F480341

General Info

Members Datasets Scaffolds Average Seq Length
776 466 702 142

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_1307712_c1|nmdc:mga0qj67_1307712_c1_89_544
Length 151
Sequence MQKGYHMKMSPVLRAALVALVAFAAAPLSQARADEGFVTLTIYKAGWIIGGSGGSGVLQFRGRTYPLSTGGLDYGLVFGGSKTVLRGRVSNIWRPSDVAGVYGAAGAGLAVGAGARAIVLTNQKGAVLELSGHQVGLMANADLSGLAITMR

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
11 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
12 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
13 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
14 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
15 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
16 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
17 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
18 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
19 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
20 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
21 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
22 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
23 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
24 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
25 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
26 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
27 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
28 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
29 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
30 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
31 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
32 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
33 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
34 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
35 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
36 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
37 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
38 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
39 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
40 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
41 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
42 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
43 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
44 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
45 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
46 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
47 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
48 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
49 2904699407
50 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
51 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
52 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
53 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
54 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
55 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
56 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
57 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
58 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
59 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
60 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
61 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
62 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
63 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
64 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
65 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
66 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
67 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
68 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
69 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
70 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
73 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
78 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
79 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
85 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
95 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
98 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
99 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
100 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
101 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
102 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
105 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
106 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
107 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
108 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
109 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
110 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
111 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
112 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
113 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
114 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
115 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
116 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
125 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
126 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
127 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
128 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
129 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
130 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
131 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
132 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
133 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
134 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
135 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
136 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
137 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
138 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
139 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
140 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
141 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
142 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
143 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
144 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
145 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
146 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
147 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
148 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
149 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
150 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
151 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
152 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
153 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
154 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
155 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
156 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
157 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
158 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
159 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
161 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
162 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
167 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
168 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
169 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
170 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
174 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
175 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
176 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
179 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
184 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
185 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
186 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
187 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
188 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
189 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
190 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
191 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
192 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
193 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
194 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
198 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
258 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
259 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
260 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
261 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
262 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
263 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
267 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
268 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
269 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
270 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
271 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
272 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
273 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
274 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
275 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
276 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
277 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
278 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
279 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
280 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
281 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
282 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
283 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
284 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
285 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
286 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
287 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
288 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
289 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
292 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
294 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
295 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
296 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
297 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
298 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
299 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
300 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
301 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
302 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
303 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
304 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
305 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
306 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
307 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
308 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
309 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
310 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
311 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
312 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
313 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
314 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
315 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
318 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
319 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
320 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
321 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
322 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
323 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
324 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
325 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
326 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
327 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
328 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
329 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
330 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
331 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
332 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
333 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
334 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
335 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
344 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
