10138542 | 225 |
| 223 | 3300025303 | Ga0209051_1002249 | Ga0209051_100224912 | 225 |
| 224 | 3300025931 | Ga0207644_10047378 | Ga0207644_100473782 | 225 |
| 225 | 3300026088 | Ga0207641_10114800 | Ga0207641_101148003 | 225 |
| 226 | 3300026095 | Ga0207676_10014988 | Ga0207676_100149883 | 225 |
| 227 | 3300026121 | Ga0207683_10696260 | Ga0207683_106962601 | 225 |
| 228 | 3300027876 | Ga0209974_10025020 | Ga0209974_100250202 | 225 |
| 229 | 3300028379 | Ga0268266_10013661 | Ga0268266_100136619 | 225 |
| 230 | 3300028666 | Ga0265336_10000556 | Ga0265336_1000055612 | 225 |
| 231 | 3300028794 | Ga0307515_10018130 | Ga0307515_100181305 | 225 |
| 232 | 3300029957 | Ga0265324_10006457 | Ga0265324_100064574 | 225 |
| 233 | 3300030522 | Ga0307512_10056018 | Ga0307512_100560183 | 225 |
| 234 | 3300030522 | Ga0307512_10202173 | Ga0307512_102021732 | 225 |
| 235 | 3300031456 | Ga0307513_10363045 | Ga0307513_103630451 | 225 |
| 236 | 3300031507 | Ga0307509_10001003 | Ga0307509_100010035 | 225 |
| 237 | 3300031507 | Ga0307509_10001647 | Ga0307509_1000164718 | 225 |
| 238 | 3300031507 | Ga0307509_10029240 | Ga0307509_100292402 | 225 |
| 239 | 3300031507 | Ga0307509_10052681 | Ga0307509_100526812 | 225 |
| 240 | 3300031616 | Ga0307508_10000028 | Ga0307508_1000002891 | 225 |
| 241 | 3300031616 | Ga0307508_10001377 | Ga0307508_1000137712 | 225 |
| 242 | 3300031649 | Ga0307514_10084421 | Ga0307514_100844213 | 225 |
| 243 | 3300031911 | Ga0307412_10561092 | Ga0307412_105610922 | 225 |
| 244 | 3300033180 | Ga0307510_10025655 | Ga0307510_100256555 | 225 |
| 245 | 3300033180 | Ga0307510_10033774 | Ga0307510_100337744 | 225 |
| 246 | 3300036401 | Ga0373937_0030441 | Ga0373937_0030441_1705_2382 | 225 |
| 247 | 3300041453 | Ga0451797_1056911 | Ga0451797_1056911_70_747 | 225 |
| 248 | 3300041458 | Ga0451798_0835857 | Ga0451798_0835857_62_739 | 225 |
| 249 | 3300044712 | Ga0453684_0027068 | Ga0453684_0027068_4472_5149 | 225 |
| 250 | 3300044712 | Ga0453684_0344616 | Ga0453684_0344616_739_1416 | 225 |
| 251 | 3300044735 | Ga0466968_0020050 | Ga0466968_0020050_695_1390 | 225 |
| 252 | 3300045051 | Ga0451576_0102995 | Ga0451576_0102995_1626_2309 | 225 |
| 253 | 3300046454 | Ga0495592_0000734 | Ga0495592_0000734_1208_1906 | 225 |
| 254 | 3300046460 | Ga0495638_0272965 | Ga0495638_0272965_78_755 | 225 |
| 255 | 3300046511 | Ga0495608_0373996 | Ga0495608_0373996_39_731 | 225 |
| 256 | 3300046519 | Ga0495632_0001700 | Ga0495632_0001700_861_1538 | 225 |
| 257 | 3300046519 | Ga0495632_0054120 | Ga0495632_0054120_167_859 | 225 |
| 258 | 3300046524 | Ga0495648_0264694 | Ga0495648_0264694_19_711 | 225 |
| 259 | 3300046616 | Ga0495668_0117584 | Ga0495668_0117584_195_872 | 225 |
| 260 | 3300046683 | Ga0495658_0096932 | Ga0495658_0096932_1025_1717 | 225 |
| 261 | 3300047321 | Ga0495676_0101914 | Ga0495676_0101914_755_1447 | 225 |
| 262 | 3300047472 | Ga0495686_0088778 | Ga0495686_0088778_672_1364 | 225 |
| 263 | 3300048905 | Ga0496102_0001760 | Ga0496102_0001760_7509_8186 | 225 |
| 264 | 3300048909 | Ga0496106_0401041 | Ga0496106_0401041_161_838 | 225 |
| 265 | 3300048917 | Ga0496114_0000554 | Ga0496114_0000554_19783_20460 | 225 |
| 266 | 3300049682 | Ga0501252_006255 | Ga0501252_006255_316_993 | 225 |
| 267 | 3300050489 | nmdc:mga03683_11731_c1 | nmdc:mga03683_11731_c1_918_1598 | 225 |
| 268 | 3300050489 | nmdc:mga03683_259784_c1 | nmdc:mga03683_259784_c1_44_721 | 225 |
| 269 | 3300050493 | nmdc:mga0k408_10919_c1 | nmdc:mga0k408_10919_c1_2672_3349 | 225 |
| 270 | 3300050493 | nmdc:mga0k408_25834_c1 | nmdc:mga0k408_25834_c1_326_1003 | 225 |
| 271 | 3300050493 | nmdc:mga0k408_2752_c1 | nmdc:mga0k408_2752_c1_3053_3733 | 225 |
| 272 | 3300050496 | nmdc:mga07m45_152709_c1 | nmdc:mga07m45_152709_c1_41_733 | 225 |
| 273 | 3300050496 | nmdc:mga07m45_20211_c1 | nmdc:mga07m45_20211_c1_1039_1716 | 225 |
| 274 | 3300050508 | nmdc:mga09592_28582_c1 | nmdc:mga09592_28582_c1_1815_2495 | 225 |
| 275 | 3300050509 | nmdc:mga0qj67_131048_c1 | nmdc:mga0qj67_131048_c1_134_814 | 225 |
| 276 | 3300053086 | Ga0500578_0000311 | Ga0500578_0000311_55142_55819 | 225 |
| 277 | 3300053088 | Ga0500644_0072836 | Ga0500644_0072836_376_1074 | 225 |
| 278 | 3300053090 | Ga0500646_0003723 | Ga0500646_0003723_220_897 | 225 |
| 279 | 3300053092 | Ga0500583_0024103 | Ga0500583_0024103_1611_2303 | 225 |
| 280 | 3300053092 | Ga0500583_0208174 | Ga0500583_0208174_195_872 | 225 |
| 281 | 3300053093 | Ga0500651_0026946 | Ga0500651_0026946_2181_2858 | 225 |
| 282 | 3300053093 | Ga0500651_0117260 | Ga0500651_0117260_250_948 | 225 |
| 283 | 3300053098 | Ga0500650_0028900 | Ga0500650_0028900_190_867 | 225 |
| 284 | 3300053109 | Ga0500569_090657 | Ga0500569_090657_37_714 | 225 |
| 285 | 3300053118 | Ga0500594_0001185 | Ga0500594_0001185_2298_2996 | 225 |
| 286 | 3300053123 | Ga0500614_022515 | Ga0500614_022515_35_733 | 225 |
| 287 | 3300053130 | Ga0500642_0002755 | Ga0500642_0002755_2049_2726 | 225 |
| 288 | 3300053131 | Ga0500652_000663 | Ga0500652_000663_3750_4427 | 225 |
| 289 | 3300053133 | Ga0500655_010539 | Ga0500655_010539_208_885 | 225 |
| 290 | 3300053136 | Ga0500559_0000133 | Ga0500559_0000133_12216_12914 | 225 |
| 291 | 3300053139 | Ga0500568_0017650 | Ga0500568_0017650_629_1306 | 225 |
| 292 | 3300053139 | Ga0500568_0046502 | Ga0500568_0046502_602_1300 | 225 |
