F480488

General Info

Members Datasets Scaffolds Average Seq Length
779 273 1558 403

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_012720|Ga0590071_012720_343_1800
Length 485
Sequence VTVVTERARIRDRGHPGRKDGRTSVANRIMKLDWEAGMTFARRGVRLIGSVAGVAALLLLGGVIFNGTVSAFATKKGPVDVDKRNAAALFAEGRQIFRYDTFGDQKFWGGALQLHKAIAGAKNGGVGPGVSPKTALSLGLKVDSTKIPASVVAALKAGKVDLGDPATTVALLKLNAVVGVKGFFDRKGTLTSLGTTCALCHSTVDDSFAPGIGKRLDGWANRDLNVGEIVAASPSVKPFADLLGVDQDTVRKVLRSWGPGFYNAELDKDGKAFRPDGKPAGTVLPPAFGLAGVNLGTYTGFGTVTYWNAYVAVTQMHGQGNFYDPRFNDPEKYPLAVKSGSWNVRSARDLVTSKLGPLHYYQLSLKAPKAPKGSFDAKAAKRGEDVFMGKGKCAGCHMPPLYTEPGFNMHEPEEICTDSFQADRSPDEMYRTTPLKGLWTHQKGGFYHDGRFKSLNEVVEHYNGCFGLNLTAGEKSDVVQFLKSR

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
187 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
188 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
215 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
216 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
251 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
252 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
272 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
273 2643221695 Lysobacter sp. Root494 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0.77
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 0.51
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 10.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_012720 3300059421 Bacteria 1972
2 Ga0055524_1003605 3300003775 Bacteria 7462
3 Ga0055530_10006762 3300003791 Bacteria 5006
4 Ga0065715_10009217 3300005293 Bacteria 3710
5 Ga0065715_10110253 3300005293 Bacteria 2622
6 Ga0065707_10000951 3300005295 Bacteria 9238
7 Ga0065707_10011095 3300005295 Bacteria 3977
8 Ga0065707_10116693 3300005295 Bacteria 2230
9 Ga0070658_10005485 3300005327 Bacteria 10289
10 Ga0070658_10015158 3300005327 Bacteria 6168
11 Ga0070658_10018476 3300005327 Bacteria 5582
12 Ga0070658_10124139 3300005327 Unclassified 2148
13 Ga0070676_10061707 3300005328 Bacteria 2228
14 Ga0070676_10073098 3300005328 Unclassified 2063
15 Ga0070683_100041942 3300005329 Bacteria 4213
16 Ga0070683_100075317 3300005329 Bacteria 3153
17 Ga0070683_100088515 3300005329 Unclassified 2905
18 Ga0070683_100091312 3300005329 Bacteria 2859
19 Ga0070683_100100199 3300005329 Bacteria 2727
20 Ga0070683_100121326 3300005329 Bacteria 2469
21 Ga0070683_100144505 3300005329 Bacteria 2254
22 Ga0070683_100288303 3300005329 Bacteria 1561
23 Ga0070690_100002622 3300005330 Bacteria 9688
24 Ga0070690_100003980 3300005330 Bacteria 8167
25 Ga0070690_100019905 3300005330 Bacteria 4083
26 Ga0070690_100039774 3300005330 Unclassified 2972
27 Ga0070690_100130663 3300005330 Bacteria 1696
28 Ga0070670_100000931 3300005331 Bacteria 22956
29 Ga0070670_100015464 3300005331 Bacteria 6554
30 Ga0070670_100041341 3300005331 Bacteria 3963
31 Ga0070670_100046949 3300005331 Bacteria 3716
32 Ga0070670_100058654 3300005331 Bacteria 3304
33 Ga0070670_100109493 3300005331 Bacteria 2380
34 Ga0070670_100289619 3300005331 Bacteria 1431
35 Ga0070677_10020344 3300005333 Bacteria 2417
36 Ga0068869_100013039 3300005334 Bacteria 5515
37 Ga0068869_100067776 3300005334 Bacteria 2634
38 Ga0068869_100070285 3300005334 Unclassified 2590
39 Ga0070666_10013712 3300005335 Bacteria 5145
40 Ga0070666_10165344 3300005335 Bacteria 1547
41 Ga0070680_100001061 3300005336 Bacteria 19707
42 Ga0070680_100001510 3300005336 Bacteria 16941
43 Ga0070680_100019745 3300005336 Bacteria 5343
44 Ga0070680_100031150 3300005336 Bacteria 4287
45 Ga0070680_100050638 3300005336 Bacteria 3388
46 Ga0070680_100100013 3300005336 Bacteria 2407
47 Ga0070680_100123423 3300005336 Unclassified 2163
48 Ga0070680_100185106 3300005336 Bacteria 1754
49 Ga0070682_100000601 3300005337 Bacteria 21900
50 Ga0070682_100003828 3300005337 Bacteria 8359
51 Ga0070682_100004295 3300005337 Bacteria 7912
52 Ga0070682_100054944 3300005337 Unclassified 2500
53 Ga0068868_100034761 3300005338 Bacteria 3893
54 Ga0068868_100056015 3300005338 Bacteria 3112
55 Ga0068868_100164677 3300005338 Bacteria 1833
56 Ga0070660_100082417 3300005339 Bacteria 2526
57 Ga0070660_100115440 3300005339 Bacteria 2140
58 Ga0070689_100026736 3300005340 Bacteria 4346
59 Ga0070689_100028523 3300005340 Bacteria 4219
60 Ga0070689_100028673 3300005340 Bacteria 4210
61 Ga0070689_100034883 3300005340 Bacteria 3840
62 Ga0070689_100035107 3300005340 Bacteria 3829
63 Ga0070689_100075902 3300005340 Bacteria 2632
64 Ga0070687_100032288 3300005343 Bacteria 2575
65 Ga0070661_100039331 3300005344 Bacteria 3446
66 Ga0070661_100244530 3300005344 Bacteria 1383
67 Ga0070692_10002650 3300005345 Bacteria 6999
68 Ga0070668_100013311 3300005347 Bacteria 6138
69 Ga0070669_100007291 3300005353 Bacteria 7932
70 Ga0070669_100053840 3300005353 Unclassified 2946
71 Ga0070669_100216005 3300005353 Bacteria 1515
72 Ga0070669_100258360 3300005353 Bacteria 1389
73 Ga0070675_100002883 3300005354 Bacteria 12965
74 Ga0070675_100077829 3300005354 Bacteria 2761
75 Ga0070675_100171467 3300005354 Bacteria 1871
76 Ga0070671_100009593 3300005355 Bacteria 7778
77 Ga0070674_100000332 3300005356 Bacteria 23389
78 Ga0070674_100187262 3300005356 Unclassified 1589
79 Ga0070673_100002599 3300005364 Bacteria 11031
80 Ga0070673_100043494 3300005364 Bacteria 3471
81 Ga0070673_100071618 3300005364 Unclassified 2786
82 Ga0070673_100075183 3300005364 Bacteria 2724
83 Ga0070673_100159996 3300005364 Bacteria 1914
84 Ga0070673_100195106 3300005364 Unclassified 1741
85 Ga0070688_100091052 3300005365 Unclassified 1993
86 Ga0070659_100054403 3300005366 Bacteria 3152
87 Ga0070659_100085896 3300005366 Bacteria 2517
88 Ga0070667_100006831 3300005367 Bacteria 9477
89 Ga0070667_100051244 3300005367 Bacteria 3479
90 Ga0070667_100055119 3300005367 Unclassified 3357
91 Ga0070667_100068069 3300005367 Bacteria 3029
92 Ga0070667_100098272 3300005367 Bacteria 2526
93 Ga0070703_10006955 3300005406 Bacteria 3171
94 Ga0070709_10001552 3300005434 Bacteria 12397
95 Ga0070709_10008514 3300005434 Bacteria 5636
96 Ga0070701_10032889 3300005438 Bacteria 2587
97 Ga0070711_100001736 3300005439 Bacteria 12090
98 Ga0070705_100002216 3300005440 Bacteria 9876
99 Ga0070705_100004394 3300005440 Bacteria 6864
100 Ga0070705_100017613 3300005440 Bacteria 3731
101 Ga0070705_100024641 3300005440 Unclassified 3251
102 Ga0070705_100080514 3300005440 Bacteria 1998
103 Ga0070700_100015177 3300005441 Bacteria 4363
104 Ga0070700_100017728 3300005441 Bacteria 4079
105 Ga0070700_100022194 3300005441 Unclassified 3699
106 Ga0070700_100028168 3300005441 Bacteria 3338
107 Ga0070700_100050721 3300005441 Bacteria 2580
108 Ga0070694_100000850 3300005444 Bacteria 17185
109 Ga0070694_100007418 3300005444 Bacteria 6689
110 Ga0070694_100008086 3300005444 Bacteria 6424
111 Ga0070694_100021776 3300005444 Bacteria 4100
112 Ga0070694_100051571 3300005444 Bacteria 2778
113 Ga0070694_100063118 3300005444 Bacteria 2532
114 Ga0070694_100083696 3300005444 Unclassified 2224
115 Ga0070708_100000139 3300005445 Bacteria 49545
116 Ga0070708_100004438 3300005445 Bacteria 11029
117 Ga0070708_100029748 3300005445 Bacteria 4714
118 Ga0070708_100055340 3300005445 Bacteria 3528
119 Ga0070708_100089636 3300005445 Bacteria 2798
120 Ga0070708_100194930 3300005445 Unclassified 1895
121 Ga0070678_100033928 3300005456 Unclassified 3548
122 Ga0070662_100000519 3300005457 Bacteria 23221
123 Ga0070662_100085469 3300005457 Bacteria 2358
124 Ga0070662_100148283 3300005457 Bacteria 1824
125 Ga0070681_10006714 3300005458 Bacteria 11195
126 Ga0070681_10054851 3300005458 Bacteria 3971