345 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
346 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
347 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
348 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
349 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
350 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
351 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
352 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
353 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
354 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
355 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
356 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
359 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
360 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
361 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
369 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
370 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
371 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
372 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
375 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
376 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
381 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
382 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
383 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
384 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
396 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
399 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
400 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
401 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
402 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
403 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
404 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
405 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
406 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
407 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
408 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
409 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
410 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
411 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
412 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
413 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
414 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
415 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
416 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
417 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
418 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
419 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
420 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
421 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
422 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
423 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
424 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
425 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
426 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
427 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
428 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
429 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
430 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
431 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
432 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
433 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
434 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
435 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
436 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
437 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
438 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
439 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
440 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
441 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
442 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
443 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
444 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
445 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
446 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
447 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
448 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
449 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
450 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
451 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
452 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
453 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
454 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
455 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
456 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
457 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
458 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
459 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
460 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
461 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
462 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
463 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
464 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
465 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
466 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.45
Metatranscriptomes 0.13
Isolates 9.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.21
Nodule 6.7
Rhizoplane 3.61
Rhizosphere 70.23
Stem 0
Stem Tuber 0
Unclassified 8.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003892 3300001979 Bacteria 6483
2 JGI24737J22298_10002261 3300001990 Bacteria 6862
3 JGI24735J21928_10011192 3300002067 Bacteria 2848
4 JGI25406J46586_10000537 3300003203 Bacteria 17737
5 JGI25153J46596_10002167 3300003215 Bacteria 11467
6 JGI25153J46596_10002765 3300003215 Bacteria 9975
7 JGI25153J46596_10004161 3300003215 Bacteria 7854
8 JGI25153J46596_10090569 3300003215 Bacteria 740
9 rootH1_10097632 3300003323 Bacteria 3903
10 JGI25404J52841_10065107 3300003659 Bacteria 763
11 Ga0055542_1030310 3300003762 Bacteria 698
12 Ga0055531_10002385 3300003794 Bacteria 12625
13 Ga0065165_1010988 3300005262 Bacteria 3838
14 Ga0070658_10135122 3300005327 Bacteria 2057
15 Ga0070658_11156746 3300005327 Bacteria 673
16 Ga0070683_100434494 3300005329 Bacteria 1252
17 Ga0070690_100830315 3300005330 Bacteria 719
18 Ga0068869_100316626 3300005334 Bacteria 1264
19 Ga0068869_100469752 3300005334 Bacteria 1046
20 Ga0070666_10214660 3300005335 Bacteria 1356
21 Ga0068868_100236465 3300005338 Bacteria 1534
22 Ga0070660_100727213 3300005339 Bacteria 833
23 Ga0070660_100802521 3300005339 Bacteria 792
24 Ga0070660_101523996 3300005339 Bacteria 569
25 Ga0070691_10057371 3300005341 Bacteria 1868
26 Ga0070687_100896300 3300005343 Bacteria 635
27 Ga0070661_100190089 3300005344 Bacteria 1566
28 Ga0070692_10536820 3300005345 Bacteria 764
29 Ga0070668_100045408 3300005347 Bacteria 3370
30 Ga0070668_100107116 3300005347 Bacteria 2222
31 Ga0070668_100712847 3300005347 Bacteria 886
32 Ga0070669_101702678 3300005353 Bacteria 550
33 Ga0070674_100333687 3300005356 Bacteria 1219
34 Ga0070674_100577090 3300005356 Bacteria 947
35 Ga0070674_101130443 3300005356 Bacteria 693
36 Ga0070673_100140640 3300005364 Bacteria 2035
37 Ga0070673_100391024 3300005364 Bacteria 1242
38 Ga0070659_100152007 3300005366 Bacteria 1889
39 Ga0070667_100323999 3300005367 Bacteria 1391
40 Ga0070667_101487451 3300005367 Bacteria 636
41 Ga0070709_10001480 3300005434 Bacteria 12685
42 Ga0070709_10081253 3300005434 Bacteria 2115
43 Ga0070709_10793587 3300005434 Bacteria 743
44 Ga0070714_100211699 3300005435 Bacteria 1777
45 Ga0070714_100408882 3300005435 Bacteria 1284
46 Ga0070713_100007306 3300005436 Bacteria 7737
47 Ga0070713_100112219 3300005436 Bacteria 2379
48 Ga0070710_10002746 3300005437 Bacteria 8381
49 Ga0070711_100004779 3300005439 Bacteria 8027
50 Ga0070711_100052100 3300005439 Bacteria 2815
51 Ga0070705_100047711 3300005440 Bacteria 2477
52 Ga0070700_100012056 3300005441 Bacteria 4806
53 Ga0070694_100108791 3300005444 Bacteria 1972
54 Ga0070694_100290859 3300005444 Bacteria 1249
55 Ga0070663_100007141 3300005455 Bacteria 6780
56 Ga0070663_100025005 3300005455 Bacteria 4027
57 Ga0070663_100038261 3300005455 Bacteria 3346
58 Ga0070663_100045122 3300005455 Bacteria 3112
59 Ga0070663_100055286 3300005455 Bacteria 2840
60 Ga0070662_100008152 3300005457 Bacteria 6825
61 Ga0070662_100136069 3300005457 Bacteria 1900
62 Ga0070681_10110202 3300005458 Bacteria 2692
63 Ga0070681_10200906 3300005458 Bacteria 1911
64 Ga0070681_10915449 3300005458 Bacteria 795
65 Ga0068867_100444192 3300005459 Bacteria 1103
66 Ga0068867_100494084 3300005459 Bacteria 1051
67 Ga0070685_10261560 3300005466 Bacteria 1151
68 Ga0070685_11405128 3300005466 Bacteria 536
69 Ga0070706_100827484 3300005467 Bacteria 856
70 Ga0070706_101623192 3300005467 Bacteria 590
71 Ga0070698_100321241 3300005471 Bacteria 1479
72 Ga0070698_101330770 3300005471 Bacteria 669
73 Ga0070699_100085656 3300005518 Bacteria 2749
74 Ga0070699_100249187 3300005518 Bacteria 1586
75 Ga0070679_100246697 3300005530 Bacteria 1742
76 Ga0070679_100897946 3300005530 Bacteria 829
77 Ga0070684_100067369 3300005535 Bacteria 3144
78 Ga0070684_100488673 3300005535 Bacteria 1140
79 Ga0070697_100435207 3300005536 Bacteria 1141
80 Ga0068853_100189009 3300005539 Bacteria 1870
81 Ga0068853_100221902 3300005539 Bacteria 1727
82 Ga0068853_100285592 3300005539 Bacteria 1522
83 Ga0068853_101235143 3300005539 Bacteria 722
84 Ga0070686_101479961 3300005544 Bacteria 572
85 Ga0070695_100164920 3300005545 Bacteria 1558
86 Ga0070695_100400366 3300005545 Bacteria 1040
87 Ga0070696_100024642 3300005546 Bacteria 4090
88 Ga0070665_100036014 3300005548 Bacteria 4979
89 Ga0070665_100073367 3300005548 Bacteria 3428
90 Ga0070665_100084019 3300005548 Bacteria 3188
91 Ga0070665_100128430 3300005548 Bacteria 2538
92 Ga0070665_100273358 3300005548 Bacteria 1691
93 Ga0070704_100337991 3300005549 Bacteria 1267
94 Ga0070704_100355047 3300005549 Bacteria 1239
95 Ga0068855_100067805 3300005563 Bacteria 4155
96 Ga0068855_100070033 3300005563 Bacteria 4081
97 Ga0068855_100082440 3300005563 Bacteria 3727
98 Ga0068855_100347813 3300005563 Bacteria 1633
99 Ga0070664_100054305 3300005564 Bacteria 3398
100 Ga0070664_101031220 3300005564 Bacteria 774
101 Ga0068857_100003393 3300005577 Bacteria 13264
102 Ga0068857_100079814 3300005577 Bacteria 2921
103 Ga0068854_100021016 3300005578 Bacteria 4424
104 Ga0068854_100924527 3300005578 Bacteria 768
105 Ga0068856_100016560 3300005614 Bacteria 7135
106 Ga0068856_100039259 3300005614 Bacteria 4648
107 Ga0068856_100175466 3300005614 Bacteria 2155
108 Ga0070702_100053995 3300005615 Bacteria 2310
109 Ga0068852_100053433 3300005616 Bacteria 3477
110 Ga0068852_100175043 3300005616 Bacteria 2014
111 Ga0068859_100141462 3300005617 Bacteria 2480
112 Ga0068859_101253997 3300005617 Bacteria 817
113 Ga0068864_100228105 3300005618 Bacteria 1721
114 Ga0068866_10085395 3300005718 Bacteria 1706
115 Ga0068861_100073048 3300005719 Bacteria 2663
116 Ga0068861_100088946 3300005719 Bacteria 2433
117 Ga0068861_100433764 3300005719 Bacteria 1173
118 Ga0068851_10001384 3300005834 Bacteria 10587
119 Ga0068870_10801114 3300005840 Bacteria 658
120 Ga0068863_100073813 3300005841 Bacteria 3227
121 Ga0068858_100111546 3300005842 Bacteria 2554
122 Ga0068858_100244731 3300005842 Bacteria 1702
123 Ga0068858_101684626 3300005842 Bacteria 626
124 Ga0068860_100031004 3300005843 Bacteria 5140
125 Ga0068860_100141254 3300005843 Bacteria 2314
126 Ga0068860_100839892 3300005843 Bacteria 933
127 Ga0068862_100451117 3300005844 Bacteria 1212
128 Ga0068862_100551507 3300005844 Bacteria 1101
129 Ga0081455_10038301 3300005937 Bacteria 4246
130 Ga0081538_10185129 3300005981 Bacteria 884
131 Ga0081540_1008661 3300005983 Bacteria 7087
132 Ga0081540_1010412 3300005983 Bacteria 6303
133 Ga0081540_1015069 3300005983 Bacteria 4906
134 Ga0081540_1029763 3300005983 Bacteria 3037
135 Ga0081540_1095496 3300005983 Bacteria 1295
136 Ga0081540_1204958 3300005983 Bacteria 714
137 Ga0081539_10000191 3300005985 Bacteria 142387
138 Ga0081539_10000321 3300005985 Bacteria 106887
139 Ga0081539_10037459 3300005985 Bacteria 2890
140 Ga0070717_10000895 3300006028 Bacteria 19768
141 Ga0070717_10127614 3300006028 Bacteria 2185