| 293 | 3300053142 | Ga0500577_0019302 | Ga0500577_0019302_818_1495 | 225 |
| 294 | 3300053148 | Ga0500590_005138 | Ga0500590_005138_1926_2615 | 225 |
| 295 | 3300053154 | Ga0500619_036256 | Ga0500619_036256_113_811 | 225 |
| 296 | 3300053156 | Ga0500622_0000307 | Ga0500622_0000307_41977_42654 | 225 |
| 297 | 3300053156 | Ga0500622_0011091 | Ga0500622_0011091_3487_4185 | 225 |
| 298 | 3300053156 | Ga0500622_0111327 | Ga0500622_0111327_504_1181 | 225 |
| 299 | 3300053177 | Ga0500636_0044245 | Ga0500636_0044245_1582_2280 | 225 |
| 300 | 3300053724 | Ga0500570_129469 | Ga0500570_129469_151_828 | 225 |
| 301 | 3300053739 | Ga0500587_005972 | Ga0500587_005972_159_857 | 225 |
| 302 | 3300002738 | JGI25154J39366_1002401 | JGI25154J39366_10024012 | 226 |
| 303 | 3300002741 | JGI25157J39369_1000192 | JGI25157J39369_100019212 | 226 |
| 304 | 3300003316 | rootH1_10013103 | rootH1_100131036 | 226 |
| 305 | 3300003320 | rootH2_10039876 | rootH2_100398762 | 226 |
| 306 | 3300003323 | rootH1_10061484 | rootH1_100614842 | 226 |
| 307 | 3300005327 | Ga0070658_10107688 | Ga0070658_101076882 | 226 |
| 308 | 3300005338 | Ga0068868_100405159 | Ga0068868_1004051592 | 226 |
| 309 | 3300005339 | Ga0070660_100138820 | Ga0070660_1001388202 | 226 |
| 310 | 3300005364 | Ga0070673_100113674 | Ga0070673_1001136743 | 226 |
| 311 | 3300005365 | Ga0070688_100137898 | Ga0070688_1001378982 | 226 |
| 312 | 3300005366 | Ga0070659_100128068 | Ga0070659_1001280683 | 226 |
| 313 | 3300005367 | Ga0070667_100501443 | Ga0070667_1005014432 | 226 |
| 314 | 3300005456 | Ga0070678_100127087 | Ga0070678_1001270872 | 226 |
| 315 | 3300005467 | Ga0070706_100003188 | Ga0070706_10000318811 | 226 |
| 316 | 3300005468 | Ga0070707_100110514 | Ga0070707_1001105143 | 226 |
| 317 | 3300005471 | Ga0070698_100036226 | Ga0070698_1000362264 | 226 |
| 318 | 3300005535 | Ga0070684_100203446 | Ga0070684_1002034461 | 226 |
| 319 | 3300005539 | Ga0068853_100206676 | Ga0068853_1002066762 | 226 |
| 320 | 3300005563 | Ga0068855_100009714 | Ga0068855_10000971413 | 226 |
| 321 | 3300005577 | Ga0068857_100003374 | Ga0068857_10000337416 | 226 |
| 322 | 3300005578 | Ga0068854_100027116 | Ga0068854_1000271162 | 226 |
| 323 | 3300005614 | Ga0068856_100002916 | Ga0068856_10000291614 | 226 |
| 324 | 3300005616 | Ga0068852_100054632 | Ga0068852_1000546325 | 226 |
| 325 | 3300005843 | Ga0068860_100743685 | Ga0068860_1007436852 | 226 |
| 326 | 3300006042 | Ga0075368_10071519 | Ga0075368_100715192 | 226 |
| 327 | 3300006195 | Ga0075366_10028467 | Ga0075366_100284672 | 226 |
| 328 | 3300006195 | Ga0075366_10043913 | Ga0075366_100439132 | 226 |
| 329 | 3300006353 | Ga0075370_10011503 | Ga0075370_100115032 | 226 |
| 330 | 3300006358 | Ga0068871_100353045 | Ga0068871_1003530452 | 226 |
| 331 | 3300009093 | Ga0105240_10236407 | Ga0105240_102364072 | 226 |
| 332 | 3300009148 | Ga0105243_10099110 | Ga0105243_100991102 | 226 |
| 333 | 3300009174 | Ga0105241_10039332 | Ga0105241_100393323 | 226 |
| 334 | 3300009545 | Ga0105237_10208900 | Ga0105237_102089002 | 226 |
| 335 | 3300009551 | Ga0105238_10148910 | Ga0105238_101489102 | 226 |
| 336 | 3300010375 | Ga0105239_10249173 | Ga0105239_102491732 | 226 |
| 337 | 3300011119 | Ga0105246_10612925 | Ga0105246_106129252 | 226 |
| 338 | 3300013105 | Ga0157369_10021757 | Ga0157369_100217572 | 226 |
| 339 | 3300014745 | Ga0157377_10490916 | Ga0157377_104909161 | 226 |
| 340 | 3300015262 | Ga0182007_10014416 | Ga0182007_100144164 | 226 |
| 341 | 3300021361 | Ga0213872_10000318 | Ga0213872_1000031821 | 226 |
| 342 | 3300025231 | Ga0207427_100611 | Ga0207427_10061115 | 226 |
| 343 | 3300025242 | Ga0209258_100941 | Ga0209258_10094110 | 226 |
| 344 | 3300025246 | Ga0209646_1000258 | Ga0209646_100025812 | 226 |
| 345 | 3300025250 | Ga0209026_1000011 | Ga0209026_1000011440 | 226 |
| 346 | 3300025253 | Ga0209677_100633 | Ga0209677_10063317 | 226 |
| 347 | 3300025256 | Ga0209759_1000034 | Ga0209759_100003436 | 226 |
| 348 | 3300025256 | Ga0209759_1000900 | Ga0209759_100090014 | 226 |
| 349 | 3300025910 | Ga0207684_10004160 | Ga0207684_100041604 | 226 |
| 350 | 3300025911 | Ga0207654_10071738 | Ga0207654_100717382 | 226 |
| 351 | 3300025913 | Ga0207695_10005833 | Ga0207695_100058332 | 226 |
| 352 | 3300025913 | Ga0207695_10069686 | Ga0207695_100696862 | 226 |
| 353 | 3300025919 | Ga0207657_10194781 | Ga0207657_101947812 | 226 |
| 354 | 3300025921 | Ga0207652_10147881 | Ga0207652_101478812 | 226 |
| 355 | 3300025924 | Ga0207694_10137055 | Ga0207694_101370552 | 226 |
| 356 | 3300025927 | Ga0207687_10597826 | Ga0207687_105978262 | 226 |
| 357 | 3300025934 | Ga0207686_10120723 | Ga0207686_101207232 | 226 |
| 358 | 3300025942 | Ga0207689_10079217 | Ga0207689_100792171 | 226 |
| 359 | 3300025949 | Ga0207667_10004262 | Ga0207667_1000426218 | 226 |
| 360 | 3300025960 | Ga0207651_10039143 | Ga0207651_100391434 | 226 |
| 361 | 3300025981 | Ga0207640_10006820 | Ga0207640_100068204 | 226 |
| 362 | 3300026023 | Ga0207677_10329585 | Ga0207677_103295852 | 226 |
| 363 | 3300026078 | Ga0207702_10002432 | Ga0207702_1000243214 | 226 |
| 364 | 3300026116 | Ga0207674_10014124 | Ga0207674_100141243 | 226 |
| 365 | 3300026118 | Ga0207675_100049790 | Ga0207675_1000497905 | 226 |
| 366 | 3300026121 | Ga0207683_10078252 | Ga0207683_100782522 | 226 |
| 367 | 3300027866 | Ga0209813_10003672 | Ga0209813_100036722 | 226 |