127 Ga0070681_10056291 3300005458 Bacteria 3914
128 Ga0070681_10137131 3300005458 Bacteria 2377
129 Ga0070681_10306610 3300005458 Unclassified 1497
130 Ga0068867_100001018 3300005459 Bacteria 19161
131 Ga0068867_100021380 3300005459 Bacteria 4617
132 Ga0068867_100027638 3300005459 Bacteria 4080
133 Ga0068867_100045839 3300005459 Unclassified 3208
134 Ga0068867_100055291 3300005459 Bacteria 2935
135 Ga0070685_10023589 3300005466 Bacteria 3370
136 Ga0070706_100008915 3300005467 Bacteria 9339
137 Ga0070706_100068355 3300005467 Bacteria 3285
138 Ga0070706_100221488 3300005467 Bacteria 1766
139 Ga0070707_100002601 3300005468 Bacteria 17148
140 Ga0070707_100043081 3300005468 Unclassified 4321
141 Ga0070707_100060549 3300005468 Bacteria 3631
142 Ga0070707_100063624 3300005468 Bacteria 3540
143 Ga0070707_100096750 3300005468 Bacteria 2859
144 Ga0070707_100118606 3300005468 Bacteria 2569
145 Ga0070698_100008474 3300005471 Bacteria 11104
146 Ga0070698_100023833 3300005471 Bacteria 6391
147 Ga0070698_100050320 3300005471 Bacteria 4249
148 Ga0070698_100069336 3300005471 Unclassified 3540
149 Ga0070698_100141745 3300005471 Bacteria 2354
150 Ga0070698_100144377 3300005471 Unclassified 2330
151 Ga0070699_100000036 3300005518 Bacteria 133816
152 Ga0070699_100016584 3300005518 Bacteria 6322
153 Ga0070699_100058671 3300005518 Bacteria 3334
154 Ga0070699_100124888 3300005518 Bacteria 2265
155 Ga0070699_100344708 3300005518 Unclassified 1341
156 Ga0070679_100002002 3300005530 Bacteria 18297
157 Ga0070679_100010963 3300005530 Bacteria 8613
158 Ga0070679_100027003 3300005530 Bacteria 5646
159 Ga0070679_100027018 3300005530 Bacteria 5644
160 Ga0070679_100034666 3300005530 Bacteria 5002
161 Ga0070679_100034702 3300005530 Bacteria 5001
162 Ga0070679_100095741 3300005530 Bacteria 2956
163 Ga0070679_100186643 3300005530 Bacteria 2044
164 Ga0070679_100229681 3300005530 Bacteria 1815
165 Ga0070684_100070313 3300005535 Bacteria 3080
166 Ga0070684_100187949 3300005535 Bacteria 1879
167 Ga0070697_100033376 3300005536 Unclassified 4145
168 Ga0070697_100036235 3300005536 Bacteria 3984
169 Ga0070697_100046023 3300005536 Unclassified 3536
170 Ga0070697_100055590 3300005536 Bacteria 3218
171 Ga0070697_100135394 3300005536 Bacteria 2068
172 Ga0070697_100162761 3300005536 Bacteria 1885
173 Ga0070672_100017678 3300005543 Bacteria 5137
174 Ga0070672_100019494 3300005543 Bacteria 4924
175 Ga0070672_100058803 3300005543 Bacteria 3023
176 Ga0070672_100061964 3300005543 Bacteria 2950
177 Ga0070686_100010131 3300005544 Bacteria 5305
178 Ga0070686_100019717 3300005544 Bacteria 3979
179 Ga0070686_100025630 3300005544 Bacteria 3550
180 Ga0070686_100057045 3300005544 Bacteria 2507
181 Ga0070686_100128470 3300005544 Bacteria 1750
182 Ga0070686_100136476 3300005544 Bacteria 1703
183 Ga0070695_100000320 3300005545 Bacteria 24625
184 Ga0070695_100002362 3300005545 Bacteria 10834
185 Ga0070695_100002927 3300005545 Bacteria 9940
186 Ga0070695_100003044 3300005545 Bacteria 9766
187 Ga0070695_100083550 3300005545 Bacteria 2116
188 Ga0070696_100000430 3300005546 Bacteria 26356
189 Ga0070696_100001418 3300005546 Bacteria 15660
190 Ga0070696_100010767 3300005546 Bacteria 6126
191 Ga0070696_100016443 3300005546 Bacteria 4982
192 Ga0070696_100016579 3300005546 Bacteria 4965
193 Ga0070696_100022203 3300005546 Bacteria 4310
194 Ga0070693_100013285 3300005547 Unclassified 4191
195 Ga0070693_100034743 3300005547 Bacteria 2791
196 Ga0070693_100036515 3300005547 Bacteria 2733
197 Ga0070665_100028705 3300005548 Bacteria 5602
198 Ga0070704_100000943 3300005549 Bacteria 14692
199 Ga0070704_100002359 3300005549 Bacteria 10597
200 Ga0070704_100013149 3300005549 Bacteria 5128
201 Ga0070704_100017661 3300005549 Unclassified 4543
202 Ga0070704_100166570 3300005549 Bacteria 1748
203 Ga0070704_100184768 3300005549 Bacteria 1670
204 Ga0068855_100015497 3300005563 Bacteria 9178
205 Ga0068855_100041785 3300005563 Bacteria 5433
206 Ga0068855_100245904 3300005563 Bacteria 1997
207 Ga0070664_100000735 3300005564 Bacteria 25222
208 Ga0070664_100048585 3300005564 Bacteria 3585
209 Ga0070664_100094714 3300005564 Bacteria 2589
210 Ga0070664_100183980 3300005564 Bacteria 1859
211 Ga0070664_100288417 3300005564 Bacteria 1481
212 Ga0068857_100002618 3300005577 Bacteria 14771
213 Ga0068857_100010414 3300005577 Bacteria 8081
214 Ga0068854_100000404 3300005578 Bacteria 27172
215 Ga0068854_100021591 3300005578 Bacteria 4370
216 Ga0068856_100059679 3300005614 Bacteria 3768
217 Ga0068856_100069980 3300005614 Bacteria 3470
218 Ga0068856_100083511 3300005614 Bacteria 3172
219 Ga0070702_100021332 3300005615 Unclassified 3407
220 Ga0068852_100003357 3300005616 Bacteria 11171
221 Ga0068852_100019157 3300005616 Bacteria 5409
222 Ga0068852_100159452 3300005616 Bacteria 2105
223 Ga0068859_100043047 3300005617 Bacteria 4537
224 Ga0068859_100043121 3300005617 Bacteria 4533
225 Ga0068859_100060674 3300005617 Bacteria 3811
226 Ga0068859_100096235 3300005617 Bacteria 3013
227 Ga0068859_100158929 3300005617 Bacteria 2339
228 Ga0068859_100184208 3300005617 Unclassified 2171
229 Ga0068859_100184480 3300005617 Bacteria 2170
230 Ga0068859_100186859 3300005617 Bacteria 2156
231 Ga0068859_100397086 3300005617 Unclassified 1475
232 Ga0068864_100003735 3300005618 Bacteria 12567
233 Ga0068864_100012387 3300005618 Bacteria 7051
234 Ga0068864_100024237 3300005618 Bacteria 5103
235 Ga0068864_100029970 3300005618 Bacteria 4611
236 Ga0068864_100302852 3300005618 Bacteria 1497
237 Ga0068866_10015975 3300005718 Unclassified 3346
238 Ga0068866_10063973 3300005718 Bacteria 1919
239 Ga0068861_100025410 3300005719 Unclassified 4295
240 Ga0068861_100034319 3300005719 Bacteria 3751
241 Ga0068861_100065468 3300005719 Unclassified 2800
242 Ga0068861_100100705 3300005719 Bacteria 2297
243 Ga0068870_10089608 3300005840 Bacteria 1717
244 Ga0068863_100008431 3300005841 Bacteria 10065
245 Ga0068863_100012059 3300005841 Bacteria 8350
246 Ga0068863_100017115 3300005841 Bacteria 6954
247 Ga0068863_100060256 3300005841 Bacteria 3589
248 Ga0068863_100303027 3300005841 Unclassified 1550
249 Ga0068858_100010849 3300005842 Bacteria 8614
250 Ga0068858_100039209 3300005842 Bacteria 4393
251 Ga0068858_100151218 3300005842 Bacteria 2183
252 Ga0068860_100007627 3300005843 Bacteria 10827
253 Ga0068860_100032290 3300005843 Bacteria 5030
254 Ga0068860_100053554 3300005843 Bacteria 3837
255 Ga0068860_100062010 3300005843 Bacteria 3553
256 Ga0068860_100107464 3300005843 Bacteria 2667
257 Ga0068860_100152961 3300005843 Bacteria 2222
258 Ga0068862_100019047 3300005844 Bacteria 5723
259 Ga0068862_100039330 3300005844 Bacteria 4016
260 Ga0068862_100045014 3300005844 Bacteria 3765
261 Ga0068862_100287977 3300005844 Bacteria 1508
262 Ga0081455_10030027 3300005937 Bacteria 4946
263 Ga0070716_100064613 3300006173 Unclassified 2129
264 Ga0097621_100138569 3300006237 Bacteria 2077
265 Ga0097621_100146579 3300006237 Bacteria 2022
266 Ga0068871_100074502 3300006358 Bacteria 2800
267 Ga0068871_100109705 3300006358 Bacteria 2320
268 Ga0075428_100000755 3300006844 Bacteria 33616
269 Ga0075428_100010980 3300006844 Bacteria 10073
270 Ga0075428_100014029 3300006844 Bacteria 8917
271 Ga0075428_100029221 3300006844 Bacteria 6100
272 Ga0075428_100056376 3300006844 Unclassified 4304
273 Ga0075428_100082505 3300006844 Bacteria 3508
274 Ga0075428_100100068 3300006844 Bacteria 3161
275 Ga0075428_100288359 3300006844 Bacteria 1766
276 Ga0075430_100003468 3300006846 Bacteria 13195
277 Ga0075430_100003859 3300006846 Bacteria 12627