142 Ga0070717_10154975 3300006028 Bacteria 1984
143 Ga0075365_10051819 3300006038 Bacteria 2712
144 Ga0075365_10561352 3300006038 Bacteria 807
145 Ga0075368_10003646 3300006042 Bacteria 5161
146 Ga0075368_10103185 3300006042 Bacteria 1172
147 Ga0075363_100101566 3300006048 Bacteria 1592
148 Ga0075363_100122118 3300006048 Bacteria 1455
149 Ga0075364_10097811 3300006051 Bacteria 1952
150 Ga0075364_10190464 3300006051 Bacteria 1389
151 Ga0075364_10441726 3300006051 Bacteria 889
152 Ga0070715_10054737 3300006163 Bacteria 1729
153 Ga0070716_100001956 3300006173 Bacteria 9361
154 Ga0070712_100131999 3300006175 Bacteria 1894
155 Ga0070712_100295268 3300006175 Bacteria 1310
156 Ga0070712_101383035 3300006175 Bacteria 614
157 Ga0075362_10004938 3300006177 Bacteria 4833
158 Ga0075367_10010837 3300006178 Bacteria 4804
159 Ga0075367_10048147 3300006178 Bacteria 2510
160 Ga0075366_10072660 3300006195 Bacteria 2050
161 Ga0075366_10535437 3300006195 Bacteria 725
162 Ga0097621_100061594 3300006237 Bacteria 3078
163 Ga0097621_100128040 3300006237 Bacteria 2158
164 Ga0075370_10574346 3300006353 Bacteria 682
165 Ga0075428_100041253 3300006844 Bacteria 5076
166 Ga0075428_100090126 3300006844 Bacteria 3345
167 Ga0075430_100279594 3300006846 Bacteria 1381
168 Ga0075430_100913868 3300006846 Bacteria 723
169 Ga0075431_100044037 3300006847 Bacteria 4603
170 Ga0075431_100221419 3300006847 Bacteria 1930
171 Ga0075434_100092874 3300006871 Bacteria 3020
172 Ga0075434_100247825 3300006871 Bacteria 1801
173 Ga0075429_100023616 3300006880 Bacteria 5336
174 Ga0075436_100189490 3300006914 Bacteria 1455
175 Ga0075436_101489080 3300006914 Bacteria 514
176 Ga0097620_100141459 3300006931 Bacteria 2480
177 Ga0097620_101253827 3300006931 Bacteria 817
178 Ga0099824_1010822 3300006942 Bacteria 10568
179 Ga0099823_1057810 3300006944 Bacteria 2117
180 Ga0075435_100070641 3300007076 Bacteria 2850
181 Ga0075435_100133886 3300007076 Bacteria 2075
182 Ga0075435_100215345 3300007076 Bacteria 1630
183 Ga0075435_100257757 3300007076 Bacteria 1485
184 Ga0105240_10012741 3300009093 Bacteria 11589
185 Ga0105240_10039036 3300009093 Bacteria 6083
186 Ga0105240_10457491 3300009093 Bacteria 1427
187 Ga0105240_11463039 3300009093 Bacteria 717
188 Ga0111539_10075550 3300009094 Bacteria 3969
189 Ga0111539_10495629 3300009094 Bacteria 1423
190 Ga0111539_12842870 3300009094 Bacteria 561
191 Ga0105245_11761526 3300009098 Bacteria 672
192 Ga0105247_10278045 3300009101 Bacteria 1154
193 Ga0114129_10129588 3300009147 Bacteria 3466
194 Ga0114129_10267960 3300009147 Bacteria 2286
195 Ga0105243_10051227 3300009148 Bacteria 3265
196 Ga0105243_11890484 3300009148 Bacteria 629
197 Ga0105241_10002223 3300009174 Bacteria 14590
198 Ga0105241_10020943 3300009174 Bacteria 4833
199 Ga0105241_10989410 3300009174 Bacteria 786
200 Ga0105242_10203844 3300009176 Bacteria 1758
201 Ga0105242_11562998 3300009176 Bacteria 692
202 Ga0105248_10059889 3300009177 Bacteria 4276
203 Ga0105237_10062535 3300009545 Bacteria 3722
204 Ga0105238_10005872 3300009551 Bacteria 12161
205 Ga0105238_10057859 3300009551 Bacteria 3886
206 Ga0105238_10061254 3300009551 Bacteria 3766
207 Ga0105249_10131989 3300009553 Bacteria 2386
208 Ga0105249_10219709 3300009553 Bacteria 1869
209 Ga0105249_10315199 3300009553 Bacteria 1574
210 Ga0105249_10601952 3300009553 Bacteria 1154
211 Ga0105249_11056120 3300009553 Bacteria 882
212 Ga0105249_11718276 3300009553 Bacteria 700
213 Ga0105239_10006765 3300010375 Bacteria 13236
214 Ga0105239_10221992 3300010375 Bacteria 2119
215 Ga0105239_10999775 3300010375 Bacteria 962
216 Ga0105239_12532871 3300010375 Bacteria 598
217 Ga0157338_1090572 3300012515 Bacteria 509
218 Ga0157369_10137510 3300013105 Bacteria 2586
219 Ga0157369_10336821 3300013105 Bacteria 1567
220 Ga0157374_10161013 3300013296 Bacteria 2186
221 Ga0157374_11079286 3300013296 Bacteria 823
222 Ga0157378_10128596 3300013297 Bacteria 2342
223 Ga0157378_11280768 3300013297 Bacteria 774
224 Ga0157378_13173337 3300013297 Bacteria 510
225 Ga0163162_11799740 3300013306 Bacteria 700
226 Ga0157375_10070643 3300013308 Bacteria 3502
227 Ga0157375_11706981 3300013308 Bacteria 746
228 Ga0163163_10380009 3300014325 Bacteria 1470
229 Ga0163163_11440234 3300014325 Bacteria 750
230 Ga0157380_10064387 3300014326 Bacteria 2943
231 Ga0157380_10168890 3300014326 Bacteria 1909
232 Ga0157380_10615551 3300014326 Bacteria 1077
233 Ga0157380_10788977 3300014326 Bacteria 966
234 Ga0157377_10094303 3300014745 Bacteria 1773
235 Ga0157377_10096429 3300014745 Bacteria 1754
236 Ga0157376_10109383 3300014969 Bacteria 2430
237 Ga0163161_10008057 3300017792 Bacteria 7288
238 Ga0163161_10440362 3300017792 Bacteria 1052
239 Ga0214544_1000001 3300021320 Bacteria 783667
240 Ga0214542_1000005 3300021321 Bacteria 389646
241 Ga0214545_1000003 3300021324 Bacteria 720274
242 Ga0214543_1000002 3300021327 Bacteria 712733
243 Ga0213873_10020668 3300021358 Bacteria 1540
244 Ga0213876_10129578 3300021384 Bacteria 1340
245 Ga0207425_1006205 3300025245 Bacteria 3297
246 Ga0209148_1000253 3300025254 Bacteria 84643
247 Ga0209455_1001670 3300025272 Bacteria 9565
248 Ga0209455_1001785 3300025272 Bacteria 9087
249 Ga0209455_1020575 3300025272 Bacteria 1301
250 Ga0209564_1023373 3300025295 Bacteria 2150
251 Ga0209758_1000026 3300025297 Bacteria 582706
252 Ga0209758_1000318 3300025297 Bacteria 92807
253 Ga0209758_1013863 3300025297 Bacteria 4347
254 Ga0209758_1035491 3300025297 Bacteria 1965
255 Ga0209050_1075379 3300025298 Bacteria 737
256 Ga0209256_1006168 3300025299 Bacteria 6477
257 Ga0209257_1002140 3300025304 Bacteria 20574
258 Ga0209257_1074936 3300025304 Bacteria 882
259 Ga0207697_10034977 3300025315 Bacteria 2056
260 Ga0207656_10015578 3300025321 Bacteria 2944
261 Ga0207653_10039653 3300025885 Bacteria 1542
262 Ga0207692_10003254 3300025898 Bacteria 6322
263 Ga0207642_10158139 3300025899 Bacteria 1214
264 Ga0207710_10019712 3300025900 Bacteria 2879
265 Ga0207710_10222023 3300025900 Bacteria 938
266 Ga0207680_10071688 3300025903 Bacteria 2148
267 Ga0207680_10200674 3300025903 Bacteria 1359
268 Ga0207647_10119523 3300025904 Bacteria 1554
269 Ga0207647_10129293 3300025904 Bacteria 1485
270 Ga0207647_10353368 3300025904 Bacteria 832
271 Ga0207699_10000473 3300025906 Bacteria 20435
272 Ga0207699_10151845 3300025906 Bacteria 1533
273 Ga0207645_10173023 3300025907 Bacteria 1416
274 Ga0207643_10575768 3300025908 Bacteria 724
275 Ga0207705_10258917 3300025909 Bacteria 1328
276 Ga0207684_10705958 3300025910 Bacteria 857
277 Ga0207654_10000069 3300025911 Bacteria 67460
278 Ga0207654_10038930 3300025911 Bacteria 2671
279 Ga0207654_10599191 3300025911 Bacteria 786
280 Ga0207707_10359204 3300025912 Bacteria 1254
281 Ga0207707_10841541 3300025912 Bacteria 762
282 Ga0207695_10000713 3300025913 Bacteria 64808
283 Ga0207695_11295303 3300025913 Bacteria 609
284 Ga0207671_10085077 3300025914 Bacteria 2376
285 Ga0207671_10271567 3300025914 Bacteria 1336
286 Ga0207693_10069543 3300025915 Bacteria 2755
287 Ga0207693_10348729 3300025915 Bacteria 1158
288 Ga0207663_10002959 3300025916 Bacteria 8211
289 Ga0207663_10067234 3300025916 Bacteria 2297
290 Ga0207660_10385501 3300025917 Bacteria 1127
291 Ga0207657_10178308 3300025919 Bacteria 1718
292 Ga0207657_10305876 3300025919 Bacteria 1259
293 Ga0207649_10835634 3300025920 Bacteria 720
294 Ga0207652_10411890 3300025921 Bacteria 1219
295 Ga0207652_10532902 3300025921 Bacteria 1056
296 Ga0207681_10794408 3300025923 Bacteria 790
297 Ga0207694_10000155 3300025924 Bacteria 70678
298 Ga0207694_10137232 3300025924 Bacteria 1965
299 Ga0207694_10219091 3300025924 Bacteria 1552
300 Ga0207650_10541183 3300025925 Bacteria 976
301 Ga0207687_10364271 3300025927 Bacteria 1181
302 Ga0207700_10010008 3300025928 Bacteria 5958
303 Ga0207700_10057224 3300025928 Bacteria 2939
304 Ga0207664_10156426 3300025929 Bacteria 1941
305 Ga0207706_10019156 3300025933 Bacteria 6155
306 Ga0207670_10386657 3300025936 Bacteria 1116
307 Ga0207669_10006895 3300025937 Bacteria 5225
308 Ga0207669_10288689 3300025937 Bacteria 1241
309 Ga0207665_10004551 3300025939 Bacteria 9202
310 Ga0207665_10114431 3300025939 Bacteria 1899
311 Ga0207665_10179515 3300025939 Bacteria 1533
312 Ga0207691_10471151 3300025940 Bacteria 1068
313 Ga0207711_10441398 3300025941 Bacteria 1211
314 Ga0207689_10276723 3300025942 Bacteria 1390
315 Ga0207689_10592172 3300025942 Bacteria 933
316 Ga0207661_10382793 3300025944 Bacteria 1273
317 Ga0207679_10361660 3300025945 Bacteria 1268
318 Ga0207667_10016768 3300025949 Bacteria 8265
319 Ga0207667_10022616 3300025949 Bacteria 6939
320 Ga0207667_10141920 3300025949 Bacteria 2473
321 Ga0207667_10326271 3300025949 Bacteria 1567
322 Ga0207651_10207912 3300025960 Bacteria 1573
323 Ga0207651_10378996 3300025960 Bacteria 1198
324 Ga0207651_11967019 3300025960 Bacteria 525
325 Ga0207712_10016558 3300025961 Bacteria 4777
326 Ga0207712_10170558 3300025961 Bacteria 1700
327 Ga0207712_10225932 3300025961 Bacteria 1500
328 Ga0207668_10052856 3300025972 Bacteria 2812
329 Ga0207668_10169567 3300025972 Bacteria 1710
330 Ga0207668_10484283 3300025972 Bacteria 1061
331 Ga0207668_11263079 3300025972 Bacteria 664
332 Ga0207640_10098285 3300025981 Bacteria 2046
333 Ga0207640_10124609 3300025981 Bacteria 1853
334 Ga0207640_11149866 3300025981 Bacteria 688
335 Ga0207658_10281763 3300025986 Bacteria 1425
336 Ga0207658_10466762 3300025986 Bacteria 1120
337 Ga0207703_10030186 3300026035 Bacteria 4282
338 Ga0207703_10075684 3300026035 Bacteria 2791
339 Ga0207703_12111711 3300026035 Bacteria 539
340 Ga0207639_10004418 3300026041 Bacteria 9486
341 Ga0207639_10016402 3300026041 Bacteria 5239
342 Ga0207639_10046034 3300026041 Bacteria 3290
343 Ga0207639_10297464 3300026041 Bacteria 1425
344 Ga0207678_10017837 3300026067 Bacteria 6233
345 Ga0207678_10044698 3300026067 Bacteria 3831
346 Ga0207678_10095290 3300026067 Bacteria 2543
347 Ga0207678_10096836 3300026067 Bacteria 2522
348 Ga0207678_10104256 3300026067 Bacteria 2420
349 Ga0207678_10145188 3300026067 Bacteria 2025
350 Ga0207708_10010066 3300026075 Bacteria 7020
351 Ga0207708_10223904 3300026075 Bacteria 1508
352 Ga0207708_10545264 3300026075 Bacteria 977
353 Ga0207702_10000022 3300026078 Bacteria 192961
354 Ga0207702_10028437 3300026078 Bacteria 4647
355 Ga0207702_10184421 3300026078 Bacteria 1924
356 Ga0207702_10517667 3300026078 Bacteria 1164
357 Ga0207702_10902350 3300026078 Bacteria 876
358 Ga0207641_10227431 3300026088 Bacteria 1732
359 Ga0207648_10060285 3300026089 Bacteria 3309
360 Ga0207676_10320570 3300026095 Bacteria 1422
361 Ga0207674_10051668 3300026116 Bacteria 4194
362 Ga0207674_10111619 3300026116 Bacteria 2708
363 Ga0207674_10258347 3300026116 Bacteria 1689
364 Ga0207674_10954906 3300026116 Bacteria 826
365 Ga0207675_100049166 3300026118 Bacteria 3936
366 Ga0207675_100052206 3300026118 Bacteria 3815
367 Ga0207675_100123415 3300026118 Bacteria 2452
368 Ga0207683_10073580 3300026121 Bacteria 3023
369 Ga0207683_10416397 3300026121 Bacteria 1237
370 Ga0207698_10073528 3300026142 Bacteria 2722
371 Ga0209389_1000090 3300027296 Bacteria 83470
372 Ga0209389_1000119 3300027296 Bacteria 70614
373 Ga0209589_1000010 3300027357 Bacteria 237657
374 Ga0209489_100011 3300027361 Bacteria 244710
375 Ga0209489_100385 3300027361 Bacteria 79532
376 Ga0209700_100013 3300027363 Bacteria 341906
377 Ga0209813_10002330 3300027866 Bacteria 4351
378 Ga0207428_10278165 3300027907 Bacteria 1243
379 Ga0207428_11085791 3300027907 Bacteria 560
380 Ga0268266_10000446 3300028379 Bacteria 61283
381 Ga0268266_10026030 3300028379 Bacteria 4976
382 Ga0268266_10056880 3300028379 Bacteria 3364
383 Ga0268266_10120842 3300028379 Bacteria 2331
384 Ga0268266_10812016 3300028379 Bacteria 903
385 Ga0268266_11719784 3300028379 Bacteria 602
386 Ga0268265_11363567 3300028380 Bacteria 710
387 Ga0268265_11948575 3300028380 Bacteria 594
388 Ga0268264_10044665 3300028381 Bacteria 3676
389 Ga0268264_10200235 3300028381 Bacteria 1826
390 Ga0268264_10406693 3300028381 Bacteria 1309
391 Ga0307517_10001444 3300028786 Bacteria 39936
392 Ga0307515_10021507 3300028794 Bacteria 11433
393 Ga0265330_10126316 3300031235 Bacteria 1089
394 Ga0265328_10095158 3300031239 Bacteria 1101
395 Ga0265339_10000828 3300031249 Bacteria 23823
396 Ga0265316_10613527 3300031344 Bacteria 771
397 Ga0307513_10414716 3300031456 Bacteria 1078
398 Ga0307508_10000184 3300031616 Bacteria 75613
399 Ga0307508_10200344 3300031616 Bacteria 1597
400 Ga0265342_10480383 3300031712 Bacteria 635
401 Ga0307516_10650731 3300031730 Bacteria 709