| 368 | 3300031824 | Ga0307413_10530766 | Ga0307413_105307662 | 226 |
| 369 | 3300035691 | Ga0373931_0080247 | Ga0373931_0080247_336_1028 | 226 |
| 370 | 3300037312 | Ga0395899_0479437 | Ga0395899_0479437_14_706 | 226 |
| 371 | 3300037466 | Ga0395898_0513608 | Ga0395898_0513608_289_981 | 226 |
| 372 | 3300037471 | Ga0395905_0448879 | Ga0395905_0448879_301_993 | 226 |
| 373 | 3300039447 | Ga0436361_0781207 | Ga0436361_0781207_7006_7713 | 226 |
| 374 | 3300044658 | Ga0466972_0005822 | Ga0466972_0005822_3090_3773 | 226 |
| 375 | 3300044683 | Ga0466965_0095387 | Ga0466965_0095387_381_1064 | 226 |
| 376 | 3300046471 | Ga0495650_0021380 | Ga0495650_0021380_1052_1744 | 226 |
| 377 | 3300047472 | Ga0495686_0005275 | Ga0495686_0005275_539_1231 | 226 |
| 378 | 3300050493 | nmdc:mga0k408_27122_c2 | nmdc:mga0k408_27122_c2_1828_2520 | 226 |
| 379 | 3300050494 | nmdc:mga06z11_18752_c1 | nmdc:mga06z11_18752_c1_374_1060 | 226 |
| 380 | 3300050495 | nmdc:mga04h51_106307_c1 | nmdc:mga04h51_106307_c1_83_769 | 226 |
| 381 | 3300050496 | nmdc:mga07m45_22669_c1 | nmdc:mga07m45_22669_c1_2242_2934 | 226 |
| 382 | 3300053080 | Ga0500635_0000029 | Ga0500635_0000029_30280_30975 | 226 |
| 383 | 3300003756 | Ga0055533_1000045 | Ga0055533_1000045167 | 227 |
| 384 | 3300003759 | Ga0055525_1000651 | Ga0055525_10006518 | 227 |
| 385 | 3300003775 | Ga0055524_1000160 | Ga0055524_100016072 | 227 |
| 386 | 3300003775 | Ga0055524_1000950 | Ga0055524_10009507 | 227 |
| 387 | 3300003791 | Ga0055530_10003900 | Ga0055530_100039005 | 227 |
| 388 | 3300003792 | Ga0055540_1000280 | Ga0055540_100028017 | 227 |
| 389 | 3300003794 | Ga0055531_10002844 | Ga0055531_100028444 | 227 |
| 390 | 3300005293 | Ga0065715_10147911 | Ga0065715_101479112 | 227 |
| 391 | 3300005328 | Ga0070676_10014014 | Ga0070676_100140142 | 227 |
| 392 | 3300005328 | Ga0070676_10128991 | Ga0070676_101289912 | 227 |
| 393 | 3300005329 | Ga0070683_100034533 | Ga0070683_1000345334 | 227 |
| 394 | 3300005331 | Ga0070670_100030882 | Ga0070670_1000308822 | 227 |
| 395 | 3300005331 | Ga0070670_100254154 | Ga0070670_1002541542 | 227 |
| 396 | 3300005333 | Ga0070677_10000759 | Ga0070677_100007597 | 227 |
| 397 | 3300005334 | Ga0068869_100008007 | Ga0068869_1000080072 | 227 |
| 398 | 3300005336 | Ga0070680_100033882 | Ga0070680_1000338824 | 227 |
| 399 | 3300005338 | Ga0068868_100059605 | Ga0068868_1000596053 | 227 |
| 400 | 3300005339 | Ga0070660_100022340 | Ga0070660_1000223403 | 227 |
| 401 | 3300005339 | Ga0070660_100031686 | Ga0070660_1000316862 | 227 |
| 402 | 3300005340 | Ga0070689_100204952 | Ga0070689_1002049521 | 227 |
| 403 | 3300005343 | Ga0070687_100028705 | Ga0070687_1000287052 | 227 |
| 404 | 3300005344 | Ga0070661_100001313 | Ga0070661_10000131312 | 227 |
| 405 | 3300005344 | Ga0070661_100076006 | Ga0070661_1000760063 | 227 |
| 406 | 3300005344 | Ga0070661_100127022 | Ga0070661_1001270222 | 227 |
| 407 | 3300005347 | Ga0070668_100062512 | Ga0070668_1000625123 | 227 |
| 408 | 3300005353 | Ga0070669_100028795 | Ga0070669_1000287953 | 227 |
| 409 | 3300005354 | Ga0070675_100000818 | Ga0070675_1000008188 | 227 |
| 410 | 3300005354 | Ga0070675_100030054 | Ga0070675_1000300542 | 227 |
| 411 | 3300005354 | Ga0070675_100182009 | Ga0070675_1001820092 | 227 |
| 412 | 3300005355 | Ga0070671_100003782 | Ga0070671_1000037824 | 227 |
| 413 | 3300005355 | Ga0070671_100249870 | Ga0070671_1002498702 | 227 |
| 414 | 3300005355 | Ga0070671_100262645 | Ga0070671_1002626452 | 227 |
| 415 | 3300005356 | Ga0070674_100025932 | Ga0070674_1000259324 | 227 |
| 416 | 3300005364 | Ga0070673_100129097 | Ga0070673_1001290972 | 227 |
| 417 | 3300005365 | Ga0070688_100433881 | Ga0070688_1004338812 | 227 |
| 418 | 3300005366 | Ga0070659_100000505 | Ga0070659_10000050513 | 227 |
| 419 | 3300005366 | Ga0070659_100031327 | Ga0070659_1000313272 | 227 |
| 420 | 3300005366 | Ga0070659_100123333 | Ga0070659_1001233332 | 227 |
| 421 | 3300005366 | Ga0070659_100456570 | Ga0070659_1004565702 | 227 |
| 422 | 3300005367 | Ga0070667_100004788 | Ga0070667_10000478811 | 227 |
| 423 | 3300005367 | Ga0070667_100079621 | Ga0070667_1000796212 | 227 |
| 424 | 3300005455 | Ga0070663_100039279 | Ga0070663_1000392792 | 227 |
| 425 | 3300005456 | Ga0070678_100002094 | Ga0070678_1000020946 | 227 |
| 426 | 3300005456 | Ga0070678_100003402 | Ga0070678_1000034024 | 227 |
| 427 | 3300005459 | Ga0068867_100705789 | Ga0068867_1007057891 | 227 |
| 428 | 3300005530 | Ga0070679_100015678 | Ga0070679_1000156783 | 227 |
| 429 | 3300005535 | Ga0070684_100035060 | Ga0070684_1000350602 | 227 |
| 430 | 3300005535 | Ga0070684_100342907 | Ga0070684_1003429072 | 227 |
| 431 | 3300005539 | Ga0068853_100047481 | Ga0068853_1000474813 | 227 |
| 432 | 3300005543 | Ga0070672_100002951 | Ga0070672_1000029517 | 227 |
| 433 | 3300005543 | Ga0070672_100088865 | Ga0070672_1000888652 | 227 |
| 434 | 3300005543 | Ga0070672_100105092 | Ga0070672_1001050922 | 227 |
| 435 | 3300005547 | Ga0070693_100009780 | Ga0070693_1000097802 | 227 |
| 436 | 3300005547 | Ga0070693_100077070 | Ga0070693_1000770702 | 227 |
| 437 | 3300005548 | Ga0070665_100629731 | Ga0070665_1006297312 | 227 |
| 438 | 3300005564 | Ga0070664_100005281 | Ga0070664_1000052816 | 227 |
| 439 | 3300005564 | Ga0070664_100013261 | Ga0070664_1000132615 | 227 |