278 Ga0075430_100018632 3300006846 Bacteria 5908
279 Ga0075430_100024063 3300006846 Bacteria 5185
280 Ga0075430_100026130 3300006846 Bacteria 4968
281 Ga0075430_100082127 3300006846 Bacteria 2700
282 Ga0075430_100097994 3300006846 Bacteria 2449
283 Ga0075431_100000073 3300006847 Bacteria 58648
284 Ga0075431_100006169 3300006847 Bacteria 11895
285 Ga0075431_100017961 3300006847 Bacteria 7192
286 Ga0075431_100071059 3300006847 Bacteria 3591
287 Ga0075431_100081362 3300006847 Bacteria 3344
288 Ga0075431_100132699 3300006847 Bacteria 2568
289 Ga0075431_100162564 3300006847 Bacteria 2295
290 Ga0075433_10000372 3300006852 Bacteria 28233
291 Ga0075433_10026633 3300006852 Bacteria 4898
292 Ga0075433_10221342 3300006852 Bacteria 1681
293 Ga0075434_100007866 3300006871 Bacteria 9877
294 Ga0075434_100015045 3300006871 Bacteria 7409
295 Ga0075434_100017015 3300006871 Bacteria 6997
296 Ga0075434_100055777 3300006871 Bacteria 3926
297 Ga0075434_100231794 3300006871 Bacteria 1866
298 Ga0075429_100000740 3300006880 Bacteria 25626
299 Ga0075429_100013309 3300006880 Bacteria 7134
300 Ga0075429_100028549 3300006880 Bacteria 4844
301 Ga0075429_100073212 3300006880 Bacteria 2984
302 Ga0068865_100003719 3300006881 Bacteria 9157
303 Ga0068865_100028034 3300006881 Bacteria 3727
304 Ga0068865_100037027 3300006881 Bacteria 3292
305 Ga0068865_100048390 3300006881 Bacteria 2926
306 Ga0075436_100002988 3300006914 Bacteria 11579
307 Ga0075436_100007709 3300006914 Bacteria 7356
308 Ga0075436_100012839 3300006914 Bacteria 5742
309 Ga0075436_100024381 3300006914 Bacteria 4158
310 Ga0097620_100043050 3300006931 Bacteria 4537
311 Ga0097620_100043122 3300006931 Bacteria 4533
312 Ga0097620_100060674 3300006931 Bacteria 3811
313 Ga0097620_100096235 3300006931 Bacteria 3013
314 Ga0097620_100158938 3300006931 Bacteria 2339
315 Ga0097620_100184199 3300006931 Unclassified 2171
316 Ga0097620_100184489 3300006931 Bacteria 2170
317 Ga0097620_100186852 3300006931 Bacteria 2156
318 Ga0075435_100000667 3300007076 Bacteria 21182
319 Ga0075435_100012464 3300007076 Bacteria 6298
320 Ga0075435_100027031 3300007076 Bacteria 4484
321 Ga0075435_100029801 3300007076 Unclassified 4286
322 Ga0105240_10071260 3300009093 Bacteria 4299
323 Ga0105240_10224403 3300009093 Unclassified 2187
324 Ga0105240_10306592 3300009093 Unclassified 1815
325 Ga0111539_10000289 3300009094 Bacteria 60610
326 Ga0111539_10006435 3300009094 Bacteria 15142
327 Ga0111539_10010182 3300009094 Bacteria 11847
328 Ga0111539_10011953 3300009094 Bacteria 10885
329 Ga0111539_10029947 3300009094 Bacteria 6620
330 Ga0111539_10030826 3300009094 Bacteria 6519
331 Ga0111539_10033666 3300009094 Bacteria 6220
332 Ga0111539_10048759 3300009094 Bacteria 5054
333 Ga0111539_10171652 3300009094 Bacteria 2533
334 Ga0111539_10175569 3300009094 Bacteria 2503
335 Ga0111539_10239272 3300009094 Bacteria 2113
336 Ga0111539_10469394 3300009094 Bacteria 1465
337 Ga0105245_10000862 3300009098 Bacteria 27532
338 Ga0105245_10010848 3300009098 Bacteria 7929
339 Ga0105245_10025039 3300009098 Bacteria 5246
340 Ga0105245_10096825 3300009098 Unclassified 2724
341 Ga0105245_10198136 3300009098 Bacteria 1927
342 Ga0114129_10000258 3300009147 Bacteria 59635
343 Ga0114129_10001090 3300009147 Bacteria 35640
344 Ga0114129_10004010 3300009147 Bacteria 20797
345 Ga0114129_10020737 3300009147 Bacteria 9339
346 Ga0114129_10041798 3300009147 Bacteria 6455
347 Ga0114129_10043345 3300009147 Bacteria 6330
348 Ga0114129_10063058 3300009147 Bacteria 5177
349 Ga0114129_10080106 3300009147 Bacteria 4540
350 Ga0114129_10298748 3300009147 Unclassified 2147
351 Ga0114129_10406989 3300009147 Bacteria 1792
352 Ga0105243_10002649 3300009148 Bacteria 14866
353 Ga0105243_10011347 3300009148 Bacteria 6744
354 Ga0105241_10008265 3300009174 Bacteria 7662
355 Ga0105241_10117429 3300009174 Unclassified 2138
356 Ga0105242_10005672 3300009176 Bacteria 9634
357 Ga0105242_10026973 3300009176 Bacteria 4556
358 Ga0105242_10030153 3300009176 Bacteria 4331
359 Ga0105242_10057571 3300009176 Unclassified 3184
360 Ga0105242_10179162 3300009176 Bacteria 1869
361 Ga0105242_10298972 3300009176 Bacteria 1468
362 Ga0105248_10001276 3300009177 Bacteria 28138
363 Ga0105248_10010516 3300009177 Bacteria 10192
364 Ga0105248_10025837 3300009177 Bacteria 6531
365 Ga0105248_10029728 3300009177 Bacteria 6097
366 Ga0105248_10068034 3300009177 Unclassified 3999
367 Ga0105248_10071978 3300009177 Bacteria 3885
368 Ga0105248_10074694 3300009177 Unclassified 3810
369 Ga0105248_10098075 3300009177 Bacteria 3301
370 Ga0105249_10021844 3300009553 Bacteria 5730
371 Ga0105249_10092806 3300009553 Bacteria 2827
372 Ga0105249_10136748 3300009553 Bacteria 2346
373 Ga0105239_10077711 3300010375 Bacteria 3653
374 Ga0105239_10120527 3300010375 Unclassified 2913
375 Ga0105246_10032259 3300011119 Bacteria 3473
376 Ga0105246_10047835 3300011119 Bacteria 2923
377 Ga0157373_10007787 3300013100 Bacteria 7965
378 Ga0157370_10102413 3300013104 Unclassified 2681
379 Ga0157370_10245734 3300013104 Bacteria 1655
380 Ga0157370_10295271 3300013104 Bacteria 1496
381 Ga0157369_10002331 3300013105 Bacteria 22845
382 Ga0157369_10005201 3300013105 Bacteria 15203
383 Ga0157369_10174036 3300013105 Bacteria 2267
384 Ga0157369_10237771 3300013105 Unclassified 1903
385 Ga0157374_10012312 3300013296 Bacteria 7442
386 Ga0157374_10026810 3300013296 Bacteria 5189
387 Ga0157378_10004772 3300013297 Bacteria 11874
388 Ga0157378_10046621 3300013297 Unclassified 3852
389 Ga0163162_10006062 3300013306 Bacteria 11701
390 Ga0163162_10022026 3300013306 Bacteria 6278
391 Ga0163162_10064665 3300013306 Bacteria 3703
392 Ga0157372_10004820 3300013307 Bacteria 14342
393 Ga0157372_10020923 3300013307 Bacteria 7062
394 Ga0157372_10044577 3300013307 Bacteria 4915
395 Ga0157372_10158279 3300013307 Unclassified 2617
396 Ga0157372_10274867 3300013307 Bacteria 1958
397 Ga0157375_10009020 3300013308 Bacteria 8730
398 Ga0157375_10145452 3300013308 Unclassified 2501
399 Ga0157375_10162475 3300013308 Bacteria 2376
400 Ga0157375_10287876 3300013308 Unclassified 1806
401 Ga0157375_10337935 3300013308 Bacteria 1671
402 Ga0163163_10000013 3300014325 Bacteria 242522
403 Ga0163163_10002166 3300014325 Bacteria 16597
404 Ga0163163_10005585 3300014325 Bacteria 10896
405 Ga0163163_10028969 3300014325 Bacteria 5323
406 Ga0163163_10044921 3300014325 Bacteria 4335
407 Ga0163163_10152439 3300014325 Bacteria 2355
408 Ga0157380_10003445 3300014326 Bacteria 10867
409 Ga0157380_10022226 3300014326 Bacteria 4770
410 Ga0157380_10036999 3300014326 Bacteria 3781
411 Ga0157380_10165759 3300014326 Bacteria 1925
412 Ga0157379_10095021 3300014968 Unclassified 2674
413 Ga0157379_10173211 3300014968 Bacteria 1948
414 Ga0157376_10104980 3300014969 Bacteria 2477
415 Ga0157376_10302127 3300014969 Bacteria 1515
416 Ga0163161_10010588 3300017792 Bacteria 6384
417 Ga0163161_10249784 3300017792 Bacteria 1382
418 Ga0197907_10997133 3300020069 Bacteria 2113
419 Ga0206356_10025876 3300020070 Bacteria 2332
420 Ga0206349_1608838 3300020075 Unclassified 1635
421 Ga0206354_11511175 3300020081 Bacteria 1930
422 Ga0206353_10829592 3300020082 Bacteria 2860
423 Ga0213876_10038370 3300021384 Bacteria 2528
424 Ga0224712_10022038 3300022467 Bacteria 2190
425 Ga0209673_1024820 3300025273 Bacteria 2005
426 Ga0209676_1031619 3300025292 Bacteria 1601
427 Ga0209564_1006131 3300025295 Bacteria 6593
428 Ga0209256_1002260 3300025299 Bacteria 16328
429 Ga0209051_1035428 3300025303 Bacteria 1857
430 Ga0207697_10070082 3300025315 Unclassified 1468