402 Ga0307413_10611089 3300031824 Bacteria 894
403 Ga0307406_10256175 3300031901 Bacteria 1321
404 Ga0307412_10226481 3300031911 Bacteria 1437
405 Ga0307409_100020254 3300031995 Bacteria 4529
406 Ga0307409_101068272 3300031995 Bacteria 828
407 Ga0307414_11192412 3300032004 Bacteria 705
408 Ga0307411_10056323 3300032005 Bacteria 2591
409 Ga0307415_100238842 3300032126 Bacteria 1468
410 Ga0307415_100882745 3300032126 Bacteria 823
411 Ga0307510_10037129 3300033180 Bacteria 5411
412 Ga0307510_10153529 3300033180 Bacteria 1915
413 Ga0307510_10239149 3300033180 Bacteria 1312
414 Ga0315911_1000004 3300033442 Bacteria 472637
415 Ga0373929_0049641 3300035085 Bacteria 956
416 Ga0373932_0092942 3300035112 Bacteria 971
417 Ga0373953_0090395 3300035117 Bacteria 1280
418 Ga0373954_0547444 3300035118 Bacteria 573
419 Ga0373956_0130971 3300035119 Bacteria 1174
420 Ga0373955_0051615 3300035172 Bacteria 2240
421 Ga0316574_0182456 3300035398 Bacteria 1350
422 Ga0373924_0124665 3300035410 Bacteria 1119
423 Ga0373933_0225423 3300035724 Bacteria 1203
424 Ga0373933_0795178 3300035724 Bacteria 622
425 Ga0373947_0751106 3300035725 Bacteria 666
426 Ga0373937_0013354 3300036401 Bacteria 7235
427 Ga0373937_0026026 3300036401 Bacteria 5285
428 Ga0310112_021218 3300036458 Bacteria 910
429 Ga0395900_0209301 3300037418 Bacteria 1970
430 Ga0395898_0003901 3300037466 Bacteria 16470
431 Ga0395898_0122961 3300037466 Bacteria 2487
432 Ga0395898_0519676 3300037466 Bacteria 1132
433 Ga0395905_0042749 3300037471 Bacteria 4251
434 Ga0395905_1201635 3300037471 Bacteria 662
435 Ga0395901_0056619 3300038443 Bacteria 4079
436 Ga0436365_0959977 3300039437 Bacteria 23998
437 Ga0436361_0010735 3300039447 Bacteria 769
438 Ga0436363_0957086 3300039450 Bacteria 1070
439 Ga0436362_0857586 3300039453 Bacteria 7154
440 Ga0451789_0510036 3300041443 Bacteria 759
441 Ga0451795_0596719 3300041456 Bacteria 556
442 Ga0451845_0033945 3300041501 Bacteria 741
443 Ga0451851_0176691 3300041507 Bacteria 569
444 Ga0439464_0097677 3300042439 Bacteria 890
445 Ga0466972_0000090 3300044658 Bacteria 82487
446 Ga0466972_0050010 3300044658 Bacteria 2018
447 Ga0466972_0059824 3300044658 Bacteria 1828
448 Ga0466966_0000376 3300044684 Bacteria 29152
449 Ga0466961_0001144 3300044693 Bacteria 16294
450 Ga0466961_0634015 3300044693 Bacteria 642
451 Ga0466963_0215151 3300044694 Bacteria 1345
452 Ga0466963_0565153 3300044694 Bacteria 803
453 Ga0466968_0042387 3300044735 Bacteria 1924
454 Ga0466968_0572443 3300044735 Bacteria 568
455 Ga0466960_0113031 3300044901 Bacteria 1413
456 Ga0466960_0657731 3300044901 Bacteria 626
457 Ga0466959_0023994 3300045049 Bacteria 4516
458 Ga0466959_0936705 3300045049 Bacteria 577
459 Ga0466967_0018740 3300045976 Bacteria 5543
460 Ga0466967_0203575 3300045976 Bacteria 1875
461 Ga0495592_0027444 3300046454 Bacteria 4317
462 Ga0495592_0028408 3300046454 Bacteria 4237
463 Ga0495603_0023706 3300046455 Bacteria 3712
464 Ga0495603_0026045 3300046455 Bacteria 3536
465 Ga0495629_0049078 3300046459 Bacteria 2959
466 Ga0495629_0300585 3300046459 Bacteria 1099
467 Ga0495629_0832511 3300046459 Bacteria 608
468 Ga0495651_0002649 3300046462 Bacteria 13871
469 Ga0495651_0010512 3300046462 Bacteria 7111
470 Ga0495651_0391216 3300046462 Bacteria 909
471 Ga0495653_0038459 3300046463 Bacteria 3756
472 Ga0495653_0064142 3300046463 Bacteria 2768
473 Ga0495582_0377347 3300046473 Bacteria 817
474 Ga0495605_0231992 3300046474 Bacteria 795
475 Ga0495605_0482045 3300046474 Bacteria 508
476 Ga0495639_0051951 3300046475 Bacteria 1865
477 Ga0495639_0345907 3300046475 Bacteria 746
478 Ga0495664_0364157 3300046477 Bacteria 870
479 Ga0495584_0068361 3300046491 Bacteria 1785
480 Ga0495606_0001093 3300046507 Bacteria 38858
481 Ga0495608_0005459 3300046511 Bacteria 9091
482 Ga0495608_0049451 3300046511 Bacteria 2791
483 Ga0495628_0009859 3300046516 Bacteria 8137
484 Ga0495630_0331309 3300046517 Bacteria 1164
485 Ga0495631_0272978 3300046518 Bacteria 720
486 Ga0495632_0167101 3300046519 Bacteria 1012
487 Ga0495644_0129781 3300046523 Bacteria 960
488 Ga0495644_0278859 3300046523 Bacteria 652
489 Ga0495648_0072515 3300046524 Bacteria 1992
490 Ga0495648_0211282 3300046524 Bacteria 964
491 Ga0495648_0314376 3300046524 Bacteria 729
492 Ga0495652_0007232 3300046529 Bacteria 10248
493 Ga0495652_0046160 3300046529 Bacteria 3741
494 Ga0495652_0111878 3300046529 Bacteria 2195
495 Ga0495652_0987736 3300046529 Bacteria 551
496 Ga0495654_0344072 3300046530 Bacteria 601
497 Ga0495640_0113548 3300046533 Bacteria 1767
498 Ga0495587_0007813 3300046536 Bacteria 6910
499 Ga0495587_0192604 3300046536 Bacteria 1154
500 Ga0495587_0201889 3300046536 Bacteria 1124
501 Ga0495645_0025718 3300046543 Bacteria 4274
502 Ga0495667_0000942 3300046559 Bacteria 18781
503 Ga0495667_0011759 3300046559 Bacteria 5929
504 Ga0495634_0054479 3300046642 Bacteria 2677
505 Ga0495635_0039027 3300046663 Bacteria 3287
506 Ga0495657_0004119 3300046675 Bacteria 11655
507 Ga0495657_0006453 3300046675 Bacteria 9178
508 Ga0495599_0037455 3300046678 Bacteria 3047
509 Ga0495599_0551196 3300046678 Bacteria 675
510 Ga0495623_0031884 3300046679 Bacteria 3387
511 Ga0495623_0063925 3300046679 Bacteria 2303
512 Ga0495646_0138267 3300046680 Bacteria 1364
513 Ga0495669_0006686 3300046684 Bacteria 4825
514 Ga0495613_0191960 3300046689 Bacteria 1443
515 Ga0495670_0119303 3300046691 Bacteria 1370
516 Ga0495671_0237900 3300046692 Bacteria 880
517 Ga0495671_0402439 3300046692 Bacteria 655
518 Ga0495649_0270270 3300046694 Bacteria 870
519 Ga0495600_0004569 3300046809 Bacteria 8298
520 Ga0495600_0006529 3300046809 Bacteria 7097
521 Ga0495600_0223391 3300046809 Bacteria 1204
522 Ga0495660_0322570 3300046810 Bacteria 694
523 Ga0495581_0118103 3300047315 Bacteria 1543
524 Ga0495604_0002688 3300047317 Bacteria 14257
525 Ga0495604_0055722 3300047317 Bacteria 3046
526 Ga0495674_0218017 3300047319 Bacteria 1578
527 Ga0495680_0001592 3300047322 Bacteria 24241
528 Ga0495680_0006377 3300047322 Bacteria 10977
529 Ga0495680_0159254 3300047322 Bacteria 1640
530 Ga0495675_0034684 3300047444 Bacteria 3221
531 Ga0495675_0444658 3300047444 Bacteria 750
532 Ga0495677_0076241 3300047445 Bacteria 1253
533 Ga0495684_0042485 3300047471 Bacteria 3482
534 Ga0495686_0110474 3300047472 Bacteria 1649
535 Ga0495686_0152575 3300047472 Bacteria 1355
536 Ga0495686_0580623 3300047472 Bacteria 582
537 Ga0495593_0006559 3300047673 Bacteria 6812
538 Ga0495602_0029622 3300048088 Bacteria 5208
539 Ga0495602_0031206 3300048088 Bacteria 5041
540 Ga0495602_0477491 3300048088 Bacteria 875
541 Ga0496100_0130625 3300048903 Bacteria 1769
542 Ga0496100_0140373 3300048903 Bacteria 1712
543 Ga0496100_0694297 3300048903 Bacteria 794
544 Ga0496100_1430215 3300048903 Bacteria 546
545 Ga0496101_0199753 3300048904 Bacteria 1545
546 Ga0496101_0310960 3300048904 Bacteria 1235
547 Ga0496101_0739419 3300048904 Bacteria 776
548 Ga0496101_1317654 3300048904 Bacteria 564
549 Ga0496102_0060847 3300048905 Bacteria 3455
550 Ga0496102_0368435 3300048905 Bacteria 1352
551 Ga0496102_0717094 3300048905 Bacteria 923
552 Ga0496104_1287667 3300048907 Bacteria 634
553 Ga0496106_0247650 3300048909 Bacteria 1424
554 Ga0496107_0188284 3300048910 Bacteria 1533
555 Ga0496108_0425345 3300048911 Bacteria 1160
556 Ga0496108_0941417 3300048911 Bacteria 740
557 Ga0496109_0255485 3300048912 Bacteria 1650
558 Ga0496109_0966578 3300048912 Bacteria 789
559 Ga0496109_1248175 3300048912 Bacteria 679
560 Ga0496110_0289832 3300048913 Bacteria 1491
561 Ga0496110_1031004 3300048913 Bacteria 730
562 Ga0496111_0240456 3300048914 Bacteria 1345
563 Ga0496112_0108211 3300048915 Bacteria 2750
564 Ga0496113_0127032 3300048916 Bacteria 1998
565 Ga0496115_0558994 3300048918 Bacteria 914
566 Ga0496117_0105505 3300048920 Bacteria 1771
567 Ga0496118_0030366 3300048921 Bacteria 4512
568 Ga0496118_0221212 3300048921 Bacteria 1102
569 Ga0496120_0203112 3300048923 Bacteria 958
570 Ga0496121_0059965 3300048924 Bacteria 3134
571 Ga0496121_0083755 3300048924 Bacteria 2516
572 Ga0496121_0100628 3300048924 Bacteria 2231
573 Ga0496121_0322684 3300048924 Bacteria 1039
574 Ga0496125_0589383 3300048928 Bacteria 609
575 Ga0496126_0007749 3300048929 Bacteria 11708
576 Ga0496126_0034788 3300048929 Bacteria 4727
577 Ga0496126_0302293 3300048929 Bacteria 1320
578 Ga0496126_0464748 3300048929 Bacteria 1016
579 Ga0496126_0715821 3300048929 Bacteria 776
580 Ga0501031_0505139 3300049568 Bacteria 780
581 Ga0501033_0049411 3300049570 Plasmid 3122
582 Ga0501033_0324191 3300049570 Bacteria 1082
583 Ga0501036_0083899 3300049572 Bacteria 2694
584 Ga0501036_0360348 3300049572 Bacteria 1214
585 Ga0501036_0550534 3300049572 Bacteria 959
586 Ga0501038_0098368 3300049574 Bacteria 2440
587 Ga0501038_0865366 3300049574 Bacteria 669
588 Ga0501039_0216346 3300049575 Bacteria 1506
589 Ga0501040_0024394 3300049576 Bacteria 4059
590 Ga0501040_0625671 3300049576 Bacteria 778
591 Ga0501041_0019828 3300049577 Bacteria 4017
592 Ga0501041_0302644 3300049577 Bacteria 1008
593 Ga0501042_0076316 3300049578 Bacteria 2399
594 Ga0501046_0076709 3300049580 Bacteria 2589
595 Ga0501047_0133310 3300049581 Bacteria 2364
596 Ga0501048_0059784 3300049582 Bacteria 2701
597 Ga0501048_0773811 3300049582 Bacteria 689
598 Ga0501067_0173489 3300049583 Bacteria 1201
599 Ga0501068_0314585 3300049584 Bacteria 1003
600 Ga0501070_0304791 3300049586 Bacteria 1297
601 Ga0501072_0016764 3300049588 Bacteria 5628
602 Ga0501072_0276959 3300049588 Bacteria 1335
603 Ga0501072_0564985 3300049588 Bacteria 898
604 Ga0501073_0063636 3300049589 Bacteria 2573
605 Ga0501074_0442167 3300049590 Bacteria 922
606 Ga0501074_0485266 3300049590 Bacteria 876
607 Ga0501075_0502505 3300049591 Unclassified 925
608 Ga0501075_1440322 3300049591 Bacteria 521
609 Ga0501075_1473653 3300049591 Bacteria 515
610 Ga0501076_0355711 3300049592 Bacteria 1203
611 Ga0501076_0415600 3300049592 Bacteria 1106
612 Ga0501077_0054638 3300049593 Bacteria 2536
613 Ga0501079_0014393 3300049741 Bacteria 6030
614 Ga0501079_0316176 3300049741 Bacteria 1222
615 Ga0501080_0024033 3300049742 Bacteria 5650
616 Ga0501081_0034860 3300049743 Bacteria 3425
617 Ga0501081_0252391 3300049743 Bacteria 1288
618 Ga0501081_1005396 3300049743 Bacteria 630
619 Ga0501045_0111925 3300049824 Bacteria 2024
620 Ga0501045_0199072 3300049824 Bacteria 1493
621 Ga0501045_0751819 3300049824 Bacteria 719
622 nmdc:mga03n38_20019_c1 3300050490 Bacteria 2670
623 nmdc:mga00v17_428270_c1 3300050491 Bacteria 859
624 nmdc:mga00v17_523477_c1 3300050491 Bacteria 768
625 nmdc:mga0yw44_394168_c1 3300050492 Bacteria 936
626 nmdc:mga0yw44_78033_c1 3300050492 Bacteria 2070
627 nmdc:mga0k408_140888_c1 3300050493 Bacteria 1435
628 nmdc:mga0k408_264138_c1 3300050493 Bacteria 1028
629 nmdc:mga0k408_73627_c1 3300050493 Bacteria 1995
630 nmdc:mga06z11_1238_c1 3300050494 Bacteria 9427
631 nmdc:mga06z11_143043_c1 3300050494 Bacteria 1354
632 nmdc:mga06z11_382606_c1 3300050494 Bacteria 845
633 nmdc:mga04h51_2069_c1 3300050495 Bacteria 4709
634 nmdc:mga07m45_42162_c1 3300050496 Bacteria 2558
635 nmdc:mga07m45_865102_c1 3300050496 Bacteria 517
636 nmdc:mga05p37_1066242_c1 3300050507 Bacteria 850
637 nmdc:mga05p37_260841_c1 3300050507 Bacteria 2074
638 nmdc:mga09592_87010_c1 3300050508 Bacteria 2667
639 nmdc:mga0qj67_1307712_c1 3300050509 Bacteria 561
640 nmdc:mga0qj67_78838_c1 3300050509 Bacteria 2637
641 nmdc:mga0qj67_85820_c1 3300050509 Bacteria 2525
642 nmdc:mga06r32_26718_c1 3300050510 Bacteria 5386
643 nmdc:mga06r32_4212_c1 3300050510 Bacteria 12885
644 nmdc:mga08y16_1515617_c1 3300050511 Bacteria 630
645 nmdc:mga08y16_393206_c1 3300050511 Bacteria 1420
646 nmdc:mga08y16_790132_c1 3300050511 Bacteria 943
647 nmdc:mga0n895_185725_c1 3300050512 Bacteria 2110
648 nmdc:mga0n895_232047_c1 3300050512 Bacteria 1873
649 nmdc:mga0n895_800814_c1 3300050512 Bacteria 933
650 nmdc:mga0n895_91654_c1 3300050512 Bacteria 3042
651 nmdc:mga0rr50_30085_c1 3300050513 Bacteria 3840
652 nmdc:mga08x19_106654_c1 3300050514 Bacteria 1864
653 nmdc:mga0a205_543629_c1 3300050515 Bacteria 1017
654 nmdc:mga0sz30_128427_c1 3300050516 Bacteria 1116
655 nmdc:mga0sz30_74171_c1 3300050516 Bacteria 1467
656 Ga0495601_0341856 3300053077 Bacteria 973
657 Ga0495601_0722184 3300053077 Bacteria 635
658 Ga0495612_0434493 3300053078 Bacteria 599
659 Ga0500635_0003695 3300053080 Bacteria 3871
660 Ga0495595_0261242 3300053084 Bacteria 868
661 Ga0495619_0009050 3300053085 Bacteria 6282
662 Ga0500578_0174819 3300053086 Bacteria 1326
663 Ga0500647_0016939 3300053091 Bacteria 3354