| 440 | 3300005564 | Ga0070664_100215014 | Ga0070664_1002150142 | 227 |
| 441 | 3300005577 | Ga0068857_100266420 | Ga0068857_1002664202 | 227 |
| 442 | 3300005578 | Ga0068854_100017645 | Ga0068854_1000176454 | 227 |
| 443 | 3300005614 | Ga0068856_100024316 | Ga0068856_1000243165 | 227 |
| 444 | 3300005614 | Ga0068856_100026468 | Ga0068856_1000264682 | 227 |
| 445 | 3300005615 | Ga0070702_100155912 | Ga0070702_1001559122 | 227 |
| 446 | 3300005615 | Ga0070702_100462975 | Ga0070702_1004629751 | 227 |
| 447 | 3300005616 | Ga0068852_100173764 | Ga0068852_1001737642 | 227 |
| 448 | 3300005617 | Ga0068859_100127837 | Ga0068859_1001278373 | 227 |
| 449 | 3300005618 | Ga0068864_100016598 | Ga0068864_1000165982 | 227 |
| 450 | 3300005618 | Ga0068864_100084658 | Ga0068864_1000846582 | 227 |
| 451 | 3300005719 | Ga0068861_100023609 | Ga0068861_1000236093 | 227 |
| 452 | 3300005834 | Ga0068851_10024199 | Ga0068851_100241992 | 227 |
| 453 | 3300005834 | Ga0068851_10039128 | Ga0068851_100391282 | 227 |
| 454 | 3300005834 | Ga0068851_10206479 | Ga0068851_102064792 | 227 |
| 455 | 3300005840 | Ga0068870_10063283 | Ga0068870_100632832 | 227 |
| 456 | 3300005841 | Ga0068863_100354863 | Ga0068863_1003548632 | 227 |
| 457 | 3300005842 | Ga0068858_100030332 | Ga0068858_1000303324 | 227 |
| 458 | 3300005843 | Ga0068860_100028345 | Ga0068860_1000283454 | 227 |
| 459 | 3300005843 | Ga0068860_100263404 | Ga0068860_1002634042 | 227 |
| 460 | 3300005844 | Ga0068862_100055835 | Ga0068862_1000558353 | 227 |
| 461 | 3300006237 | Ga0097621_100026939 | Ga0097621_1000269394 | 227 |
| 462 | 3300006237 | Ga0097621_100047802 | Ga0097621_1000478022 | 227 |
| 463 | 3300006237 | Ga0097621_100070853 | Ga0097621_1000708534 | 227 |
| 464 | 3300006358 | Ga0068871_100036870 | Ga0068871_1000368702 | 227 |
| 465 | 3300006358 | Ga0068871_100102167 | Ga0068871_1001021673 | 227 |
| 466 | 3300006358 | Ga0068871_100140856 | Ga0068871_1001408562 | 227 |
| 467 | 3300006358 | Ga0068871_100247924 | Ga0068871_1002479242 | 227 |
| 468 | 3300006358 | Ga0068871_100812235 | Ga0068871_1008122352 | 227 |
| 469 | 3300006881 | Ga0068865_100086682 | Ga0068865_1000866822 | 227 |
| 470 | 3300006931 | Ga0097620_100127837 | Ga0097620_1001278373 | 227 |
| 471 | 3300006946 | Ga0079104_1000053 | Ga0079104_1000053108 | 227 |
| 472 | 3300009098 | Ga0105245_10060858 | Ga0105245_100608582 | 227 |
| 473 | 3300009148 | Ga0105243_10093018 | Ga0105243_100930183 | 227 |
| 474 | 3300009177 | Ga0105248_10049549 | Ga0105248_100495492 | 227 |
| 475 | 3300009177 | Ga0105248_10220221 | Ga0105248_102202212 | 227 |
| 476 | 3300009177 | Ga0105248_10229301 | Ga0105248_102293012 | 227 |
| 477 | 3300009551 | Ga0105238_10034370 | Ga0105238_100343704 | 227 |
| 478 | 3300009551 | Ga0105238_10491394 | Ga0105238_104913941 | 227 |
| 479 | 3300009553 | Ga0105249_10027507 | Ga0105249_100275072 | 227 |
| 480 | 3300010375 | Ga0105239_10994595 | Ga0105239_109945952 | 227 |
| 481 | 3300013100 | Ga0157373_10057699 | Ga0157373_100576993 | 227 |
| 482 | 3300013100 | Ga0157373_10362906 | Ga0157373_103629062 | 227 |
| 483 | 3300013105 | Ga0157369_10351196 | Ga0157369_103511962 | 227 |
| 484 | 3300013296 | Ga0157374_10266447 | Ga0157374_102664472 | 227 |
| 485 | 3300013306 | Ga0163162_10001148 | Ga0163162_100011488 | 227 |
| 486 | 3300013307 | Ga0157372_10320684 | Ga0157372_103206842 | 227 |
| 487 | 3300013307 | Ga0157372_10441962 | Ga0157372_104419622 | 227 |
| 488 | 3300013308 | Ga0157375_10003901 | Ga0157375_100039018 | 227 |
| 489 | 3300013308 | Ga0157375_11358396 | Ga0157375_113583961 | 227 |
| 490 | 3300014326 | Ga0157380_10003166 | Ga0157380_100031665 | 227 |
| 491 | 3300014968 | Ga0157379_10005217 | Ga0157379_100052178 | 227 |
| 492 | 3300014968 | Ga0157379_10083586 | Ga0157379_100835863 | 227 |
| 493 | 3300014968 | Ga0157379_10115768 | Ga0157379_101157682 | 227 |
| 494 | 3300014968 | Ga0157379_10446499 | Ga0157379_104464991 | 227 |
| 495 | 3300014969 | Ga0157376_10054658 | Ga0157376_100546582 | 227 |
| 496 | 3300017792 | Ga0163161_10074083 | Ga0163161_100740833 | 227 |
| 497 | 3300025226 | Ga0209674_100073 | Ga0209674_100073167 | 227 |
| 498 | 3300025230 | Ga0209563_100061 | Ga0209563_10006163 | 227 |
| 499 | 3300025253 | Ga0209677_100120 | Ga0209677_10012024 | 227 |
| 500 | 3300025291 | Ga0209675_1004911 | Ga0209675_10049112 | 227 |
| 501 | 3300025298 | Ga0209050_1001841 | Ga0209050_10018415 | 227 |
| 502 | 3300025299 | Ga0209256_1000045 | Ga0209256_1000045145 | 227 |
| 503 | 3300025303 | Ga0209051_1000004 | Ga0209051_10000041054 | 227 |
| 504 | 3300025304 | Ga0209257_1000315 | Ga0209257_100031519 | 227 |
| 505 | 3300025315 | Ga0207697_10014102 | Ga0207697_100141021 | 227 |
| 506 | 3300025321 | Ga0207656_10006100 | Ga0207656_100061002 | 227 |
| 507 | 3300025321 | Ga0207656_10015084 | Ga0207656_100150843 | 227 |
| 508 | 3300025321 | Ga0207656_10119346 | Ga0207656_101193461 | 227 |
| 509 | 3300025893 | Ga0207682_10001172 | Ga0207682_100011725 | 227 |
| 510 | 3300025901 | Ga0207688_10058647 | Ga0207688_100586472 | 227 |
| 511 | 3300025901 | Ga0207688_10212655 | Ga0207688_102126552 | 227 |
| 512 | 3300025907 | Ga0207645_10008207 | Ga0207645_100082075 | 227 |
| 513 | 3300025908 | Ga0207643_10130470 | Ga0207643_101304702 | 227 |
| 514 | 3300025909 | Ga0207705_10125397 | Ga0207705_101253972 | 227 |