431 Ga0207653_10000165 3300025885 Bacteria 46874
432 Ga0207682_10055304 3300025893 Unclassified 1650
433 Ga0207642_10001609 3300025899 Bacteria 6946
434 Ga0207680_10033933 3300025903 Bacteria 2915
435 Ga0207699_10048990 3300025906 Bacteria 2484
436 Ga0207645_10000547 3300025907 Bacteria 31303
437 Ga0207645_10038238 3300025907 Bacteria 3077
438 Ga0207643_10021696 3300025908 Bacteria 3532
439 Ga0207643_10029412 3300025908 Bacteria 3055
440 Ga0207705_10005371 3300025909 Bacteria 9580
441 Ga0207705_10005668 3300025909 Bacteria 9321
442 Ga0207705_10128579 3300025909 Unclassified 1884
443 Ga0207705_10141171 3300025909 Bacteria 1799
444 Ga0207705_10235397 3300025909 Bacteria 1394
445 Ga0207684_10040642 3300025910 Bacteria 3943
446 Ga0207684_10065239 3300025910 Bacteria 3091
447 Ga0207684_10077808 3300025910 Bacteria 2821
448 Ga0207684_10107023 3300025910 Unclassified 2392
449 Ga0207707_10001283 3300025912 Bacteria 23435
450 Ga0207707_10034064 3300025912 Bacteria 4457
451 Ga0207707_10125711 3300025912 Bacteria 2242
452 Ga0207695_10011998 3300025913 Bacteria 10426
453 Ga0207695_10247505 3300025913 Unclassified 1682
454 Ga0207663_10000180 3300025916 Bacteria 28367
455 Ga0207660_10000129 3300025917 Bacteria 44676
456 Ga0207660_10029376 3300025917 Bacteria 3770
457 Ga0207660_10058489 3300025917 Bacteria 2764
458 Ga0207662_10018448 3300025918 Bacteria 3959
459 Ga0207662_10021115 3300025918 Bacteria 3717
460 Ga0207657_10005298 3300025919 Bacteria 13512
461 Ga0207657_10012266 3300025919 Bacteria 8466
462 Ga0207657_10144561 3300025919 Bacteria 1941
463 Ga0207657_10185764 3300025919 Bacteria 1679
464 Ga0207649_10042159 3300025920 Bacteria 2782
465 Ga0207649_10158844 3300025920 Unclassified 1565
466 Ga0207652_10007967 3300025921 Bacteria 8505
467 Ga0207652_10023607 3300025921 Bacteria 5096
468 Ga0207652_10115133 3300025921 Bacteria 2388
469 Ga0207652_10119666 3300025921 Bacteria 2342
470 Ga0207652_10210348 3300025921 Unclassified 1751
471 Ga0207646_10000640 3300025922 Bacteria 45611
472 Ga0207646_10023731 3300025922 Bacteria 5630
473 Ga0207646_10030461 3300025922 Bacteria 4890
474 Ga0207646_10075482 3300025922 Bacteria 3012
475 Ga0207646_10108331 3300025922 Unclassified 2493
476 Ga0207646_10301867 3300025922 Bacteria 1447
477 Ga0207681_10033958 3300025923 Bacteria 3350
478 Ga0207681_10107833 3300025923 Bacteria 2021
479 Ga0207681_10163417 3300025923 Bacteria 1681
480 Ga0207681_10176911 3300025923 Bacteria 1622
481 Ga0207650_10002840 3300025925 Bacteria 11968
482 Ga0207650_10019265 3300025925 Bacteria 4792
483 Ga0207659_10001924 3300025926 Bacteria 12314
484 Ga0207659_10024447 3300025926 Bacteria 4048
485 Ga0207659_10035299 3300025926 Bacteria 3455
486 Ga0207687_10002401 3300025927 Bacteria 12707
487 Ga0207644_10129468 3300025931 Bacteria 1930
488 Ga0207644_10202601 3300025931 Bacteria 1566
489 Ga0207690_10100649 3300025932 Bacteria 2063
490 Ga0207690_10163810 3300025932 Bacteria 1660
491 Ga0207690_10191187 3300025932 Bacteria 1548
492 Ga0207706_10000011 3300025933 Bacteria 196033
493 Ga0207706_10006061 3300025933 Bacteria 11239
494 Ga0207706_10006085 3300025933 Bacteria 11212
495 Ga0207706_10051608 3300025933 Bacteria 3631
496 Ga0207706_10061733 3300025933 Bacteria 3300
497 Ga0207686_10000091 3300025934 Bacteria 74172
498 Ga0207686_10028556 3300025934 Bacteria 3281
499 Ga0207709_10001293 3300025935 Bacteria 17859
500 Ga0207670_10014767 3300025936 Bacteria 4647
501 Ga0207670_10029633 3300025936 Bacteria 3488
502 Ga0207670_10072221 3300025936 Unclassified 2389
503 Ga0207669_10004638 3300025937 Bacteria 6069
504 Ga0207669_10009940 3300025937 Unclassified 4557
505 Ga0207669_10035096 3300025937 Bacteria 2850
506 Ga0207704_10000247 3300025938 Bacteria 26430
507 Ga0207704_10035074 3300025938 Bacteria 2870
508 Ga0207704_10084656 3300025938 Bacteria 2061
509 Ga0207691_10007790 3300025940 Bacteria 10313
510 Ga0207691_10009430 3300025940 Bacteria 9375
511 Ga0207691_10009934 3300025940 Bacteria 9138
512 Ga0207691_10015977 3300025940 Bacteria 7131
513 Ga0207691_10027431 3300025940 Bacteria 5339
514 Ga0207691_10048490 3300025940 Bacteria 3894
515 Ga0207711_10115943 3300025941 Bacteria 2387
516 Ga0207711_10204613 3300025941 Unclassified 1802
517 Ga0207711_10219203 3300025941 Bacteria 1739
518 Ga0207711_10262692 3300025941 Bacteria 1587
519 Ga0207689_10000755 3300025942 Bacteria 31026
520 Ga0207689_10018735 3300025942 Bacteria 5837
521 Ga0207689_10075994 3300025942 Bacteria 2761
522 Ga0207661_10018901 3300025944 Bacteria 5128
523 Ga0207661_10062113 3300025944 Bacteria 3021
524 Ga0207661_10082451 3300025944 Unclassified 2659
525 Ga0207661_10094759 3300025944 Bacteria 2494
526 Ga0207679_10008389 3300025945 Bacteria 6580
527 Ga0207679_10013274 3300025945 Bacteria 5399
528 Ga0207679_10031003 3300025945 Bacteria 3739
529 Ga0207679_10082286 3300025945 Bacteria 2464
530 Ga0207679_10240492 3300025945 Bacteria 1534
531 Ga0207651_10032144 3300025960 Bacteria 3366
532 Ga0207651_10081054 3300025960 Bacteria 2338
533 Ga0207651_10109632 3300025960 Bacteria 2069
534 Ga0207651_10150675 3300025960 Unclassified 1810
535 Ga0207668_10135341 3300025972 Bacteria 1887
536 Ga0207640_10037532 3300025981 Unclassified 3049
537 Ga0207640_10144093 3300025981 Bacteria 1741
538 Ga0207658_10027142 3300025986 Bacteria 4021
539 Ga0207658_10081568 3300025986 Bacteria 2481
540 Ga0207677_10008458 3300026023 Bacteria 5751
541 Ga0207677_10019596 3300026023 Bacteria 4090
542 Ga0207703_10016336 3300026035 Bacteria 5786
543 Ga0207678_10070716 3300026067 Bacteria 2992
544 Ga0207708_10002174 3300026075 Bacteria 14466
545 Ga0207708_10012647 3300026075 Bacteria 6293
546 Ga0207708_10016107 3300026075 Bacteria 5615
547 Ga0207708_10028683 3300026075 Bacteria 4215
548 Ga0207708_10108091 3300026075 Bacteria 2157
549 Ga0207708_10169452 3300026075 Bacteria 1728
550 Ga0207702_10031345 3300026078 Bacteria 4431
551 Ga0207702_10040811 3300026078 Bacteria 3890
552 Ga0207702_10126238 3300026078 Bacteria 2297
553 Ga0207641_10005560 3300026088 Bacteria 10742
554 Ga0207641_10008258 3300026088 Bacteria 8604
555 Ga0207641_10014650 3300026088 Bacteria 6429
556 Ga0207641_10074310 3300026088 Bacteria 2932
557 Ga0207641_10132892 3300026088 Bacteria 2236
558 Ga0207648_10000206 3300026089 Bacteria 62974
559 Ga0207648_10011592 3300026089 Bacteria 8300
560 Ga0207648_10020064 3300026089 Bacteria 6029
561 Ga0207648_10023696 3300026089 Bacteria 5493
562 Ga0207648_10025644 3300026089 Bacteria 5248
563 Ga0207648_10059944 3300026089 Bacteria 3319
564 Ga0207676_10048989 3300026095 Bacteria 3283
565 Ga0207676_10088549 3300026095 Bacteria 2534
566 Ga0207674_10001092 3300026116 Bacteria 35309
567 Ga0207674_10003781 3300026116 Bacteria 18467
568 Ga0207674_10004645 3300026116 Bacteria 16491
569 Ga0207675_100004528 3300026118 Bacteria 13417
570 Ga0207675_100032715 3300026118 Bacteria 4845
571 Ga0207675_100065798 3300026118 Bacteria 3388
572 Ga0207675_100075403 3300026118 Unclassified 3157
573 Ga0207675_100357219 3300026118 Bacteria 1433
574 Ga0207683_10001041 3300026121 Bacteria 25273
575 Ga0207683_10042270 3300026121 Bacteria 3981
576 Ga0207683_10170434 3300026121 Bacteria 1971
577 Ga0207698_10003154 3300026142 Bacteria 9888
578 Ga0207698_10014259 3300026142 Bacteria 5277
579 Ga0207698_10147450 3300026142 Bacteria 2037
580 Ga0207698_10319995 3300026142 Unclassified 1452
581 Ga0209981_1004101 3300027378 Bacteria 1899
582 Ga0209995_1001004 3300027471 Bacteria 4339
583 Ga0209995_1010099 3300027471 Unclassified 1528
584 Ga0209968_1002646 3300027526 Bacteria 2695