664 Ga0500583_0305368 3300053092 Bacteria 778
665 Ga0500651_0192212 3300053093 Bacteria 1208
666 Ga0500566_0035961 3300053094 Bacteria 2875
667 Ga0500566_0077857 3300053094 Bacteria 1851
668 Ga0500641_0392582 3300053096 Bacteria 547
669 Ga0500650_0101242 3300053098 Bacteria 1348
670 Ga0500554_005653 3300053102 Bacteria 2746
671 Ga0500554_052395 3300053102 Bacteria 1288
672 Ga0500557_000199 3300053105 Bacteria 10123
673 Ga0500572_000589 3300053111 Bacteria 12248
674 Ga0500572_190930 3300053111 Bacteria 671
675 Ga0500595_006818 3300053119 Bacteria 4807
676 Ga0500595_016538 3300053119 Bacteria 2745
677 Ga0500595_082458 3300053119 Bacteria 939
678 Ga0500607_091370 3300053121 Bacteria 1530
679 Ga0500626_255626 3300053128 Bacteria 650
680 Ga0500559_0000685 3300053136 Bacteria 22515
681 Ga0500559_0002260 3300053136 Bacteria 10172
682 Ga0500603_001309 3300053150 Bacteria 5711
683 Ga0500616_0000048 3300053153 Bacteria 313108
684 Ga0500619_055268 3300053154 Bacteria 1294
685 Ga0500620_063141 3300053155 Bacteria 1264
686 Ga0500620_095524 3300053155 Bacteria 1037
687 Ga0500639_207464 3300053163 Bacteria 834
688 Ga0500636_0001458 3300053177 Bacteria 12856
689 Ga0500637_0013609 3300053178 Bacteria 4271
690 Ga0500649_200353 3300053722 Bacteria 646
691 Ga0500576_093824 3300053725 Bacteria 1240
692 Ga0500596_012476 3300053735 Bacteria 1288
693 Ga0500601_000304 3300053737 Bacteria 9207
694 Ga0501084_0041314 3300054114 Bacteria 3858
695 Ga0501084_1633947 3300054114 Bacteria 539
696 Ga0500661_064515 3300055283 Bacteria 664
697 Ga0501082_0048263 3300060353 Bacteria 3670
698 Ga0501082_0236393 3300060353 Bacteria 1590
699 Ga0530510_0014906 3300061734 Bacteria 5489
700 Ga0530510_0042639 3300061734 Bacteria 3278
701 Ga0530510_1215240 3300061734 Bacteria 578
702 Ga0530510_1463283 3300061734 Bacteria 524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025928 Ga0207700_10057224 Ga0207700_100572245 108
2 iso_pu_bacteria 8019687851 8019694193 110
3 3300006914 Ga0075436_100189490 Ga0075436_1001894902 111
4 3300007076 Ga0075435_100133886 Ga0075435_1001338863 111
5 3300009147 Ga0114129_10267960 Ga0114129_102679603 111
6 3300050496 nmdc:mga07m45_865102_c1 nmdc:mga07m45_865102_c1_16_393 111
7 3300050512 nmdc:mga0n895_232047_c1 nmdc:mga0n895_232047_c1_835_1269 111
8 3300053155 Ga0500620_063141 Ga0500620_063141_872_1249 111
9 3300037466 Ga0395898_0519676 Ga0395898_0519676_609_1046 112
10 3300005334 Ga0068869_100316626 Ga0068869_1003166261 113
11 3300025942 Ga0207689_10276723 Ga0207689_102767232 113
12 3300005356 Ga0070674_100577090 Ga0070674_1005770902 114
13 3300044694 Ga0466963_0215151 Ga0466963_0215151_254_640 114
14 3300025297 Ga0209758_1035491 Ga0209758_10354911 116
15 3300048929 Ga0496126_0464748 Ga0496126_0464748_379_810 116
16 3300049576 Ga0501040_0625671 Ga0501040_0625671_41_475 116
17 3300049743 Ga0501081_1005396 Ga0501081_1005396_146_580 116
18 3300003323 rootH1_10097632 rootH1_100976323 118
19 3300009553 Ga0105249_11718276 Ga0105249_117182761 118
20 3300035725 Ga0373947_0751106 Ga0373947_0751106_77_529 118
21 3300048905 Ga0496102_0368435 Ga0496102_0368435_418_858 118
22 3300017792 Ga0163161_10440362 Ga0163161_104403622 120
23 3300047471 Ga0495684_0042485 Ga0495684_0042485_991_1368 120
24 3300061734 Ga0530510_1215240 Ga0530510_1215240_20_424 120
25 3300005983 Ga0081540_1010412 Ga0081540_10104127 121
26 3300047472 Ga0495686_0152575 Ga0495686_0152575_932_1339 121
27 3300037471 Ga0395905_1201635 Ga0395905_1201635_133_573 122
28 3300042439 Ga0439464_0097677 Ga0439464_0097677_469_879 122
29 3300053119 Ga0500595_016538 Ga0500595_016538_10_420 122
30 3300061734 Ga0530510_1463283 Ga0530510_1463283_62_472 122
31 3300025972 Ga0207668_11263079 Ga0207668_112630791 123
32 3300049586 Ga0501070_0304791 Ga0501070_0304791_680_1114 123
33 3300006844 Ga0075428_100041253 Ga0075428_1000412537 124
34 3300006846 Ga0075430_100279594 Ga0075430_1002795941 124
35 3300006847 Ga0075431_100044037 Ga0075431_1000440372 124
36 3300006880 Ga0075429_100023616 Ga0075429_1000236167 124
37 3300025885 Ga0207653_10039653 Ga0207653_100396532 124
38 3300026078 Ga0207702_10517667 Ga0207702_105176671 124
39 3300035112 Ga0373932_0092942 Ga0373932_0092942_24_440 124
40 3300049570 Ga0501033_0324191 Ga0501033_0324191_542_964 124
41 3300049572 Ga0501036_0083899 Ga0501036_0083899_2251_2682 124
42 3300049572 Ga0501036_0360348 Ga0501036_0360348_105_527 124
43 3300049574 Ga0501038_0098368 Ga0501038_0098368_1577_2008 124
44 3300049574 Ga0501038_0865366 Ga0501038_0865366_168_590 124
45 3300049575 Ga0501039_0216346 Ga0501039_0216346_50_472 124
46 3300049576 Ga0501040_0024394 Ga0501040_0024394_1774_2205 124
47 3300049577 Ga0501041_0019828 Ga0501041_0019828_2289_2711 124
48 3300049578 Ga0501042_0076316 Ga0501042_0076316_1678_2100 124
49 3300049580 Ga0501046_0076709 Ga0501046_0076709_1050_1472 124
50 3300049582 Ga0501048_0059784 Ga0501048_0059784_1227_1649 124
51 3300049582 Ga0501048_0773811 Ga0501048_0773811_202_633 124
52 3300049584 Ga0501068_0314585 Ga0501068_0314585_520_951 124
53 3300049588 Ga0501072_0016764 Ga0501072_0016764_300_722 124
54 3300049588 Ga0501072_0564985 Ga0501072_0564985_226_657 124
55 3300049590 Ga0501074_0442167 Ga0501074_0442167_115_537 124
56 3300049591 Ga0501075_1440322 Ga0501075_1440322_35_457 124
57 3300049592 Ga0501076_0415600 Ga0501076_0415600_251_682 124
58 3300049593 Ga0501077_0054638 Ga0501077_0054638_249_671 124
59 3300049741 Ga0501079_0014393 Ga0501079_0014393_3181_3612 124
60 3300049741 Ga0501079_0316176 Ga0501079_0316176_621_1043 124
61 3300049742 Ga0501080_0024033 Ga0501080_0024033_3926_4348 124
62 3300049743 Ga0501081_0034860 Ga0501081_0034860_2736_3158 124
63 3300049824 Ga0501045_0199072 Ga0501045_0199072_702_1133 124
64 3300049824 Ga0501045_0751819 Ga0501045_0751819_248_670 124
65 3300050493 nmdc:mga0k408_73627_c1 nmdc:mga0k408_73627_c1_1393_1809 124
66 3300050508 nmdc:mga09592_87010_c1 nmdc:mga09592_87010_c1_550_984 124
67 3300050509 nmdc:mga0qj67_85820_c1 nmdc:mga0qj67_85820_c1_1109_1543 124
68 3300050510 nmdc:mga06r32_4212_c1 nmdc:mga06r32_4212_c1_11378_11812 124
69 3300054114 Ga0501084_0041314 Ga0501084_0041314_317_748 124
70 3300060353 Ga0501082_0048263 Ga0501082_0048263_1296_1718 124
71 3300061734 Ga0530510_0014906 Ga0530510_0014906_2628_3059 124
72 3300061734 Ga0530510_0042639 Ga0530510_0042639_1161_1583 124
73 3300025272 Ga0209455_1020575 Ga0209455_10205752 125
74 3300028786 Ga0307517_10001444 Ga0307517_1000144446 125
75 3300031730 Ga0307516_10650731 Ga0307516_106507311 125
76 3300009553 Ga0105249_10601952 Ga0105249_106019522 126
77 iso_pu_bacteria 2508501042 2508696871 126
78 iso_pu_bacteria 2513237102 2513706539 126
79 iso_pu_bacteria 2513237161 2514010568 126
80 iso_pu_bacteria 2524023205 2524438125 126
81 iso_pu_bacteria 2617270741 2617373210 126
82 iso_pu_bacteria 2744054633 2745076994 126
83 iso_pu_bacteria 2791355196 2793066033 126
84 iso_pu_bacteria 2824609381 2824617062 126
85 iso_pu_bacteria 2824617872 2824625906 126
86 iso_pu_bacteria 2824626560 2824634662 126
87 iso_pu_bacteria 2824635225 2824642720 126
88 iso_pu_bacteria 2824644064 2824650656 126
89 iso_pu_bacteria 2824653114 2824658776 126
90 iso_pu_bacteria 2824671348 2824679326 126
91 iso_pu_bacteria 2824687955 2824695915 126
92 iso_pu_bacteria 2824723954 2824730751 126
93 iso_pu_bacteria 2824732956 2824738729 126
94 iso_pu_bacteria 2824746037 2824752408 126
95 iso_pu_bacteria 2838122688 2838127959 126
96 iso_pu_bacteria 2841941048 2841943258 126
97 iso_pu_bacteria 2841949485 2841954014 126
98 iso_pu_bacteria 2841957949 2841961943 126
99 iso_pu_bacteria 2841966195 2841968106 126
100 iso_pu_bacteria 2841974524 2841981361 126
101 iso_pu_bacteria 2841983080 2841988056 126
102 iso_pu_bacteria 2842038055 2842042640 126
103 iso_pu_bacteria 2842045827 2842050683 126
104 iso_pu_bacteria 2857509624 2857512254 126
105 iso_pu_bacteria 2874612657 2874616875 126
106 iso_pu_bacteria 2874620515 2874623372 126
107 iso_pu_bacteria 2876761206 2876762912 126
108 iso_pu_bacteria 2881364244 2881370746 126
109 iso_pu_bacteria 2881665667 2881673273 126
110 iso_pu_bacteria 2885366525 2885366872 126
111 iso_pu_bacteria 2885409591 2885411874 126
112 iso_pu_bacteria 2888419890 2888421862 126
113 iso_pu_bacteria 2904666416 2904672697 126
114 iso_pu_bacteria 2906626472 2906635240 126
115 iso_pu_bacteria 2908775508 2908781667 126
116 iso_pu_bacteria 2922393267 2922401027 126
117 iso_pu_bacteria 2935984226 2935990655 126
118 iso_pu_bacteria 3005483717 3005488286 126
119 iso_pu_bacteria 3005506211 3005507063 126
120 iso_pu_bacteria 3005587118 3005593024 126
121 iso_pu_bacteria 8006926726 8006929825 126
122 iso_pu_bacteria 8016583857 8016589058 126
123 3300025914 Ga0207671_10085077 Ga0207671_100850771 127
124 3300026067 Ga0207678_10145188 Ga0207678_101451884 127
125 3300035398 Ga0316574_0182456 Ga0316574_0182456_787_1215 127
126 3300041507 Ga0451851_0176691 Ga0451851_0176691_74_508 127
127 3300046459 Ga0495629_0832511 Ga0495629_0832511_131_565 127
128 3300046477 Ga0495664_0364157 Ga0495664_0364157_51_485 127
129 3300046524 Ga0495648_0072515 Ga0495648_0072515_1507_1941 127
130 3300046524 Ga0495648_0314376 Ga0495648_0314376_52_486 127
131 3300046810 Ga0495660_0322570 Ga0495660_0322570_49_483 127
132 3300053077 Ga0495601_0722184 Ga0495601_0722184_160_594 127
133 3300053091 Ga0500647_0016939 Ga0500647_0016939_2559_2993 127
134 3300053105 Ga0500557_000199 Ga0500557_000199_1247_1681 127
135 3300053128 Ga0500626_255626 Ga0500626_255626_65_499 127
136 3300053722 Ga0500649_200353 Ga0500649_200353_66_500 127
137 3300053737 Ga0500601_000304 Ga0500601_000304_122_556 127
138 3300026035 Ga0207703_12111711 Ga0207703_121117111 128
139 3300048905 Ga0496102_0717094 Ga0496102_0717094_216_644 128
140 3300048911 Ga0496108_0941417 Ga0496108_0941417_226_654 128
141 3300048912 Ga0496109_0966578 Ga0496109_0966578_40_468 128
142 iso_pu_bacteria 2513237096 2513657681 128
143 iso_pu_bacteria 2513237098 2513676200 128
144 iso_pu_bacteria 2513237137 2513862147 128
145 iso_pu_bacteria 2513237145 2513919680 128
146 iso_pu_bacteria 2517572143 2517895324 128
147 iso_pu_bacteria 2524023228 2524540970 128
148 iso_pu_bacteria 2667528175 2671120242 128
149 iso_pu_bacteria 2885374607 2885382366 128
150 iso_pu_bacteria 2885383462 2885392611 128
151 iso_pu_bacteria 2903748898 2903757595 128
152 iso_pu_bacteria 2903768456 2903778144 128
153 iso_pu_bacteria 2904699407 2904710775 128
154 iso_pu_bacteria 2906635258 2906637858 128
155 iso_pu_bacteria 2906660503 2906665300 128
156 iso_pu_bacteria 2908739725 2908741076 128
157 iso_pu_bacteria 2922361189 2922361402 128
158 iso_pu_bacteria 2922386360 2922393018 128
159 iso_pu_bacteria 2935630451 2935631161 128
160 iso_pu_bacteria 2941507105 2941507813 128
161 iso_pu_bacteria 2941515067 2941516239 128
162 iso_pu_bacteria 2941523033 2941523052 128
163 iso_pu_bacteria 3005474847 3005477019 128
164 iso_pu_bacteria 8006933436 8006934402 128
165 iso_pu_bacteria 8006973647 8006974372 128
166 iso_pu_bacteria 8006984368 8006985269 128
167 iso_pu_bacteria 8056673599 8056675879 128
168 iso_pu_bacteria 8056681323 8056682889 128
169 3300003215 JGI25153J46596_10002167 JGI25153J46596_100021677 129
170 3300003215 JGI25153J46596_10002765 JGI25153J46596_1000276512 129
171 3300003215 JGI25153J46596_10004161 JGI25153J46596_100041616 129
172 3300003659 JGI25404J52841_10065107 JGI25404J52841_100651071 129
173 3300003794 Ga0055531_10002385 Ga0055531_100023851 129
174 3300005262 Ga0065165_1010988 Ga0065165_10109886 129
175 3300005329 Ga0070683_100434494 Ga0070683_1004344942 129
176 3300005434 Ga0070709_10793587 Ga0070709_107935872 129
177 3300005435 Ga0070714_100211699 Ga0070714_1002116992 129
178 3300005435 Ga0070714_100408882 Ga0070714_1004088821 129
179 3300005436 Ga0070713_100112219 Ga0070713_1001122192 129
180 3300005439 Ga0070711_100052100 Ga0070711_1000521003 129
181 3300005458 Ga0070681_10110202 Ga0070681_101102023 129
182 3300005458 Ga0070681_10915449 Ga0070681_109154492 129
183 3300005471 Ga0070698_101330770 Ga0070698_1013307701 129
184 3300005530 Ga0070679_100897946 Ga0070679_1008979461 129
185 3300005535 Ga0070684_100067369 Ga0070684_1000673693 129
186 3300005535 Ga0070684_100488673 Ga0070684_1004886732 129
187 3300005577 Ga0068857_100079814 Ga0068857_1000798142 129
188 3300005937 Ga0081455_10038301 Ga0081455_100383016 129
189 3300005983 Ga0081540_1008661 Ga0081540_10086618 129
190 3300005983 Ga0081540_1015069 Ga0081540_10150694 129
191 3300005983 Ga0081540_1029763 Ga0081540_10297633 129
192 3300006028 Ga0070717_10000895 Ga0070717_100008955 129
193 3300006028 Ga0070717_10154975 Ga0070717_101549753 129
194 3300006175 Ga0070712_100295268 Ga0070712_1002952682 129
195 3300006914 Ga0075436_101489080 Ga0075436_1014890801 129
196 3300006942 Ga0099824_1010822 Ga0099824_10108222 129
197 3300006944 Ga0099823_1057810 Ga0099823_10578102 129
198 3300013105 Ga0157369_10137510 Ga0157369_101375102 129
199 3300021320 Ga0214544_1000001 Ga0214544_1000001267 129
200 3300021321 Ga0214542_1000005 Ga0214542_1000005267 129
201 3300021324 Ga0214545_1000003 Ga0214545_1000003497 129
202 3300021327 Ga0214543_1000002 Ga0214543_1000002268 129
203 3300025245 Ga0207425_1006205 Ga0207425_10062053 129
204 3300025295 Ga0209564_1023373 Ga0209564_10233733 129
205 3300025297 Ga0209758_1000026 Ga0209758_100002652 129
206 3300025297 Ga0209758_1000318 Ga0209758_100031874 129
207 3300025298 Ga0209050_1075379 Ga0209050_10753791 129
208 3300025299 Ga0209256_1006168 Ga0209256_10061681 129
209 3300025304 Ga0209257_1002140 Ga0209257_100214026 129
210 3300025304 Ga0209257_1074936 Ga0209257_10749361 129
211 3300025906 Ga0207699_10151845 Ga0207699_101518451 129
212 3300025912 Ga0207707_10359204 Ga0207707_103592042 129
213 3300025915 Ga0207693_10348729 Ga0207693_103487292 129
214 3300025916 Ga0207663_10067234 Ga0207663_100672343 129
215 3300025921 Ga0207652_10411890 Ga0207652_104118902 129
216 3300025928 Ga0207700_10010008 Ga0207700_100100089 129
217 3300025929 Ga0207664_10156426 Ga0207664_101564262 129
218 3300025939 Ga0207665_10114431 Ga0207665_101144314 129
219 3300025939 Ga0207665_10179515 Ga0207665_101795152 129
220 3300025944 Ga0207661_10382793 Ga0207661_103827931 129
221 3300026116 Ga0207674_10258347 Ga0207674_102583472 129
222 3300027296 Ga0209389_1000090 Ga0209389_100009030 129
223 3300027296 Ga0209389_1000119 Ga0209389_100011949 129
224 3300027357 Ga0209589_1000010 Ga0209589_1000010206 129
225 3300027361 Ga0209489_100011 Ga0209489_10001130 129
226 3300027361 Ga0209489_100385 Ga0209489_10038559 129
227 3300027363 Ga0209700_100013 Ga0209700_10001330 129
228 3300031249 Ga0265339_10000828 Ga0265339_100008284 129
229 3300031344 Ga0265316_10613527 Ga0265316_106135271 129
230 3300039450 Ga0436363_0957086 Ga0436363_0957086_159_590 129
231 3300044658 Ga0466972_0050010 Ga0466972_0050010_1002_1436 129
232 3300044658 Ga0466972_0059824 Ga0466972_0059824_696_1130 129
233 3300044735 Ga0466968_0042387 Ga0466968_0042387_1347_1781 129
234 3300044735 Ga0466968_0572443 Ga0466968_0572443_44_478 129
235 3300044901 Ga0466960_0113031 Ga0466960_0113031_133_567 129
236 3300044901 Ga0466960_0657731 Ga0466960_0657731_169_603 129
237 3300045976 Ga0466967_0203575 Ga0466967_0203575_62_493 129
238 3300046474 Ga0495605_0482045 Ga0495605_0482045_58_492 129
239 3300048920 Ga0496117_0105505 Ga0496117_0105505_1061_1492 129
240 3300048921 Ga0496118_0030366 Ga0496118_0030366_923_1354 129
241 3300048923 Ga0496120_0203112 Ga0496120_0203112_183_614 129
242 3300049588 Ga0501072_0276959 Ga0501072_0276959_819_1256 129
243 3300050514 nmdc:mga08x19_106654_c1 nmdc:mga08x19_106654_c1_1368_1799 129
244 3300053119 Ga0500595_006818 Ga0500595_006818_1330_1761 129
245 3300003203 JGI25406J46586_10000537 JGI25406J46586_100005376 130
246 3300003215 JGI25153J46596_10090569 JGI25153J46596_100905691 130
247 3300003762 Ga0055542_1030310 Ga0055542_10303101 130
248 3300005341 Ga0070691_10057371 Ga0070691_100573713 130
249 3300005345 Ga0070692_10536820 Ga0070692_105368201 130
250 3300005434 Ga0070709_10001480 Ga0070709_1000148012 130
251 3300005434 Ga0070709_10081253 Ga0070709_100812533 130
252 3300005436 Ga0070713_100007306 Ga0070713_1000073065 130
253 3300005437 Ga0070710_10002746 Ga0070710_100027465 130
254 3300005439 Ga0070711_100004779 Ga0070711_1000047795 130
255 3300005440 Ga0070705_100047711 Ga0070705_1000477111 130
256 3300005441 Ga0070700_100012056 Ga0070700_1000120564 130
257 3300005444 Ga0070694_100108791 Ga0070694_1001087911 130
258 3300005444 Ga0070694_100290859 Ga0070694_1002908592 130
259 3300005455 Ga0070663_100038261 Ga0070663_1000382612 130
260 3300005467 Ga0070706_100827484 Ga0070706_1008274841 130
261 3300005518 Ga0070699_100249187 Ga0070699_1002491871 130
262 3300005545 Ga0070695_100164920 Ga0070695_1001649201 130
263 3300005545 Ga0070695_100400366 Ga0070695_1004003662 130
264 3300005546 Ga0070696_100024642 Ga0070696_1000246423 130
265 3300005549 Ga0070704_100337991 Ga0070704_1003379912 130
266 3300005617 Ga0068859_101253997 Ga0068859_1012539971 130
267 3300005719 Ga0068861_100088946 Ga0068861_1000889461 130
268 3300005840 Ga0068870_10801114 Ga0068870_108011141 130
269 3300005842 Ga0068858_101684626 Ga0068858_1016846261 130
270 3300005843 Ga0068860_100839892 Ga0068860_1008398922 130
271 3300005983 Ga0081540_1204958 Ga0081540_12049581 130
272 3300005985 Ga0081539_10000321 Ga0081539_1000032129 130
273 3300006028 Ga0070717_10127614 Ga0070717_101276143 130
274 3300006042 Ga0075368_10003646 Ga0075368_100036463 130
275 3300006048 Ga0075363_100101566 Ga0075363_1001015663 130
276 3300006051 Ga0075364_10190464 Ga0075364_101904644 130
277 3300006163 Ga0070715_10054737 Ga0070715_100547372 130
278 3300006173 Ga0070716_100001956 Ga0070716_1000019566 130
279 3300006175 Ga0070712_100131999 Ga0070712_1001319994 130
280 3300006178 Ga0075367_10010837 Ga0075367_100108373 130
281 3300006178 Ga0075367_10048147 Ga0075367_100481472 130
282 3300006195 Ga0075366_10072660 Ga0075366_100726602 130
283 3300006844 Ga0075428_100090126 Ga0075428_1000901264 130
284 3300006846 Ga0075430_100913868 Ga0075430_1009138681 130
285 3300006847 Ga0075431_100221419 Ga0075431_1002214192 130
286 3300006871 Ga0075434_100092874 Ga0075434_1000928744 130
287 3300006931 Ga0097620_101253827 Ga0097620_1012538271 130
288 3300007076 Ga0075435_100070641 Ga0075435_1000706414 130
289 3300009094 Ga0111539_10495629 Ga0111539_104956292 130
290 3300009176 Ga0105242_11562998 Ga0105242_115629981 130
291 3300009553 Ga0105249_10219709 Ga0105249_102197093 130
292 3300012515 Ga0157338_1090572 Ga0157338_10905721 130
293 3300013308 Ga0157375_11706981 Ga0157375_117069811 130
294 3300014325 Ga0163163_11440234 Ga0163163_114402341 130
295 3300021358 Ga0213873_10020668 Ga0213873_100206683 130
296 3300021384 Ga0213876_10129578 Ga0213876_101295782 130
297 3300025254 Ga0209148_1000253 Ga0209148_100025333 130
298 3300025272 Ga0209455_1001670 Ga0209455_100167010 130
299 3300025898 Ga0207692_10003254 Ga0207692_100032549 130
300 3300025904 Ga0207647_10353368 Ga0207647_103533682 130
301 3300025906 Ga0207699_10000473 Ga0207699_1000047323 130
302 3300025908 Ga0207643_10575768 Ga0207643_105757681 130
303 3300025910 Ga0207684_10705958 Ga0207684_107059581 130
304 3300025912 Ga0207707_10841541 Ga0207707_108415412 130
305 3300025915 Ga0207693_10069543 Ga0207693_100695433 130
306 3300025916 Ga0207663_10002959 Ga0207663_1000295910 130
307 3300025917 Ga0207660_10385501 Ga0207660_103855011 130
308 3300025939 Ga0207665_10004551 Ga0207665_100045515 130
309 3300025961 Ga0207712_10170558 Ga0207712_101705583 130
310 3300026075 Ga0207708_10010066 Ga0207708_100100663 130
311 3300026118 Ga0207675_100123415 Ga0207675_1001234152 130
312 3300027866 Ga0209813_10002330 Ga0209813_100023303 130
313 3300027907 Ga0207428_11085791 Ga0207428_110857911 130
314 3300033180 Ga0307510_10153529 Ga0307510_101535293 130
315 3300036458 Ga0310112_021218 Ga0310112_021218_85_522 130
316 3300037418 Ga0395900_0209301 Ga0395900_0209301_484_918 130
317 3300037466 Ga0395898_0003901 Ga0395898_0003901_8620_9054 130
318 3300037466 Ga0395898_0122961 Ga0395898_0122961_1794_2228 130
319 3300037471 Ga0395905_0042749 Ga0395905_0042749_1630_2064 130
320 3300038443 Ga0395901_0056619 Ga0395901_0056619_1108_1542 130
321 3300039437 Ga0436365_0959977 Ga0436365_0959977_14214_14648 130
322 3300039447 Ga0436361_0010735 Ga0436361_0010735_60_494 130
323 3300039453 Ga0436362_0857586 Ga0436362_0857586_136_570 130
324 3300041456 Ga0451795_0596719 Ga0451795_0596719_74_508 130
325 3300041501 Ga0451845_0033945 Ga0451845_0033945_45_479 130
326 3300044658 Ga0466972_0000090 Ga0466972_0000090_40492_40926 130
327 3300044684 Ga0466966_0000376 Ga0466966_0000376_6951_7385 130
328 3300044693 Ga0466961_0001144 Ga0466961_0001144_13949_14383 130
329 3300044693 Ga0466961_0634015 Ga0466961_0634015_13_447 130
330 3300044694 Ga0466963_0565153 Ga0466963_0565153_242_676 130
331 3300045049 Ga0466959_0023994 Ga0466959_0023994_67_501 130
332 3300045049 Ga0466959_0936705 Ga0466959_0936705_129_563 130
333 3300045976 Ga0466967_0018740 Ga0466967_0018740_2349_2783 130
334 3300046454 Ga0495592_0028408 Ga0495592_0028408_1805_2239 130
335 3300046462 Ga0495651_0002649 Ga0495651_0002649_12683_13117 130
336 3300046463 Ga0495653_0038459 Ga0495653_0038459_961_1395 130
337 3300046507 Ga0495606_0001093 Ga0495606_0001093_22303_22737 130
338 3300046511 Ga0495608_0049451 Ga0495608_0049451_1958_2392 130
339 3300046516 Ga0495628_0009859 Ga0495628_0009859_1334_1768 130
340 3300046517 Ga0495630_0331309 Ga0495630_0331309_159_593 130
341 3300046519 Ga0495632_0167101 Ga0495632_0167101_43_477 130
342 3300046523 Ga0495644_0278859 Ga0495644_0278859_136_612 130
343 3300046524 Ga0495648_0211282 Ga0495648_0211282_369_803 130
344 3300046529 Ga0495652_0007232 Ga0495652_0007232_6790_7224 130
345 3300046529 Ga0495652_0987736 Ga0495652_0987736_86_520 130
346 3300046536 Ga0495587_0192604 Ga0495587_0192604_102_536 130
347 3300046543 Ga0495645_0025718 Ga0495645_0025718_3527_3961 130
348 3300046559 Ga0495667_0011759 Ga0495667_0011759_1060_1494 130
349 3300046675 Ga0495657_0006453 Ga0495657_0006453_3818_4252 130
350 3300046678 Ga0495599_0551196 Ga0495599_0551196_27_461 130
351 3300046679 Ga0495623_0063925 Ga0495623_0063925_982_1416 130
352 3300046680 Ga0495646_0138267 Ga0495646_0138267_676_1110 130
353 3300046689 Ga0495613_0191960 Ga0495613_0191960_848_1282 130
354 3300046694 Ga0495649_0270270 Ga0495649_0270270_365_799 130
355 3300046809 Ga0495600_0004569 Ga0495600_0004569_1676_2110 130
356 3300047317 Ga0495604_0002688 Ga0495604_0002688_11029_11463 130
357 3300047322 Ga0495680_0001592 Ga0495680_0001592_6149_6583 130
358 3300047472 Ga0495686_0110474 Ga0495686_0110474_1051_1485 130
359 3300048088 Ga0495602_0029622 Ga0495602_0029622_2067_2501 130
360 3300048905 Ga0496102_0060847 Ga0496102_0060847_1782_2216 130
361 3300048924 Ga0496121_0083755 Ga0496121_0083755_717_1151 130
362 3300048924 Ga0496121_0100628 Ga0496121_0100628_1650_2084 130
363 3300048929 Ga0496126_0007749 Ga0496126_0007749_4867_5301 130
364 3300049570 Ga0501033_0049411 Ga0501033_0049411_655_1089 130
365 3300049572 Ga0501036_0550534 Ga0501036_0550534_238_672 130
366 3300049577 Ga0501041_0302644 Ga0501041_0302644_36_470 130
367 3300049581 Ga0501047_0133310 Ga0501047_0133310_1898_2332 130
368 3300049583 Ga0501067_0173489 Ga0501067_0173489_499_933 130
369 3300049589 Ga0501073_0063636 Ga0501073_0063636_1198_1632 130
370 3300049590 Ga0501074_0485266 Ga0501074_0485266_109_543 130
371 3300049591 Ga0501075_0502505 Ga0501075_0502505_472_906 130
372 3300049591 Ga0501075_1473653 Ga0501075_1473653_61_495 130
373 3300049592 Ga0501076_0355711 Ga0501076_0355711_59_493 130
374 3300049743 Ga0501081_0252391 Ga0501081_0252391_339_773 130
375 3300049824 Ga0501045_0111925 Ga0501045_0111925_1417_1851 130
376 3300050490 nmdc:mga03n38_20019_c1 nmdc:mga03n38_20019_c1_1652_2086 130
377 3300050491 nmdc:mga00v17_428270_c1 nmdc:mga00v17_428270_c1_41_475 130
378 3300050494 nmdc:mga06z11_1238_c1 nmdc:mga06z11_1238_c1_184_618 130
379 3300050495 nmdc:mga04h51_2069_c1 nmdc:mga04h51_2069_c1_3215_3649 130
380 3300050509 nmdc:mga0qj67_78838_c1 nmdc:mga0qj67_78838_c1_601_1035 130
381 3300050510 nmdc:mga06r32_26718_c1 nmdc:mga06r32_26718_c1_3469_3903 130
382 3300050511 nmdc:mga08y16_393206_c1 nmdc:mga08y16_393206_c1_747_1181 130
383 3300050512 nmdc:mga0n895_91654_c1 nmdc:mga0n895_91654_c1_1677_2111 130
384 3300050513 nmdc:mga0rr50_30085_c1 nmdc:mga0rr50_30085_c1_1627_2061 130
385 3300053086 Ga0500578_0174819 Ga0500578_0174819_740_1174 130
386 3300053093 Ga0500651_0192212 Ga0500651_0192212_595_1029 130
387 3300053094 Ga0500566_0035961 Ga0500566_0035961_303_737 130
388 3300053098 Ga0500650_0101242 Ga0500650_0101242_717_1151 130
389 3300053102 Ga0500554_052395 Ga0500554_052395_71_505 130
390 3300053111 Ga0500572_190930 Ga0500572_190930_203_637 130
391 3300053119 Ga0500595_082458 Ga0500595_082458_273_707 130
392 3300053121 Ga0500607_091370 Ga0500607_091370_1040_1474 130
393 3300053136 Ga0500559_0002260 Ga0500559_0002260_8454_8888 130
394 3300053154 Ga0500619_055268 Ga0500619_055268_680_1114 130