| 515 | 3300025909 | Ga0207705_10155318 | Ga0207705_101553182 | 227 |
| 516 | 3300025913 | Ga0207695_10492502 | Ga0207695_104925022 | 227 |
| 517 | 3300025917 | Ga0207660_10040424 | Ga0207660_100404242 | 227 |
| 518 | 3300025917 | Ga0207660_10426181 | Ga0207660_104261812 | 227 |
| 519 | 3300025918 | Ga0207662_10043314 | Ga0207662_100433142 | 227 |
| 520 | 3300025919 | Ga0207657_10026522 | Ga0207657_100265222 | 227 |
| 521 | 3300025919 | Ga0207657_10048270 | Ga0207657_100482704 | 227 |
| 522 | 3300025920 | Ga0207649_10003219 | Ga0207649_100032191 | 227 |
| 523 | 3300025920 | Ga0207649_10045734 | Ga0207649_100457343 | 227 |
| 524 | 3300025923 | Ga0207681_10003758 | Ga0207681_100037583 | 227 |
| 525 | 3300025923 | Ga0207681_10105650 | Ga0207681_101056502 | 227 |
| 526 | 3300025925 | Ga0207650_10001006 | Ga0207650_1000100619 | 227 |
| 527 | 3300025925 | Ga0207650_10006632 | Ga0207650_100066326 | 227 |
| 528 | 3300025925 | Ga0207650_10072259 | Ga0207650_100722593 | 227 |
| 529 | 3300025926 | Ga0207659_10001264 | Ga0207659_100012648 | 227 |
| 530 | 3300025931 | Ga0207644_10010359 | Ga0207644_100103594 | 227 |
| 531 | 3300025931 | Ga0207644_10058804 | Ga0207644_100588043 | 227 |
| 532 | 3300025931 | Ga0207644_10060948 | Ga0207644_100609483 | 227 |
| 533 | 3300025931 | Ga0207644_10086148 | Ga0207644_100861482 | 227 |
| 534 | 3300025932 | Ga0207690_10005140 | Ga0207690_100051402 | 227 |
| 535 | 3300025932 | Ga0207690_10101686 | Ga0207690_101016862 | 227 |
| 536 | 3300025933 | Ga0207706_10006354 | Ga0207706_100063544 | 227 |
| 537 | 3300025940 | Ga0207691_10005520 | Ga0207691_100055204 | 227 |
| 538 | 3300025940 | Ga0207691_10105709 | Ga0207691_101057092 | 227 |
| 539 | 3300025940 | Ga0207691_10133998 | Ga0207691_101339982 | 227 |
| 540 | 3300025941 | Ga0207711_10202331 | Ga0207711_102023312 | 227 |
| 541 | 3300025942 | Ga0207689_10000415 | Ga0207689_1000041521 | 227 |
| 542 | 3300025944 | Ga0207661_10188114 | Ga0207661_101881142 | 227 |
| 543 | 3300025945 | Ga0207679_10000863 | Ga0207679_100008634 | 227 |
| 544 | 3300025945 | Ga0207679_10040109 | Ga0207679_100401093 | 227 |
| 545 | 3300025945 | Ga0207679_10235186 | Ga0207679_102351862 | 227 |
| 546 | 3300025949 | Ga0207667_10071909 | Ga0207667_100719094 | 227 |
| 547 | 3300025960 | Ga0207651_10073631 | Ga0207651_100736312 | 227 |
| 548 | 3300025972 | Ga0207668_10023934 | Ga0207668_100239344 | 227 |
| 549 | 3300025972 | Ga0207668_10520400 | Ga0207668_105204001 | 227 |
| 550 | 3300025981 | Ga0207640_10291132 | Ga0207640_102911321 | 227 |
| 551 | 3300025986 | Ga0207658_10046494 | Ga0207658_100464943 | 227 |
| 552 | 3300025986 | Ga0207658_10244154 | Ga0207658_102441542 | 227 |
| 553 | 3300026035 | Ga0207703_10038758 | Ga0207703_100387583 | 227 |
| 554 | 3300026041 | Ga0207639_10183700 | Ga0207639_101837002 | 227 |
| 555 | 3300026041 | Ga0207639_10504839 | Ga0207639_105048391 | 227 |
| 556 | 3300026067 | Ga0207678_10048953 | Ga0207678_100489533 | 227 |
| 557 | 3300026067 | Ga0207678_10106729 | Ga0207678_101067292 | 227 |
| 558 | 3300026078 | Ga0207702_10044569 | Ga0207702_100445692 | 227 |
| 559 | 3300026078 | Ga0207702_10069777 | Ga0207702_100697774 | 227 |
| 560 | 3300026088 | Ga0207641_10153694 | Ga0207641_101536942 | 227 |
| 561 | 3300026095 | Ga0207676_10011359 | Ga0207676_100113595 | 227 |
| 562 | 3300026116 | Ga0207674_10104114 | Ga0207674_101041142 | 227 |
| 563 | 3300026116 | Ga0207674_10167295 | Ga0207674_101672952 | 227 |
| 564 | 3300026118 | Ga0207675_100000177 | Ga0207675_10000017743 | 227 |
| 565 | 3300026118 | Ga0207675_100072299 | Ga0207675_1000722992 | 227 |
| 566 | 3300026121 | Ga0207683_10005398 | Ga0207683_100053986 | 227 |
| 567 | 3300026121 | Ga0207683_10009410 | Ga0207683_100094104 | 227 |
| 568 | 3300026142 | Ga0207698_10240806 | Ga0207698_102408062 | 227 |
| 569 | 3300026142 | Ga0207698_10294526 | Ga0207698_102945262 | 227 |
| 570 | 3300027111 | Ga0209281_1000147 | Ga0209281_1000147108 | 227 |
| 571 | 3300027682 | Ga0209971_1066260 | Ga0209971_10662602 | 227 |
| 572 | 3300028379 | Ga0268266_10197823 | Ga0268266_101978232 | 227 |
| 573 | 3300028381 | Ga0268264_10028673 | Ga0268264_100286732 | 227 |
| 574 | 3300028381 | Ga0268264_10079473 | Ga0268264_100794733 | 227 |
| 575 | 3300028794 | Ga0307515_10010714 | Ga0307515_100107147 | 227 |
| 576 | 3300031548 | Ga0307408_100062879 | Ga0307408_1000628792 | 227 |
| 577 | 3300031731 | Ga0307405_10057608 | Ga0307405_100576082 | 227 |
| 578 | 3300031852 | Ga0307410_10227855 | Ga0307410_102278552 | 227 |
| 579 | 3300031901 | Ga0307406_10349285 | Ga0307406_103492852 | 227 |
| 580 | 3300031911 | Ga0307412_10427002 | Ga0307412_104270022 | 227 |
| 581 | 3300031911 | Ga0307412_10671413 | Ga0307412_106714132 | 227 |
| 582 | 3300031995 | Ga0307409_100000528 | Ga0307409_10000052818 | 227 |
| 583 | 3300032002 | Ga0307416_100002866 | Ga0307416_10000286611 | 227 |
| 584 | 3300032004 | Ga0307414_10136911 | Ga0307414_101369112 | 227 |
| 585 | 3300032005 | Ga0307411_10054197 | Ga0307411_100541972 | 227 |
| 586 | 3300032126 | Ga0307415_100000956 | Ga0307415_10000095613 | 227 |
| 587 | 3300035117 | Ga0373953_0069024 | Ga0373953_0069024_327_1031 | 227 |
| 588 | 3300035172 | Ga0373955_0020437 | Ga0373955_0020437_2155_2859 | 227 |
| 589 | 3300035691 | Ga0373931_0055367 | Ga0373931_0055367_900_1625 | 227 |