585 Ga0209998_10000196 3300027717 Bacteria 21285
586 Ga0209974_10019794 3300027876 Bacteria 2231
587 Ga0207428_10000486 3300027907 Bacteria 47460
588 Ga0207428_10002067 3300027907 Bacteria 20252
589 Ga0207428_10006531 3300027907 Bacteria 10757
590 Ga0207428_10033234 3300027907 Bacteria 4238
591 Ga0207428_10038059 3300027907 Bacteria 3912
592 Ga0207428_10057477 3300027907 Bacteria 3088
593 Ga0207428_10086641 3300027907 Bacteria 2437
594 Ga0268266_10035823 3300028379 Bacteria 4221
595 Ga0268265_10046462 3300028380 Unclassified 3246
596 Ga0268264_10043911 3300028381 Bacteria 3706
597 Ga0268264_10082208 3300028381 Bacteria 2755
598 Ga0268264_10146637 3300028381 Unclassified 2111
599 Ga0268264_10170535 3300028381 Bacteria 1967
600 Ga0268264_10219765 3300028381 Bacteria 1749
601 Ga0268264_10299758 3300028381 Bacteria 1513
602 Ga0307515_10039216 3300028794 Bacteria 7543
603 Ga0316177_1139426 3300030731 Bacteria 3326
604 Ga0316176_1141945 3300030732 Bacteria 1900
605 Ga0314311_1012584 3300030733 Bacteria 2311
606 Ga0307513_10079612 3300031456 Bacteria 3384
607 Ga0307408_100037745 3300031548 Bacteria 3404
608 Ga0307408_100092514 3300031548 Bacteria 2286
609 Ga0307405_10006401 3300031731 Bacteria 5789
610 Ga0307405_10150259 3300031731 Bacteria 1637
611 Ga0307413_10118938 3300031824 Bacteria 1785
612 Ga0307410_10073266 3300031852 Bacteria 2381
613 Ga0307410_10162680 3300031852 Bacteria 1674
614 Ga0307406_10027043 3300031901 Bacteria 3452
615 Ga0307406_10044982 3300031901 Bacteria 2769
616 Ga0307406_10045068 3300031901 Bacteria 2766
617 Ga0307407_10067070 3300031903 Bacteria 2119
618 Ga0307407_10116191 3300031903 Bacteria 1688
619 Ga0307412_10037489 3300031911 Bacteria 3115
620 Ga0307412_10202119 3300031911 Bacteria 1510
621 Ga0307409_100052465 3300031995 Bacteria 3127
622 Ga0307409_100146437 3300031995 Bacteria 2043
623 Ga0307416_100031138 3300032002 Bacteria 4012
624 Ga0307416_100037030 3300032002 Bacteria 3749
625 Ga0307416_100050620 3300032002 Bacteria 3312
626 Ga0307416_100066240 3300032002 Bacteria 2973
627 Ga0307416_100098557 3300032002 Bacteria 2536
628 Ga0307414_10044245 3300032004 Bacteria 3039
629 Ga0307414_10092151 3300032004 Unclassified 2255
630 Ga0307414_10165503 3300032004 Bacteria 1762
631 Ga0307411_10000857 3300032005 Bacteria 11436
632 Ga0307411_10016884 3300032005 Bacteria 4142
633 Ga0307411_10024336 3300032005 Bacteria 3608
634 Ga0307411_10034300 3300032005 Bacteria 3157
635 Ga0307411_10049240 3300032005 Bacteria 2737
636 Ga0307415_100019717 3300032126 Bacteria 4099
637 Ga0307415_100115331 3300032126 Bacteria 2002
638 Ga0373941_0004071 3300035115 Bacteria 3353
639 Ga0373954_0040204 3300035118 Bacteria 2178
640 Ga0373947_0040493 3300035725 Bacteria 2775
641 Ga0373925_0129581 3300037068 Bacteria 1965
642 Ga0395899_0010696 3300037312 Bacteria 7033
643 Ga0395899_0023922 3300037312 Bacteria 4622
644 Ga0395900_0015385 3300037418 Bacteria 7797
645 Ga0395900_0029254 3300037418 Bacteria 5651
646 Ga0395898_0104695 3300037466 Bacteria 2714
647 Ga0395898_0349143 3300037466 Bacteria 1411
648 Ga0395905_0012683 3300037471 Bacteria 8108
649 Ga0395905_0020629 3300037471 Bacteria 6239
650 Ga0395905_0029562 3300037471 Bacteria 5163
651 Ga0395905_0157491 3300037471 Bacteria 2136
652 Ga0395901_0003258 3300038443 Bacteria 16332
653 Ga0395901_0019119 3300038443 Bacteria 7005
654 Ga0395901_0236123 3300038443 Bacteria 1908
655 Ga0436365_1772995 3300039437 Bacteria 2556
656 Ga0451849_1239114 3300041505 Bacteria 6351
657 Ga0451853_0446380 3300041512 Unclassified 4818
658 Ga0439448_0029477 3300042005 Bacteria 1738
659 Ga0439449_0012771 3300042007 Bacteria 3158
660 Ga0439449_0073233 3300042007 Bacteria 1262
661 Ga0439446_0004520 3300042156 Bacteria 3526
662 Ga0439434_0030450 3300042435 Bacteria 1638
663 Ga0451577_0037788 3300042876 Bacteria 4345
664 Ga0451576_0003478 3300045051 Bacteria 21554
665 Ga0451576_0012410 3300045051 Bacteria 9569
666 Ga0451576_0013702 3300045051 Bacteria 9058
667 Ga0451576_0032157 3300045051 Bacteria 5590
668 Ga0451576_0042006 3300045051 Bacteria 4828
669 Ga0451576_0088335 3300045051 Bacteria 3224
670 Ga0451576_0174462 3300045051 Bacteria 2244
671 Ga0451576_0256009 3300045051 Bacteria 1829
672 Ga0495580_0113359 3300046472 Bacteria 1883
673 Ga0495608_0113156 3300046511 Bacteria 1744
674 Ga0495663_0036438 3300046525 Bacteria 1481
675 Ga0495656_0000015 3300046615 Bacteria 131080
676 Ga0495656_0105500 3300046615 Bacteria 1310
677 Ga0495659_0001317 3300046664 Bacteria 8530
678 Ga0495659_0013210 3300046664 Bacteria 2686
679 Ga0495649_0007903 3300046694 Bacteria 6435
680 Ga0495636_0106297 3300047318 Unclassified 1231
681 Ga0495684_0013993 3300047471 Bacteria 6172
682 Ga0496102_0063219 3300048905 Unclassified 3389
683 Ga0496106_0221611 3300048909 Bacteria 1509
684 Ga0496113_0083265 3300048916 Bacteria 2454
685 Ga0496114_0128582 3300048917 Unclassified 2186
686 Ga0501031_0055977 3300049568 Bacteria 2570
687 Ga0501033_0012784 3300049570 Bacteria 6401
688 Ga0501033_0043741 3300049570 Bacteria 3335
689 Ga0501036_0177925 3300049572 Bacteria 1791
690 Ga0501041_0125578 3300049577 Bacteria 1597
691 Ga0501042_0117151 3300049578 Bacteria 1918
692 Ga0501043_0207035 3300049579 Bacteria 1521
693 Ga0501047_0213141 3300049581 Bacteria 1789
694 Ga0501048_0013534 3300049582 Bacteria 6052
695 Ga0501067_0023272 3300049583 Bacteria 3433
696 Ga0501068_0000308 3300049584 Bacteria 24470
697 Ga0501070_0011289 3300049586 Bacteria 7547
698 Ga0501070_0035769 3300049586 Bacteria 4148
699 Ga0501071_0068618 3300049587 Bacteria 2580
700 Ga0501072_0082372 3300049588 Bacteria 2551
701 Ga0501072_0152152 3300049588 Bacteria 1845
702 Ga0501073_0002899 3300049589 Bacteria 12868
703 Ga0501074_0017705 3300049590 Bacteria 5175
704 Ga0501074_0100673 3300049590 Bacteria 2068
705 Ga0501075_0094755 3300049591 Bacteria 2266
706 Ga0501076_0025093 3300049592 Bacteria 4611
707 Ga0501077_0003850 3300049593 Bacteria 9044
708 Ga0501077_0005455 3300049593 Bacteria 7741
709 Ga0501235_006829 3300049669 Bacteria 2484
710 Ga0501221_001131 3300049704 Bacteria 4393
711 Ga0501225_0052395 3300049705 Bacteria 1138
712 Ga0501079_0017831 3300049741 Bacteria 5422
713 Ga0501079_0107062 3300049741 Bacteria 2170
714 Ga0501079_0290711 3300049741 Bacteria 1278
715 Ga0501079_0303931 3300049741 Bacteria 1248
716 Ga0501080_0016685 3300049742 Bacteria 6781
717 Ga0501081_0041494 3300049743 Bacteria 3152
718 Ga0501081_0080132 3300049743 Bacteria 2285
719 Ga0501083_0095992 3300049744 Bacteria 1956
720 Ga0501044_0008742 3300049823 Bacteria 11084
721 Ga0501045_0005386 3300049824 Bacteria 8867
722 Ga0501045_0021535 3300049824 Bacteria 4613
723 Ga0501212_002093 3300049851 Bacteria 2369
724 nmdc:mga05p37_12_c1 3300050507 Bacteria 85565
725 nmdc:mga05p37_139730_c1 3300050507 Unclassified 2968
726 nmdc:mga05p37_1421_c1 3300050507 Bacteria 27840
727 nmdc:mga05p37_275124_c1 3300050507 Bacteria 2011
728 nmdc:mga05p37_60683_c1 3300050507 Bacteria 4655
729 nmdc:mga05p37_64054_c1 3300050507 Bacteria 4523
730 nmdc:mga09592_156971_c1 3300050508 Unclassified 1964
731 nmdc:mga09592_242991_c1 3300050508 Bacteria 1560
732 nmdc:mga09592_29587_c1 3300050508 Bacteria 4555
733 nmdc:mga09592_43455_c1 3300050508 Bacteria 3783
734 nmdc:mga09592_54065_c1 3300050508 Bacteria 3392
735 nmdc:mga09592_6076_c1 3300050508 Bacteria 9843
736 nmdc:mga09592_71219_c1 3300050508 Bacteria 2951
737 nmdc:mga0qj67_1465_c1 3300050509 Bacteria 16543
738 nmdc:mga0qj67_175390_c1 3300050509 Bacteria 1741
739 nmdc:mga0qj67_246133_c1 3300050509 Bacteria 1451
740 nmdc:mga0qj67_8381_c1 3300050509 Bacteria 7664
741 nmdc:mga0qj67_97826_c1 3300050509 Bacteria 2364
742 nmdc:mga06r32_124055_c1 3300050510 Bacteria 2549
743 nmdc:mga06r32_147041_c1 3300050510 Bacteria 2334
744 nmdc:mga06r32_1920_c1 3300050510 Bacteria 18517
745 nmdc:mga06r32_45197_c1 3300050510 Bacteria 4197
746 nmdc:mga06r32_51_c2 3300050510 Bacteria 15915
747 nmdc:mga06r32_65852_c1 3300050510 Bacteria 3496
748 nmdc:mga08y16_1406_c1 3300050511 Bacteria 24115
749 nmdc:mga08y16_154981_c1 3300050511 Bacteria 2381
750 nmdc:mga08y16_1955_c1 3300050511 Bacteria 21005
751 nmdc:mga08y16_31179_c1 3300050511 Bacteria 5609
752 nmdc:mga08y16_47049_c1 3300050511 Bacteria 4516
753 nmdc:mga08y16_52361_c1 3300050511 Bacteria 4271
754 nmdc:mga08y16_63248_c1 3300050511 Bacteria 3865
755 nmdc:mga08y16_69551_c1 3300050511 Bacteria 3670
756 nmdc:mga0n895_10108_c1 3300050512 Bacteria 8308
757 nmdc:mga0n895_13520_c1 3300050512 Bacteria 7370
758 nmdc:mga0n895_146005_c1 3300050512 Bacteria 2395
759 nmdc:mga0n895_252199_c1 3300050512 Bacteria 1791
760 nmdc:mga0n895_4973_c1 3300050512 Bacteria 11028
761 nmdc:mga0rr50_24370_c1 3300050513 Unclassified 4189
762 nmdc:mga0rr50_247_c1 3300050513 Bacteria 29327
763 nmdc:mga0rr50_290_c1 3300050513 Bacteria 27222
764 nmdc:mga0rr50_3830_c1 3300050513 Bacteria 8733
765 nmdc:mga08x19_114047_c1 3300050514 Unclassified 1805
766 nmdc:mga08x19_38184_c1 3300050514 Bacteria 3050
767 nmdc:mga08x19_4737_c1 3300050514 Bacteria 8068
768 nmdc:mga0a205_124167_c1 3300050515 Unclassified 2481
769 nmdc:mga0a205_16297_c1 3300050515 Bacteria 6959
770 nmdc:mga0a205_168852_c1 3300050515 Bacteria 2083
771 nmdc:mga0a205_2508_c1 3300050515 Bacteria 16193
772 nmdc:mga0a205_287489_c1 3300050515 Bacteria 1519
773 nmdc:mga0a205_48512_c1 3300050515 Bacteria 4098
774 nmdc:mga0a205_57991_c1 3300050515 Bacteria 3739
775 Ga0590077_004907 3300059426 Bacteria 2737
776 Ga0501082_0134278 3300060353 Bacteria 2147
777 Ga0530510_0066755 3300061734 Bacteria 2609
778 2572256013 2571042365 Bacteria 3289345
779 2644530274 2643221695 Bacteria 3441323
780 Ga0590071_012720
781 Ga0055524_1003605
782 Ga0055530_10006762
783 Ga0065715_10009217
784 Ga0065715_10110253
785 Ga0065707_10000951
786 Ga0065707_10011095
787 Ga0065707_10116693
788 Ga0070658_10005485
789 Ga0070658_10015158
790 Ga0070658_10018476
791 Ga0070658_10124139
792 Ga0070676_10061707
793 Ga0070676_10073098
794 Ga0070683_100041942
795 Ga0070683_100075317
796 Ga0070683_100088515
797 Ga0070683_100091312
798 Ga0070683_100100199
799 Ga0070683_100121326
800 Ga0070683_100144505
801 Ga0070683_100288303
802 Ga0070690_100002622
803 Ga0070690_100003980
804 Ga0070690_100019905
805 Ga0070690_100039774
806 Ga0070690_100130663
807 Ga0070670_100000931
808 Ga0070670_100015464
809 Ga0070670_100041341
810 Ga0070670_100046949
811 Ga0070670_100058654
812 Ga0070670_100109493
813 Ga0070670_100289619
814 Ga0070677_10020344
815 Ga0068869_100013039
816 Ga0068869_100067776
817 Ga0068869_100070285
818 Ga0070666_10013712
819 Ga0070666_10165344
820 Ga0070680_100001061
821 Ga0070680_100001510
822 Ga0070680_100019745
823 Ga0070680_100031150
824 Ga0070680_100050638
825 Ga0070680_100100013
826 Ga0070680_100123423
827 Ga0070680_100185106
828 Ga0070682_100000601
829 Ga0070682_100003828
830 Ga0070682_100004295
831 Ga0070682_100054944
832 Ga0068868_100034761
833 Ga0068868_100056015
834 Ga0068868_100164677
835 Ga0070660_100082417
836 Ga0070660_100115440
837 Ga0070689_100026736
838 Ga0070689_100028523
839 Ga0070689_100028673
840 Ga0070689_100034883
841 Ga0070689_100035107
842 Ga0070689_100075902
843 Ga0070687_100032288
844 Ga0070661_100039331
845 Ga0070661_100244530
846 Ga0070692_10002650
847 Ga0070668_100013311
848 Ga0070669_100007291
849 Ga0070669_100053840
850 Ga0070669_100216005
851 Ga0070669_100258360
852 Ga0070675_100002883
853 Ga0070675_100077829
854 Ga0070675_100171467
855 Ga0070671_100009593
856 Ga0070674_100000332
857 Ga0070674_100187262
858 Ga0070673_100002599
859 Ga0070673_100043494
860 Ga0070673_100071618
861 Ga0070673_100075183
862 Ga0070673_100159996
863 Ga0070673_100195106
864 Ga0070688_100091052
865 Ga0070659_100054403
866 Ga0070659_100085896
867 Ga0070667_100006831
868 Ga0070667_100051244
869 Ga0070667_100055119
870 Ga0070667_100068069
871 Ga0070667_100098272
872 Ga0070703_10006955
873 Ga0070709_10001552
874 Ga0070709_10008514
875 Ga0070701_10032889
876 Ga0070711_100001736
877 Ga0070705_100002216
878 Ga0070705_100004394
879 Ga0070705_100017613
880 Ga0070705_100024641
881 Ga0070705_100080514
882 Ga0070700_100015177
883 Ga0070700_100017728
884 Ga0070700_100022194
885 Ga0070700_100028168
886 Ga0070700_100050721
887 Ga0070694_100000850
888 Ga0070694_100007418
889 Ga0070694_100008086
890 Ga0070694_100021776
891 Ga0070694_100051571
892 Ga0070694_100063118
893 Ga0070694_100083696
894 Ga0070708_100000139
895 Ga0070708_100004438
896 Ga0070708_100029748
897 Ga0070708_100055340
898 Ga0070708_100089636
899 Ga0070708_100194930
900 Ga0070678_100033928
901 Ga0070662_100000519
902 Ga0070662_100085469
903 Ga0070662_100148283
904 Ga0070681_10006714
905 Ga0070681_10054851
906 Ga0070681_10056291
907 Ga0070681_10137131
908 Ga0070681_10306610
909 Ga0068867_100001018
910 Ga0068867_100021380
911 Ga0068867_100027638
912 Ga0068867_100045839
913 Ga0068867_100055291
914 Ga0070685_10023589
915 Ga0070706_100008915
916 Ga0070706_100068355
917 Ga0070706_100221488
918 Ga0070707_100002601
919 Ga0070707_100043081
920 Ga0070707_100060549
921 Ga0070707_100063624
922 Ga0070707_100096750
923 Ga0070707_100118606
924 Ga0070698_100008474
925 Ga0070698_100023833
926 Ga0070698_100050320
927 Ga0070698_100069336
928 Ga0070698_100141745
929 Ga0070698_100144377
930 Ga0070699_100000036
931 Ga0070699_100016584
932 Ga0070699_100058671
933 Ga0070699_100124888
934 Ga0070699_100344708
935 Ga0070679_100002002
936 Ga0070679_100010963
937 Ga0070679_100027003
938 Ga0070679_100027018
939 Ga0070679_100034666
940 Ga0070679_100034702
941 Ga0070679_100095741
942 Ga0070679_100186643
943 Ga0070679_100229681
944 Ga0070684_100070313
945 Ga0070684_100187949
946 Ga0070697_100033376
947 Ga0070697_100036235
948 Ga0070697_100046023
949 Ga0070697_100055590
950 Ga0070697_100135394
951 Ga0070697_100162761
952 Ga0070672_100017678
953 Ga0070672_100019494
954 Ga0070672_100058803
955 Ga0070672_100061964
956 Ga0070686_100010131
957 Ga0070686_100019717
958 Ga0070686_100025630
959 Ga0070686_100057045
960 Ga0070686_100128470
961 Ga0070686_100136476
962 Ga0070695_100000320
963 Ga0070695_100002362
964 Ga0070695_100002927
965 Ga0070695_100003044
966 Ga0070695_100083550
967 Ga0070696_100000430
968 Ga0070696_100001418
969 Ga0070696_100010767
970 Ga0070696_100016443
971 Ga0070696_100016579
972 Ga0070696_100022203
973 Ga0070693_100013285
974 Ga0070693_100034743
975 Ga0070693_100036515
976 Ga0070665_100028705
977 Ga0070704_100000943
978 Ga0070704_100002359
979 Ga0070704_100013149
980 Ga0070704_100017661
981 Ga0070704_100166570
982 Ga0070704_100184768
983 Ga0068855_100015497
984 Ga0068855_100041785
985 Ga0068855_100245904
986 Ga0070664_100000735
987 Ga0070664_100048585
988 Ga0070664_100094714
989 Ga0070664_100183980
990 Ga0070664_100288417
991 Ga0068857_100002618
992 Ga0068857_100010414
993 Ga0068854_100000404
994 Ga0068854_100021591
995 Ga0068856_100059679
996 Ga0068856_100069980
997 Ga0068856_100083511
998 Ga0070702_100021332
999 Ga0068852_100003357
1000 Ga0068852_100019157
1001 Ga0068852_100159452
1002 Ga0068859_100043047
1003 Ga0068859_100043121
1004 Ga0068859_100060674
1005 Ga0068859_100096235
1006 Ga0068859_100158929
1007 Ga0068859_100184208
1008 Ga0068859_100184480
1009 Ga0068859_100186859
1010 Ga0068859_100397086
1011 Ga0068864_100003735
1012 Ga0068864_100012387
1013 Ga0068864_100024237
1014 Ga0068864_100029970
1015 Ga0068864_100302852
1016 Ga0068866_10015975
1017 Ga0068866_10063973
1018 Ga0068861_100025410
1019 Ga0068861_100034319
1020 Ga0068861_100065468
1021 Ga0068861_100100705
1022 Ga0068870_10089608
1023 Ga0068863_100008431
1024 Ga0068863_100012059
1025 Ga0068863_100017115
1026 Ga0068863_100060256
1027 Ga0068863_100303027
1028 Ga0068858_100010849
1029 Ga0068858_100039209
1030 Ga0068858_100151218
1031 Ga0068860_100007627
1032 Ga0068860_100032290
1033 Ga0068860_100053554
1034 Ga0068860_100062010
1035 Ga0068860_100107464
1036 Ga0068860_100152961
1037 Ga0068862_100019047
1038 Ga0068862_100039330
1039 Ga0068862_100045014
1040 Ga0068862_100287977
1041 Ga0081455_10030027
1042 Ga0070716_100064613
1043 Ga0097621_100138569
1044 Ga0097621_100146579
1045 Ga0068871_100074502
1046 Ga0068871_100109705
1047 Ga0075428_100000755
1048 Ga0075428_100010980
1049 Ga0075428_100014029
1050 Ga0075428_100029221
1051 Ga0075428_100056376
1052 Ga0075428_100082505
1053 Ga0075428_100100068
1054 Ga0075428_100288359
1055 Ga0075430_100003468
1056 Ga0075430_100003859
1057 Ga0075430_100018632
1058 Ga0075430_100024063
1059 Ga0075430_100026130
1060 Ga0075430_100082127
1061 Ga0075430_100097994
1062 Ga0075431_100000073
1063 Ga0075431_100006169
1064 Ga0075431_100017961
1065 Ga0075431_100071059
1066 Ga0075431_100081362
1067 Ga0075431_100132699
1068 Ga0075431_100162564
1069 Ga0075433_10000372
1070 Ga0075433_10026633
1071 Ga0075433_10221342
1072 Ga0075434_100007866
1073 Ga0075434_100015045
1074 Ga0075434_100017015
1075 Ga0075434_100055777
1076 Ga0075434_100231794
1077 Ga0075429_100000740
1078 Ga0075429_100013309
1079 Ga0075429_100028549
1080 Ga0075429_100073212
1081 Ga0068865_100003719
1082 Ga0068865_100028034
1083 Ga0068865_100037027
1084 Ga0068865_100048390
1085 Ga0075436_100002988
1086 Ga0075436_100007709
1087 Ga0075436_100012839
1088 Ga0075436_100024381
1089 Ga0097620_100043050
1090 Ga0097620_100043122
1091 Ga0097620_100060674
1092 Ga0097620_100096235
1093 Ga0097620_100158938
1094 Ga0097620_100184199
1095 Ga0097620_100184489
1096 Ga0097620_100186852
1097 Ga0075435_100000667
1098 Ga0075435_100012464
1099 Ga0075435_100027031
1100 Ga0075435_100029801
1101 Ga0105240_10071260
1102 Ga0105240_10224403
1103 Ga0105240_10306592
1104 Ga0111539_10000289
1105 Ga0111539_10006435
1106 Ga0111539_10010182
1107 Ga0111539_10011953
1108 Ga0111539_10029947
1109 Ga0111539_10030826
1110 Ga0111539_10033666
1111 Ga0111539_10048759
1112 Ga0111539_10171652
1113 Ga0111539_10175569
1114 Ga0111539_10239272
1115 Ga0111539_10469394
1116 Ga0105245_10000862
1117 Ga0105245_10010848
1118 Ga0105245_10025039
1119 Ga0105245_10096825
1120 Ga0105245_10198136
1121 Ga0114129_10000258
1122 Ga0114129_10001090
1123 Ga0114129_10004010
1124 Ga0114129_10020737
1125 Ga0114129_10041798
1126 Ga0114129_10043345
1127 Ga0114129_10063058
1128 Ga0114129_10080106
1129 Ga0114129_10298748
1130 Ga0114129_10406989
1131 Ga0105243_10002649
1132 Ga0105243_10011347
1133 Ga0105241_10008265
1134 Ga0105241_10117429
1135 Ga0105242_10005672
1136 Ga0105242_10026973
1137 Ga0105242_10030153
1138 Ga0105242_10057571
1139 Ga0105242_10179162
1140 Ga0105242_10298972
1141 Ga0105248_10001276
1142 Ga0105248_10010516
1143 Ga0105248_10025837
1144 Ga0105248_10029728
1145 Ga0105248_10068034
1146 Ga0105248_10071978
1147 Ga0105248_10074694
1148 Ga0105248_10098075
1149 Ga0105249_10021844
1150 Ga0105249_10092806
1151 Ga0105249_10136748
1152 Ga0105239_10077711
1153 Ga0105239_10120527
1154 Ga0105246_10032259
1155 Ga0105246_10047835
1156 Ga0157373_10007787
1157 Ga0157370_10102413
1158 Ga0157370_10245734
1159 Ga0157370_10295271
1160 Ga0157369_10002331
1161 Ga0157369_10005201
1162 Ga0157369_10174036
1163 Ga0157369_10237771
1164 Ga0157374_10012312
1165 Ga0157374_10026810
1166 Ga0157378_10004772
1167 Ga0157378_10046621
1168 Ga0163162_10006062
1169 Ga0163162_10022026
1170 Ga0163162_10064665
1171 Ga0157372_10004820
1172 Ga0157372_10020923
1173 Ga0157372_10044577
1174 Ga0157372_10158279
1175 Ga0157372_10274867
1176 Ga0157375_10009020
1177 Ga0157375_10145452
1178 Ga0157375_10162475
1179 Ga0157375_10287876
1180 Ga0157375_10337935
1181 Ga0163163_10000013
1182 Ga0163163_10002166
1183 Ga0163163_10005585
1184 Ga0163163_10028969
1185 Ga0163163_10044921
1186 Ga0163163_10152439
1187 Ga0157380_10003445
1188 Ga0157380_10022226
1189 Ga0157380_10036999
1190 Ga0157380_10165759
1191 Ga0157379_10095021
1192 Ga0157379_10173211
1193 Ga0157376_10104980
1194 Ga0157376_10302127
1195 Ga0163161_10010588
1196 Ga0163161_10249784
1197 Ga0197907_10997133
1198 Ga0206356_10025876
1199 Ga0206349_1608838
1200 Ga0206354_11511175
1201 Ga0206353_10829592
1202 Ga0213876_10038370
1203 Ga0224712_10022038
1204 Ga0209673_1024820
1205 Ga0209676_1031619
1206 Ga0209564_1006131
1207 Ga0209256_1002260
1208 Ga0209051_1035428
1209 Ga0207697_10070082
1210 Ga0207653_10000165
1211 Ga0207682_10055304
1212 Ga0207642_10001609
1213 Ga0207680_10033933
1214 Ga0207699_10048990
1215 Ga0207645_10000547
1216 Ga0207645_10038238
1217 Ga0207643_10021696
1218 Ga0207643_10029412
1219 Ga0207705_10005371
1220 Ga0207705_10005668
1221 Ga0207705_10128579
1222 Ga0207705_10141171
1223 Ga0207705_10235397
1224 Ga0207684_10040642
1225 Ga0207684_10065239
1226 Ga0207684_10077808
1227 Ga0207684_10107023
1228 Ga0207707_10001283
1229 Ga0207707_10034064
1230 Ga0207707_10125711
1231 Ga0207695_10011998
1232 Ga0207695_10247505
1233 Ga0207663_10000180
1234 Ga0207660_10000129
1235 Ga0207660_10029376
1236 Ga0207660_10058489
1237 Ga0207662_10018448
1238 Ga0207662_10021115
1239 Ga0207657_10005298
1240 Ga0207657_10012266
1241 Ga0207657_10144561
1242 Ga0207657_10185764
1243 Ga0207649_10042159
1244 Ga0207649_10158844
1245 Ga0207652_10007967
1246 Ga0207652_10023607
1247 Ga0207652_10115133
1248 Ga0207652_10119666
1249 Ga0207652_10210348
1250 Ga0207646_10000640
1251 Ga0207646_10023731
1252 Ga0207646_10030461
1253 Ga0207646_10075482
1254 Ga0207646_10108331
1255 Ga0207646_10301867
1256 Ga0207681_10033958
1257 Ga0207681_10107833
1258 Ga0207681_10163417
1259 Ga0207681_10176911
1260 Ga0207650_10002840
1261 Ga0207650_10019265
1262 Ga0207659_10001924
1263 Ga0207659_10024447
1264 Ga0207659_10035299
1265 Ga0207687_10002401
1266 Ga0207644_10129468
1267 Ga0207644_10202601
1268 Ga0207690_10100649
1269 Ga0207690_10163810
1270 Ga0207690_10191187
1271 Ga0207706_10000011
1272 Ga0207706_10006061
1273 Ga0207706_10006085
1274 Ga0207706_10051608
1275 Ga0207706_10061733
1276 Ga0207686_10000091
1277 Ga0207686_10028556
1278 Ga0207709_10001293
1279 Ga0207670_10014767
1280 Ga0207670_10029633
1281 Ga0207670_10072221
1282 Ga0207669_10004638
1283 Ga0207669_10009940
1284 Ga0207669_10035096
1285 Ga0207704_10000247
1286 Ga0207704_10035074
1287 Ga0207704_10084656
1288 Ga0207691_10007790
1289 Ga0207691_10009430
1290 Ga0207691_10009934
1291 Ga0207691_10015977
1292 Ga0207691_10027431
1293 Ga0207691_10048490
1294 Ga0207711_10115943
1295 Ga0207711_10204613
1296 Ga0207711_10219203
1297 Ga0207711_10262692
1298 Ga0207689_10000755
1299 Ga0207689_10018735
1300 Ga0207689_10075994
1301 Ga0207661_10018901
1302 Ga0207661_10062113
1303 Ga0207661_10082451
1304 Ga0207661_10094759
1305 Ga0207679_10008389
1306 Ga0207679_10013274
1307 Ga0207679_10031003
1308 Ga0207679_10082286
1309 Ga0207679_10240492
1310 Ga0207651_10032144
1311 Ga0207651_10081054
1312 Ga0207651_10109632
1313 Ga0207651_10150675
1314 Ga0207668_10135341
1315 Ga0207640_10037532
1316 Ga0207640_10144093
1317 Ga0207658_10027142
1318 Ga0207658_10081568
1319 Ga0207677_10008458
1320 Ga0207677_10019596
1321 Ga0207703_10016336
1322 Ga0207678_10070716
1323 Ga0207708_10002174
1324 Ga0207708_10012647
1325 Ga0207708_10016107
1326 Ga0207708_10028683
1327 Ga0207708_10108091
1328 Ga0207708_10169452
1329 Ga0207702_10031345
1330 Ga0207702_10040811
1331 Ga0207702_10126238
1332 Ga0207641_10005560
1333 Ga0207641_10008258
1334 Ga0207641_10014650
1335 Ga0207641_10074310
1336 Ga0207641_10132892
1337 Ga0207648_10000206
1338 Ga0207648_10011592
1339 Ga0207648_10020064
1340 Ga0207648_10023696
1341 Ga0207648_10025644
1342 Ga0207648_10059944
1343 Ga0207676_10048989
1344 Ga0207676_10088549
1345 Ga0207674_10001092
1346 Ga0207674_10003781
1347 Ga0207674_10004645
1348 Ga0207675_100004528
1349 Ga0207675_100032715
1350 Ga0207675_100065798
1351 Ga0207675_100075403
1352 Ga0207675_100357219
1353 Ga0207683_10001041
1354 Ga0207683_10042270
1355 Ga0207683_10170434
1356 Ga0207698_10003154
1357 Ga0207698_10014259
1358 Ga0207698_10147450
1359 Ga0207698_10319995
1360 Ga0209981_1004101
1361 Ga0209995_1001004
1362 Ga0209995_1010099
1363 Ga0209968_1002646
1364 Ga0209998_10000196
1365 Ga0209974_10019794
1366 Ga0207428_10000486
1367 Ga0207428_10002067
1368 Ga0207428_10006531
1369 Ga0207428_10033234
1370 Ga0207428_10038059
1371 Ga0207428_10057477
1372 Ga0207428_10086641
1373 Ga0268266_10035823
1374 Ga0268265_10046462
1375 Ga0268264_10043911
1376 Ga0268264_10082208
1377 Ga0268264_10146637
1378 Ga0268264_10170535
1379 Ga0268264_10219765
1380 Ga0268264_10299758
1381 Ga0307515_10039216
1382 Ga0316177_1139426
1383 Ga0316176_1141945
1384 Ga0314311_1012584
1385 Ga0307513_10079612
1386 Ga0307408_100037745
1387 Ga0307408_100092514
1388 Ga0307405_10006401
1389 Ga0307405_10150259
1390 Ga0307413_10118938
1391 Ga0307410_10073266
1392 Ga0307410_10162680
1393 Ga0307406_10027043
1394 Ga0307406_10044982
1395 Ga0307406_10045068
1396 Ga0307407_10067070
1397 Ga0307407_10116191
1398 Ga0307412_10037489
1399 Ga0307412_10202119
1400 Ga0307409_100052465
1401 Ga0307409_100146437
1402 Ga0307416_100031138
1403 Ga0307416_100037030
1404 Ga0307416_100050620
1405 Ga0307416_100066240
1406 Ga0307416_100098557
1407 Ga0307414_10044245
1408 Ga0307414_10092151
1409 Ga0307414_10165503
1410 Ga0307411_10000857
1411 Ga0307411_10016884
1412 Ga0307411_10024336
1413 Ga0307411_10034300
1414 Ga0307411_10049240
1415 Ga0307415_100019717
1416 Ga0307415_100115331
1417 Ga0373941_0004071
1418 Ga0373954_0040204
1419 Ga0373947_0040493
1420 Ga0373925_0129581
1421 Ga0395899_0010696
1422 Ga0395899_0023922
1423 Ga0395900_0015385
1424 Ga0395900_0029254
1425 Ga0395898_0104695
1426 Ga0395898_0349143
1427 Ga0395905_0012683
1428 Ga0395905_0020629
1429 Ga0395905_0029562
1430 Ga0395905_0157491
1431 Ga0395901_0003258
1432 Ga0395901_0019119
1433 Ga0395901_0236123
1434 Ga0436365_1772995
1435 Ga0451849_1239114
1436 Ga0451853_0446380
1437 Ga0439448_0029477
1438 Ga0439449_0012771
1439 Ga0439449_0073233
1440 Ga0439446_0004520
1441 Ga0439434_0030450
1442 Ga0451577_0037788
1443 Ga0451576_0003478
1444 Ga0451576_0012410
1445 Ga0451576_0013702
1446 Ga0451576_0032157
1447 Ga0451576_0042006
1448 Ga0451576_0088335
1449 Ga0451576_0174462
1450 Ga0451576_0256009
1451 Ga0495580_0113359
1452 Ga0495608_0113156
1453 Ga0495663_0036438
1454 Ga0495656_0000015
1455 Ga0495656_0105500
1456 Ga0495659_0001317
1457 Ga0495659_0013210
1458 Ga0495649_0007903
1459 Ga0495636_0106297
1460 Ga0495684_0013993
1461 Ga0496102_0063219
1462 Ga0496106_0221611
1463 Ga0496113_0083265
1464 Ga0496114_0128582
1465 Ga0501031_0055977
1466 Ga0501033_0012784
1467 Ga0501033_0043741
1468 Ga0501036_0177925
1469 Ga0501041_0125578
1470 Ga0501042_0117151
1471 Ga0501043_0207035
1472 Ga0501047_0213141
1473 Ga0501048_0013534
1474 Ga0501067_0023272
1475 Ga0501068_0000308
1476 Ga0501070_0011289
1477 Ga0501070_0035769
1478 Ga0501071_0068618
1479 Ga0501072_0082372
1480 Ga0501072_0152152
1481 Ga0501073_0002899
1482 Ga0501074_0017705
1483 Ga0501074_0100673
1484 Ga0501075_0094755
1485 Ga0501076_0025093
1486 Ga0501077_0003850
1487 Ga0501077_0005455
1488 Ga0501235_006829
1489 Ga0501221_001131
1490 Ga0501225_0052395
1491 Ga0501079_0017831
1492 Ga0501079_0107062
1493 Ga0501079_0290711
1494 Ga0501079_0303931
1495 Ga0501080_0016685
1496 Ga0501081_0041494
1497 Ga0501081_0080132
1498 Ga0501083_0095992
1499 Ga0501044_0008742
1500 Ga0501045_0005386
1501 Ga0501045_0021535
1502 Ga0501212_002093
1503 nmdc:mga05p37_12_c1
1504 nmdc:mga05p37_139730_c1
1505 nmdc:mga05p37_1421_c1
1506 nmdc:mga05p37_275124_c1
1507 nmdc:mga05p37_60683_c1
1508 nmdc:mga05p37_64054_c1
1509 nmdc:mga09592_156971_c1
1510 nmdc:mga09592_242991_c1
1511 nmdc:mga09592_29587_c1
1512 nmdc:mga09592_43455_c1
1513 nmdc:mga09592_54065_c1
1514 nmdc:mga09592_6076_c1
1515 nmdc:mga09592_71219_c1
1516 nmdc:mga0qj67_1465_c1
1517 nmdc:mga0qj67_175390_c1
1518 nmdc:mga0qj67_246133_c1
1519 nmdc:mga0qj67_8381_c1
1520 nmdc:mga0qj67_97826_c1
1521 nmdc:mga06r32_124055_c1
1522 nmdc:mga06r32_147041_c1
1523 nmdc:mga06r32_1920_c1
1524 nmdc:mga06r32_45197_c1
1525 nmdc:mga06r32_51_c2
1526 nmdc:mga06r32_65852_c1
1527 nmdc:mga08y16_1406_c1
1528 nmdc:mga08y16_154981_c1
1529 nmdc:mga08y16_1955_c1
1530 nmdc:mga08y16_31179_c1
1531 nmdc:mga08y16_47049_c1
1532 nmdc:mga08y16_52361_c1
1533 nmdc:mga08y16_63248_c1
1534 nmdc:mga08y16_69551_c1
1535 nmdc:mga0n895_10108_c1
1536 nmdc:mga0n895_13520_c1
1537 nmdc:mga0n895_146005_c1
1538 nmdc:mga0n895_252199_c1
1539 nmdc:mga0n895_4973_c1
1540 nmdc:mga0rr50_24370_c1
1541 nmdc:mga0rr50_247_c1
1542 nmdc:mga0rr50_290_c1
1543 nmdc:mga0rr50_3830_c1
1544 nmdc:mga08x19_114047_c1
1545 nmdc:mga08x19_38184_c1
1546 nmdc:mga08x19_4737_c1
1547 nmdc:mga0a205_124167_c1
1548 nmdc:mga0a205_16297_c1
1549 nmdc:mga0a205_168852_c1
1550 nmdc:mga0a205_2508_c1
1551 nmdc:mga0a205_287489_c1
1552 nmdc:mga0a205_48512_c1
1553 nmdc:mga0a205_57991_c1
1554 Ga0590077_004907
1555 Ga0501082_0134278
1556 Ga0530510_0066755
1557 2572256013
1558 2644530274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c1v-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from paracoccus pantotrophus - mixed valence form 0.6759 206 400
6fu3-assembly1.cif.gz_B structure of the mixed-valence, active form, of cytochrome c peroxidase from obligate human pathogenic bacterium neisseria gonorrhoeae 0.6703 213 400
6e1c-assembly2.cif.gz_B crystal structure of a maug-like protein associated with microbial copper homeostasis 0.656 209 401
3o5c-assembly2.cif.gz_C cytochrome c peroxidase bccp of shewanella oneidensis 0.6527 209 400
3hq8-assembly1.cif.gz_B ccpa from g. sulfurreducens s134p/v135k variant 0.6518 267 400
ID Description Score Start End Superfamily
af_Q93VA3_71_175_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7811 294 314 1.10.760.10
3o5cC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6583 284 400 1.10.760.10
4aaoA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6416 276 401 1.10.760.10
4fa4B02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6215 292 400 1.10.760.10
1zzhC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.614 291 401 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A356TE41-F1-model_v4 Cytochrome c domain-containing protein 0.9794 274 401 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A7V9HWV0-F1-model_v4 Cytochrome c domain-containing protein 0.9779 49 220 GO:0016020
AF-A0A3N5YPE5-F1-model_v4 Cytochrome c domain-containing protein 0.9729 52 183
AF-A0A537A9X0-F1-model_v4 Cytochrome c domain-containing protein 0.9709 346 401 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A328ZMV2-F1-model_v4 deleted 0.9688 346 401

Map