395 3300053155 Ga0500620_095524 Ga0500620_095524_395_829 130
396 3300053177 Ga0500636_0001458 Ga0500636_0001458_6852_7286 130
397 3300055283 Ga0500661_064515 Ga0500661_064515_87_521 130
398 3300060353 Ga0501082_0236393 Ga0501082_0236393_1020_1454 130
399 3300005536 Ga0070697_100435207 Ga0070697_1004352072 131
400 3300005985 Ga0081539_10000191 Ga0081539_1000019187 131
401 3300046459 Ga0495629_0300585 Ga0495629_0300585_382_819 131
402 3300046529 Ga0495652_0111878 Ga0495652_0111878_1037_1477 131
403 3300046809 Ga0495600_0223391 Ga0495600_0223391_205_645 131
404 3300047322 Ga0495680_0159254 Ga0495680_0159254_1118_1558 131
405 3300048904 Ga0496101_1317654 Ga0496101_1317654_40_480 131
406 3300048913 Ga0496110_0289832 Ga0496110_0289832_527_967 131
407 3300048929 Ga0496126_0302293 Ga0496126_0302293_386_823 131
408 3300050507 nmdc:mga05p37_1066242_c1 nmdc:mga05p37_1066242_c1_300_737 131
409 3300050509 nmdc:mga0qj67_1307712_c1 nmdc:mga0qj67_1307712_c1_89_544 131
410 3300053084 Ga0495595_0261242 Ga0495595_0261242_62_502 131
411 3300053153 Ga0500616_0000048 Ga0500616_0000048_1848_2285 131
412 3300001979 JGI24740J21852_10003892 JGI24740J21852_100038925 132
413 3300001990 JGI24737J22298_10002261 JGI24737J22298_100022619 132
414 3300002067 JGI24735J21928_10011192 JGI24735J21928_100111922 132
415 3300005327 Ga0070658_10135122 Ga0070658_101351222 132
416 3300005327 Ga0070658_11156746 Ga0070658_111567462 132
417 3300005330 Ga0070690_100830315 Ga0070690_1008303152 132
418 3300005334 Ga0068869_100469752 Ga0068869_1004697521 132
419 3300005335 Ga0070666_10214660 Ga0070666_102146601 132
420 3300005338 Ga0068868_100236465 Ga0068868_1002364651 132
421 3300005339 Ga0070660_100727213 Ga0070660_1007272131 132
422 3300005339 Ga0070660_100802521 Ga0070660_1008025212 132
423 3300005339 Ga0070660_101523996 Ga0070660_1015239961 132
424 3300005343 Ga0070687_100896300 Ga0070687_1008963001 132
425 3300005344 Ga0070661_100190089 Ga0070661_1001900891 132
426 3300005347 Ga0070668_100045408 Ga0070668_1000454083 132
427 3300005347 Ga0070668_100107116 Ga0070668_1001071163 132
428 3300005347 Ga0070668_100712847 Ga0070668_1007128472 132
429 3300005353 Ga0070669_101702678 Ga0070669_1017026781 132
430 3300005356 Ga0070674_100333687 Ga0070674_1003336871 132
431 3300005356 Ga0070674_101130443 Ga0070674_1011304431 132
432 3300005364 Ga0070673_100140640 Ga0070673_1001406402 132
433 3300005364 Ga0070673_100391024 Ga0070673_1003910242 132
434 3300005366 Ga0070659_100152007 Ga0070659_1001520073 132
435 3300005367 Ga0070667_100323999 Ga0070667_1003239992 132
436 3300005367 Ga0070667_101487451 Ga0070667_1014874511 132
437 3300005455 Ga0070663_100007141 Ga0070663_1000071414 132
438 3300005455 Ga0070663_100025005 Ga0070663_1000250054 132
439 3300005455 Ga0070663_100045122 Ga0070663_1000451222 132
440 3300005455 Ga0070663_100055286 Ga0070663_1000552864 132
441 3300005457 Ga0070662_100008152 Ga0070662_1000081523 132
442 3300005457 Ga0070662_100136069 Ga0070662_1001360692 132
443 3300005458 Ga0070681_10200906 Ga0070681_102009062 132
444 3300005459 Ga0068867_100444192 Ga0068867_1004441922 132
445 3300005459 Ga0068867_100494084 Ga0068867_1004940841 132
446 3300005466 Ga0070685_10261560 Ga0070685_102615601 132
447 3300005466 Ga0070685_11405128 Ga0070685_114051281 132
448 3300005467 Ga0070706_101623192 Ga0070706_1016231921 132
449 3300005471 Ga0070698_100321241 Ga0070698_1003212412 132
450 3300005518 Ga0070699_100085656 Ga0070699_1000856562 132
451 3300005530 Ga0070679_100246697 Ga0070679_1002466972 132
452 3300005539 Ga0068853_100189009 Ga0068853_1001890093 132
453 3300005539 Ga0068853_100221902 Ga0068853_1002219022 132
454 3300005539 Ga0068853_100285592 Ga0068853_1002855922 132
455 3300005539 Ga0068853_101235143 Ga0068853_1012351431 132
456 3300005544 Ga0070686_101479961 Ga0070686_1014799611 132
457 3300005548 Ga0070665_100036014 Ga0070665_1000360144 132
458 3300005548 Ga0070665_100073367 Ga0070665_1000733672 132
459 3300005548 Ga0070665_100084019 Ga0070665_1000840193 132
460 3300005548 Ga0070665_100128430 Ga0070665_1001284303 132
461 3300005548 Ga0070665_100273358 Ga0070665_1002733582 132
462 3300005549 Ga0070704_100355047 Ga0070704_1003550472 132
463 3300005563 Ga0068855_100067805 Ga0068855_1000678051 132
464 3300005563 Ga0068855_100070033 Ga0068855_1000700336 132
465 3300005563 Ga0068855_100082440 Ga0068855_1000824404 132
466 3300005563 Ga0068855_100347813 Ga0068855_1003478132 132
467 3300005564 Ga0070664_100054305 Ga0070664_1000543053 132
468 3300005564 Ga0070664_101031220 Ga0070664_1010312201 132
469 3300005577 Ga0068857_100003393 Ga0068857_10000339316 132
470 3300005578 Ga0068854_100021016 Ga0068854_1000210167 132
471 3300005578 Ga0068854_100924527 Ga0068854_1009245271 132
472 3300005614 Ga0068856_100016560 Ga0068856_1000165603 132
473 3300005614 Ga0068856_100039259 Ga0068856_1000392594 132
474 3300005614 Ga0068856_100175466 Ga0068856_1001754664 132
475 3300005615 Ga0070702_100053995 Ga0070702_1000539951 132
476 3300005616 Ga0068852_100053433 Ga0068852_1000534332 132
477 3300005616 Ga0068852_100175043 Ga0068852_1001750433 132
478 3300005617 Ga0068859_100141462 Ga0068859_1001414624 132
479 3300005618 Ga0068864_100228105 Ga0068864_1002281051 132
480 3300005718 Ga0068866_10085395 Ga0068866_100853952 132
481 3300005719 Ga0068861_100073048 Ga0068861_1000730482 132
482 3300005719 Ga0068861_100433764 Ga0068861_1004337642 132
483 3300005834 Ga0068851_10001384 Ga0068851_1000138410 132
484 3300005841 Ga0068863_100073813 Ga0068863_1000738135 132
485 3300005842 Ga0068858_100111546 Ga0068858_1001115462 132
486 3300005842 Ga0068858_100244731 Ga0068858_1002447312 132
487 3300005843 Ga0068860_100031004 Ga0068860_1000310049 132
488 3300005843 Ga0068860_100141254 Ga0068860_1001412542 132
489 3300005844 Ga0068862_100451117 Ga0068862_1004511172 132
490 3300005844 Ga0068862_100551507 Ga0068862_1005515072 132
491 3300005981 Ga0081538_10185129 Ga0081538_101851291 132
492 3300005983 Ga0081540_1095496 Ga0081540_10954962 132
493 3300005985 Ga0081539_10037459 Ga0081539_100374593 132
494 3300006038 Ga0075365_10051819 Ga0075365_100518195 132
495 3300006038 Ga0075365_10561352 Ga0075365_105613521 132
496 3300006042 Ga0075368_10103185 Ga0075368_101031852 132
497 3300006048 Ga0075363_100122118 Ga0075363_1001221183 132
498 3300006051 Ga0075364_10097811 Ga0075364_100978112 132
499 3300006051 Ga0075364_10441726 Ga0075364_104417261 132
500 3300006175 Ga0070712_101383035 Ga0070712_1013830351 132
501 3300006177 Ga0075362_10004938 Ga0075362_100049384 132
502 3300006195 Ga0075366_10535437 Ga0075366_105354371 132
503 3300006237 Ga0097621_100061594 Ga0097621_1000615943 132
504 3300006237 Ga0097621_100128040 Ga0097621_1001280403 132
505 3300006353 Ga0075370_10574346 Ga0075370_105743461 132
506 3300006871 Ga0075434_100247825 Ga0075434_1002478252 132
507 3300006931 Ga0097620_100141459 Ga0097620_1001414594 132
508 3300007076 Ga0075435_100215345 Ga0075435_1002153452 132
509 3300007076 Ga0075435_100257757 Ga0075435_1002577572 132
510 3300009093 Ga0105240_10012741 Ga0105240_1001274112 132
511 3300009093 Ga0105240_10039036 Ga0105240_100390363 132
512 3300009093 Ga0105240_10457491 Ga0105240_104574912 132
513 3300009093 Ga0105240_11463039 Ga0105240_114630391 132
514 3300009094 Ga0111539_10075550 Ga0111539_100755504 132
515 3300009094 Ga0111539_12842870 Ga0111539_128428701 132
516 3300009098 Ga0105245_11761526 Ga0105245_117615261 132
517 3300009101 Ga0105247_10278045 Ga0105247_102780452 132
518 3300009147 Ga0114129_10129588 Ga0114129_101295883 132
519 3300009148 Ga0105243_10051227 Ga0105243_100512274 132
520 3300009148 Ga0105243_11890484 Ga0105243_118904841 132
521 3300009174 Ga0105241_10002223 Ga0105241_1000222315 132
522 3300009174 Ga0105241_10020943 Ga0105241_100209434 132
523 3300009174 Ga0105241_10989410 Ga0105241_109894102 132
524 3300009176 Ga0105242_10203844 Ga0105242_102038441 132
525 3300009177 Ga0105248_10059889 Ga0105248_100598893 132
526 3300009545 Ga0105237_10062535 Ga0105237_100625351 132
527 3300009551 Ga0105238_10005872 Ga0105238_1000587214 132
528 3300009551 Ga0105238_10057859 Ga0105238_100578592 132
529 3300009551 Ga0105238_10061254 Ga0105238_100612542 132
530 3300009553 Ga0105249_10131989 Ga0105249_101319892 132
531 3300009553 Ga0105249_10315199 Ga0105249_103151993 132
532 3300009553 Ga0105249_11056120 Ga0105249_110561201 132
533 3300010375 Ga0105239_10006765 Ga0105239_1000676516 132
534 3300010375 Ga0105239_10221992 Ga0105239_102219922 132
535 3300010375 Ga0105239_10999775 Ga0105239_109997751 132
536 3300010375 Ga0105239_12532871 Ga0105239_125328711 132
537 3300013105 Ga0157369_10336821 Ga0157369_103368212 132
538 3300013296 Ga0157374_10161013 Ga0157374_101610133 132
539 3300013296 Ga0157374_11079286 Ga0157374_110792862 132
540 3300013297 Ga0157378_10128596 Ga0157378_101285963 132
541 3300013297 Ga0157378_11280768 Ga0157378_112807681 132
542 3300013297 Ga0157378_13173337 Ga0157378_131733371 132
543 3300013306 Ga0163162_11799740 Ga0163162_117997401 132
544 3300013308 Ga0157375_10070643 Ga0157375_100706435 132
545 3300014325 Ga0163163_10380009 Ga0163163_103800092 132
546 3300014326 Ga0157380_10064387 Ga0157380_100643871 132
547 3300014326 Ga0157380_10168890 Ga0157380_101688902 132
548 3300014326 Ga0157380_10615551 Ga0157380_106155511 132
549 3300014326 Ga0157380_10788977 Ga0157380_107889772 132
550 3300014745 Ga0157377_10094303 Ga0157377_100943033 132
551 3300014745 Ga0157377_10096429 Ga0157377_100964292 132
552 3300014969 Ga0157376_10109383 Ga0157376_101093832 132
553 3300017792 Ga0163161_10008057 Ga0163161_100080578 132
554 3300025272 Ga0209455_1001785 Ga0209455_100178510 132
555 3300025297 Ga0209758_1013863 Ga0209758_10138636 132
556 3300025315 Ga0207697_10034977 Ga0207697_100349773 132
557 3300025321 Ga0207656_10015578 Ga0207656_100155781 132
558 3300025899 Ga0207642_10158139 Ga0207642_101581392 132
559 3300025900 Ga0207710_10019712 Ga0207710_100197123 132
560 3300025900 Ga0207710_10222023 Ga0207710_102220231 132
561 3300025903 Ga0207680_10071688 Ga0207680_100716883 132
562 3300025903 Ga0207680_10200674 Ga0207680_102006743 132
563 3300025904 Ga0207647_10119523 Ga0207647_101195232 132
564 3300025904 Ga0207647_10129293 Ga0207647_101292932 132
565 3300025907 Ga0207645_10173023 Ga0207645_101730232 132
566 3300025909 Ga0207705_10258917 Ga0207705_102589171 132
567 3300025911 Ga0207654_10000069 Ga0207654_1000006964 132
568 3300025911 Ga0207654_10038930 Ga0207654_100389303 132
569 3300025911 Ga0207654_10599191 Ga0207654_105991911 132
570 3300025913 Ga0207695_10000713 Ga0207695_1000071329 132
571 3300025913 Ga0207695_11295303 Ga0207695_112953031 132
572 3300025914 Ga0207671_10271567 Ga0207671_102715671 132
573 3300025919 Ga0207657_10178308 Ga0207657_101783083 132
574 3300025919 Ga0207657_10305876 Ga0207657_103058762 132
575 3300025920 Ga0207649_10835634 Ga0207649_108356341 132
576 3300025921 Ga0207652_10532902 Ga0207652_105329022 132
577 3300025923 Ga0207681_10794408 Ga0207681_107944081 132
578 3300025924 Ga0207694_10000155 Ga0207694_1000015532 132
579 3300025924 Ga0207694_10137232 Ga0207694_101372324 132
580 3300025924 Ga0207694_10219091 Ga0207694_102190912 132
581 3300025925 Ga0207650_10541183 Ga0207650_105411831 132
582 3300025927 Ga0207687_10364271 Ga0207687_103642712 132
583 3300025933 Ga0207706_10019156 Ga0207706_100191568 132
584 3300025936 Ga0207670_10386657 Ga0207670_103866571 132
585 3300025937 Ga0207669_10006895 Ga0207669_100068957 132
586 3300025937 Ga0207669_10288689 Ga0207669_102886892 132
587 3300025940 Ga0207691_10471151 Ga0207691_104711512 132
588 3300025941 Ga0207711_10441398 Ga0207711_104413982 132
589 3300025942 Ga0207689_10592172 Ga0207689_105921721 132
590 3300025945 Ga0207679_10361660 Ga0207679_103616601 132
591 3300025949 Ga0207667_10016768 Ga0207667_1001676810 132
592 3300025949 Ga0207667_10022616 Ga0207667_100226166 132
593 3300025949 Ga0207667_10141920 Ga0207667_101419203 132
594 3300025949 Ga0207667_10326271 Ga0207667_103262712 132
595 3300025960 Ga0207651_10207912 Ga0207651_102079122 132
596 3300025960 Ga0207651_10378996 Ga0207651_103789962 132
597 3300025960 Ga0207651_11967019 Ga0207651_119670191 132
598 3300025961 Ga0207712_10016558 Ga0207712_100165584 132
599 3300025961 Ga0207712_10225932 Ga0207712_102259321 132
600 3300025972 Ga0207668_10052856 Ga0207668_100528563 132
601 3300025972 Ga0207668_10169567 Ga0207668_101695673 132
602 3300025972 Ga0207668_10484283 Ga0207668_104842832 132
603 3300025981 Ga0207640_10098285 Ga0207640_100982854 132
604 3300025981 Ga0207640_10124609 Ga0207640_101246093 132
605 3300025981 Ga0207640_11149866 Ga0207640_111498661 132
606 3300025986 Ga0207658_10281763 Ga0207658_102817632 132
607 3300025986 Ga0207658_10466762 Ga0207658_104667622 132
608 3300026035 Ga0207703_10030186 Ga0207703_100301863 132
609 3300026035 Ga0207703_10075684 Ga0207703_100756841 132
610 3300026041 Ga0207639_10004418 Ga0207639_100044187 132
611 3300026041 Ga0207639_10016402 Ga0207639_100164022 132
612 3300026041 Ga0207639_10046034 Ga0207639_100460343 132
613 3300026041 Ga0207639_10297464 Ga0207639_102974643 132
614 3300026067 Ga0207678_10017837 Ga0207678_100178374 132
615 3300026067 Ga0207678_10044698 Ga0207678_100446982 132
616 3300026067 Ga0207678_10095290 Ga0207678_100952901 132
617 3300026067 Ga0207678_10096836 Ga0207678_100968362 132
618 3300026067 Ga0207678_10104256 Ga0207678_101042561 132
619 3300026075 Ga0207708_10223904 Ga0207708_102239042 132
620 3300026075 Ga0207708_10545264 Ga0207708_105452641 132
621 3300026078 Ga0207702_10000022 Ga0207702_1000002220 132
622 3300026078 Ga0207702_10028437 Ga0207702_100284373 132
623 3300026078 Ga0207702_10184421 Ga0207702_101844212 132
624 3300026078 Ga0207702_10902350 Ga0207702_109023502 132
625 3300026088 Ga0207641_10227431 Ga0207641_102274311 132
626 3300026089 Ga0207648_10060285 Ga0207648_100602853 132
627 3300026095 Ga0207676_10320570 Ga0207676_103205702 132
628 3300026116 Ga0207674_10051668 Ga0207674_100516683 132
629 3300026116 Ga0207674_10111619 Ga0207674_101116194 132
630 3300026116 Ga0207674_10954906 Ga0207674_109549062 132
631 3300026118 Ga0207675_100049166 Ga0207675_1000491664 132
632 3300026118 Ga0207675_100052206 Ga0207675_1000522064 132
633 3300026121 Ga0207683_10073580 Ga0207683_100735804 132
634 3300026121 Ga0207683_10416397 Ga0207683_104163972 132
635 3300026142 Ga0207698_10073528 Ga0207698_100735285 132
636 3300027907 Ga0207428_10278165 Ga0207428_102781651 132
637 3300028379 Ga0268266_10000446 Ga0268266_1000044634 132
638 3300028379 Ga0268266_10026030 Ga0268266_100260305 132
639 3300028379 Ga0268266_10056880 Ga0268266_100568801 132
640 3300028379 Ga0268266_10120842 Ga0268266_101208424 132
641 3300028379 Ga0268266_10812016 Ga0268266_108120161 132
642 3300028379 Ga0268266_11719784 Ga0268266_117197841 132
643 3300028380 Ga0268265_11363567 Ga0268265_113635671 132
644 3300028380 Ga0268265_11948575 Ga0268265_119485751 132
645 3300028381 Ga0268264_10044665 Ga0268264_100446652 132
646 3300028381 Ga0268264_10200235 Ga0268264_102002353 132
647 3300028381 Ga0268264_10406693 Ga0268264_104066932 132
648 3300028794 Ga0307515_10021507 Ga0307515_1002150712 132
649 3300031235 Ga0265330_10126316 Ga0265330_101263161 132
650 3300031239 Ga0265328_10095158 Ga0265328_100951581 132
651 3300031456 Ga0307513_10414716 Ga0307513_104147161 132
652 3300031616 Ga0307508_10000184 Ga0307508_1000018476 132
653 3300031616 Ga0307508_10200344 Ga0307508_102003441 132
654 3300031712 Ga0265342_10480383 Ga0265342_104803831 132
655 3300031824 Ga0307413_10611089 Ga0307413_106110891 132
656 3300031901 Ga0307406_10256175 Ga0307406_102561751 132
657 3300031911 Ga0307412_10226481 Ga0307412_102264811 132
658 3300031995 Ga0307409_100020254 Ga0307409_1000202543 132
659 3300031995 Ga0307409_101068272 Ga0307409_1010682721 132
660 3300032004 Ga0307414_11192412 Ga0307414_111924121 132
661 3300032005 Ga0307411_10056323 Ga0307411_100563232 132
662 3300032126 Ga0307415_100238842 Ga0307415_1002388423 132
663 3300032126 Ga0307415_100882745 Ga0307415_1008827451 132
664 3300033180 Ga0307510_10037129 Ga0307510_100371294 132
665 3300033180 Ga0307510_10239149 Ga0307510_102391491 132
666 3300033442 Ga0315911_1000004 Ga0315911_1000004442 132
667 3300035085 Ga0373929_0049641 Ga0373929_0049641_81_521 132
668 3300035117 Ga0373953_0090395 Ga0373953_0090395_586_1026 132
669 3300035118 Ga0373954_0547444 Ga0373954_0547444_119_559 132
670 3300035119 Ga0373956_0130971 Ga0373956_0130971_137_577 132
671 3300035172 Ga0373955_0051615 Ga0373955_0051615_988_1428 132
672 3300035410 Ga0373924_0124665 Ga0373924_0124665_353_793 132
673 3300035724 Ga0373933_0225423 Ga0373933_0225423_309_749 132
674 3300035724 Ga0373933_0795178 Ga0373933_0795178_114_554 132
675 3300036401 Ga0373937_0013354 Ga0373937_0013354_611_1051 132
676 3300036401 Ga0373937_0026026 Ga0373937_0026026_1034_1474 132
677 3300041443 Ga0451789_0510036 Ga0451789_0510036_37_477 132
678 3300046454 Ga0495592_0027444 Ga0495592_0027444_1714_2154 132
679 3300046455 Ga0495603_0023706 Ga0495603_0023706_696_1136 132
680 3300046455 Ga0495603_0026045 Ga0495603_0026045_2516_2956 132
681 3300046459 Ga0495629_0049078 Ga0495629_0049078_1626_2066 132
682 3300046462 Ga0495651_0010512 Ga0495651_0010512_4437_4877 132
683 3300046462 Ga0495651_0391216 Ga0495651_0391216_328_768 132
684 3300046463 Ga0495653_0064142 Ga0495653_0064142_1839_2279 132
685 3300046473 Ga0495582_0377347 Ga0495582_0377347_75_515 132
686 3300046474 Ga0495605_0231992 Ga0495605_0231992_76_516 132
687 3300046475 Ga0495639_0051951 Ga0495639_0051951_417_857 132
688 3300046475 Ga0495639_0345907 Ga0495639_0345907_291_731 132
689 3300046491 Ga0495584_0068361 Ga0495584_0068361_725_1165 132
690 3300046511 Ga0495608_0005459 Ga0495608_0005459_2196_2636 132
691 3300046518 Ga0495631_0272978 Ga0495631_0272978_250_690 132
692 3300046523 Ga0495644_0129781 Ga0495644_0129781_407_847 132
693 3300046529 Ga0495652_0046160 Ga0495652_0046160_2300_2740 132
694 3300046530 Ga0495654_0344072 Ga0495654_0344072_39_479 132
695 3300046533 Ga0495640_0113548 Ga0495640_0113548_71_511 132
696 3300046536 Ga0495587_0007813 Ga0495587_0007813_3765_4205 132
697 3300046536 Ga0495587_0201889 Ga0495587_0201889_363_803 132
698 3300046559 Ga0495667_0000942 Ga0495667_0000942_16858_17298 132
699 3300046642 Ga0495634_0054479 Ga0495634_0054479_125_565 132
700 3300046663 Ga0495635_0039027 Ga0495635_0039027_1963_2403 132
701 3300046675 Ga0495657_0004119 Ga0495657_0004119_3695_4135 132
702 3300046678 Ga0495599_0037455 Ga0495599_0037455_2193_2633 132
703 3300046679 Ga0495623_0031884 Ga0495623_0031884_2478_2918 132
704 3300046684 Ga0495669_0006686 Ga0495669_0006686_1125_1565 132
705 3300046691 Ga0495670_0119303 Ga0495670_0119303_585_1025 132
706 3300046692 Ga0495671_0237900 Ga0495671_0237900_190_630 132
707 3300046692 Ga0495671_0402439 Ga0495671_0402439_107_547 132
708 3300046809 Ga0495600_0006529 Ga0495600_0006529_2143_2583 132
709 3300047315 Ga0495581_0118103 Ga0495581_0118103_1062_1502 132
710 3300047317 Ga0495604_0055722 Ga0495604_0055722_448_888 132
711 3300047319 Ga0495674_0218017 Ga0495674_0218017_1014_1454 132
712 3300047322 Ga0495680_0006377 Ga0495680_0006377_3810_4250 132
713 3300047444 Ga0495675_0034684 Ga0495675_0034684_374_814 132
714 3300047444 Ga0495675_0444658 Ga0495675_0444658_50_490 132
715 3300047445 Ga0495677_0076241 Ga0495677_0076241_25_465 132
716 3300047472 Ga0495686_0580623 Ga0495686_0580623_76_516 132
717 3300047673 Ga0495593_0006559 Ga0495593_0006559_5282_5722 132
718 3300048088 Ga0495602_0031206 Ga0495602_0031206_2034_2474 132
719 3300048088 Ga0495602_0477491 Ga0495602_0477491_172_612 132
720 3300048903 Ga0496100_0130625 Ga0496100_0130625_1183_1623 132
721 3300048903 Ga0496100_0140373 Ga0496100_0140373_702_1142 132
722 3300048903 Ga0496100_0694297 Ga0496100_0694297_293_733 132
723 3300048903 Ga0496100_1430215 Ga0496100_1430215_61_501 132
724 3300048904 Ga0496101_0199753 Ga0496101_0199753_676_1116 132
725 3300048904 Ga0496101_0310960 Ga0496101_0310960_358_798 132
726 3300048904 Ga0496101_0739419 Ga0496101_0739419_306_746 132
727 3300048907 Ga0496104_1287667 Ga0496104_1287667_108_548 132
728 3300048909 Ga0496106_0247650 Ga0496106_0247650_15_455 132
729 3300048910 Ga0496107_0188284 Ga0496107_0188284_668_1108 132
730 3300048911 Ga0496108_0425345 Ga0496108_0425345_232_672 132
731 3300048912 Ga0496109_0255485 Ga0496109_0255485_816_1256 132
732 3300048912 Ga0496109_1248175 Ga0496109_1248175_175_615 132
733 3300048913 Ga0496110_1031004 Ga0496110_1031004_83_523 132
734 3300048914 Ga0496111_0240456 Ga0496111_0240456_500_940 132
735 3300048915 Ga0496112_0108211 Ga0496112_0108211_709_1149 132
736 3300048916 Ga0496113_0127032 Ga0496113_0127032_1028_1468 132
737 3300048918 Ga0496115_0558994 Ga0496115_0558994_175_615 132
738 3300048921 Ga0496118_0221212 Ga0496118_0221212_172_612 132
739 3300048924 Ga0496121_0059965 Ga0496121_0059965_864_1304 132
740 3300048924 Ga0496121_0322684 Ga0496121_0322684_465_905 132
741 3300048928 Ga0496125_0589383 Ga0496125_0589383_138_578 132
742 3300048929 Ga0496126_0034788 Ga0496126_0034788_4149_4589 132
743 3300048929 Ga0496126_0715821 Ga0496126_0715821_126_566 132
744 3300049568 Ga0501031_0505139 Ga0501031_0505139_32_472 132
745 3300050491 nmdc:mga00v17_523477_c1 nmdc:mga00v17_523477_c1_160_600 132
746 3300050492 nmdc:mga0yw44_394168_c1 nmdc:mga0yw44_394168_c1_101_541 132
747 3300050492 nmdc:mga0yw44_78033_c1 nmdc:mga0yw44_78033_c1_556_996 132
748 3300050493 nmdc:mga0k408_140888_c1 nmdc:mga0k408_140888_c1_582_1022 132
749 3300050493 nmdc:mga0k408_264138_c1 nmdc:mga0k408_264138_c1_53_493 132
750 3300050494 nmdc:mga06z11_143043_c1 nmdc:mga06z11_143043_c1_657_1097 132
751 3300050494 nmdc:mga06z11_382606_c1 nmdc:mga06z11_382606_c1_233_673 132
752 3300050496 nmdc:mga07m45_42162_c1 nmdc:mga07m45_42162_c1_1247_1687 132
753 3300050507 nmdc:mga05p37_260841_c1 nmdc:mga05p37_260841_c1_382_822 132
754 3300050511 nmdc:mga08y16_1515617_c1 nmdc:mga08y16_1515617_c1_94_534 132
755 3300050511 nmdc:mga08y16_790132_c1 nmdc:mga08y16_790132_c1_145_585 132
756 3300050512 nmdc:mga0n895_185725_c1 nmdc:mga0n895_185725_c1_14_454 132
757 3300050512 nmdc:mga0n895_800814_c1 nmdc:mga0n895_800814_c1_358_798 132
758 3300050515 nmdc:mga0a205_543629_c1 nmdc:mga0a205_543629_c1_85_525 132
759 3300050516 nmdc:mga0sz30_128427_c1 nmdc:mga0sz30_128427_c1_600_1040 132
760 3300050516 nmdc:mga0sz30_74171_c1 nmdc:mga0sz30_74171_c1_695_1135 132
761 3300053077 Ga0495601_0341856 Ga0495601_0341856_67_507 132
762 3300053078 Ga0495612_0434493 Ga0495612_0434493_141_581 132
763 3300053080 Ga0500635_0003695 Ga0500635_0003695_1587_2027 132
764 3300053085 Ga0495619_0009050 Ga0495619_0009050_2378_2818 132
765 3300053092 Ga0500583_0305368 Ga0500583_0305368_68_508 132
766 3300053094 Ga0500566_0077857 Ga0500566_0077857_700_1140 132
767 3300053096 Ga0500641_0392582 Ga0500641_0392582_42_482 132
768 3300053102 Ga0500554_005653 Ga0500554_005653_1207_1647 132
769 3300053111 Ga0500572_000589 Ga0500572_000589_2208_2648 132
770 3300053136 Ga0500559_0000685 Ga0500559_0000685_88_528 132
771 3300053150 Ga0500603_001309 Ga0500603_001309_2203_2643 132
772 3300053163 Ga0500639_207464 Ga0500639_207464_46_486 132
773 3300053178 Ga0500637_0013609 Ga0500637_0013609_2797_3237 132
774 3300053725 Ga0500576_093824 Ga0500576_093824_728_1168 132
775 3300053735 Ga0500596_012476 Ga0500596_012476_226_666 132
776 3300054114 Ga0501084_1633947 Ga0501084_1633947_65_505 132

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uc0-assembly1.cif.gz_B crystal structure of beta-barrel-like, uncharacterized protein of cog5400 from brucella abortus 0.7014 63 120
5uc0-assembly1.cif.gz_A crystal structure of beta-barrel-like, uncharacterized protein of cog5400 from brucella abortus 0.6574 54 120
3hzh-assembly1.cif.gz_B crystal structure of the chex-chey-bef3-mg+2 complex from borrelia burgdorferi 0.5052 91 117
3rnq-assembly1.cif.gz_B crystal structure of the complex between the extracellular domains of mouse pd-1 mutant and pd-l2 0.4974 27 116
2xft-assembly1.cif.gz_A structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway 0.4796 66 124
ID Description Score Start End Superfamily
af_P52332_284_421_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6006 95 120 2.30.29.30
af_P41217_144_233_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5449 62 118 2.60.40.10
af_Q9U3M7_409_746_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.5362 95 123 3.40.710.10
5cxfA02 Mainly Beta;Roll;PH-domain like; 0.4884 93 113 2.30.29.100
af_Q5MD89_245_360_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4867 62 126 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A1H6CJL1-F1-model_v4 Las17-binding protein actin regulator 0.8005 62 118 GO:0016020
AF-A0A181CCW0-F1-model_v4 deleted 0.7747 31 117
AF-A0A2V8PD31-F1-model_v4 DUF1134 domain-containing protein 0.7703 63 132
AF-A0A537K9A0-F1-model_v4 DUF1134 domain-containing protein 0.7569 63 132
AF-A0A2S5TFJ1-F1-model_v4 DUF1134 domain-containing protein 0.7536 61 132

Feature Viewer

pLDDT pTM Quality
67.43 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map