| 590 | 3300035692 | Ga0373935_0086846 | Ga0373935_0086846_353_1057 | 227 |
| 591 | 3300035695 | Ga0373927_0099187 | Ga0373927_0099187_595_1299 | 227 |
| 592 | 3300035724 | Ga0373933_0244365 | Ga0373933_0244365_77_781 | 227 |
| 593 | 3300036401 | Ga0373937_0160248 | Ga0373937_0160248_948_1652 | 227 |
| 594 | 3300037068 | Ga0373925_0027592 | Ga0373925_0027592_2655_3359 | 227 |
| 595 | 3300037068 | Ga0373925_0198780 | Ga0373925_0198780_161_931 | 227 |
| 596 | 3300039450 | Ga0436363_0216572 | Ga0436363_0216572_2665_3369 | 227 |
| 597 | 3300046463 | Ga0495653_0364154 | Ga0495653_0364154_11_715 | 227 |
| 598 | 3300046507 | Ga0495606_0012250 | Ga0495606_0012250_5927_6628 | 227 |
| 599 | 3300046511 | Ga0495608_0076717 | Ga0495608_0076717_57_761 | 227 |
| 600 | 3300046524 | Ga0495648_0226971 | Ga0495648_0226971_51_752 | 227 |
| 601 | 3300046615 | Ga0495656_0092430 | Ga0495656_0092430_516_1220 | 227 |
| 602 | 3300046616 | Ga0495668_0013457 | Ga0495668_0013457_562_1263 | 227 |
| 603 | 3300046663 | Ga0495635_0064949 | Ga0495635_0064949_1016_1720 | 227 |
| 604 | 3300046678 | Ga0495599_0442488 | Ga0495599_0442488_35_739 | 227 |
| 605 | 3300046680 | Ga0495646_0096867 | Ga0495646_0096867_676_1389 | 227 |
| 606 | 3300046683 | Ga0495658_0109957 | Ga0495658_0109957_204_908 | 227 |
| 607 | 3300046684 | Ga0495669_0023944 | Ga0495669_0023944_1089_1790 | 227 |
| 608 | 3300046692 | Ga0495671_0111242 | Ga0495671_0111242_157_864 | 227 |
| 609 | 3300046694 | Ga0495649_0000180 | Ga0495649_0000180_21196_21897 | 227 |
| 610 | 3300046794 | Ga0495589_0075751 | Ga0495589_0075751_84_785 | 227 |
| 611 | 3300047322 | Ga0495680_0096673 | Ga0495680_0096673_1197_1901 | 227 |
| 612 | 3300047472 | Ga0495686_0083867 | Ga0495686_0083867_656_1354 | 227 |
| 613 | 3300048905 | Ga0496102_0569758 | Ga0496102_0569758_192_917 | 227 |
| 614 | 3300048907 | Ga0496104_0107765 | Ga0496104_0107765_1901_2626 | 227 |
| 615 | 3300048908 | Ga0496105_0466008 | Ga0496105_0466008_227_931 | 227 |
| 616 | 3300048909 | Ga0496106_0141839 | Ga0496106_0141839_797_1495 | 227 |
| 617 | 3300048911 | Ga0496108_0285627 | Ga0496108_0285627_65_790 | 227 |
| 618 | 3300048912 | Ga0496109_0360169 | Ga0496109_0360169_179_883 | 227 |
| 619 | 3300048913 | Ga0496110_0128718 | Ga0496110_0128718_833_1558 | 227 |
| 620 | 3300048915 | Ga0496112_0539277 | Ga0496112_0539277_64_762 | 227 |
| 621 | 3300050493 | nmdc:mga0k408_86274_c1 | nmdc:mga0k408_86274_c1_178_861 | 227 |
| 622 | 3300050511 | nmdc:mga08y16_558075_c1 | nmdc:mga08y16_558075_c1_85_810 | 227 |
| 623 | 3300053077 | Ga0495601_0058433 | Ga0495601_0058433_530_1234 | 227 |
| 624 | 3300053084 | Ga0495595_0015382 | Ga0495595_0015382_720_1424 | 227 |
| 625 | 3300053085 | Ga0495619_0045623 | Ga0495619_0045623_1531_2235 | 227 |
| 626 | 3300053086 | Ga0500578_0076324 | Ga0500578_0076324_505_1203 | 227 |
| 627 | 3300053122 | Ga0500608_123485 | Ga0500608_123485_179_880 | 227 |
| 628 | 3300053177 | Ga0500636_0049964 | Ga0500636_0049964_777_1478 | 227 |
| 629 | 3300053730 | Ga0500645_034488 | Ga0500645_034488_164_862 | 227 |
| 630 | 3300003316 | rootH1_10011472 | rootH1_100114725 | 228 |
| 631 | 3300003322 | rootL2_10000675 | rootL2_100006752 | 228 |
| 632 | 3300005328 | Ga0070676_10010008 | Ga0070676_100100082 | 228 |
| 633 | 3300005328 | Ga0070676_10169820 | Ga0070676_101698202 | 228 |
| 634 | 3300005334 | Ga0068869_100013610 | Ga0068869_1000136105 | 228 |
| 635 | 3300005335 | Ga0070666_10079620 | Ga0070666_100796202 | 228 |
| 636 | 3300005338 | Ga0068868_100047268 | Ga0068868_1000472684 | 228 |
| 637 | 3300005338 | Ga0068868_100125332 | Ga0068868_1001253322 | 228 |
| 638 | 3300005354 | Ga0070675_100090425 | Ga0070675_1000904252 | 228 |
| 639 | 3300005364 | Ga0070673_100107302 | Ga0070673_1001073023 | 228 |
| 640 | 3300005455 | Ga0070663_100019028 | Ga0070663_1000190283 | 228 |
| 641 | 3300005457 | Ga0070662_100002604 | Ga0070662_1000026047 | 228 |
| 642 | 3300005459 | Ga0068867_100021775 | Ga0068867_1000217752 | 228 |
| 643 | 3300005468 | Ga0070707_100882552 | Ga0070707_1008825521 | 228 |
| 644 | 3300005539 | Ga0068853_100600002 | Ga0068853_1006000022 | 228 |
| 645 | 3300005577 | Ga0068857_100027213 | Ga0068857_1000272134 | 228 |
| 646 | 3300005577 | Ga0068857_100187250 | Ga0068857_1001872502 | 228 |
| 647 | 3300005616 | Ga0068852_100009725 | Ga0068852_1000097252 | 228 |
| 648 | 3300005616 | Ga0068852_100030734 | Ga0068852_1000307344 | 228 |
| 649 | 3300005840 | Ga0068870_10216166 | Ga0068870_102161662 | 228 |
| 650 | 3300006042 | Ga0075368_10001585 | Ga0075368_100015857 | 228 |
| 651 | 3300006177 | Ga0075362_10004323 | Ga0075362_100043235 | 228 |
| 652 | 3300006177 | Ga0075362_10015052 | Ga0075362_100150523 | 228 |
| 653 | 3300006178 | Ga0075367_10006326 | Ga0075367_100063266 | 228 |
| 654 | 3300006178 | Ga0075367_10009705 | Ga0075367_100097055 | 228 |
| 655 | 3300006178 | Ga0075367_10065416 | Ga0075367_100654163 | 228 |
| 656 | 3300006186 | Ga0075369_10000429 | Ga0075369_100004293 | 228 |
| 657 | 3300006195 | Ga0075366_10006781 | Ga0075366_100067812 | 228 |
| 658 | 3300006353 | Ga0075370_10002430 | Ga0075370_100024305 | 228 |
| 659 | 3300006353 | Ga0075370_10033655 | Ga0075370_100336553 | 228 |
| 660 | 3300006353 | Ga0075370_10044344 | Ga0075370_100443442 | 228 |
| 661 | 3300006353 | Ga0075370_10065556 | Ga0075370_100655562 | 228 |
| 662 | 3300009093 | Ga0105240_10064095 | Ga0105240_100640953 | 228 |
| 663 | 3300009148 | Ga0105243_10011524 | Ga0105243_100115243 | 228 |
| 664 | 3300009174 | Ga0105241_10304265 | Ga0105241_103042652 | 228 |
| 665 | 3300009545 | Ga0105237_10129214 | Ga0105237_101292142 | 228 |
| 666 | 3300010375 | Ga0105239_10353583 | Ga0105239_103535832 | 228 |
| 667 | 3300011119 | Ga0105246_10548100 | Ga0105246_105481002 | 228 |
| 668 | 3300014745 | Ga0157377_10000132 | Ga0157377_1000013216 | 228 |
| 669 | 3300021361 | Ga0213872_10005163 | Ga0213872_100051633 | 228 |
| 670 | 3300021361 | Ga0213872_10095899 | Ga0213872_100958992 | 228 |
| 671 | 3300025907 | Ga0207645_10014430 | Ga0207645_100144305 | 228 |
| 672 | 3300025911 | Ga0207654_10368197 | Ga0207654_103681972 | 228 |
| 673 | 3300025914 | Ga0207671_10030236 | Ga0207671_100302364 | 228 |
| 674 | 3300025919 | Ga0207657_10535710 | Ga0207657_105357102 | 228 |
| 675 | 3300025922 | Ga0207646_10379050 | Ga0207646_103790502 | 228 |
| 676 | 3300025925 | Ga0207650_10599503 | Ga0207650_105995032 | 228 |
| 677 | 3300025926 | Ga0207659_10163835 | Ga0207659_101638352 | 228 |
| 678 | 3300025933 | Ga0207706_10000785 | Ga0207706_100007855 | 228 |
| 679 | 3300025933 | Ga0207706_10004957 | Ga0207706_1000495712 | 228 |
| 680 | 3300025935 | Ga0207709_10004700 | Ga0207709_1000470010 | 228 |
| 681 | 3300025938 | Ga0207704_10283536 | Ga0207704_102835362 | 228 |
| 682 | 3300025940 | Ga0207691_10006646 | Ga0207691_100066462 | 228 |
| 683 | 3300025942 | Ga0207689_10017327 | Ga0207689_100173274 | 228 |
| 684 | 3300025942 | Ga0207689_10176566 | Ga0207689_101765662 | 228 |
| 685 | 3300025960 | Ga0207651_10187737 | Ga0207651_101877372 | 228 |
| 686 | 3300026067 | Ga0207678_10016179 | Ga0207678_100161795 | 228 |
| 687 | 3300026089 | Ga0207648_10001573 | Ga0207648_1000157310 | 228 |
| 688 | 3300026089 | Ga0207648_10033577 | Ga0207648_100335775 | 228 |
| 689 | 3300026116 | Ga0207674_10025976 | Ga0207674_100259764 | 228 |
| 690 | 3300026116 | Ga0207674_10038054 | Ga0207674_100380544 | 228 |
| 691 | 3300026116 | Ga0207674_10642573 | Ga0207674_106425731 | 228 |
| 692 | 3300026118 | Ga0207675_100314949 | Ga0207675_1003149492 | 228 |
| 693 | 3300026142 | Ga0207698_10011410 | Ga0207698_100114102 | 228 |
| 694 | 3300026142 | Ga0207698_10873773 | Ga0207698_108737731 | 228 |
| 695 | 3300028794 | Ga0307515_10301318 | Ga0307515_103013182 | 228 |
| 696 | 3300031456 | Ga0307513_10035096 | Ga0307513_100350963 | 228 |
| 697 | 3300031730 | Ga0307516_10002006 | Ga0307516_1000200620 | 228 |
| 698 | 3300031730 | Ga0307516_10044489 | Ga0307516_100444893 | 228 |
| 699 | 3300037471 | Ga0395905_0314630 | Ga0395905_0314630_739_1425 | 228 |
| 700 | 3300039447 | Ga0436361_0237820 | Ga0436361_0237820_1671_2384 | 228 |
| 701 | 3300039447 | Ga0436361_0653054 | Ga0436361_0653054_4565_5278 | 228 |
| 702 | 3300042876 | Ga0451577_0007365 | Ga0451577_0007365_7559_8245 | 228 |
| 703 | 3300044658 | Ga0466972_0015489 | Ga0466972_0015489_251_940 | 228 |
| 704 | 3300044765 | Ga0466970_0098737 | Ga0466970_0098737_816_1505 | 228 |
| 705 | 3300044901 | Ga0466960_0151398 | Ga0466960_0151398_205_894 | 228 |
| 706 | 3300046474 | Ga0495605_0034108 | Ga0495605_0034108_1702_2394 | 228 |
| 707 | 3300046519 | Ga0495632_0017146 | Ga0495632_0017146_3282_3974 | 228 |
| 708 | 3300046522 | Ga0495643_0135091 | Ga0495643_0135091_277_972 | 228 |
| 709 | 3300046542 | Ga0495597_0003790 | Ga0495597_0003790_4517_5212 | 228 |
| 710 | 3300046616 | Ga0495668_0015696 | Ga0495668_0015696_425_1117 | 228 |
| 711 | 3300046648 | Ga0495611_0122273 | Ga0495611_0122273_240_932 | 228 |
| 712 | 3300046660 | Ga0495625_0269716 | Ga0495625_0269716_237_929 | 228 |
| 713 | 3300046694 | Ga0495649_0108683 | Ga0495649_0108683_608_1300 | 228 |
| 714 | 3300047443 | Ga0495687_000890 | Ga0495687_000890_10097_10792 | 228 |
| 715 | 3300047443 | Ga0495687_009019 | Ga0495687_009019_1778_2470 | 228 |
| 716 | 3300047443 | Ga0495687_014505 | Ga0495687_014505_1571_2263 | 228 |
| 717 | 3300047445 | Ga0495677_0093560 | Ga0495677_0093560_147_839 | 228 |
| 718 | 3300047469 | Ga0495673_0096905 | Ga0495673_0096905_469_1161 | 228 |
| 719 | 3300047472 | Ga0495686_0137862 | Ga0495686_0137862_634_1326 | 228 |
| 720 | 3300048091 | Ga0495626_0054419 | Ga0495626_0054419_1104_1796 | 228 |
| 721 | 3300048924 | Ga0496121_0010106 | Ga0496121_0010106_3294_3986 | 228 |
| 722 | 3300048927 | Ga0496124_0003631 | Ga0496124_0003631_3321_4019 | 228 |
| 723 | 3300048928 | Ga0496125_0012783 | Ga0496125_0012783_3242_3940 | 228 |
| 724 | 3300050489 | nmdc:mga03683_10708_c1 | nmdc:mga03683_10708_c1_2401_3096 | 228 |
| 725 | 3300050491 | nmdc:mga00v17_49418_c1 | nmdc:mga00v17_49418_c1_303_998 | 228 |
| 726 | 3300050491 | nmdc:mga00v17_97988_c1 | nmdc:mga00v17_97988_c1_643_1338 | 228 |
| 727 | 3300050492 | nmdc:mga0yw44_175847_c1 | nmdc:mga0yw44_175847_c1_149_844 | 228 |
| 728 | 3300050493 | nmdc:mga0k408_110914_c1 | nmdc:mga0k408_110914_c1_760_1455 | 228 |
| 729 | 3300050493 | nmdc:mga0k408_12173_c1 | nmdc:mga0k408_12173_c1_699_1391 | 228 |
| 730 | 3300050493 | nmdc:mga0k408_4953_c1 | nmdc:mga0k408_4953_c1_5678_6373 | 228 |
| 731 | 3300050493 | nmdc:mga0k408_75652_c2 | nmdc:mga0k408_75652_c2_287_982 | 228 |
| 732 | 3300050494 | nmdc:mga06z11_56308_c1 | nmdc:mga06z11_56308_c1_454_1146 | 228 |
| 733 | 3300050495 | nmdc:mga04h51_22799_c1 | nmdc:mga04h51_22799_c1_797_1492 | 228 |
| 734 | 3300050496 | nmdc:mga07m45_13723_c1 | nmdc:mga07m45_13723_c1_1272_1964 | 228 |
| 735 | 3300050496 | nmdc:mga07m45_1608_c1 | nmdc:mga07m45_1608_c1_2781_3473 | 228 |
| 736 | 3300050496 | nmdc:mga07m45_225796_c1 | nmdc:mga07m45_225796_c1_73_768 | 228 |
| 737 | 3300050496 | nmdc:mga07m45_25425_c1 | nmdc:mga07m45_25425_c1_1964_2656 | 228 |
| 738 | 3300050496 | nmdc:mga07m45_29719_c1 | nmdc:mga07m45_29719_c1_1253_1948 | 228 |
| 739 | 3300050516 | nmdc:mga0sz30_22155_c1 | nmdc:mga0sz30_22155_c1_1039_1734 | 228 |
| 740 | 3300053134 | Ga0500658_0002762 | Ga0500658_0002762_309_1001 | 228 |
| 741 | 3300053139 | Ga0500568_0009517 | Ga0500568_0009517_632_1324 | 228 |
| 742 | 3300001979 | JGI24740J21852_10022958 | JGI24740J21852_100229582 | 229 |
| 743 | 3300005563 | Ga0068855_100129349 | Ga0068855_1001293492 | 229 |
| 744 | 3300005616 | Ga0068852_100191114 | Ga0068852_1001911142 | 229 |
| 745 | 3300005834 | Ga0068851_10116026 | Ga0068851_101160262 | 229 |
| 746 | 3300009093 | Ga0105240_10072064 | Ga0105240_100720643 | 229 |
| 747 | 3300009174 | Ga0105241_10591764 | Ga0105241_105917642 | 229 |
| 748 | 3300009545 | Ga0105237_10018091 | Ga0105237_100180913 | 229 |
| 749 | 3300010375 | Ga0105239_10039921 | Ga0105239_100399213 | 229 |
| 750 | 3300014325 | Ga0163163_10501588 | Ga0163163_105015882 | 229 |
| 751 | 3300025321 | Ga0207656_10078023 | Ga0207656_100780232 | 229 |
| 752 | 3300025913 | Ga0207695_10264468 | Ga0207695_102644681 | 229 |
| 753 | 3300025914 | Ga0207671_10003773 | Ga0207671_1000377311 | 229 |
| 754 | 3300025949 | Ga0207667_10462279 | Ga0207667_104622792 | 229 |
| 755 | 3300026067 | Ga0207678_10014014 | Ga0207678_100140143 | 229 |
| 756 | 3300028786 | Ga0307517_10241977 | Ga0307517_102419772 | 229 |
| 757 | 3300028794 | Ga0307515_10283962 | Ga0307515_102839622 | 229 |
| 758 | 3300031548 | Ga0307408_100203466 | Ga0307408_1002034662 | 229 |
| 759 | 3300037466 | Ga0395898_0001191 | Ga0395898_0001191_1760_2464 | 229 |
| 760 | 3300044658 | Ga0466972_0006098 | Ga0466972_0006098_2689_3381 | 229 |
| 761 | 3300044683 | Ga0466965_0017284 | Ga0466965_0017284_49_741 | 229 |
| 762 | 3300044684 | Ga0466966_0006064 | Ga0466966_0006064_333_1034 | 229 |
| 763 | 3300044694 | Ga0466963_0021472 | Ga0466963_0021472_97_798 | 229 |
| 764 | 3300044712 | Ga0453684_0118372 | Ga0453684_0118372_77_766 | 229 |
| 765 | 3300044719 | Ga0466971_0100547 | Ga0466971_0100547_286_987 | 229 |
| 766 | 3300044765 | Ga0466970_0192146 | Ga0466970_0192146_355_1056 | 229 |
| 767 | 3300045049 | Ga0466959_0050980 | Ga0466959_0050980_1340_2041 | 229 |
| 768 | 3300045836 | Ga0466958_0111000 | Ga0466958_0111000_670_1371 | 229 |
| 769 | 3300045976 | Ga0466967_0189251 | Ga0466967_0189251_558_1259 | 229 |
| 770 | 3300049517 | Ga0501294_005716 | Ga0501294_005716_85_777 | 229 |
| 771 | 3300049521 | Ga0501298_004902 | Ga0501298_004902_80_772 | 229 |
| 772 | 3300049569 | Ga0501032_0036399 | Ga0501032_0036399_1875_2564 | 229 |
| 773 | 3300049579 | Ga0501043_0000002 | Ga0501043_0000002_319611_320300 | 229 |
| 774 | 3300049580 | Ga0501046_0000008 | Ga0501046_0000008_319708_320397 | 229 |
| 775 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_342876_343565 | 229 |
| 776 | 3300049582 | Ga0501048_0002164 | Ga0501048_0002164_6113_6802 | 229 |
| 777 | 3300049762 | Ga0501265_001134 | Ga0501265_001134_2131_2823 | 229 |
| 778 | 3300049823 | Ga0501044_0196635 | Ga0501044_0196635_640_1329 | 229 |
| 779 | 3300049824 | Ga0501045_0006316 | Ga0501045_0006316_2361_3050 | 229 |
| 780 | 3300053154 | Ga0500619_000029 | Ga0500619_000029_43846_44535 | 229 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e98-assembly1.cif.gz_B | crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution | 0.7746 | 46 | 224 |
| 3e98-assembly1.cif.gz_B | crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution | 0.7631 | 46 | 224 |
| 3jbq-assembly1.cif.gz_G | domain organization and conformational plasticity of the g protein effector, pde6 | 0.723 | 82 | 224 |
| 3cit-assembly1.cif.gz_B-2 | crystal structure of the gaf domain of a putative sensor histidine kinase from pseudomonas syringae pv. tomato | 0.6957 | 73 | 224 |
| 3cit-assembly1.cif.gz_A-2 | crystal structure of the gaf domain of a putative sensor histidine kinase from pseudomonas syringae pv. tomato | 0.6787 | 73 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P23305_50_233_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.805 | 46 | 227 | 3.30.450.40 |
| af_P23305_50_233_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7934 | 46 | 227 | 3.30.450.40 |
| af_P37013_4_170_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7683 | 82 | 225 | 3.30.450.40 |
| 3e98B00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.755 | 46 | 224 | 3.30.450.40 |
| 3e98B00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7439 | 46 | 224 | 3.30.450.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5VX57-F1-model_v4 | deleted | 0.9763 | 85 | 228 |
|
| AF-A0A098U0F1-F1-model_v4 | deleted | 0.9536 | 95 | 180 |
|
| AF-A0A4Q5VHV1-F1-model_v4 | deleted | 0.9457 | 62 | 227 |
|
| AF-A0A4Q5VX57-F1-model_v4 | deleted | 0.944 | 85 | 228 |
|
| AF-A0A257P8X0-F1-model_v4 | DUF484 family protein | 0.9427 | 141 | 225 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar