F480289
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 401 | 736 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300003578|Ga0006562J51391_1128315|Ga0006562J51391_11283152 |
| Length | 147 |
| Sequence | MSRGRMQFRHGARDEPEINLIPFIDVLLVILIFLMLSTTYSKFTEMQLRLPTADVDSQRDYPKEVIVAVSADGRYSINKKPVADRNVDTVAAALGAAATGGKDSVVIISADASSPHQAVITVMEAARRVGLVQITFAAQSSAQQAGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 8 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 9 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 10 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 11 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 12 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 13 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 14 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 15 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 16 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 17 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 18 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 19 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 20 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 21 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 22 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 23 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 24 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 25 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 26 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 27 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 28 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 29 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 30 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 31 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 32 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 33 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 34 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 35 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 36 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 37 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 38 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 39 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 40 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 41 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 42 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 43 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 44 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 45 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 46 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 47 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 48 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 49 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 50 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 51 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 52 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 53 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 54 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 55 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 65 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 67 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 70 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 72 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 102 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 112 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 113 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 125 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 126 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 206 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 207 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 208 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 209 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 210 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 211 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 212 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 240 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 241 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 242 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 243 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 244 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 245 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 246 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 251 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 252 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 253 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 256 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 257 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 258 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 259 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 260 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 261 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 262 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 263 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 264 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 265 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 266 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 267 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 268 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 269 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 270 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 271 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 272 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 273 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 274 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 275 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 276 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 277 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 278 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 279 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 280 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 281 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 282 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 283 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 284 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 285 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 286 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 287 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 288 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 289 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 290 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 291 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 292 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 293 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 294 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 295 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 296 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 297 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 298 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 334 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 335 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 336 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 337 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 338 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 339 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 353 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 356 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 372 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 374 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 375 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 376 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 379 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 380 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 381 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 382 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 383 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 384 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 385 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 386 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 387 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 389 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 390 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 394 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 396 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 398 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 399 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 400 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.72 |
| Metatranscriptomes | 0.13 |
| Isolates | 5.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 34.15 |
| Nodule | 1.42 |
| Rhizoplane | 1.29 |
| Rhizosphere | 54.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000002 | 3300002704 | Bacteria | 292156 |
| 2 | JGI25156J39149_1000003 | 3300002705 | Bacteria | 305434 |
| 3 | JGI25154J39366_1000009 | 3300002738 | Bacteria | 305408 |
| 4 | JGI25158J39367_1002521 | 3300002739 | Bacteria | 2962 |
| 5 | JGI25157J39369_1000002 | 3300002741 | Bacteria | 305434 |
| 6 | JGI25150J39212_1001290 | 3300002774 | Bacteria | 7148 |
| 7 | JGI25159J45721_1001861 | 3300002987 | Bacteria | 8437 |
| 8 | JGI25159J45721_1002062 | 3300002987 | Bacteria | 7934 |
| 9 | JGI25151J46595_10003617 | 3300003187 | Bacteria | 8453 |
| 10 | JGI25151J46595_10010954 | 3300003187 | Bacteria | 4192 |
| 11 | JGI25151J46595_10013500 | 3300003187 | Bacteria | 3673 |
| 12 | JGI25151J46595_10016857 | 3300003187 | Bacteria | 3185 |
| 13 | JGI25151J46595_10109725 | 3300003187 | Bacteria | 723 |
| 14 | JGI25153J46596_10025433 | 3300003215 | Bacteria | 2115 |
| 15 | rootH1_10020189 | 3300003316 | Bacteria | 3283 |
| 16 | rootL2_10002429 | 3300003322 | Bacteria | 20561 |
| 17 | JGI25160J50197_1000646 | 3300003354 | Bacteria | 19384 |
| 18 | JGI25160J50197_1000712 | 3300003354 | Bacteria | 18321 |
| 19 | JGI25161J50226_1000018 | 3300003374 | Bacteria | 172599 |
| 20 | Ga0006562J51391_1128315 | 3300003578 | Bacteria | 5254 |
| 21 | Ga0055535_1004635 | 3300003761 | Bacteria | 3268 |
| 22 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 23 | Ga0055526_1001518 | 3300003771 | Bacteria | 16425 |
| 24 | Ga0055526_1010011 | 3300003771 | Bacteria | 4472 |
| 25 | Ga0055526_1083266 | 3300003771 | Bacteria | 618 |
| 26 | Ga0055537_1000611 | 3300003773 | Bacteria | 19655 |
| 27 | Ga0055524_1000012 | 3300003775 | Bacteria | 260384 |
| 28 | Ga0055524_1000467 | 3300003775 | Bacteria | 32384 |
| 29 | Ga0055536_1000619 | 3300003781 | Bacteria | 24142 |
| 30 | Ga0055536_1009081 | 3300003781 | Bacteria | 4176 |
| 31 | Ga0055536_1009125 | 3300003781 | Bacteria | 4153 |
| 32 | Ga0055534_1000566 | 3300003784 | Bacteria | 19542 |
| 33 | Ga0055534_1012050 | 3300003784 | Bacteria | 1729 |
| 34 | Ga0055528_1000925 | 3300003790 | Bacteria | 19615 |
| 35 | Ga0055528_1000932 | 3300003790 | Bacteria | 19542 |
| 36 | Ga0055530_10000258 | 3300003791 | Bacteria | 47803 |
| 37 | Ga0055530_10000468 | 3300003791 | Bacteria | 35281 |
| 38 | Ga0055530_10002096 | 3300003791 | Bacteria | 13321 |
| 39 | Ga0055530_10002329 | 3300003791 | Bacteria | 12409 |
| 40 | Ga0055530_10012755 | 3300003791 | Bacteria | 2910 |
| 41 | Ga0055530_10095340 | 3300003791 | Bacteria | 604 |
| 42 | Ga0055540_1000012 | 3300003792 | Bacteria | 262667 |
| 43 | Ga0055540_1000023 | 3300003792 | Bacteria | 201131 |
| 44 | Ga0055540_1001593 | 3300003792 | Bacteria | 13220 |
| 45 | Ga0055540_1001668 | 3300003792 | Bacteria | 12860 |
| 46 | Ga0055540_1002522 | 3300003792 | Bacteria | 9562 |
| 47 | Ga0055540_1006194 | 3300003792 | Bacteria | 4809 |
| 48 | Ga0055531_10000345 | 3300003794 | Bacteria | 45594 |
| 49 | Ga0055531_10001882 | 3300003794 | Bacteria | 14698 |
| 50 | Ga0055531_10002317 | 3300003794 | Bacteria | 12860 |
| 51 | Ga0055531_10005462 | 3300003794 | Bacteria | 7439 |
| 52 | Ga0055531_10021287 | 3300003794 | Bacteria | 2521 |
| 53 | Ga0065165_1059631 | 3300005262 | Bacteria | 1049 |
| 54 | Ga0070658_10106566 | 3300005327 | Bacteria | 2319 |
| 55 | Ga0070658_10173078 | 3300005327 | Bacteria | 1814 |
| 56 | Ga0070658_10674937 | 3300005327 | Bacteria | 897 |
| 57 | Ga0070670_100028698 | 3300005331 | Bacteria | 4789 |
| 58 | Ga0068869_100055267 | 3300005334 | Bacteria | 2893 |
| 59 | Ga0068869_101867476 | 3300005334 | Bacteria | 538 |
| 60 | Ga0070682_100204466 | 3300005337 | Bacteria | 1395 |
| 61 | Ga0068868_100144468 | 3300005338 | Bacteria | 1955 |
| 62 | Ga0070660_100131394 | 3300005339 | Bacteria | 2004 |
| 63 | Ga0070660_100773559 | 3300005339 | Bacteria | 807 |
| 64 | Ga0070661_100185938 | 3300005344 | Bacteria | 1583 |
| 65 | Ga0070669_100087546 | 3300005353 | Bacteria | 2329 |
| 66 | Ga0070674_100397772 | 3300005356 | Bacteria | 1125 |
| 67 | Ga0070688_101108853 | 3300005365 | Bacteria | 633 |
| 68 | Ga0070659_100426046 | 3300005366 | Bacteria | 1123 |
| 69 | Ga0070714_100176236 | 3300005435 | Bacteria | 1943 |
| 70 | Ga0070678_100056601 | 3300005456 | Bacteria | 2869 |
| 71 | Ga0070678_100606613 | 3300005456 | Bacteria | 978 |
| 72 | Ga0070678_100650034 | 3300005456 | Bacteria | 946 |
| 73 | Ga0070678_100843089 | 3300005456 | Bacteria | 835 |
| 74 | Ga0070662_100020121 | 3300005457 | Bacteria | 4541 |
| 75 | Ga0070662_100164083 | 3300005457 | Bacteria | 1739 |
| 76 | Ga0068867_100167155 | 3300005459 | Bacteria | 1739 |
| 77 | Ga0070706_101733894 | 3300005467 | Bacteria | 568 |
| 78 | Ga0070707_100183676 | 3300005468 | Bacteria | 2039 |
| 79 | Ga0070679_100082648 | 3300005530 | Bacteria | 3201 |
| 80 | Ga0068853_100385910 | 3300005539 | Bacteria | 1309 |
| 81 | Ga0068853_101448525 | 3300005539 | Bacteria | 665 |
| 82 | Ga0070672_101412440 | 3300005543 | Bacteria | 623 |
| 83 | Ga0070665_100273590 | 3300005548 | Bacteria | 1691 |
| 84 | Ga0070704_100479568 | 3300005549 | Bacteria | 1076 |
| 85 | Ga0068855_100067747 | 3300005563 | Bacteria | 4157 |
| 86 | Ga0068855_100083077 | 3300005563 | Bacteria | 3711 |
| 87 | Ga0068855_100104421 | 3300005563 | Bacteria | 3259 |
| 88 | Ga0068855_101370166 | 3300005563 | Bacteria | 730 |
| 89 | Ga0068857_100025225 | 3300005577 | Bacteria | 5235 |
| 90 | Ga0068857_100139774 | 3300005577 | Bacteria | 2188 |
| 91 | Ga0068854_100981658 | 3300005578 | Bacteria | 747 |
| 92 | Ga0068852_100236525 | 3300005616 | Bacteria | 1744 |
| 93 | Ga0068852_100322503 | 3300005616 | Bacteria | 1501 |
| 94 | Ga0068852_101573826 | 3300005616 | Bacteria | 680 |
| 95 | Ga0068852_101718896 | 3300005616 | Bacteria | 650 |
| 96 | Ga0068859_101024603 | 3300005617 | Bacteria | 907 |
| 97 | Ga0068864_100612088 | 3300005618 | Bacteria | 1058 |
| 98 | Ga0068861_100563512 | 3300005719 | Bacteria | 1040 |
| 99 | Ga0068862_100071635 | 3300005844 | Bacteria | 2992 |
| 100 | Ga0075365_10012495 | 3300006038 | Bacteria | 5046 |
| 101 | Ga0075365_10063578 | 3300006038 | Bacteria | 2471 |
| 102 | Ga0075365_10393583 | 3300006038 | Bacteria | 978 |
| 103 | Ga0075368_10024851 | 3300006042 | Bacteria | 2296 |
| 104 | Ga0075368_10207967 | 3300006042 | Bacteria | 829 |
| 105 | Ga0075368_10389531 | 3300006042 | Bacteria | 611 |
| 106 | Ga0075363_100008603 | 3300006048 | Bacteria | 4763 |
| 107 | Ga0075363_100009940 | 3300006048 | Bacteria | 4492 |
| 108 | Ga0075363_100020743 | 3300006048 | Bacteria | 3299 |
| 109 | Ga0075363_100049966 | 3300006048 | Bacteria | 2228 |
| 110 | Ga0075363_100195854 | 3300006048 | Bacteria | 1154 |
| 111 | Ga0075364_10006278 | 3300006051 | Bacteria | 6974 |
| 112 | Ga0075364_10039374 | 3300006051 | Bacteria | 3064 |
| 113 | Ga0075432_10048247 | 3300006058 | Bacteria | 1498 |
| 114 | Ga0075432_10057023 | 3300006058 | Bacteria | 1385 |
| 115 | Ga0075362_10009304 | 3300006177 | Bacteria | 3795 |
| 116 | Ga0075362_10015316 | 3300006177 | Bacteria | 3116 |
| 117 | Ga0075362_10027540 | 3300006177 | Bacteria | 2434 |
| 118 | Ga0075362_10073744 | 3300006177 | Bacteria | 1563 |
| 119 | Ga0075362_10089551 | 3300006177 | Bacteria | 1427 |
| 120 | Ga0075362_10337089 | 3300006177 | Bacteria | 753 |
| 121 | Ga0075367_10006255 | 3300006178 | Bacteria | 6000 |
| 122 | Ga0075367_10052314 | 3300006178 | Bacteria | 2417 |
| 123 | Ga0075367_10080808 | 3300006178 | Bacteria | 1966 |
| 124 | Ga0075367_10186701 | 3300006178 | Bacteria | 1293 |
| 125 | Ga0075367_10220216 | 3300006178 | Bacteria | 1188 |
| 126 | Ga0075366_10003789 | 3300006195 | Bacteria | 8042 |
| 127 | Ga0075366_10005303 | 3300006195 | Bacteria | 6983 |
| 128 | Ga0075366_10016348 | 3300006195 | Bacteria | 4264 |
| 129 | Ga0075366_10042200 | 3300006195 | Bacteria | 2700 |
| 130 | Ga0075366_10112588 | 3300006195 | Bacteria | 1638 |
| 131 | Ga0075366_10308221 | 3300006195 | Bacteria | 969 |
| 132 | Ga0075366_10423949 | 3300006195 | Bacteria | 820 |
| 133 | Ga0075366_10618825 | 3300006195 | Bacteria | 671 |
| 134 | Ga0097621_100103874 | 3300006237 | Bacteria | 2394 |
| 135 | Ga0075370_10000113 | 3300006353 | Bacteria | 26281 |
| 136 | Ga0075370_10009267 | 3300006353 | Bacteria | 5105 |
| 137 | Ga0075370_10009814 | 3300006353 | Bacteria | 4988 |
| 138 | Ga0075370_10018917 | 3300006353 | Bacteria | 3741 |
| 139 | Ga0075370_10021624 | 3300006353 | Bacteria | 3524 |
| 140 | Ga0075370_10110265 | 3300006353 | Bacteria | 1598 |
| 141 | Ga0075370_10176749 | 3300006353 | Bacteria | 1256 |
| 142 | Ga0075370_10324294 | 3300006353 | Bacteria | 918 |
| 143 | Ga0075370_10449390 | 3300006353 | Bacteria | 775 |
| 144 | Ga0075370_10548821 | 3300006353 | Bacteria | 699 |
| 145 | Ga0075370_10878057 | 3300006353 | Bacteria | 548 |
| 146 | Ga0068871_100539829 | 3300006358 | Bacteria | 1055 |
| 147 | Ga0075430_100276481 | 3300006846 | Bacteria | 1390 |
| 148 | Ga0068865_101165209 | 3300006881 | Bacteria | 681 |
| 149 | Ga0097620_101024706 | 3300006931 | Bacteria | 907 |
| 150 | Ga0079104_1019897 | 3300006946 | Bacteria | 1863 |
| 151 | Ga0099826_10018478 | 3300006948 | Bacteria | 5259 |
| 152 | Ga0099826_10092532 | 3300006948 | Bacteria | 1845 |
| 153 | Ga0099826_10275347 | 3300006948 | Bacteria | 873 |
| 154 | Ga0099826_10297222 | 3300006948 | Bacteria | 827 |
| 155 | Ga0105244_10006312 | 3300009036 | Bacteria | 7711 |
| 156 | Ga0105240_10010481 | 3300009093 | Bacteria | 13031 |
| 157 | Ga0105240_10038655 | 3300009093 | Bacteria | 6119 |
| 158 | Ga0105245_10082783 | 3300009098 | Bacteria | 2936 |
| 159 | Ga0105247_11419583 | 3300009101 | Bacteria | 563 |
| 160 | Ga0114129_10420441 | 3300009147 | Bacteria | 1758 |
| 161 | Ga0105243_10003718 | 3300009148 | Bacteria | 12244 |
| 162 | Ga0105243_10009907 | 3300009148 | Bacteria | 7245 |
| 163 | Ga0105243_10029931 | 3300009148 | Bacteria | 4189 |
| 164 | Ga0105243_10510460 | 3300009148 | Bacteria | 1141 |
| 165 | Ga0105241_10403179 | 3300009174 | Bacteria | 1200 |
| 166 | Ga0105241_10446187 | 3300009174 | Bacteria | 1144 |
| 167 | Ga0105237_10000674 | 3300009545 | Bacteria | 47165 |
| 168 | Ga0105238_10084714 | 3300009551 | Bacteria | 3159 |
| 169 | Ga0105238_10316590 | 3300009551 | Bacteria | 1546 |
| 170 | Ga0105238_10521004 | 3300009551 | Bacteria | 1191 |
| 171 | Ga0105239_10002955 | 3300010375 | Bacteria | 21201 |
| 172 | Ga0105239_10180443 | 3300010375 | Bacteria | 2362 |
| 173 | Ga0105239_10260861 | 3300010375 | Bacteria | 1947 |
| 174 | Ga0105246_10123184 | 3300011119 | Bacteria | 1924 |
| 175 | Ga0157319_1000013 | 3300012497 | Bacteria | 154883 |
| 176 | Ga0157319_1036266 | 3300012497 | Bacteria | 557 |
| 177 | Ga0157347_1010744 | 3300012502 | Bacteria | 965 |
| 178 | Ga0157326_1002747 | 3300012513 | Bacteria | 1868 |
| 179 | Ga0157373_10022709 | 3300013100 | Bacteria | 4550 |
| 180 | Ga0157373_10039138 | 3300013100 | Bacteria | 3395 |
| 181 | Ga0157371_10143363 | 3300013102 | Bacteria | 1702 |
| 182 | Ga0157370_11553642 | 3300013104 | Bacteria | 595 |
| 183 | Ga0157369_10005311 | 3300013105 | Bacteria | 15014 |
| 184 | Ga0163162_10195517 | 3300013306 | Bacteria | 2151 |
| 185 | Ga0157372_10028520 | 3300013307 | Bacteria | 6092 |
| 186 | Ga0157375_11297136 | 3300013308 | Bacteria | 856 |
| 187 | Ga0157380_12224018 | 3300014326 | Bacteria | 612 |
| 188 | Ga0182008_10002197 | 3300014497 | Bacteria | 12389 |
| 189 | Ga0182008_10053615 | 3300014497 | Bacteria | 1996 |
| 190 | Ga0182008_10095818 | 3300014497 | Bacteria | 1464 |
| 191 | Ga0157376_10756312 | 3300014969 | Bacteria | 981 |
| 192 | Ga0157376_11456896 | 3300014969 | Bacteria | 717 |
| 193 | Ga0157376_11473096 | 3300014969 | Bacteria | 713 |
| 194 | Ga0157376_12587425 | 3300014969 | Bacteria | 547 |
| 195 | Ga0182006_1174856 | 3300015261 | Bacteria | 718 |
| 196 | Ga0182007_10000693 | 3300015262 | Bacteria | 19235 |
| 197 | Ga0182005_1015209 | 3300015265 | Bacteria | 2149 |
| 198 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 199 | Ga0163161_10010831 | 3300017792 | Bacteria | 6320 |
| 200 | Ga0163161_10131504 | 3300017792 | Bacteria | 1888 |
| 201 | Ga0163161_10163139 | 3300017792 | Bacteria | 1700 |
| 202 | Ga0163161_10228194 | 3300017792 | Bacteria | 1444 |
| 203 | Ga0163161_10486216 | 3300017792 | Bacteria | 1003 |
| 204 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 205 | Ga0209436_102515 | 3300025208 | Bacteria | 5463 |
| 206 | Ga0209436_111482 | 3300025208 | Bacteria | 1553 |
| 207 | Ga0209672_103149 | 3300025228 | Bacteria | 3547 |
| 208 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 209 | Ga0207425_1000450 | 3300025245 | Bacteria | 26760 |
| 210 | Ga0207425_1000784 | 3300025245 | Bacteria | 16242 |
| 211 | Ga0207425_1002389 | 3300025245 | Bacteria | 6644 |
| 212 | Ga0207425_1003947 | 3300025245 | Bacteria | 4576 |
| 213 | Ga0207425_1064914 | 3300025245 | Bacteria | 636 |
| 214 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 215 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 216 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 217 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 218 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 219 | Ga0209129_1000718 | 3300025258 | Bacteria | 21373 |
| 220 | Ga0209129_1001139 | 3300025258 | Bacteria | 15365 |
| 221 | Ga0209129_1003872 | 3300025258 | Bacteria | 6232 |
| 222 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 223 | Ga0209565_1000114 | 3300025263 | Bacteria | 116078 |
| 224 | Ga0209565_1000187 | 3300025263 | Bacteria | 76001 |
| 225 | Ga0209565_1000892 | 3300025263 | Bacteria | 16282 |
| 226 | Ga0209565_1001739 | 3300025263 | Bacteria | 8889 |
| 227 | Ga0209673_1000074 | 3300025273 | Bacteria | 233552 |
| 228 | Ga0209673_1000389 | 3300025273 | Bacteria | 79243 |
| 229 | Ga0209673_1001621 | 3300025273 | Bacteria | 19594 |
| 230 | Ga0209673_1002302 | 3300025273 | Bacteria | 13581 |
| 231 | Ga0209673_1003621 | 3300025273 | Bacteria | 8940 |
| 232 | Ga0209673_1007069 | 3300025273 | Bacteria | 5265 |
| 233 | Ga0209673_1039655 | 3300025273 | Bacteria | 1357 |
| 234 | Ga0209130_1000050 | 3300025284 | Bacteria | 222092 |
| 235 | Ga0209130_1000069 | 3300025284 | Bacteria | 179177 |
| 236 | Ga0209130_1001070 | 3300025284 | Bacteria | 20605 |
| 237 | Ga0209675_1000029 | 3300025291 | Bacteria | 281053 |
| 238 | Ga0209675_1000044 | 3300025291 | Bacteria | 230392 |
| 239 | Ga0209675_1000232 | 3300025291 | Bacteria | 56301 |
| 240 | Ga0209675_1001699 | 3300025291 | Bacteria | 12181 |
| 241 | Ga0209675_1002669 | 3300025291 | Bacteria | 8997 |
| 242 | Ga0209675_1003844 | 3300025291 | Bacteria | 6927 |
| 243 | Ga0209675_1010724 | 3300025291 | Bacteria | 3103 |
| 244 | Ga0209675_1041451 | 3300025291 | Bacteria | 1004 |
| 245 | Ga0209675_1086622 | 3300025291 | Bacteria | 572 |
| 246 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 247 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 248 | Ga0209676_1000139 | 3300025292 | Bacteria | 177886 |
| 249 | Ga0209676_1001285 | 3300025292 | Bacteria | 25953 |
| 250 | Ga0209676_1001530 | 3300025292 | Bacteria | 21006 |
| 251 | Ga0209676_1032620 | 3300025292 | Bacteria | 1564 |
| 252 | Ga0209676_1032923 | 3300025292 | Bacteria | 1551 |
| 253 | Ga0209025_1000316 | 3300025294 | Bacteria | 107447 |
| 254 | Ga0209025_1000435 | 3300025294 | Bacteria | 82663 |
| 255 | Ga0209025_1001778 | 3300025294 | Bacteria | 25651 |
| 256 | Ga0209025_1005176 | 3300025294 | Bacteria | 10786 |
| 257 | Ga0209025_1005467 | 3300025294 | Bacteria | 10348 |
| 258 | Ga0209025_1005773 | 3300025294 | Bacteria | 9927 |
| 259 | Ga0209025_1017247 | 3300025294 | Bacteria | 4184 |
| 260 | Ga0209025_1020498 | 3300025294 | Bacteria | 3614 |
| 261 | Ga0209025_1026531 | 3300025294 | Bacteria | 2903 |
| 262 | Ga0209025_1036670 | 3300025294 | Bacteria | 2191 |
| 263 | Ga0209564_1000090 | 3300025295 | Bacteria | 249298 |
| 264 | Ga0209564_1001399 | 3300025295 | Bacteria | 25052 |
| 265 | Ga0209564_1001809 | 3300025295 | Bacteria | 19735 |
| 266 | Ga0209564_1003288 | 3300025295 | Bacteria | 11240 |
| 267 | Ga0209564_1025454 | 3300025295 | Bacteria | 1989 |
| 268 | Ga0209758_1000044 | 3300025297 | Bacteria | 398448 |
| 269 | Ga0209758_1003942 | 3300025297 | Bacteria | 12892 |
| 270 | Ga0209758_1015794 | 3300025297 | Bacteria | 3883 |
| 271 | Ga0209758_1062172 | 3300025297 | Bacteria | 1224 |
| 272 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 273 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 274 | Ga0209050_1000748 | 3300025298 | Bacteria | 46763 |
| 275 | Ga0209050_1003012 | 3300025298 | Bacteria | 13065 |
| 276 | Ga0209050_1004127 | 3300025298 | Bacteria | 10092 |
| 277 | Ga0209050_1006734 | 3300025298 | Bacteria | 6709 |
| 278 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 279 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 280 | Ga0209256_1000022 | 3300025299 | Bacteria | 481843 |
| 281 | Ga0209256_1001137 | 3300025299 | Bacteria | 30308 |
| 282 | Ga0209256_1084653 | 3300025299 | Bacteria | 686 |
| 283 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 284 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 285 | Ga0207426_1000071 | 3300025302 | Bacteria | 329539 |
| 286 | Ga0207426_1003300 | 3300025302 | Bacteria | 8974 |
| 287 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 288 | Ga0209051_1000036 | 3300025303 | Bacteria | 339863 |
| 289 | Ga0209051_1000079 | 3300025303 | Bacteria | 201183 |
| 290 | Ga0209051_1000254 | 3300025303 | Bacteria | 90411 |
| 291 | Ga0209051_1000465 | 3300025303 | Bacteria | 53039 |
| 292 | Ga0209051_1000893 | 3300025303 | Bacteria | 29873 |
| 293 | Ga0209051_1001299 | 3300025303 | Bacteria | 21972 |
| 294 | Ga0209051_1015793 | 3300025303 | Bacteria | 3458 |
| 295 | Ga0209051_1016913 | 3300025303 | Bacteria | 3276 |
| 296 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 297 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 298 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 299 | Ga0209257_1000045 | 3300025304 | Bacteria | 484429 |
| 300 | Ga0209257_1000137 | 3300025304 | Bacteria | 204210 |
| 301 | Ga0209257_1000183 | 3300025304 | Bacteria | 156618 |
| 302 | Ga0209257_1000226 | 3300025304 | Bacteria | 133836 |
| 303 | Ga0209257_1001249 | 3300025304 | Bacteria | 31428 |
| 304 | Ga0209257_1004427 | 3300025304 | Bacteria | 10890 |
| 305 | Ga0209257_1008548 | 3300025304 | Bacteria | 5778 |
| 306 | Ga0207656_10016315 | 3300025321 | Bacteria | 2891 |
| 307 | Ga0207655_1003605 | 3300025728 | Bacteria | 11448 |
| 308 | Ga0207688_10876460 | 3300025901 | Bacteria | 569 |
| 309 | Ga0207705_10540466 | 3300025909 | Bacteria | 906 |
| 310 | Ga0207654_10495471 | 3300025911 | Bacteria | 862 |
| 311 | Ga0207695_10062014 | 3300025913 | Bacteria | 3862 |
| 312 | Ga0207671_10005512 | 3300025914 | Bacteria | 11641 |
| 313 | Ga0207671_10214669 | 3300025914 | Bacteria | 1506 |
| 314 | Ga0207660_10122893 | 3300025917 | Bacteria | 1968 |
| 315 | Ga0207662_11117314 | 3300025918 | Bacteria | 560 |
| 316 | Ga0207657_10055016 | 3300025919 | Bacteria | 3438 |
| 317 | Ga0207657_10254540 | 3300025919 | Bacteria | 1399 |
| 318 | Ga0207657_10812388 | 3300025919 | Bacteria | 723 |
| 319 | Ga0207652_10185118 | 3300025921 | Bacteria | 1872 |
| 320 | Ga0207652_10330106 | 3300025921 | Bacteria | 1377 |
| 321 | Ga0207646_10386937 | 3300025922 | Bacteria | 1263 |
| 322 | Ga0207681_10881116 | 3300025923 | Bacteria | 749 |
| 323 | Ga0207694_10102299 | 3300025924 | Bacteria | 2271 |
| 324 | Ga0207694_10111475 | 3300025924 | Bacteria | 2177 |
| 325 | Ga0207694_10725186 | 3300025924 | Bacteria | 839 |
| 326 | Ga0207650_10037174 | 3300025925 | Bacteria | 3547 |
| 327 | Ga0207659_10565480 | 3300025926 | Bacteria | 967 |
| 328 | Ga0207706_10043459 | 3300025933 | Bacteria | 3982 |
| 329 | Ga0207709_10000308 | 3300025935 | Bacteria | 53075 |
| 330 | Ga0207709_10030909 | 3300025935 | Bacteria | 3121 |
| 331 | Ga0207709_10052492 | 3300025935 | Bacteria | 2504 |
| 332 | Ga0207689_10033336 | 3300025942 | Bacteria | 4281 |
| 333 | Ga0207689_10226241 | 3300025942 | Bacteria | 1546 |
| 334 | Ga0207679_11108630 | 3300025945 | Bacteria | 726 |
| 335 | Ga0207667_10141437 | 3300025949 | Bacteria | 2477 |
| 336 | Ga0207667_10157592 | 3300025949 | Bacteria | 2336 |
| 337 | Ga0207667_10324139 | 3300025949 | Bacteria | 1573 |
| 338 | Ga0207667_11618739 | 3300025949 | Bacteria | 616 |
| 339 | Ga0207667_11833770 | 3300025949 | Bacteria | 570 |
| 340 | Ga0207651_10907851 | 3300025960 | Bacteria | 785 |
| 341 | Ga0207658_10609204 | 3300025986 | Bacteria | 982 |
| 342 | Ga0207677_10002959 | 3300026023 | Bacteria | 8975 |
| 343 | Ga0207639_10033887 | 3300026041 | Bacteria | 3770 |
| 344 | Ga0207639_10198421 | 3300026041 | Bacteria | 1719 |
| 345 | Ga0207639_10348015 | 3300026041 | Bacteria | 1323 |
| 346 | Ga0207678_10428100 | 3300026067 | Bacteria | 1148 |
| 347 | Ga0207702_10201192 | 3300026078 | Bacteria | 1846 |
| 348 | Ga0207648_10241467 | 3300026089 | Bacteria | 1608 |
| 349 | Ga0207648_10845603 | 3300026089 | Bacteria | 853 |
| 350 | Ga0207676_10491917 | 3300026095 | Bacteria | 1163 |
| 351 | Ga0207676_11703705 | 3300026095 | Bacteria | 629 |
| 352 | Ga0207674_10056108 | 3300026116 | Bacteria | 4001 |
| 353 | Ga0207683_10091578 | 3300026121 | Bacteria | 2709 |
| 354 | Ga0207683_10283950 | 3300026121 | Bacteria | 1513 |
| 355 | Ga0207683_10733956 | 3300026121 | Bacteria | 916 |
| 356 | Ga0207698_10199379 | 3300026142 | Bacteria | 1791 |
| 357 | Ga0207698_11992815 | 3300026142 | Bacteria | 595 |
| 358 | Ga0209281_1022425 | 3300027111 | Bacteria | 1209 |
| 359 | Ga0209281_1054133 | 3300027111 | Bacteria | 631 |
| 360 | Ga0209371_1010706 | 3300027312 | Bacteria | 2791 |
| 361 | Ga0209282_1003375 | 3300027666 | Bacteria | 9482 |
| 362 | Ga0209282_1094424 | 3300027666 | Bacteria | 1557 |
| 363 | Ga0207428_10506245 | 3300027907 | Bacteria | 877 |
| 364 | Ga0268266_10780709 | 3300028379 | Bacteria | 922 |
| 365 | Ga0268265_11250284 | 3300028380 | Bacteria | 741 |
| 366 | Ga0307515_10000302 | 3300028794 | Bacteria | 121875 |
| 367 | Ga0307515_10739565 | 3300028794 | Bacteria | 602 |
| 368 | Ga0268256_1015926 | 3300030500 | Bacteria | 2174 |
| 369 | Ga0316177_1035191 | 3300030731 | Bacteria | 934 |
| 370 | Ga0316177_1176206 | 3300030731 | Bacteria | 6146 |
| 371 | Ga0314311_1132537 | 3300030733 | Bacteria | 15305 |
| 372 | Ga0316178_1047908 | 3300030735 | Bacteria | 3382 |
| 373 | Ga0316180_1016115 | 3300030736 | Bacteria | 3132 |
| 374 | Ga0316183_1064677 | 3300030742 | Bacteria | 5372 |
| 375 | Ga0316181_1016216 | 3300030744 | Bacteria | 2719 |
| 376 | Ga0316181_1021957 | 3300030744 | Bacteria | 1525 |
| 377 | Ga0316182_1198643 | 3300030745 | Bacteria | 2835 |
| 378 | Ga0316182_1334382 | 3300030745 | Bacteria | 717 |
| 379 | Ga0265332_10072160 | 3300031238 | Bacteria | 1470 |
| 380 | Ga0265327_10006337 | 3300031251 | Bacteria | 9495 |
| 381 | Ga0307513_10000010 | 3300031456 | Bacteria | 360812 |
| 382 | Ga0307513_10000014 | 3300031456 | Bacteria | 303157 |
| 383 | Ga0307513_10468809 | 3300031456 | Bacteria | 981 |
| 384 | Ga0307513_10499396 | 3300031456 | Bacteria | 934 |
| 385 | Ga0307408_100015159 | 3300031548 | Bacteria | 5129 |
| 386 | Ga0307408_100032886 | 3300031548 | Bacteria | 3619 |
| 387 | Ga0307408_100066851 | 3300031548 | Bacteria | 2641 |
| 388 | Ga0307408_100198861 | 3300031548 | Bacteria | 1620 |
| 389 | Ga0307408_100428283 | 3300031548 | Bacteria | 1143 |
| 390 | Ga0307408_100656913 | 3300031548 | Bacteria | 938 |
| 391 | Ga0307408_100691912 | 3300031548 | Bacteria | 915 |
| 392 | Ga0307408_101592707 | 3300031548 | Bacteria | 620 |
| 393 | Ga0307514_10117701 | 3300031649 | Bacteria | 1863 |
| 394 | Ga0265314_10004251 | 3300031711 | Bacteria | 13421 |
| 395 | Ga0265342_10050409 | 3300031712 | Bacteria | 2487 |
| 396 | Ga0307516_10278932 | 3300031730 | Bacteria | 1354 |
| 397 | Ga0307405_10050523 | 3300031731 | Bacteria | 2575 |
| 398 | Ga0307405_10051342 | 3300031731 | Bacteria | 2558 |
| 399 | Ga0307405_10055618 | 3300031731 | Bacteria | 2477 |
| 400 | Ga0307405_10130429 | 3300031731 | Bacteria | 1736 |
| 401 | Ga0307405_10195113 | 3300031731 | Bacteria | 1465 |
| 402 | Ga0307405_10271674 | 3300031731 | Bacteria | 1271 |
| 403 | Ga0307405_10506738 | 3300031731 | Bacteria | 968 |
| 404 | Ga0307405_10599211 | 3300031731 | Bacteria | 899 |
| 405 | Ga0307405_10989762 | 3300031731 | Bacteria | 717 |
| 406 | Ga0307405_12104729 | 3300031731 | Bacteria | 506 |
| 407 | Ga0307413_10112493 | 3300031824 | Bacteria | 1825 |
| 408 | Ga0307413_10252644 | 3300031824 | Bacteria | 1309 |
| 409 | Ga0307413_10466580 | 3300031824 | Bacteria | 1006 |
| 410 | Ga0307413_11230010 | 3300031824 | Bacteria | 652 |
| 411 | Ga0307410_10323675 | 3300031852 | Bacteria | 1224 |
| 412 | Ga0307406_10002299 | 3300031901 | Bacteria | 10392 |
| 413 | Ga0307406_10045966 | 3300031901 | Bacteria | 2744 |
| 414 | Ga0307406_10108712 | 3300031901 | Bacteria | 1904 |
| 415 | Ga0307406_10187614 | 3300031901 | Bacteria | 1511 |
| 416 | Ga0307407_10098207 | 3300031903 | Bacteria | 1811 |
| 417 | Ga0307412_10036873 | 3300031911 | Bacteria | 3136 |
| 418 | Ga0307412_10040382 | 3300031911 | Bacteria | 3018 |
| 419 | Ga0307412_10053604 | 3300031911 | Bacteria | 2674 |
| 420 | Ga0307412_10076369 | 3300031911 | Bacteria | 2301 |
| 421 | Ga0307412_10366799 | 3300031911 | Bacteria | 1161 |
| 422 | Ga0307412_11186928 | 3300031911 | Bacteria | 683 |
| 423 | Ga0307416_100049797 | 3300032002 | Bacteria | 3334 |
| 424 | Ga0307416_100136503 | 3300032002 | Bacteria | 2220 |
| 425 | Ga0307416_100181970 | 3300032002 | Bacteria | 1971 |
| 426 | Ga0307416_100624517 | 3300032002 | Bacteria | 1160 |
| 427 | Ga0307416_100786033 | 3300032002 | Bacteria | 1047 |
| 428 | Ga0307414_10030934 | 3300032004 | Bacteria | 3503 |
| 429 | Ga0307414_10032160 | 3300032004 | Bacteria | 3451 |
| 430 | Ga0307411_10223096 | 3300032005 | Bacteria | 1463 |
| 431 | Ga0307411_10264246 | 3300032005 | Bacteria | 1361 |
| 432 | Ga0307411_10365444 | 3300032005 | Bacteria | 1181 |
| 433 | Ga0373959_0028276 | 3300034820 | Bacteria | 1119 |
| 434 | Ga0373945_0428465 | 3300035116 | Bacteria | 583 |
| 435 | Ga0373943_0667045 | 3300035170 | Bacteria | 615 |
| 436 | Ga0373931_0063924 | 3300035691 | Bacteria | 1990 |
| 437 | Ga0395899_0001547 | 3300037312 | Bacteria | 19420 |
| 438 | Ga0395899_0042593 | 3300037312 | Bacteria | 3388 |
| 439 | Ga0395899_0963912 | 3300037312 | Bacteria | 516 |
| 440 | Ga0395900_0009467 | 3300037418 | Bacteria | 9985 |
| 441 | Ga0395900_0022998 | 3300037418 | Bacteria | 6379 |
| 442 | Ga0395900_0030213 | 3300037418 | Bacteria | 5562 |
| 443 | Ga0395900_0060679 | 3300037418 | Bacteria | 3891 |
| 444 | Ga0395900_0066823 | 3300037418 | Bacteria | 3695 |
| 445 | Ga0395900_0289197 | 3300037418 | Bacteria | 1628 |
| 446 | Ga0395898_0007975 | 3300037466 | Bacteria | 11234 |
| 447 | Ga0395898_0011010 | 3300037466 | Bacteria | 9425 |
| 448 | Ga0395898_0122345 | 3300037466 | Bacteria | 2493 |
| 449 | Ga0395898_0146785 | 3300037466 | Bacteria | 2258 |
| 450 | Ga0395905_0241054 | 3300037471 | Bacteria | 1689 |
| 451 | Ga0395905_0611090 | 3300037471 | Bacteria | 992 |
| 452 | Ga0395905_0662779 | 3300037471 | Bacteria | 945 |
| 453 | Ga0395905_1281416 | 3300037471 | Bacteria | 636 |
| 454 | Ga0395901_0044247 | 3300038443 | Bacteria | 4618 |
| 455 | Ga0395901_0164134 | 3300038443 | Bacteria | 2332 |
| 456 | Ga0395901_0270467 | 3300038443 | Bacteria | 1767 |
| 457 | Ga0395901_0462240 | 3300038443 | Bacteria | 1297 |
| 458 | Ga0436365_0464954 | 3300039437 | Bacteria | 682 |
| 459 | Ga0439436_0000703 | 3300041404 | Bacteria | 9012 |
| 460 | Ga0439436_0002187 | 3300041404 | Bacteria | 5850 |
| 461 | Ga0439436_0003327 | 3300041404 | Bacteria | 4876 |
| 462 | Ga0439436_0021925 | 3300041404 | Bacteria | 1895 |
| 463 | Ga0439436_0055865 | 3300041404 | Bacteria | 1109 |
| 464 | Ga0439438_025903 | 3300041405 | Bacteria | 1593 |
| 465 | Ga0439438_043899 | 3300041405 | Bacteria | 1153 |
| 466 | Ga0439439_0000471 | 3300041406 | Bacteria | 6900 |
| 467 | Ga0439439_0061343 | 3300041406 | Bacteria | 998 |
| 468 | Ga0439439_0141143 | 3300041406 | Bacteria | 680 |
| 469 | Ga0439439_0206487 | 3300041406 | Bacteria | 572 |
| 470 | Ga0439447_004982 | 3300041407 | Bacteria | 4481 |
| 471 | Ga0439447_022525 | 3300041407 | Bacteria | 1648 |
| 472 | Ga0439447_088262 | 3300041407 | Bacteria | 714 |
| 473 | Ga0439461_0022993 | 3300041410 | Bacteria | 1252 |
| 474 | Ga0439466_0002529 | 3300041411 | Bacteria | 7156 |
| 475 | Ga0439466_0025336 | 3300041411 | Bacteria | 2071 |
| 476 | Ga0439466_0026442 | 3300041411 | Bacteria | 2017 |
| 477 | Ga0439465_0003784 | 3300041413 | Bacteria | 4934 |
| 478 | Ga0451791_1555033 | 3300041451 | Bacteria | 2476 |
| 479 | Ga0451793_1183457 | 3300041452 | Bacteria | 771 |
| 480 | Ga0451800_1627045 | 3300041459 | Bacteria | 623 |
| 481 | Ga0451804_0299013 | 3300041463 | Bacteria | 626 |
| 482 | Ga0451833_0100439 | 3300041491 | Bacteria | 533 |
| 483 | Ga0451839_0586664 | 3300041496 | Bacteria | 618 |
| 484 | Ga0451841_0276797 | 3300041498 | Bacteria | 533 |
| 485 | Ga0451851_0287117 | 3300041507 | Bacteria | 1810 |
| 486 | Ga0451853_1870137 | 3300041512 | Bacteria | 2421 |
| 487 | Ga0439431_0003175 | 3300041997 | Bacteria | 3614 |
| 488 | Ga0439431_0040566 | 3300041997 | Bacteria | 1184 |
| 489 | Ga0439433_0004619 | 3300041999 | Bacteria | 2959 |
| 490 | Ga0439442_011963 | 3300042002 | Bacteria | 1771 |
| 491 | Ga0439442_056858 | 3300042002 | Bacteria | 827 |
| 492 | Ga0439445_0000164 | 3300042004 | Bacteria | 11799 |
| 493 | Ga0439445_0024412 | 3300042004 | Bacteria | 1537 |
| 494 | Ga0439445_0030456 | 3300042004 | Bacteria | 1398 |
| 495 | Ga0439432_006112 | 3300042006 | Bacteria | 4311 |
| 496 | Ga0439432_016051 | 3300042006 | Bacteria | 2523 |
| 497 | Ga0439449_0000494 | 3300042007 | Bacteria | 14768 |
| 498 | Ga0439449_0001318 | 3300042007 | Bacteria | 9731 |
| 499 | Ga0439449_0004819 | 3300042007 | Bacteria | 5204 |
| 500 | Ga0439449_0005691 | 3300042007 | Bacteria | 4764 |
| 501 | Ga0439449_0031646 | 3300042007 | Bacteria | 1972 |
| 502 | Ga0439449_0151734 | 3300042007 | Bacteria | 864 |
| 503 | Ga0439449_0200805 | 3300042007 | Bacteria | 746 |
| 504 | Ga0439452_001807 | 3300042010 | Bacteria | 8321 |
| 505 | Ga0439452_002182 | 3300042010 | Bacteria | 7394 |
| 506 | Ga0439454_003682 | 3300042011 | Bacteria | 1724 |
| 507 | Ga0439457_001873 | 3300042014 | Bacteria | 6215 |
| 508 | Ga0439457_052152 | 3300042014 | Bacteria | 919 |
| 509 | Ga0439462_0018325 | 3300042015 | Bacteria | 1818 |
| 510 | Ga0439462_0061596 | 3300042015 | Bacteria | 1016 |
| 511 | Ga0450911_000596 | 3300042115 | Bacteria | 10991 |
| 512 | Ga0450923_011411 | 3300042125 | Bacteria | 1596 |
| 513 | Ga0450890_006957 | 3300042127 | Bacteria | 1443 |
| 514 | Ga0450894_008192 | 3300042131 | Bacteria | 1350 |
| 515 | Ga0450896_003203 | 3300042133 | Bacteria | 2163 |
| 516 | Ga0450898_005252 | 3300042134 | Bacteria | 1950 |
| 517 | Ga0450903_025585 | 3300042138 | Bacteria | 902 |
| 518 | Ga0450904_007394 | 3300042139 | Bacteria | 1091 |
| 519 | Ga0450906_003663 | 3300042145 | Bacteria | 3275 |
| 520 | Ga0450906_074638 | 3300042145 | Bacteria | 609 |
| 521 | Ga0439446_0021931 | 3300042156 | Bacteria | 1807 |
| 522 | Ga0439446_0029977 | 3300042156 | Bacteria | 1571 |
| 523 | Ga0439446_0153374 | 3300042156 | Bacteria | 759 |
| 524 | Ga0439446_0351384 | 3300042156 | Bacteria | 525 |
| 525 | Ga0450908_008165 | 3300042184 | Bacteria | 1964 |
| 526 | Ga0450909_005276 | 3300042185 | Bacteria | 1860 |
| 527 | Ga0450909_057895 | 3300042185 | Bacteria | 610 |
| 528 | Ga0439434_0007410 | 3300042435 | Bacteria | 3216 |
| 529 | Ga0439434_0288955 | 3300042435 | Bacteria | 565 |
| 530 | Ga0439434_0342747 | 3300042435 | Bacteria | 521 |
| 531 | Ga0439459_0000926 | 3300042438 | Bacteria | 4131 |
| 532 | Ga0439459_0042973 | 3300042438 | Bacteria | 967 |
| 533 | Ga0439459_0074146 | 3300042438 | Bacteria | 792 |
| 534 | Ga0439464_0044365 | 3300042439 | Bacteria | 1273 |
| 535 | Ga0450916_011556 | 3300042530 | Bacteria | 1117 |
| 536 | Ga0450918_002734 | 3300042531 | Bacteria | 3307 |
| 537 | Ga0450893_0012894 | 3300042532 | Bacteria | 1390 |
| 538 | Ga0451577_0038579 | 3300042876 | Bacteria | 4296 |
| 539 | Ga0451577_0058241 | 3300042876 | Bacteria | 3444 |
| 540 | Ga0451577_1522291 | 3300042876 | Bacteria | 591 |
| 541 | Ga0466969_0067571 | 3300044656 | Bacteria | 1724 |
| 542 | Ga0466972_0278698 | 3300044658 | Bacteria | 781 |
| 543 | Ga0453683_0003078 | 3300044673 | Bacteria | 12483 |
| 544 | Ga0453683_0143784 | 3300044673 | Bacteria | 1506 |
| 545 | Ga0466965_0388479 | 3300044683 | Bacteria | 769 |
| 546 | Ga0466965_0506621 | 3300044683 | Bacteria | 677 |
| 547 | Ga0466966_0176873 | 3300044684 | Bacteria | 1296 |
| 548 | Ga0466966_0184178 | 3300044684 | Bacteria | 1266 |
| 549 | Ga0466966_0614160 | 3300044684 | Bacteria | 655 |
| 550 | Ga0466966_0631318 | 3300044684 | Bacteria | 645 |
| 551 | Ga0466961_0005995 | 3300044693 | Bacteria | 7705 |
| 552 | Ga0466961_0209177 | 3300044693 | Bacteria | 1205 |
| 553 | Ga0466961_0222455 | 3300044693 | Bacteria | 1163 |
| 554 | Ga0453684_0067284 | 3300044712 | Bacteria | 4556 |
| 555 | Ga0453684_0881546 | 3300044712 | Bacteria | 959 |
| 556 | Ga0453684_1431954 | 3300044712 | Bacteria | 715 |
| 557 | Ga0466971_0250930 | 3300044719 | Bacteria | 843 |
| 558 | Ga0466970_0107076 | 3300044765 | Bacteria | 1525 |
| 559 | Ga0466970_0598210 | 3300044765 | Bacteria | 640 |
| 560 | Ga0466957_0404582 | 3300044842 | Bacteria | 934 |
| 561 | Ga0466957_0946927 | 3300044842 | Bacteria | 617 |
| 562 | Ga0466957_1191610 | 3300044842 | Bacteria | 551 |
| 563 | Ga0466959_0069510 | 3300045049 | Bacteria | 2551 |
| 564 | Ga0451576_0008679 | 3300045051 | Bacteria | 11898 |
| 565 | Ga0451576_0029573 | 3300045051 | Bacteria | 5861 |
| 566 | Ga0451576_0105315 | 3300045051 | Bacteria | 2934 |
| 567 | Ga0451576_0152880 | 3300045051 | Bacteria | 2407 |
| 568 | Ga0466958_0254045 | 3300045836 | Bacteria | 1125 |
| 569 | Ga0466958_0338814 | 3300045836 | Bacteria | 967 |
| 570 | Ga0466967_0190524 | 3300045976 | Bacteria | 1938 |
| 571 | Ga0495627_004217 | 3300046453 | Bacteria | 6082 |
| 572 | Ga0495627_006704 | 3300046453 | Bacteria | 4484 |
| 573 | Ga0495603_0654898 | 3300046455 | Bacteria | 601 |
| 574 | Ga0495629_1111997 | 3300046459 | Bacteria | 510 |
| 575 | Ga0495638_0092798 | 3300046460 | Bacteria | 1817 |
| 576 | Ga0495610_0011592 | 3300046512 | Bacteria | 5376 |
| 577 | Ga0495616_0002621 | 3300046513 | Bacteria | 11835 |
| 578 | Ga0495620_0004869 | 3300046515 | Bacteria | 7533 |
| 579 | Ga0495620_0228380 | 3300046515 | Bacteria | 711 |
| 580 | Ga0495631_0000568 | 3300046518 | Bacteria | 24838 |
| 581 | Ga0495637_0004150 | 3300046520 | Bacteria | 7543 |
| 582 | Ga0495654_0261347 | 3300046530 | Bacteria | 717 |
| 583 | Ga0495609_0070233 | 3300046538 | Bacteria | 1540 |
| 584 | Ga0495621_0010004 | 3300046539 | Bacteria | 2894 |
| 585 | Ga0495621_0060472 | 3300046539 | Bacteria | 1374 |
| 586 | Ga0495633_0450493 | 3300046558 | Bacteria | 581 |
| 587 | Ga0495633_0585553 | 3300046558 | Bacteria | 502 |
| 588 | Ga0495656_0002985 | 3300046615 | Bacteria | 5681 |
| 589 | Ga0495656_0024993 | 3300046615 | Bacteria | 2364 |
| 590 | Ga0495668_0023820 | 3300046616 | Bacteria | 3487 |
| 591 | Ga0495625_0002531 | 3300046660 | Bacteria | 19661 |
| 592 | Ga0495635_0634580 | 3300046663 | Bacteria | 696 |
| 593 | Ga0495588_0042065 | 3300046674 | Bacteria | 2335 |
| 594 | Ga0495588_0115079 | 3300046674 | Bacteria | 1417 |
| 595 | Ga0495658_0316311 | 3300046683 | Bacteria | 989 |
| 596 | Ga0495669_0086357 | 3300046684 | Bacteria | 1445 |
| 597 | Ga0495624_0274690 | 3300046690 | Bacteria | 1018 |
| 598 | Ga0495670_0044540 | 3300046691 | Bacteria | 2215 |
| 599 | Ga0495671_0001939 | 3300046692 | Bacteria | 13265 |
| 600 | Ga0495600_0315275 | 3300046809 | Bacteria | 984 |
| 601 | Ga0495660_0222956 | 3300046810 | Bacteria | 888 |
| 602 | Ga0495636_0323965 | 3300047318 | Bacteria | 724 |
| 603 | Ga0495676_0116290 | 3300047321 | Bacteria | 1953 |
| 604 | Ga0495677_0040587 | 3300047445 | Bacteria | 1702 |
| 605 | Ga0495681_0297021 | 3300047470 | Bacteria | 626 |
| 606 | Ga0495602_0312107 | 3300048088 | Bacteria | 1147 |
| 607 | Ga0495614_0072540 | 3300048089 | Bacteria | 1485 |
| 608 | Ga0495615_0010655 | 3300048090 | Bacteria | 1845 |
| 609 | Ga0496101_0002740 | 3300048904 | Bacteria | 10817 |
| 610 | Ga0496108_0082018 | 3300048911 | Bacteria | 2734 |
| 611 | Ga0496112_0181104 | 3300048915 | Bacteria | 2071 |
| 612 | Ga0496116_0052800 | 3300048919 | Bacteria | 2689 |
| 613 | Ga0496116_0355266 | 3300048919 | Bacteria | 669 |
| 614 | Ga0496117_0020913 | 3300048920 | Bacteria | 5320 |
| 615 | Ga0496117_0028486 | 3300048920 | Bacteria | 4324 |
| 616 | Ga0496118_0015348 | 3300048921 | Bacteria | 7096 |
| 617 | Ga0496118_0038026 | 3300048921 | Bacteria | 3863 |
| 618 | Ga0496119_0135986 | 3300048922 | Bacteria | 1333 |
| 619 | Ga0496121_0467566 | 3300048924 | Bacteria | 808 |
| 620 | Ga0496122_0002359 | 3300048925 | Bacteria | 27157 |
| 621 | Ga0496122_0021111 | 3300048925 | Bacteria | 5845 |
| 622 | Ga0496122_0041912 | 3300048925 | Bacteria | 3610 |
| 623 | Ga0496123_0000108 | 3300048926 | Bacteria | 166102 |
| 624 | Ga0496123_0075695 | 3300048926 | Bacteria | 2076 |
| 625 | Ga0496123_0080102 | 3300048926 | Bacteria | 1992 |
| 626 | Ga0496123_0333285 | 3300048926 | Bacteria | 712 |
| 627 | Ga0496124_0088091 | 3300048927 | Bacteria | 2538 |
| 628 | Ga0496124_0114436 | 3300048927 | Bacteria | 2166 |
| 629 | Ga0496125_0003980 | 3300048928 | Bacteria | 17384 |
| 630 | Ga0496125_0022083 | 3300048928 | Bacteria | 5916 |
| 631 | Ga0496125_0047676 | 3300048928 | Bacteria | 3580 |
| 632 | Ga0496125_0149459 | 3300048928 | Bacteria | 1607 |
| 633 | Ga0496126_0167849 | 3300048929 | Bacteria | 1872 |
| 634 | Ga0496126_0399063 | 3300048929 | Bacteria | 1116 |
| 635 | Ga0501031_0042512 | 3300049568 | Bacteria | 2966 |
| 636 | Ga0501032_0117606 | 3300049569 | Bacteria | 1758 |
| 637 | Ga0501034_0056036 | 3300049571 | Bacteria | 3967 |
| 638 | Ga0501034_0220904 | 3300049571 | Bacteria | 1847 |
| 639 | Ga0501038_0151237 | 3300049574 | Bacteria | 1892 |
| 640 | Ga0501042_0826001 | 3300049578 | Bacteria | 675 |
| 641 | Ga0501043_0074622 | 3300049579 | Bacteria | 2664 |
| 642 | Ga0501046_0045717 | 3300049580 | Bacteria | 3477 |
| 643 | Ga0501047_0031795 | 3300049581 | Bacteria | 5091 |
| 644 | Ga0501073_0061270 | 3300049589 | Bacteria | 2626 |
| 645 | Ga0501249_051157 | 3300049679 | Bacteria | 948 |
| 646 | Ga0501249_134923 | 3300049679 | Bacteria | 611 |
| 647 | Ga0501225_0188798 | 3300049705 | Bacteria | 648 |
| 648 | Ga0501080_0012035 | 3300049742 | Bacteria | 7925 |
| 649 | Ga0501262_000560 | 3300049759 | Bacteria | 4440 |
| 650 | Ga0501270_159532 | 3300049767 | Bacteria | 520 |
| 651 | Ga0501035_0085966 | 3300049822 | Bacteria | 2771 |
| 652 | Ga0501035_0361986 | 3300049822 | Bacteria | 1212 |
| 653 | Ga0501044_0042090 | 3300049823 | Bacteria | 4754 |
| 654 | Ga0501044_1447177 | 3300049823 | Bacteria | 552 |
| 655 | nmdc:mga03683_109941_c1 | 3300050489 | Bacteria | 1218 |
| 656 | nmdc:mga03683_12001_c1 | 3300050489 | Bacteria | 3152 |
| 657 | nmdc:mga03n38_11720_c1 | 3300050490 | Bacteria | 2505 |
| 658 | nmdc:mga03n38_127693_c1 | 3300050490 | Bacteria | 1257 |
| 659 | nmdc:mga03n38_400297_c1 | 3300050490 | Bacteria | 756 |
| 660 | nmdc:mga03n38_45822_c1 | 3300050490 | Bacteria | 1928 |
| 661 | nmdc:mga03n38_497101_c1 | 3300050490 | Bacteria | 684 |
| 662 | nmdc:mga00v17_6700_c1 | 3300050491 | Bacteria | 6120 |
| 663 | nmdc:mga00v17_68539_c1 | 3300050491 | Bacteria | 2193 |
| 664 | nmdc:mga0yw44_28590_c1 | 3300050492 | Bacteria | 3209 |
| 665 | nmdc:mga0yw44_679488_c1 | 3300050492 | Bacteria | 700 |
| 666 | nmdc:mga0yw44_705968_c1 | 3300050492 | Bacteria | 685 |
| 667 | nmdc:mga0k408_11586_c1 | 3300050493 | Bacteria | 4805 |
| 668 | nmdc:mga0k408_128324_c1 | 3300050493 | Bacteria | 1505 |
| 669 | nmdc:mga0k408_185190_c1 | 3300050493 | Bacteria | 1242 |
| 670 | nmdc:mga0k408_246592_c1 | 3300050493 | Bacteria | 1067 |
| 671 | nmdc:mga0k408_289333_c1 | 3300050493 | Bacteria | 978 |
| 672 | nmdc:mga0k408_3613_c1 | 3300050493 | Bacteria | 8180 |
| 673 | nmdc:mga0k408_37524_c1 | 3300050493 | Bacteria | 943 |
| 674 | nmdc:mga0k408_434785_c1 | 3300050493 | Bacteria | 780 |
| 675 | nmdc:mga0k408_69631_c1 | 3300050493 | Bacteria | 2053 |
| 676 | nmdc:mga06z11_107501_c1 | 3300050494 | Bacteria | 1540 |
| 677 | nmdc:mga06z11_40536_c1 | 3300050494 | Bacteria | 2324 |
| 678 | nmdc:mga06z11_71013_c1 | 3300050494 | Bacteria | 1842 |
| 679 | nmdc:mga04h51_34602_c1 | 3300050495 | Bacteria | 1614 |
| 680 | nmdc:mga07m45_1691_c1 | 3300050496 | Bacteria | 10143 |
| 681 | nmdc:mga07m45_20413_c1 | 3300050496 | Bacteria | 3598 |
| 682 | nmdc:mga07m45_272_c1 | 3300050496 | Bacteria | 20977 |
| 683 | nmdc:mga07m45_36337_c1 | 3300050496 | Bacteria | 2743 |
| 684 | nmdc:mga07m45_597_c2 | 3300050496 | Bacteria | 11502 |
| 685 | nmdc:mga07m45_65458_c1 | 3300050496 | Bacteria | 2064 |
| 686 | nmdc:mga07m45_7411_c1 | 3300050496 | Bacteria | 5607 |
| 687 | nmdc:mga07m45_849866_c1 | 3300050496 | Bacteria | 522 |
| 688 | nmdc:mga0qj67_515225_c1 | 3300050509 | Bacteria | 961 |
| 689 | nmdc:mga0sz30_449367_c1 | 3300050516 | Bacteria | 578 |
| 690 | nmdc:mga0sz30_77922_c1 | 3300050516 | Bacteria | 1432 |
| 691 | Ga0500610_0009345 | 3300053079 | Bacteria | 4339 |
| 692 | Ga0500610_0050716 | 3300053079 | Bacteria | 2159 |
| 693 | Ga0495619_1175273 | 3300053085 | Bacteria | 509 |
| 694 | Ga0500643_003384 | 3300053087 | Bacteria | 7710 |
| 695 | Ga0500644_0026473 | 3300053088 | Bacteria | 1795 |
| 696 | Ga0500644_0271875 | 3300053088 | Bacteria | 719 |
| 697 | Ga0500651_0005180 | 3300053093 | Bacteria | 7418 |
| 698 | Ga0500651_0015201 | 3300053093 | Bacteria | 4721 |
| 699 | Ga0500566_0046267 | 3300053094 | Bacteria | 2501 |
| 700 | Ga0500566_0100837 | 3300053094 | Bacteria | 1583 |
| 701 | Ga0500562_011537 | 3300053108 | Bacteria | 2243 |
| 702 | Ga0500571_000362 | 3300053110 | Bacteria | 17940 |
| 703 | Ga0500572_099449 | 3300053111 | Bacteria | 929 |
| 704 | Ga0500593_000566 | 3300053117 | Bacteria | 14276 |
| 705 | Ga0500593_004570 | 3300053117 | Bacteria | 5378 |
| 706 | Ga0500593_009718 | 3300053117 | Bacteria | 4006 |
| 707 | Ga0500594_0001381 | 3300053118 | Bacteria | 5265 |
| 708 | Ga0500595_070601 | 3300053119 | Bacteria | 1037 |
| 709 | Ga0500607_001562 | 3300053121 | Bacteria | 20266 |
| 710 | Ga0500607_033472 | 3300053121 | Bacteria | 2816 |
| 711 | Ga0500608_001521 | 3300053122 | Bacteria | 8295 |
| 712 | Ga0500608_038569 | 3300053122 | Bacteria | 2286 |
| 713 | Ga0500626_017642 | 3300053128 | Bacteria | 3140 |
| 714 | Ga0500628_002174 | 3300053129 | Bacteria | 3270 |
| 715 | Ga0500652_364739 | 3300053131 | Bacteria | 543 |
| 716 | Ga0500655_000498 | 3300053133 | Bacteria | 7923 |
| 717 | Ga0500658_0000990 | 3300053134 | Bacteria | 11609 |
| 718 | Ga0500658_0002589 | 3300053134 | Bacteria | 6994 |
| 719 | Ga0500659_0240320 | 3300053135 | Bacteria | 846 |
| 720 | Ga0500559_0001129 | 3300053136 | Bacteria | 16078 |
| 721 | Ga0500559_0034466 | 3300053136 | Bacteria | 2183 |
| 722 | Ga0500564_032919 | 3300053138 | Bacteria | 2392 |
| 723 | Ga0500568_0007553 | 3300053139 | Bacteria | 5319 |
| 724 | Ga0500616_0027696 | 3300053153 | Bacteria | 3128 |
| 725 | Ga0500616_0049584 | 3300053153 | Bacteria | 2220 |
| 726 | Ga0500616_0169504 | 3300053153 | Bacteria | 993 |
| 727 | Ga0500622_0299524 | 3300053156 | Bacteria | 686 |
| 728 | Ga0500627_0093608 | 3300053158 | Bacteria | 1345 |
| 729 | Ga0500634_0023483 | 3300053161 | Bacteria | 3351 |
| 730 | Ga0500638_030462 | 3300053162 | Bacteria | 2598 |
| 731 | Ga0500625_054278 | 3300053729 | Bacteria | 1841 |
| 732 | Ga0500645_010500 | 3300053730 | Bacteria | 3059 |
| 733 | Ga0500661_010553 | 3300055283 | Bacteria | 1681 |
| 734 | Ga0590075_006706 | 3300059424 | Bacteria | 2728 |
| 735 | Ga0590075_065430 | 3300059424 | Bacteria | 938 |
| 736 | Ga0501082_0936442 | 3300060353 | Bacteria | 758 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0107076 | Ga0466970_0107076_1175_1513 | 112 |
| 2 | 3300005456 | Ga0070678_100606613 | Ga0070678_1006066132 | 115 |
| 3 | 3300025901 | Ga0207688_10876460 | Ga0207688_108764601 | 115 |
| 4 | 3300025923 | Ga0207681_10881116 | Ga0207681_108811162 | 115 |
| 5 | 3300026089 | Ga0207648_10845603 | Ga0207648_108456031 | 115 |
| 6 | 3300026121 | Ga0207683_10733956 | Ga0207683_107339562 | 115 |
| 7 | 3300031911 | Ga0307412_10053604 | Ga0307412_100536043 | 115 |
| 8 | 3300017792 | Ga0163161_10163139 | Ga0163161_101631392 | 116 |
| 9 | 3300025291 | Ga0209675_1001699 | Ga0209675_100169911 | 117 |
| 10 | 3300025292 | Ga0209676_1032923 | Ga0209676_10329231 | 117 |
| 11 | 3300025294 | Ga0209025_1026531 | Ga0209025_10265313 | 117 |
| 12 | 3300025303 | Ga0209051_1015793 | Ga0209051_10157932 | 117 |
| 13 | 3300025304 | Ga0209257_1008548 | Ga0209257_10085488 | 117 |
| 14 | 3300053136 | Ga0500559_0001129 | Ga0500559_0001129_5822_6259 | 118 |
| 15 | 3300005456 | Ga0070678_100056601 | Ga0070678_1000566012 | 119 |
| 16 | 3300005539 | Ga0068853_100385910 | Ga0068853_1003859102 | 119 |
| 17 | 3300009093 | Ga0105240_10038655 | Ga0105240_100386554 | 119 |
| 18 | 3300009174 | Ga0105241_10446187 | Ga0105241_104461872 | 119 |
| 19 | 3300009545 | Ga0105237_10000674 | Ga0105237_1000067439 | 119 |
| 20 | 3300009551 | Ga0105238_10084714 | Ga0105238_100847142 | 119 |
| 21 | 3300010375 | Ga0105239_10002955 | Ga0105239_1000295512 | 119 |
| 22 | 3300025913 | Ga0207695_10062014 | Ga0207695_100620144 | 119 |
| 23 | 3300025914 | Ga0207671_10005512 | Ga0207671_100055126 | 119 |
| 24 | 3300025924 | Ga0207694_10102299 | Ga0207694_101022993 | 119 |
| 25 | 3300026041 | Ga0207639_10348015 | Ga0207639_103480152 | 119 |
| 26 | 3300026121 | Ga0207683_10091578 | Ga0207683_100915783 | 119 |
| 27 | 3300048928 | Ga0496125_0047676 | Ga0496125_0047676_1330_1758 | 119 |
| 28 | 3300026041 | Ga0207639_10033887 | Ga0207639_100338874 | 120 |
| 29 | 3300048920 | Ga0496117_0028486 | Ga0496117_0028486_1540_1980 | 120 |
| 30 | 3300048921 | Ga0496118_0015348 | Ga0496118_0015348_4383_4823 | 120 |
| 31 | 3300048925 | Ga0496122_0041912 | Ga0496122_0041912_527_967 | 120 |
| 32 | 3300048926 | Ga0496123_0333285 | Ga0496123_0333285_52_477 | 120 |
| 33 | 3300048928 | Ga0496125_0022083 | Ga0496125_0022083_4418_4858 | 120 |
| 34 | 3300025914 | Ga0207671_10214669 | Ga0207671_102146692 | 121 |
| 35 | 3300031824 | Ga0307413_10252644 | Ga0307413_102526442 | 121 |
| 36 | 3300042007 | Ga0439449_0151734 | Ga0439449_0151734_150_575 | 121 |
| 37 | 3300003187 | JGI25151J46595_10016857 | JGI25151J46595_100168572 | 122 |
| 38 | 3300003791 | Ga0055530_10000258 | Ga0055530_1000025816 | 122 |
| 39 | 3300003792 | Ga0055540_1000023 | Ga0055540_100002383 | 122 |
| 40 | 3300003794 | Ga0055531_10005462 | Ga0055531_100054627 | 122 |
| 41 | 3300005339 | Ga0070660_100773559 | Ga0070660_1007735592 | 122 |
| 42 | 3300005344 | Ga0070661_100185938 | Ga0070661_1001859381 | 122 |
| 43 | 3300005457 | Ga0070662_100164083 | Ga0070662_1001640833 | 122 |
| 44 | 3300005563 | Ga0068855_100083077 | Ga0068855_1000830775 | 122 |
| 45 | 3300005577 | Ga0068857_100139774 | Ga0068857_1001397742 | 122 |
| 46 | 3300005616 | Ga0068852_100236525 | Ga0068852_1002365252 | 122 |
| 47 | 3300005616 | Ga0068852_100322503 | Ga0068852_1003225032 | 122 |
| 48 | 3300006237 | Ga0097621_100103874 | Ga0097621_1001038742 | 122 |
| 49 | 3300006353 | Ga0075370_10449390 | Ga0075370_104493901 | 122 |
| 50 | 3300009036 | Ga0105244_10006312 | Ga0105244_100063124 | 122 |
| 51 | 3300009098 | Ga0105245_10082783 | Ga0105245_100827835 | 122 |
| 52 | 3300009148 | Ga0105243_10003718 | Ga0105243_1000371812 | 122 |
| 53 | 3300011119 | Ga0105246_10123184 | Ga0105246_101231841 | 122 |
| 54 | 3300013100 | Ga0157373_10039138 | Ga0157373_100391382 | 122 |
| 55 | 3300013102 | Ga0157371_10143363 | Ga0157371_101433633 | 122 |
| 56 | 3300013104 | Ga0157370_11553642 | Ga0157370_115536421 | 122 |
| 57 | 3300013105 | Ga0157369_10005311 | Ga0157369_1000531117 | 122 |
| 58 | 3300014497 | Ga0182008_10002197 | Ga0182008_100021974 | 122 |
| 59 | 3300015262 | Ga0182007_10000693 | Ga0182007_1000069319 | 122 |
| 60 | 3300015265 | Ga0182005_1015209 | Ga0182005_10152094 | 122 |
| 61 | 3300025298 | Ga0209050_1000748 | Ga0209050_100074822 | 122 |
| 62 | 3300025303 | Ga0209051_1000079 | Ga0209051_1000079104 | 122 |
| 63 | 3300025304 | Ga0209257_1000183 | Ga0209257_100018362 | 122 |
| 64 | 3300025919 | Ga0207657_10254540 | Ga0207657_102545402 | 122 |
| 65 | 3300025935 | Ga0207709_10030909 | Ga0207709_100309092 | 122 |
| 66 | 3300025945 | Ga0207679_11108630 | Ga0207679_111086302 | 122 |
| 67 | 3300025949 | Ga0207667_10157592 | Ga0207667_101575922 | 122 |
| 68 | 3300025949 | Ga0207667_11618739 | Ga0207667_116187391 | 122 |
| 69 | 3300026067 | Ga0207678_10428100 | Ga0207678_104281002 | 122 |
| 70 | 3300026116 | Ga0207674_10056108 | Ga0207674_100561082 | 122 |
| 71 | 3300026142 | Ga0207698_10199379 | Ga0207698_101993792 | 122 |
| 72 | 3300048920 | Ga0496117_0020913 | Ga0496117_0020913_1977_2417 | 122 |
| 73 | 3300048921 | Ga0496118_0038026 | Ga0496118_0038026_2575_3015 | 122 |
| 74 | 3300048928 | Ga0496125_0149459 | Ga0496125_0149459_760_1200 | 122 |
| 75 | 3300050496 | nmdc:mga07m45_1691_c1 | nmdc:mga07m45_1691_c1_787_1227 | 122 |
| 76 | 3300003781 | Ga0055536_1009125 | Ga0055536_10091254 | 123 |
| 77 | 3300003791 | Ga0055530_10012755 | Ga0055530_100127552 | 123 |
| 78 | 3300003792 | Ga0055540_1001668 | Ga0055540_10016684 | 123 |
| 79 | 3300003794 | Ga0055531_10002317 | Ga0055531_1000231712 | 123 |
| 80 | 3300006048 | Ga0075363_100020743 | Ga0075363_1000207432 | 123 |
| 81 | 3300006178 | Ga0075367_10052314 | Ga0075367_100523142 | 123 |
| 82 | 3300006195 | Ga0075366_10005303 | Ga0075366_1000530310 | 123 |
| 83 | 3300006353 | Ga0075370_10021624 | Ga0075370_100216244 | 123 |
| 84 | 3300025292 | Ga0209676_1001285 | Ga0209676_100128526 | 123 |
| 85 | 3300025298 | Ga0209050_1004127 | Ga0209050_10041274 | 123 |
| 86 | 3300025303 | Ga0209051_1000893 | Ga0209051_100089326 | 123 |
| 87 | 3300025304 | Ga0209257_1000226 | Ga0209257_100022626 | 123 |
| 88 | 3300042133 | Ga0450896_003203 | Ga0450896_003203_1169_1558 | 123 |
| 89 | 3300046453 | Ga0495627_004217 | Ga0495627_004217_1676_2116 | 123 |
| 90 | 3300046674 | Ga0495588_0115079 | Ga0495588_0115079_647_1072 | 123 |
| 91 | 3300048925 | Ga0496122_0021111 | Ga0496122_0021111_701_1141 | 123 |
| 92 | 3300048926 | Ga0496123_0080102 | Ga0496123_0080102_605_1045 | 123 |
| 93 | 3300050490 | nmdc:mga03n38_127693_c1 | nmdc:mga03n38_127693_c1_534_959 | 123 |
| 94 | 3300050493 | nmdc:mga0k408_128324_c1 | nmdc:mga0k408_128324_c1_596_1021 | 123 |
| 95 | 3300050496 | nmdc:mga07m45_20413_c1 | nmdc:mga07m45_20413_c1_2112_2537 | 123 |
| 96 | 3300005356 | Ga0070674_100397772 | Ga0070674_1003977722 | 124 |
| 97 | 3300005543 | Ga0070672_101412440 | Ga0070672_1014124402 | 124 |
| 98 | 3300014969 | Ga0157376_11473096 | Ga0157376_114730962 | 124 |
| 99 | 3300025926 | Ga0207659_10565480 | Ga0207659_105654802 | 124 |
| 100 | 3300046539 | Ga0495621_0010004 | Ga0495621_0010004_1678_2103 | 124 |
| 101 | 3300046615 | Ga0495656_0002985 | Ga0495656_0002985_432_857 | 124 |
| 102 | 3300048090 | Ga0495615_0010655 | Ga0495615_0010655_1272_1697 | 124 |
| 103 | 3300053156 | Ga0500622_0299524 | Ga0500622_0299524_59_481 | 124 |
| 104 | 3300010375 | Ga0105239_10260861 | Ga0105239_102608613 | 126 |
| 105 | 3300017792 | Ga0163161_10228194 | Ga0163161_102281942 | 126 |
| 106 | 3300025728 | Ga0207655_1003605 | Ga0207655_100360511 | 126 |
| 107 | 3300025924 | Ga0207694_10111475 | Ga0207694_101114752 | 126 |
| 108 | 3300031251 | Ga0265327_10006337 | Ga0265327_100063376 | 126 |
| 109 | 3300045051 | Ga0451576_0152880 | Ga0451576_0152880_1320_1748 | 126 |
| 110 | 3300048929 | Ga0496126_0399063 | Ga0496126_0399063_241_681 | 126 |
| 111 | 3300053128 | Ga0500626_017642 | Ga0500626_017642_1319_1759 | 126 |
| 112 | 3300053136 | Ga0500559_0034466 | Ga0500559_0034466_1675_2115 | 126 |
| 113 | 3300002739 | JGI25158J39367_1002521 | JGI25158J39367_10025214 | 127 |
| 114 | 3300002774 | JGI25150J39212_1001290 | JGI25150J39212_10012907 | 127 |
| 115 | 3300003215 | JGI25153J46596_10025433 | JGI25153J46596_100254333 | 127 |
| 116 | 3300003761 | Ga0055535_1004635 | Ga0055535_10046354 | 127 |
| 117 | 3300003762 | Ga0055542_1000004 | Ga0055542_10000044 | 127 |
| 118 | 3300003781 | Ga0055536_1000619 | Ga0055536_100061921 | 127 |
| 119 | 3300003781 | Ga0055536_1009081 | Ga0055536_10090813 | 127 |
| 120 | 3300003784 | Ga0055534_1012050 | Ga0055534_10120502 | 127 |
| 121 | 3300003791 | Ga0055530_10000468 | Ga0055530_1000046820 | 127 |
| 122 | 3300003792 | Ga0055540_1002522 | Ga0055540_100252210 | 127 |
| 123 | 3300005457 | Ga0070662_100020121 | Ga0070662_1000201212 | 127 |
| 124 | 3300005617 | Ga0068859_101024603 | Ga0068859_1010246032 | 127 |
| 125 | 3300006931 | Ga0097620_101024706 | Ga0097620_1010247062 | 127 |
| 126 | 3300009148 | Ga0105243_10009907 | Ga0105243_100099077 | 127 |
| 127 | 3300013307 | Ga0157372_10028520 | Ga0157372_100285206 | 127 |
| 128 | 3300017792 | Ga0163161_10131504 | Ga0163161_101315042 | 127 |
| 129 | 3300025208 | Ga0209436_111482 | Ga0209436_1114822 | 127 |
| 130 | 3300025228 | Ga0209672_103149 | Ga0209672_1031493 | 127 |
| 131 | 3300025242 | Ga0209258_100022 | Ga0209258_1000224 | 127 |
| 132 | 3300025245 | Ga0207425_1000450 | Ga0207425_100045026 | 127 |
| 133 | 3300025245 | Ga0207425_1003947 | Ga0207425_10039474 | 127 |
| 134 | 3300025254 | Ga0209148_1000034 | Ga0209148_10000344 | 127 |
| 135 | 3300025258 | Ga0209129_1000023 | Ga0209129_100002382 | 127 |
| 136 | 3300025258 | Ga0209129_1001139 | Ga0209129_100113911 | 127 |
| 137 | 3300025258 | Ga0209129_1003872 | Ga0209129_10038724 | 127 |
| 138 | 3300025263 | Ga0209565_1000187 | Ga0209565_100018760 | 127 |
| 139 | 3300025263 | Ga0209565_1001739 | Ga0209565_10017394 | 127 |
| 140 | 3300025273 | Ga0209673_1000389 | Ga0209673_100038960 | 127 |
| 141 | 3300025273 | Ga0209673_1003621 | Ga0209673_10036219 | 127 |
| 142 | 3300025284 | Ga0209130_1000069 | Ga0209130_100006985 | 127 |
| 143 | 3300025291 | Ga0209675_1000232 | Ga0209675_100023244 | 127 |
| 144 | 3300025291 | Ga0209675_1002669 | Ga0209675_10026694 | 127 |
| 145 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005719 | 127 |
| 146 | 3300025292 | Ga0209676_1000139 | Ga0209676_1000139151 | 127 |
| 147 | 3300025294 | Ga0209025_1000316 | Ga0209025_100031625 | 127 |
| 148 | 3300025294 | Ga0209025_1005467 | Ga0209025_10054674 | 127 |
| 149 | 3300025295 | Ga0209564_1000090 | Ga0209564_1000090212 | 127 |
| 150 | 3300025295 | Ga0209564_1003288 | Ga0209564_10032884 | 127 |
| 151 | 3300025297 | Ga0209758_1000044 | Ga0209758_1000044351 | 127 |
| 152 | 3300025297 | Ga0209758_1003942 | Ga0209758_10039427 | 127 |
| 153 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007378 | 127 |
| 154 | 3300025299 | Ga0209256_1000020 | Ga0209256_1000020354 | 127 |
| 155 | 3300025299 | Ga0209256_1000022 | Ga0209256_100002281 | 127 |
| 156 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001989 | 127 |
| 157 | 3300025302 | Ga0207426_1000031 | Ga0207426_1000031237 | 127 |
| 158 | 3300025303 | Ga0209051_1000036 | Ga0209051_100003670 | 127 |
| 159 | 3300025303 | Ga0209051_1001299 | Ga0209051_10012999 | 127 |
| 160 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011693 | 127 |
| 161 | 3300025304 | Ga0209257_1004427 | Ga0209257_10044277 | 127 |
| 162 | 3300025321 | Ga0207656_10016315 | Ga0207656_100163153 | 127 |
| 163 | 3300025933 | Ga0207706_10043459 | Ga0207706_100434593 | 127 |
| 164 | 3300025935 | Ga0207709_10000308 | Ga0207709_1000030848 | 127 |
| 165 | 3300025986 | Ga0207658_10609204 | Ga0207658_106092042 | 127 |
| 166 | 3300031731 | Ga0307405_10055618 | Ga0307405_100556184 | 127 |
| 167 | 3300031731 | Ga0307405_10130429 | Ga0307405_101304292 | 127 |
| 168 | 3300046459 | Ga0495629_1111997 | Ga0495629_1111997_74_499 | 127 |
| 169 | 3300046460 | Ga0495638_0092798 | Ga0495638_0092798_1127_1567 | 127 |
| 170 | 3300046512 | Ga0495610_0011592 | Ga0495610_0011592_3033_3473 | 127 |
| 171 | 3300046513 | Ga0495616_0002621 | Ga0495616_0002621_10812_11252 | 127 |
| 172 | 3300046515 | Ga0495620_0228380 | Ga0495620_0228380_49_489 | 127 |
| 173 | 3300046518 | Ga0495631_0000568 | Ga0495631_0000568_10765_11205 | 127 |
| 174 | 3300046530 | Ga0495654_0261347 | Ga0495654_0261347_225_665 | 127 |
| 175 | 3300046616 | Ga0495668_0023820 | Ga0495668_0023820_41_481 | 127 |
| 176 | 3300046683 | Ga0495658_0316311 | Ga0495658_0316311_364_804 | 127 |
| 177 | 3300046690 | Ga0495624_0274690 | Ga0495624_0274690_492_932 | 127 |
| 178 | 3300047321 | Ga0495676_0116290 | Ga0495676_0116290_1366_1806 | 127 |
| 179 | 3300048088 | Ga0495602_0312107 | Ga0495602_0312107_553_978 | 127 |
| 180 | 3300048089 | Ga0495614_0072540 | Ga0495614_0072540_198_638 | 127 |
| 181 | 3300048904 | Ga0496101_0002740 | Ga0496101_0002740_562_1002 | 127 |
| 182 | 3300048922 | Ga0496119_0135986 | Ga0496119_0135986_729_1169 | 127 |
| 183 | 3300048924 | Ga0496121_0467566 | Ga0496121_0467566_328_768 | 127 |
| 184 | 3300048926 | Ga0496123_0075695 | Ga0496123_0075695_392_832 | 127 |
| 185 | 3300053087 | Ga0500643_003384 | Ga0500643_003384_2529_2969 | 127 |
| 186 | 3300053093 | Ga0500651_0005180 | Ga0500651_0005180_2617_3057 | 127 |
| 187 | 3300053094 | Ga0500566_0046267 | Ga0500566_0046267_923_1363 | 127 |
| 188 | 3300053110 | Ga0500571_000362 | Ga0500571_000362_11999_12439 | 127 |
| 189 | 3300053118 | Ga0500594_0001381 | Ga0500594_0001381_1948_2388 | 127 |
| 190 | 3300053119 | Ga0500595_070601 | Ga0500595_070601_332_772 | 127 |
| 191 | 3300053122 | Ga0500608_038569 | Ga0500608_038569_599_1039 | 127 |
| 192 | 3300053133 | Ga0500655_000498 | Ga0500655_000498_2554_2994 | 127 |
| 193 | 3300053134 | Ga0500658_0000990 | Ga0500658_0000990_7325_7765 | 127 |
| 194 | 3300053134 | Ga0500658_0002589 | Ga0500658_0002589_2710_3150 | 127 |
| 195 | 3300053135 | Ga0500659_0240320 | Ga0500659_0240320_134_574 | 127 |
| 196 | 3300053138 | Ga0500564_032919 | Ga0500564_032919_1745_2185 | 127 |
| 197 | 3300053139 | Ga0500568_0007553 | Ga0500568_0007553_2174_2614 | 127 |
| 198 | 3300053153 | Ga0500616_0049584 | Ga0500616_0049584_811_1251 | 127 |
| 199 | 3300053161 | Ga0500634_0023483 | Ga0500634_0023483_261_701 | 127 |
| 200 | 3300053162 | Ga0500638_030462 | Ga0500638_030462_1833_2273 | 127 |
| 201 | 3300005327 | Ga0070658_10173078 | Ga0070658_101730782 | 128 |
| 202 | 3300025292 | Ga0209676_1032620 | Ga0209676_10326202 | 128 |
| 203 | 3300025303 | Ga0209051_1016913 | Ga0209051_10169132 | 128 |
| 204 | 3300053122 | Ga0500608_001521 | Ga0500608_001521_5378_5818 | 128 |
| 205 | 3300037312 | Ga0395899_0001547 | Ga0395899_0001547_18969_19394 | 129 |
| 206 | 3300037418 | Ga0395900_0009467 | Ga0395900_0009467_2939_3364 | 129 |
| 207 | 3300037466 | Ga0395898_0007975 | Ga0395898_0007975_2103_2528 | 129 |
| 208 | 3300037471 | Ga0395905_0662779 | Ga0395905_0662779_218_643 | 129 |
| 209 | 3300038443 | Ga0395901_0270467 | Ga0395901_0270467_648_1073 | 129 |
| 210 | 3300015683 | Ga0183362_10001 | Ga0183362_100011380 | 130 |
| 211 | 3300025273 | Ga0209673_1007069 | Ga0209673_10070697 | 130 |
| 212 | 3300025291 | Ga0209675_1086622 | Ga0209675_10866222 | 130 |
| 213 | 3300037312 | Ga0395899_0042593 | Ga0395899_0042593_1187_1615 | 130 |
| 214 | 3300037418 | Ga0395900_0022998 | Ga0395900_0022998_281_709 | 130 |
| 215 | 3300037466 | Ga0395898_0122345 | Ga0395898_0122345_184_612 | 130 |
| 216 | 3300037471 | Ga0395905_0611090 | Ga0395905_0611090_184_612 | 130 |
| 217 | 3300044842 | Ga0466957_1191610 | Ga0466957_1191610_14_442 | 130 |
| 218 | 3300037471 | Ga0395905_0241054 | Ga0395905_0241054_655_1083 | 131 |
| 219 | 3300048915 | Ga0496112_0181104 | Ga0496112_0181104_95_526 | 131 |
| 220 | 3300003187 | JGI25151J46595_10109725 | JGI25151J46595_101097252 | 133 |
| 221 | 3300005327 | Ga0070658_10106566 | Ga0070658_101065662 | 133 |
| 222 | 3300005563 | Ga0068855_100067747 | Ga0068855_1000677472 | 133 |
| 223 | 3300025291 | Ga0209675_1010724 | Ga0209675_10107242 | 133 |
| 224 | 3300025294 | Ga0209025_1036670 | Ga0209025_10366702 | 133 |
| 225 | 3300025298 | Ga0209050_1006734 | Ga0209050_10067347 | 133 |
| 226 | 3300025909 | Ga0207705_10540466 | Ga0207705_105404661 | 133 |
| 227 | 3300037312 | Ga0395899_0963912 | Ga0395899_0963912_54_479 | 133 |
| 228 | 3300037418 | Ga0395900_0030213 | Ga0395900_0030213_613_1038 | 133 |
| 229 | 3300037418 | Ga0395900_0066823 | Ga0395900_0066823_2231_2656 | 133 |
| 230 | 3300037466 | Ga0395898_0011010 | Ga0395898_0011010_8836_9261 | 133 |
| 231 | 3300037471 | Ga0395905_1281416 | Ga0395905_1281416_153_578 | 133 |
| 232 | 3300038443 | Ga0395901_0164134 | Ga0395901_0164134_194_619 | 133 |
| 233 | 3300038443 | Ga0395901_0462240 | Ga0395901_0462240_756_1181 | 133 |
| 234 | 3300044684 | Ga0466966_0631318 | Ga0466966_0631318_34_459 | 133 |
| 235 | 3300044693 | Ga0466961_0222455 | Ga0466961_0222455_30_455 | 133 |
| 236 | 3300044719 | Ga0466971_0250930 | Ga0466971_0250930_142_567 | 133 |
| 237 | 3300045836 | Ga0466958_0254045 | Ga0466958_0254045_335_760 | 133 |
| 238 | 3300045836 | Ga0466958_0338814 | Ga0466958_0338814_233_658 | 133 |
| 239 | 3300053111 | Ga0500572_099449 | Ga0500572_099449_68_508 | 133 |
| 240 | 3300053121 | Ga0500607_033472 | Ga0500607_033472_1755_2195 | 133 |
| 241 | 3300053729 | Ga0500625_054278 | Ga0500625_054278_1087_1527 | 133 |
| 242 | 3300026095 | Ga0207676_11703705 | Ga0207676_117037051 | 134 |
| 243 | 3300044656 | Ga0466969_0067571 | Ga0466969_0067571_717_1142 | 134 |
| 244 | 3300044684 | Ga0466966_0184178 | Ga0466966_0184178_232_657 | 134 |
| 245 | 3300044693 | Ga0466961_0005995 | Ga0466961_0005995_5988_6413 | 134 |
| 246 | 3300045049 | Ga0466959_0069510 | Ga0466959_0069510_334_759 | 134 |
| 247 | 3300049568 | Ga0501031_0042512 | Ga0501031_0042512_242_667 | 135 |
| 248 | 3300049571 | Ga0501034_0056036 | Ga0501034_0056036_1183_1608 | 135 |
| 249 | 3300049571 | Ga0501034_0220904 | Ga0501034_0220904_956_1381 | 135 |
| 250 | 3300049574 | Ga0501038_0151237 | Ga0501038_0151237_323_748 | 135 |
| 251 | 3300049578 | Ga0501042_0826001 | Ga0501042_0826001_224_649 | 135 |
| 252 | 3300049579 | Ga0501043_0074622 | Ga0501043_0074622_972_1397 | 135 |
| 253 | 3300049580 | Ga0501046_0045717 | Ga0501046_0045717_2584_3009 | 135 |
| 254 | 3300049581 | Ga0501047_0031795 | Ga0501047_0031795_3398_3823 | 135 |
| 255 | 3300049589 | Ga0501073_0061270 | Ga0501073_0061270_291_716 | 135 |
| 256 | 3300049742 | Ga0501080_0012035 | Ga0501080_0012035_3903_4328 | 135 |
| 257 | 3300049822 | Ga0501035_0085966 | Ga0501035_0085966_97_522 | 135 |
| 258 | 3300049823 | Ga0501044_0042090 | Ga0501044_0042090_1757_2182 | 135 |
| 259 | 3300005366 | Ga0070659_100426046 | Ga0070659_1004260462 | 136 |
| 260 | 3300005563 | Ga0068855_101370166 | Ga0068855_1013701662 | 136 |
| 261 | 3300014969 | Ga0157376_12587425 | Ga0157376_125874251 | 136 |
| 262 | 3300025949 | Ga0207667_11833770 | Ga0207667_118337702 | 136 |
| 263 | 3300032005 | Ga0307411_10264246 | Ga0307411_102642462 | 136 |
| 264 | 3300041406 | Ga0439439_0206487 | Ga0439439_0206487_59_487 | 136 |
| 265 | 3300041407 | Ga0439447_088262 | Ga0439447_088262_244_672 | 136 |
| 266 | 3300042007 | Ga0439449_0001318 | Ga0439449_0001318_8302_8730 | 136 |
| 267 | 3300042435 | Ga0439434_0342747 | Ga0439434_0342747_44_472 | 136 |
| 268 | 3300044673 | Ga0453683_0003078 | Ga0453683_0003078_10241_10669 | 136 |
| 269 | 3300045051 | Ga0451576_0008679 | Ga0451576_0008679_9434_9862 | 136 |
| 270 | 3300059424 | Ga0590075_006706 | Ga0590075_006706_2279_2707 | 136 |
| 271 | 3300003322 | rootL2_10002429 | rootL2_100024299 | 137 |
| 272 | 3300003775 | Ga0055524_1000467 | Ga0055524_100046718 | 137 |
| 273 | 3300003794 | Ga0055531_10021287 | Ga0055531_100212874 | 137 |
| 274 | 3300005337 | Ga0070682_100204466 | Ga0070682_1002044662 | 137 |
| 275 | 3300012497 | Ga0157319_1000013 | Ga0157319_100001321 | 137 |
| 276 | 3300025299 | Ga0209256_1001137 | Ga0209256_100113716 | 137 |
| 277 | 3300025304 | Ga0209257_1001249 | Ga0209257_100124918 | 137 |
| 278 | 3300027312 | Ga0209371_1010706 | Ga0209371_10107064 | 137 |
| 279 | 3300030500 | Ga0268256_1015926 | Ga0268256_10159262 | 137 |
| 280 | 3300042011 | Ga0439454_003682 | Ga0439454_003682_616_1029 | 137 |
| 281 | 3300042127 | Ga0450890_006957 | Ga0450890_006957_189_602 | 137 |
| 282 | 3300042438 | Ga0439459_0000926 | Ga0439459_0000926_3536_3949 | 137 |
| 283 | 3300042530 | Ga0450916_011556 | Ga0450916_011556_468_881 | 137 |
| 284 | 3300044765 | Ga0466970_0598210 | Ga0466970_0598210_94_522 | 137 |
| 285 | 3300050496 | nmdc:mga07m45_36337_c1 | nmdc:mga07m45_36337_c1_467_880 | 137 |
| 286 | iso_pu_bacteria | 2738541277 | 2738720317 | 137 |
| 287 | iso_pu_bacteria | 2738543019 | 2739279516 | 137 |
| 288 | iso_pu_bacteria | 2894023352 | 2894025836 | 137 |
| 289 | iso_pu_bacteria | 2929160207 | 2929163621 | 137 |
| 290 | 3300003316 | rootH1_10020189 | rootH1_100201895 | 138 |
| 291 | 3300005456 | Ga0070678_100843089 | Ga0070678_1008430892 | 138 |
| 292 | 3300006195 | Ga0075366_10308221 | Ga0075366_103082212 | 138 |
| 293 | 3300006195 | Ga0075366_10423949 | Ga0075366_104239492 | 138 |
| 294 | 3300009148 | Ga0105243_10510460 | Ga0105243_105104602 | 138 |
| 295 | 3300034820 | Ga0373959_0028276 | Ga0373959_0028276_420_836 | 138 |
| 296 | 3300035691 | Ga0373931_0063924 | Ga0373931_0063924_217_633 | 138 |
| 297 | 3300041459 | Ga0451800_1627045 | Ga0451800_1627045_196_612 | 138 |
| 298 | 3300041491 | Ga0451833_0100439 | Ga0451833_0100439_102_518 | 138 |
| 299 | 3300045051 | Ga0451576_0105315 | Ga0451576_0105315_692_1108 | 138 |
| 300 | 3300046663 | Ga0495635_0634580 | Ga0495635_0634580_64_480 | 138 |
| 301 | 3300050493 | nmdc:mga0k408_37524_c1 | nmdc:mga0k408_37524_c1_182_598 | 138 |
| 302 | 3300050496 | nmdc:mga07m45_597_c2 | nmdc:mga07m45_597_c2_4916_5332 | 138 |
| 303 | 3300053085 | Ga0495619_1175273 | Ga0495619_1175273_11_427 | 138 |
| 304 | iso_pu_bacteria | 2511231002 | 2511246182 | 138 |
| 305 | 3300005353 | Ga0070669_100087546 | Ga0070669_1000875462 | 140 |
| 306 | 3300006038 | Ga0075365_10063578 | Ga0075365_100635784 | 140 |
| 307 | 3300006042 | Ga0075368_10207967 | Ga0075368_102079672 | 140 |
| 308 | 3300006042 | Ga0075368_10389531 | Ga0075368_103895311 | 140 |
| 309 | 3300014497 | Ga0182008_10095818 | Ga0182008_100958182 | 140 |
| 310 | 3300017792 | Ga0163161_10486216 | Ga0163161_104862162 | 140 |
| 311 | 3300028794 | Ga0307515_10000302 | Ga0307515_1000030223 | 140 |
| 312 | 3300030731 | Ga0316177_1035191 | Ga0316177_10351911 | 140 |
| 313 | 3300030744 | Ga0316181_1021957 | Ga0316181_10219572 | 140 |
| 314 | 3300030745 | Ga0316182_1334382 | Ga0316182_13343822 | 140 |
| 315 | 3300031731 | Ga0307405_10271674 | Ga0307405_102716742 | 140 |
| 316 | 3300032002 | Ga0307416_100624517 | Ga0307416_1006245172 | 140 |
| 317 | 3300041452 | Ga0451793_1183457 | Ga0451793_1183457_240_662 | 140 |
| 318 | 3300042004 | Ga0439445_0030456 | Ga0439445_0030456_322_744 | 140 |
| 319 | 3300042115 | Ga0450911_000596 | Ga0450911_000596_8012_8434 | 140 |
| 320 | 3300048919 | Ga0496116_0355266 | Ga0496116_0355266_164_601 | 140 |
| 321 | 3300048925 | Ga0496122_0002359 | Ga0496122_0002359_20772_21209 | 140 |
| 322 | 3300048926 | Ga0496123_0000108 | Ga0496123_0000108_38542_38979 | 140 |
| 323 | 3300048927 | Ga0496124_0088091 | Ga0496124_0088091_853_1275 | 140 |
| 324 | 3300048927 | Ga0496124_0114436 | Ga0496124_0114436_1618_2055 | 140 |
| 325 | 3300048928 | Ga0496125_0003980 | Ga0496125_0003980_3122_3544 | 140 |
| 326 | 3300048929 | Ga0496126_0167849 | Ga0496126_0167849_540_977 | 140 |
| 327 | 3300050492 | nmdc:mga0yw44_28590_c1 | nmdc:mga0yw44_28590_c1_2511_2933 | 140 |
| 328 | 3300053117 | Ga0500593_009718 | Ga0500593_009718_2422_2844 | 140 |
| 329 | iso_pu_bacteria | 2885192300 | 2885192739 | 140 |
| 330 | iso_pu_bacteria | 2954767861 | 2954772346 | 140 |
| 331 | 3300003187 | JGI25151J46595_10010954 | JGI25151J46595_100109544 | 141 |
| 332 | 3300003578 | Ga0006562J51391_1128315 | Ga0006562J51391_11283152 | 141 |
| 333 | 3300003773 | Ga0055537_1000611 | Ga0055537_100061119 | 141 |
| 334 | 3300003784 | Ga0055534_1000566 | Ga0055534_100056619 | 141 |
| 335 | 3300003790 | Ga0055528_1000932 | Ga0055528_100093219 | 141 |
| 336 | 3300003792 | Ga0055540_1001593 | Ga0055540_100159313 | 141 |
| 337 | 3300005456 | Ga0070678_100650034 | Ga0070678_1006500341 | 141 |
| 338 | 3300005459 | Ga0068867_100167155 | Ga0068867_1001671552 | 141 |
| 339 | 3300005548 | Ga0070665_100273590 | Ga0070665_1002735902 | 141 |
| 340 | 3300005577 | Ga0068857_100025225 | Ga0068857_1000252256 | 141 |
| 341 | 3300005578 | Ga0068854_100981658 | Ga0068854_1009816581 | 141 |
| 342 | 3300005719 | Ga0068861_100563512 | Ga0068861_1005635122 | 141 |
| 343 | 3300005844 | Ga0068862_100071635 | Ga0068862_1000716352 | 141 |
| 344 | 3300006038 | Ga0075365_10012495 | Ga0075365_100124952 | 141 |
| 345 | 3300006048 | Ga0075363_100008603 | Ga0075363_1000086034 | 141 |
| 346 | 3300006048 | Ga0075363_100009940 | Ga0075363_1000099402 | 141 |
| 347 | 3300006051 | Ga0075364_10039374 | Ga0075364_100393743 | 141 |
| 348 | 3300006058 | Ga0075432_10048247 | Ga0075432_100482472 | 141 |
| 349 | 3300006177 | Ga0075362_10015316 | Ga0075362_100153163 | 141 |
| 350 | 3300006177 | Ga0075362_10027540 | Ga0075362_100275403 | 141 |
| 351 | 3300006178 | Ga0075367_10006255 | Ga0075367_100062554 | 141 |
| 352 | 3300006178 | Ga0075367_10186701 | Ga0075367_101867012 | 141 |
| 353 | 3300006178 | Ga0075367_10220216 | Ga0075367_102202162 | 141 |
| 354 | 3300006195 | Ga0075366_10003789 | Ga0075366_100037899 | 141 |
| 355 | 3300006195 | Ga0075366_10042200 | Ga0075366_100422004 | 141 |
| 356 | 3300006353 | Ga0075370_10000113 | Ga0075370_1000011318 | 141 |
| 357 | 3300006353 | Ga0075370_10009267 | Ga0075370_100092675 | 141 |
| 358 | 3300006353 | Ga0075370_10009814 | Ga0075370_100098144 | 141 |
| 359 | 3300006353 | Ga0075370_10018917 | Ga0075370_100189172 | 141 |
| 360 | 3300006353 | Ga0075370_10176749 | Ga0075370_101767492 | 141 |
| 361 | 3300006353 | Ga0075370_10878057 | Ga0075370_108780571 | 141 |
| 362 | 3300006358 | Ga0068871_100539829 | Ga0068871_1005398291 | 141 |
| 363 | 3300006881 | Ga0068865_101165209 | Ga0068865_1011652092 | 141 |
| 364 | 3300006948 | Ga0099826_10018478 | Ga0099826_100184785 | 141 |
| 365 | 3300006948 | Ga0099826_10092532 | Ga0099826_100925322 | 141 |
| 366 | 3300006948 | Ga0099826_10297222 | Ga0099826_102972222 | 141 |
| 367 | 3300009148 | Ga0105243_10029931 | Ga0105243_100299313 | 141 |
| 368 | 3300012497 | Ga0157319_1036266 | Ga0157319_10362661 | 141 |
| 369 | 3300012502 | Ga0157347_1010744 | Ga0157347_10107442 | 141 |
| 370 | 3300013100 | Ga0157373_10022709 | Ga0157373_100227096 | 141 |
| 371 | 3300013306 | Ga0163162_10195517 | Ga0163162_101955172 | 141 |
| 372 | 3300013308 | Ga0157375_11297136 | Ga0157375_112971362 | 141 |
| 373 | 3300014497 | Ga0182008_10053615 | Ga0182008_100536153 | 141 |
| 374 | 3300014969 | Ga0157376_10756312 | Ga0157376_107563122 | 141 |
| 375 | 3300014969 | Ga0157376_11456896 | Ga0157376_114568962 | 141 |
| 376 | 3300015261 | Ga0182006_1174856 | Ga0182006_11748562 | 141 |
| 377 | 3300017792 | Ga0163161_10010831 | Ga0163161_100108312 | 141 |
| 378 | 3300025258 | Ga0209129_1000718 | Ga0209129_10007183 | 141 |
| 379 | 3300025263 | Ga0209565_1000114 | Ga0209565_10001144 | 141 |
| 380 | 3300025273 | Ga0209673_1001621 | Ga0209673_100162119 | 141 |
| 381 | 3300025273 | Ga0209673_1002302 | Ga0209673_10023024 | 141 |
| 382 | 3300025291 | Ga0209675_1000029 | Ga0209675_1000029169 | 141 |
| 383 | 3300025294 | Ga0209025_1000435 | Ga0209025_100043581 | 141 |
| 384 | 3300025294 | Ga0209025_1017247 | Ga0209025_10172472 | 141 |
| 385 | 3300025303 | Ga0209051_1000465 | Ga0209051_100046550 | 141 |
| 386 | 3300025935 | Ga0207709_10052492 | Ga0207709_100524922 | 141 |
| 387 | 3300026089 | Ga0207648_10241467 | Ga0207648_102414672 | 141 |
| 388 | 3300026121 | Ga0207683_10283950 | Ga0207683_102839502 | 141 |
| 389 | 3300027111 | Ga0209281_1022425 | Ga0209281_10224252 | 141 |
| 390 | 3300027666 | Ga0209282_1003375 | Ga0209282_100337510 | 141 |
| 391 | 3300027666 | Ga0209282_1094424 | Ga0209282_10944242 | 141 |
| 392 | 3300028379 | Ga0268266_10780709 | Ga0268266_107807092 | 141 |
| 393 | 3300028380 | Ga0268265_11250284 | Ga0268265_112502842 | 141 |
| 394 | 3300030731 | Ga0316177_1176206 | Ga0316177_11762064 | 141 |
| 395 | 3300030733 | Ga0314311_1132537 | Ga0314311_113253715 | 141 |
| 396 | 3300030735 | Ga0316178_1047908 | Ga0316178_10479082 | 141 |
| 397 | 3300030736 | Ga0316180_1016115 | Ga0316180_10161153 | 141 |
| 398 | 3300030742 | Ga0316183_1064677 | Ga0316183_10646772 | 141 |
| 399 | 3300030744 | Ga0316181_1016216 | Ga0316181_10162162 | 141 |
| 400 | 3300030745 | Ga0316182_1198643 | Ga0316182_11986435 | 141 |
| 401 | 3300031238 | Ga0265332_10072160 | Ga0265332_100721602 | 141 |
| 402 | 3300031548 | Ga0307408_100015159 | Ga0307408_1000151594 | 141 |
| 403 | 3300031548 | Ga0307408_100066851 | Ga0307408_1000668512 | 141 |
| 404 | 3300031548 | Ga0307408_100198861 | Ga0307408_1001988611 | 141 |
| 405 | 3300031548 | Ga0307408_100691912 | Ga0307408_1006919122 | 141 |
| 406 | 3300031649 | Ga0307514_10117701 | Ga0307514_101177011 | 141 |
| 407 | 3300031711 | Ga0265314_10004251 | Ga0265314_1000425116 | 141 |
| 408 | 3300031712 | Ga0265342_10050409 | Ga0265342_100504093 | 141 |
| 409 | 3300031731 | Ga0307405_10050523 | Ga0307405_100505233 | 141 |
| 410 | 3300031731 | Ga0307405_10051342 | Ga0307405_100513423 | 141 |
| 411 | 3300031731 | Ga0307405_10195113 | Ga0307405_101951132 | 141 |
| 412 | 3300031731 | Ga0307405_10506738 | Ga0307405_105067382 | 141 |
| 413 | 3300031731 | Ga0307405_12104729 | Ga0307405_121047291 | 141 |
| 414 | 3300031824 | Ga0307413_10112493 | Ga0307413_101124933 | 141 |
| 415 | 3300031824 | Ga0307413_11230010 | Ga0307413_112300101 | 141 |
| 416 | 3300031852 | Ga0307410_10323675 | Ga0307410_103236752 | 141 |
| 417 | 3300031901 | Ga0307406_10002299 | Ga0307406_1000229911 | 141 |
| 418 | 3300031901 | Ga0307406_10108712 | Ga0307406_101087123 | 141 |
| 419 | 3300031901 | Ga0307406_10187614 | Ga0307406_101876142 | 141 |
| 420 | 3300031903 | Ga0307407_10098207 | Ga0307407_100982072 | 141 |
| 421 | 3300031911 | Ga0307412_10036873 | Ga0307412_100368734 | 141 |
| 422 | 3300031911 | Ga0307412_10040382 | Ga0307412_100403824 | 141 |
| 423 | 3300031911 | Ga0307412_10366799 | Ga0307412_103667992 | 141 |
| 424 | 3300032002 | Ga0307416_100136503 | Ga0307416_1001365033 | 141 |
| 425 | 3300032002 | Ga0307416_100181970 | Ga0307416_1001819702 | 141 |
| 426 | 3300032002 | Ga0307416_100786033 | Ga0307416_1007860332 | 141 |
| 427 | 3300032004 | Ga0307414_10030934 | Ga0307414_100309342 | 141 |
| 428 | 3300032004 | Ga0307414_10032160 | Ga0307414_100321603 | 141 |
| 429 | 3300032005 | Ga0307411_10223096 | Ga0307411_102230962 | 141 |
| 430 | 3300032005 | Ga0307411_10365444 | Ga0307411_103654442 | 141 |
| 431 | 3300035116 | Ga0373945_0428465 | Ga0373945_0428465_115_549 | 141 |
| 432 | 3300035170 | Ga0373943_0667045 | Ga0373943_0667045_68_502 | 141 |
| 433 | 3300041404 | Ga0439436_0000703 | Ga0439436_0000703_7368_7793 | 141 |
| 434 | 3300041404 | Ga0439436_0002187 | Ga0439436_0002187_4820_5245 | 141 |
| 435 | 3300041404 | Ga0439436_0003327 | Ga0439436_0003327_1011_1454 | 141 |
| 436 | 3300041404 | Ga0439436_0055865 | Ga0439436_0055865_198_623 | 141 |
| 437 | 3300041405 | Ga0439438_025903 | Ga0439438_025903_882_1307 | 141 |
| 438 | 3300041405 | Ga0439438_043899 | Ga0439438_043899_283_708 | 141 |
| 439 | 3300041406 | Ga0439439_0000471 | Ga0439439_0000471_2113_2538 | 141 |
| 440 | 3300041406 | Ga0439439_0061343 | Ga0439439_0061343_525_950 | 141 |
| 441 | 3300041406 | Ga0439439_0141143 | Ga0439439_0141143_40_483 | 141 |
| 442 | 3300041407 | Ga0439447_004982 | Ga0439447_004982_1611_2036 | 141 |
| 443 | 3300041407 | Ga0439447_022525 | Ga0439447_022525_814_1239 | 141 |
| 444 | 3300041411 | Ga0439466_0002529 | Ga0439466_0002529_5680_6105 | 141 |
| 445 | 3300041411 | Ga0439466_0025336 | Ga0439466_0025336_354_779 | 141 |
| 446 | 3300041411 | Ga0439466_0026442 | Ga0439466_0026442_669_1112 | 141 |
| 447 | 3300041413 | Ga0439465_0003784 | Ga0439465_0003784_78_503 | 141 |
| 448 | 3300041498 | Ga0451841_0276797 | Ga0451841_0276797_95_520 | 141 |
| 449 | 3300041997 | Ga0439431_0003175 | Ga0439431_0003175_656_1081 | 141 |
| 450 | 3300041997 | Ga0439431_0040566 | Ga0439431_0040566_382_825 | 141 |
| 451 | 3300041999 | Ga0439433_0004619 | Ga0439433_0004619_688_1113 | 141 |
| 452 | 3300042002 | Ga0439442_011963 | Ga0439442_011963_812_1237 | 141 |
| 453 | 3300042002 | Ga0439442_056858 | Ga0439442_056858_240_665 | 141 |
| 454 | 3300042004 | Ga0439445_0000164 | Ga0439445_0000164_8676_9101 | 141 |
| 455 | 3300042004 | Ga0439445_0024412 | Ga0439445_0024412_753_1181 | 141 |
| 456 | 3300042006 | Ga0439432_006112 | Ga0439432_006112_708_1133 | 141 |
| 457 | 3300042006 | Ga0439432_016051 | Ga0439432_016051_235_660 | 141 |
| 458 | 3300042007 | Ga0439449_0000494 | Ga0439449_0000494_11778_12203 | 141 |
| 459 | 3300042007 | Ga0439449_0004819 | Ga0439449_0004819_797_1222 | 141 |
| 460 | 3300042007 | Ga0439449_0005691 | Ga0439449_0005691_549_974 | 141 |
| 461 | 3300042007 | Ga0439449_0200805 | Ga0439449_0200805_41_466 | 141 |
| 462 | 3300042010 | Ga0439452_001807 | Ga0439452_001807_622_1047 | 141 |
| 463 | 3300042010 | Ga0439452_002182 | Ga0439452_002182_1924_2349 | 141 |
| 464 | 3300042014 | Ga0439457_001873 | Ga0439457_001873_2810_3235 | 141 |
| 465 | 3300042014 | Ga0439457_052152 | Ga0439457_052152_254_679 | 141 |
| 466 | 3300042015 | Ga0439462_0018325 | Ga0439462_0018325_947_1372 | 141 |
| 467 | 3300042125 | Ga0450923_011411 | Ga0450923_011411_586_1011 | 141 |
| 468 | 3300042145 | Ga0450906_003663 | Ga0450906_003663_2500_2943 | 141 |
| 469 | 3300042145 | Ga0450906_074638 | Ga0450906_074638_55_480 | 141 |
| 470 | 3300042156 | Ga0439446_0029977 | Ga0439446_0029977_1126_1551 | 141 |
| 471 | 3300042156 | Ga0439446_0351384 | Ga0439446_0351384_11_454 | 141 |
| 472 | 3300042184 | Ga0450908_008165 | Ga0450908_008165_268_711 | 141 |
| 473 | 3300042185 | Ga0450909_057895 | Ga0450909_057895_109_534 | 141 |
| 474 | 3300042435 | Ga0439434_0007410 | Ga0439434_0007410_222_647 | 141 |
| 475 | 3300042438 | Ga0439459_0074146 | Ga0439459_0074146_182_607 | 141 |
| 476 | 3300042531 | Ga0450918_002734 | Ga0450918_002734_2500_2943 | 141 |
| 477 | 3300042532 | Ga0450893_0012894 | Ga0450893_0012894_737_1162 | 141 |
| 478 | 3300042876 | Ga0451577_0038579 | Ga0451577_0038579_2515_2943 | 141 |
| 479 | 3300042876 | Ga0451577_1522291 | Ga0451577_1522291_64_492 | 141 |
| 480 | 3300044673 | Ga0453683_0143784 | Ga0453683_0143784_941_1369 | 141 |
| 481 | 3300044683 | Ga0466965_0388479 | Ga0466965_0388479_237_662 | 141 |
| 482 | 3300044712 | Ga0453684_0067284 | Ga0453684_0067284_4036_4464 | 141 |
| 483 | 3300044712 | Ga0453684_0881546 | Ga0453684_0881546_93_521 | 141 |
| 484 | 3300045051 | Ga0451576_0029573 | Ga0451576_0029573_2014_2442 | 141 |
| 485 | 3300046453 | Ga0495627_006704 | Ga0495627_006704_1254_1694 | 141 |
| 486 | 3300046455 | Ga0495603_0654898 | Ga0495603_0654898_138_563 | 141 |
| 487 | 3300046515 | Ga0495620_0004869 | Ga0495620_0004869_4627_5067 | 141 |
| 488 | 3300046520 | Ga0495637_0004150 | Ga0495637_0004150_4117_4557 | 141 |
| 489 | 3300046538 | Ga0495609_0070233 | Ga0495609_0070233_145_585 | 141 |
| 490 | 3300046558 | Ga0495633_0585553 | Ga0495633_0585553_31_471 | 141 |
| 491 | 3300046660 | Ga0495625_0002531 | Ga0495625_0002531_16721_17161 | 141 |
| 492 | 3300046674 | Ga0495588_0042065 | Ga0495588_0042065_1897_2322 | 141 |
| 493 | 3300046691 | Ga0495670_0044540 | Ga0495670_0044540_1283_1723 | 141 |
| 494 | 3300046692 | Ga0495671_0001939 | Ga0495671_0001939_7924_8364 | 141 |
| 495 | 3300046809 | Ga0495600_0315275 | Ga0495600_0315275_399_824 | 141 |
| 496 | 3300046810 | Ga0495660_0222956 | Ga0495660_0222956_241_681 | 141 |
| 497 | 3300047470 | Ga0495681_0297021 | Ga0495681_0297021_154_594 | 141 |
| 498 | 3300048919 | Ga0496116_0052800 | Ga0496116_0052800_2195_2620 | 141 |
| 499 | 3300049679 | Ga0501249_051157 | Ga0501249_051157_189_614 | 141 |
| 500 | 3300049705 | Ga0501225_0188798 | Ga0501225_0188798_139_564 | 141 |
| 501 | 3300049759 | Ga0501262_000560 | Ga0501262_000560_2253_2693 | 141 |
| 502 | 3300050489 | nmdc:mga03683_12001_c1 | nmdc:mga03683_12001_c1_2533_2958 | 141 |
| 503 | 3300050490 | nmdc:mga03n38_400297_c1 | nmdc:mga03n38_400297_c1_205_645 | 141 |
| 504 | 3300050490 | nmdc:mga03n38_45822_c1 | nmdc:mga03n38_45822_c1_123_566 | 141 |
| 505 | 3300050490 | nmdc:mga03n38_497101_c1 | nmdc:mga03n38_497101_c1_75_515 | 141 |
| 506 | 3300050491 | nmdc:mga00v17_6700_c1 | nmdc:mga00v17_6700_c1_4775_5215 | 141 |
| 507 | 3300050493 | nmdc:mga0k408_11586_c1 | nmdc:mga0k408_11586_c1_1971_2396 | 141 |
| 508 | 3300050493 | nmdc:mga0k408_3613_c1 | nmdc:mga0k408_3613_c1_4972_5412 | 141 |
| 509 | 3300050494 | nmdc:mga06z11_40536_c1 | nmdc:mga06z11_40536_c1_1127_1567 | 141 |
| 510 | 3300050494 | nmdc:mga06z11_71013_c1 | nmdc:mga06z11_71013_c1_1286_1711 | 141 |
| 511 | 3300050496 | nmdc:mga07m45_272_c1 | nmdc:mga07m45_272_c1_3833_4273 | 141 |
| 512 | 3300050496 | nmdc:mga07m45_65458_c1 | nmdc:mga07m45_65458_c1_962_1405 | 141 |
| 513 | 3300050496 | nmdc:mga07m45_7411_c1 | nmdc:mga07m45_7411_c1_2999_3439 | 141 |
| 514 | 3300050516 | nmdc:mga0sz30_77922_c1 | nmdc:mga0sz30_77922_c1_768_1193 | 141 |
| 515 | 3300053079 | Ga0500610_0009345 | Ga0500610_0009345_1654_2094 | 141 |
| 516 | 3300053079 | Ga0500610_0050716 | Ga0500610_0050716_614_1054 | 141 |
| 517 | 3300053088 | Ga0500644_0271875 | Ga0500644_0271875_284_709 | 141 |
| 518 | 3300053108 | Ga0500562_011537 | Ga0500562_011537_30_455 | 141 |
| 519 | 3300053117 | Ga0500593_000566 | Ga0500593_000566_3648_4088 | 141 |
| 520 | 3300053121 | Ga0500607_001562 | Ga0500607_001562_3868_4308 | 141 |
| 521 | 3300053153 | Ga0500616_0027696 | Ga0500616_0027696_1303_1728 | 141 |
| 522 | 3300053158 | Ga0500627_0093608 | Ga0500627_0093608_877_1317 | 141 |
| 523 | 3300060353 | Ga0501082_0936442 | Ga0501082_0936442_251_676 | 141 |
| 524 | iso_pu_bacteria | 2513020051 | 2513230940 | 141 |
| 525 | iso_pu_bacteria | 2599185214 | 2599624383 | 141 |
| 526 | iso_pu_bacteria | 2599185226 | 2599672755 | 141 |
| 527 | iso_pu_bacteria | 2599185227 | 2599683755 | 141 |
| 528 | iso_pu_bacteria | 2599185229 | 2599694364 | 141 |
| 529 | iso_pu_bacteria | 2643221628 | 2644159559 | 141 |
| 530 | iso_pu_bacteria | 2643221658 | 2644327954 | 141 |
| 531 | iso_pu_bacteria | 2643221672 | 2644398739 | 141 |
| 532 | iso_pu_bacteria | 2643221683 | 2644468467 | 141 |
| 533 | iso_pu_bacteria | 2738541307 | 2738881858 | 141 |
| 534 | iso_pu_bacteria | 2738543013 | 2739250782 | 141 |
| 535 | iso_pu_bacteria | 2818991446 | 2819595797 | 141 |
| 536 | iso_pu_bacteria | 2831265667 | 2831267057 | 141 |
| 537 | iso_pu_bacteria | 2838054893 | 2838057115 | 141 |
| 538 | iso_pu_bacteria | 2842677519 | 2842678917 | 141 |
| 539 | iso_pu_bacteria | 2885198086 | 2885198887 | 141 |
| 540 | iso_pu_bacteria | 2885211737 | 2885212850 | 141 |
| 541 | iso_pu_bacteria | 2899924645 | 2899925143 | 141 |
| 542 | iso_pu_bacteria | 2904449895 | 2904454467 | 141 |
| 543 | iso_pu_bacteria | 2904456579 | 2904461090 | 141 |
| 544 | iso_pu_bacteria | 2904541872 | 2904544707 | 141 |
| 545 | iso_pu_bacteria | 2919462493 | 2919465967 | 141 |
| 546 | iso_pu_bacteria | 2928037797 | 2928038732 | 141 |
| 547 | iso_pu_bacteria | 2928044640 | 2928045663 | 141 |
| 548 | iso_pu_bacteria | 2928051484 | 2928053280 | 141 |
| 549 | iso_pu_bacteria | 2928064002 | 2928066885 | 141 |
| 550 | iso_pu_bacteria | 2928070936 | 2928071234 | 141 |
| 551 | iso_pu_bacteria | 2928084124 | 2928084841 | 141 |
| 552 | iso_pu_bacteria | 2929520902 | 2929526974 | 141 |
| 553 | iso_pu_bacteria | 2945909444 | 2945912305 | 141 |
| 554 | iso_pu_bacteria | 2945945610 | 2945948225 | 141 |
| 555 | iso_pu_bacteria | 2945972063 | 2945977133 | 141 |
| 556 | iso_pu_bacteria | 2945984333 | 2945985382 | 141 |
| 557 | 3300002704 | JGI25155J39150_1000002 | JGI25155J39150_1000002140 | 142 |
| 558 | 3300002705 | JGI25156J39149_1000003 | JGI25156J39149_1000003166 | 142 |
| 559 | 3300002738 | JGI25154J39366_1000009 | JGI25154J39366_1000009140 | 142 |
| 560 | 3300002741 | JGI25157J39369_1000002 | JGI25157J39369_1000002140 | 142 |
| 561 | 3300002987 | JGI25159J45721_1001861 | JGI25159J45721_10018613 | 142 |
| 562 | 3300002987 | JGI25159J45721_1002062 | JGI25159J45721_10020623 | 142 |
| 563 | 3300003187 | JGI25151J46595_10003617 | JGI25151J46595_100036173 | 142 |
| 564 | 3300003187 | JGI25151J46595_10013500 | JGI25151J46595_100135002 | 142 |
| 565 | 3300003354 | JGI25160J50197_1000646 | JGI25160J50197_10006468 | 142 |
| 566 | 3300003354 | JGI25160J50197_1000712 | JGI25160J50197_10007128 | 142 |
| 567 | 3300003374 | JGI25161J50226_1000018 | JGI25161J50226_1000018170 | 142 |
| 568 | 3300003771 | Ga0055526_1001518 | Ga0055526_10015184 | 142 |
| 569 | 3300003771 | Ga0055526_1010011 | Ga0055526_10100113 | 142 |
| 570 | 3300003771 | Ga0055526_1083266 | Ga0055526_10832661 | 142 |
| 571 | 3300003775 | Ga0055524_1000012 | Ga0055524_10000128 | 142 |
| 572 | 3300003790 | Ga0055528_1000925 | Ga0055528_100092521 | 142 |
| 573 | 3300003791 | Ga0055530_10002096 | Ga0055530_100020968 | 142 |
| 574 | 3300003791 | Ga0055530_10002329 | Ga0055530_100023298 | 142 |
| 575 | 3300003791 | Ga0055530_10095340 | Ga0055530_100953401 | 142 |
| 576 | 3300003792 | Ga0055540_1000012 | Ga0055540_1000012126 | 142 |
| 577 | 3300003792 | Ga0055540_1006194 | Ga0055540_10061946 | 142 |
| 578 | 3300003794 | Ga0055531_10000345 | Ga0055531_1000034530 | 142 |
| 579 | 3300003794 | Ga0055531_10001882 | Ga0055531_1000188217 | 142 |
| 580 | 3300005262 | Ga0065165_1059631 | Ga0065165_10596312 | 142 |
| 581 | 3300005327 | Ga0070658_10674937 | Ga0070658_106749372 | 142 |
| 582 | 3300005331 | Ga0070670_100028698 | Ga0070670_1000286983 | 142 |
| 583 | 3300005334 | Ga0068869_100055267 | Ga0068869_1000552671 | 142 |
| 584 | 3300005334 | Ga0068869_101867476 | Ga0068869_1018674761 | 142 |
| 585 | 3300005338 | Ga0068868_100144468 | Ga0068868_1001444682 | 142 |
| 586 | 3300005339 | Ga0070660_100131394 | Ga0070660_1001313942 | 142 |
| 587 | 3300005365 | Ga0070688_101108853 | Ga0070688_1011088532 | 142 |
| 588 | 3300005435 | Ga0070714_100176236 | Ga0070714_1001762361 | 142 |
| 589 | 3300005467 | Ga0070706_101733894 | Ga0070706_1017338941 | 142 |
| 590 | 3300005468 | Ga0070707_100183676 | Ga0070707_1001836763 | 142 |
| 591 | 3300005530 | Ga0070679_100082648 | Ga0070679_1000826483 | 142 |
| 592 | 3300005539 | Ga0068853_101448525 | Ga0068853_1014485251 | 142 |
| 593 | 3300005549 | Ga0070704_100479568 | Ga0070704_1004795682 | 142 |
| 594 | 3300005563 | Ga0068855_100104421 | Ga0068855_1001044213 | 142 |
| 595 | 3300005616 | Ga0068852_101573826 | Ga0068852_1015738262 | 142 |
| 596 | 3300005616 | Ga0068852_101718896 | Ga0068852_1017188962 | 142 |
| 597 | 3300005618 | Ga0068864_100612088 | Ga0068864_1006120882 | 142 |
| 598 | 3300006038 | Ga0075365_10393583 | Ga0075365_103935832 | 142 |
| 599 | 3300006042 | Ga0075368_10024851 | Ga0075368_100248512 | 142 |
| 600 | 3300006048 | Ga0075363_100049966 | Ga0075363_1000499662 | 142 |
| 601 | 3300006048 | Ga0075363_100195854 | Ga0075363_1001958542 | 142 |
| 602 | 3300006051 | Ga0075364_10006278 | Ga0075364_100062785 | 142 |
| 603 | 3300006058 | Ga0075432_10057023 | Ga0075432_100570232 | 142 |
| 604 | 3300006177 | Ga0075362_10009304 | Ga0075362_100093042 | 142 |
| 605 | 3300006177 | Ga0075362_10073744 | Ga0075362_100737442 | 142 |
| 606 | 3300006177 | Ga0075362_10089551 | Ga0075362_100895513 | 142 |
| 607 | 3300006177 | Ga0075362_10337089 | Ga0075362_103370892 | 142 |
| 608 | 3300006178 | Ga0075367_10080808 | Ga0075367_100808082 | 142 |
| 609 | 3300006195 | Ga0075366_10016348 | Ga0075366_100163485 | 142 |
| 610 | 3300006195 | Ga0075366_10112588 | Ga0075366_101125882 | 142 |
| 611 | 3300006195 | Ga0075366_10618825 | Ga0075366_106188252 | 142 |
| 612 | 3300006353 | Ga0075370_10110265 | Ga0075370_101102652 | 142 |
| 613 | 3300006353 | Ga0075370_10324294 | Ga0075370_103242942 | 142 |
| 614 | 3300006353 | Ga0075370_10548821 | Ga0075370_105488212 | 142 |
| 615 | 3300006846 | Ga0075430_100276481 | Ga0075430_1002764812 | 142 |
| 616 | 3300006946 | Ga0079104_1019897 | Ga0079104_10198972 | 142 |
| 617 | 3300006948 | Ga0099826_10275347 | Ga0099826_102753472 | 142 |
| 618 | 3300009093 | Ga0105240_10010481 | Ga0105240_1001048111 | 142 |
| 619 | 3300009101 | Ga0105247_11419583 | Ga0105247_114195832 | 142 |
| 620 | 3300009147 | Ga0114129_10420441 | Ga0114129_104204411 | 142 |
| 621 | 3300009174 | Ga0105241_10403179 | Ga0105241_104031792 | 142 |
| 622 | 3300009551 | Ga0105238_10316590 | Ga0105238_103165902 | 142 |
| 623 | 3300009551 | Ga0105238_10521004 | Ga0105238_105210042 | 142 |
| 624 | 3300010375 | Ga0105239_10180443 | Ga0105239_101804432 | 142 |
| 625 | 3300012513 | Ga0157326_1002747 | Ga0157326_10027472 | 142 |
| 626 | 3300014326 | Ga0157380_12224018 | Ga0157380_122240181 | 142 |
| 627 | 3300025206 | Ga0209435_100001 | Ga0209435_100001577 | 142 |
| 628 | 3300025208 | Ga0209436_102515 | Ga0209436_1025155 | 142 |
| 629 | 3300025245 | Ga0207425_1000784 | Ga0207425_100078415 | 142 |
| 630 | 3300025245 | Ga0207425_1002389 | Ga0207425_10023898 | 142 |
| 631 | 3300025245 | Ga0207425_1064914 | Ga0207425_10649141 | 142 |
| 632 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001946 | 142 |
| 633 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003577 | 142 |
| 634 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001577 | 142 |
| 635 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004627 | 142 |
| 636 | 3300025263 | Ga0209565_1000892 | Ga0209565_10008927 | 142 |
| 637 | 3300025273 | Ga0209673_1000074 | Ga0209673_1000074155 | 142 |
| 638 | 3300025273 | Ga0209673_1039655 | Ga0209673_10396552 | 142 |
| 639 | 3300025284 | Ga0209130_1000050 | Ga0209130_1000050170 | 142 |
| 640 | 3300025284 | Ga0209130_1001070 | Ga0209130_100107017 | 142 |
| 641 | 3300025291 | Ga0209675_1000044 | Ga0209675_100004450 | 142 |
| 642 | 3300025291 | Ga0209675_1003844 | Ga0209675_10038447 | 142 |
| 643 | 3300025291 | Ga0209675_1041451 | Ga0209675_10414511 | 142 |
| 644 | 3300025292 | Ga0209676_1000029 | Ga0209676_1000029274 | 142 |
| 645 | 3300025292 | Ga0209676_1001530 | Ga0209676_100153010 | 142 |
| 646 | 3300025294 | Ga0209025_1001778 | Ga0209025_10017783 | 142 |
| 647 | 3300025294 | Ga0209025_1005176 | Ga0209025_100517611 | 142 |
| 648 | 3300025294 | Ga0209025_1005773 | Ga0209025_100577310 | 142 |
| 649 | 3300025294 | Ga0209025_1020498 | Ga0209025_10204982 | 142 |
| 650 | 3300025295 | Ga0209564_1001399 | Ga0209564_10013995 | 142 |
| 651 | 3300025295 | Ga0209564_1001809 | Ga0209564_100180914 | 142 |
| 652 | 3300025295 | Ga0209564_1025454 | Ga0209564_10254542 | 142 |
| 653 | 3300025297 | Ga0209758_1015794 | Ga0209758_10157944 | 142 |
| 654 | 3300025297 | Ga0209758_1062172 | Ga0209758_10621722 | 142 |
| 655 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003336 | 142 |
| 656 | 3300025298 | Ga0209050_1003012 | Ga0209050_10030123 | 142 |
| 657 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001340 | 142 |
| 658 | 3300025299 | Ga0209256_1084653 | Ga0209256_10846531 | 142 |
| 659 | 3300025302 | Ga0207426_1000071 | Ga0207426_100007186 | 142 |
| 660 | 3300025302 | Ga0207426_1003300 | Ga0207426_10033008 | 142 |
| 661 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003336 | 142 |
| 662 | 3300025303 | Ga0209051_1000254 | Ga0209051_100025413 | 142 |
| 663 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012639 | 142 |
| 664 | 3300025304 | Ga0209257_1000018 | Ga0209257_1000018336 | 142 |
| 665 | 3300025304 | Ga0209257_1000045 | Ga0209257_100004545 | 142 |
| 666 | 3300025304 | Ga0209257_1000137 | Ga0209257_1000137111 | 142 |
| 667 | 3300025911 | Ga0207654_10495471 | Ga0207654_104954712 | 142 |
| 668 | 3300025917 | Ga0207660_10122893 | Ga0207660_101228933 | 142 |
| 669 | 3300025918 | Ga0207662_11117314 | Ga0207662_111173141 | 142 |
| 670 | 3300025919 | Ga0207657_10055016 | Ga0207657_100550164 | 142 |
| 671 | 3300025919 | Ga0207657_10812388 | Ga0207657_108123881 | 142 |
| 672 | 3300025921 | Ga0207652_10185118 | Ga0207652_101851182 | 142 |
| 673 | 3300025921 | Ga0207652_10330106 | Ga0207652_103301062 | 142 |
| 674 | 3300025922 | Ga0207646_10386937 | Ga0207646_103869372 | 142 |
| 675 | 3300025924 | Ga0207694_10725186 | Ga0207694_107251862 | 142 |
| 676 | 3300025925 | Ga0207650_10037174 | Ga0207650_100371743 | 142 |
| 677 | 3300025942 | Ga0207689_10033336 | Ga0207689_100333364 | 142 |
| 678 | 3300025942 | Ga0207689_10226241 | Ga0207689_102262412 | 142 |
| 679 | 3300025949 | Ga0207667_10141437 | Ga0207667_101414372 | 142 |
| 680 | 3300025949 | Ga0207667_10324139 | Ga0207667_103241392 | 142 |
| 681 | 3300025960 | Ga0207651_10907851 | Ga0207651_109078512 | 142 |
| 682 | 3300026023 | Ga0207677_10002959 | Ga0207677_100029599 | 142 |
| 683 | 3300026041 | Ga0207639_10198421 | Ga0207639_101984213 | 142 |
| 684 | 3300026078 | Ga0207702_10201192 | Ga0207702_102011922 | 142 |
| 685 | 3300026095 | Ga0207676_10491917 | Ga0207676_104919172 | 142 |
| 686 | 3300026142 | Ga0207698_11992815 | Ga0207698_119928152 | 142 |
| 687 | 3300027111 | Ga0209281_1054133 | Ga0209281_10541332 | 142 |
| 688 | 3300027907 | Ga0207428_10506245 | Ga0207428_105062451 | 142 |
| 689 | 3300028794 | Ga0307515_10739565 | Ga0307515_107395651 | 142 |
| 690 | 3300031456 | Ga0307513_10000010 | Ga0307513_1000001049 | 142 |
| 691 | 3300031456 | Ga0307513_10000014 | Ga0307513_10000014251 | 142 |
| 692 | 3300031456 | Ga0307513_10468809 | Ga0307513_104688092 | 142 |
| 693 | 3300031456 | Ga0307513_10499396 | Ga0307513_104993961 | 142 |
| 694 | 3300031548 | Ga0307408_100032886 | Ga0307408_1000328862 | 142 |
| 695 | 3300031548 | Ga0307408_100428283 | Ga0307408_1004282832 | 142 |
| 696 | 3300031548 | Ga0307408_100656913 | Ga0307408_1006569131 | 142 |
| 697 | 3300031548 | Ga0307408_101592707 | Ga0307408_1015927071 | 142 |
| 698 | 3300031730 | Ga0307516_10278932 | Ga0307516_102789322 | 142 |
| 699 | 3300031731 | Ga0307405_10599211 | Ga0307405_105992112 | 142 |
| 700 | 3300031731 | Ga0307405_10989762 | Ga0307405_109897622 | 142 |
| 701 | 3300031824 | Ga0307413_10466580 | Ga0307413_104665802 | 142 |
| 702 | 3300031901 | Ga0307406_10045966 | Ga0307406_100459664 | 142 |
| 703 | 3300031911 | Ga0307412_10076369 | Ga0307412_100763694 | 142 |
| 704 | 3300031911 | Ga0307412_11186928 | Ga0307412_111869282 | 142 |
| 705 | 3300032002 | Ga0307416_100049797 | Ga0307416_1000497972 | 142 |
| 706 | 3300037418 | Ga0395900_0060679 | Ga0395900_0060679_3107_3535 | 142 |
| 707 | 3300037418 | Ga0395900_0289197 | Ga0395900_0289197_77_505 | 142 |
| 708 | 3300037466 | Ga0395898_0146785 | Ga0395898_0146785_1196_1624 | 142 |
| 709 | 3300038443 | Ga0395901_0044247 | Ga0395901_0044247_807_1235 | 142 |
| 710 | 3300039437 | Ga0436365_0464954 | Ga0436365_0464954_114_542 | 142 |
| 711 | 3300041404 | Ga0439436_0021925 | Ga0439436_0021925_1028_1456 | 142 |
| 712 | 3300041410 | Ga0439461_0022993 | Ga0439461_0022993_606_1034 | 142 |
| 713 | 3300041451 | Ga0451791_1555033 | Ga0451791_1555033_1004_1432 | 142 |
| 714 | 3300041463 | Ga0451804_0299013 | Ga0451804_0299013_88_516 | 142 |
| 715 | 3300041496 | Ga0451839_0586664 | Ga0451839_0586664_174_602 | 142 |
| 716 | 3300041507 | Ga0451851_0287117 | Ga0451851_0287117_282_710 | 142 |
| 717 | 3300041512 | Ga0451853_1870137 | Ga0451853_1870137_146_574 | 142 |
| 718 | 3300042007 | Ga0439449_0031646 | Ga0439449_0031646_822_1250 | 142 |
| 719 | 3300042015 | Ga0439462_0061596 | Ga0439462_0061596_268_696 | 142 |
| 720 | 3300042131 | Ga0450894_008192 | Ga0450894_008192_131_559 | 142 |
| 721 | 3300042134 | Ga0450898_005252 | Ga0450898_005252_503_931 | 142 |
| 722 | 3300042138 | Ga0450903_025585 | Ga0450903_025585_401_829 | 142 |
| 723 | 3300042139 | Ga0450904_007394 | Ga0450904_007394_602_1030 | 142 |
| 724 | 3300042156 | Ga0439446_0021931 | Ga0439446_0021931_215_643 | 142 |
| 725 | 3300042156 | Ga0439446_0153374 | Ga0439446_0153374_283_711 | 142 |
| 726 | 3300042185 | Ga0450909_005276 | Ga0450909_005276_985_1413 | 142 |
| 727 | 3300042435 | Ga0439434_0288955 | Ga0439434_0288955_64_498 | 142 |
| 728 | 3300042438 | Ga0439459_0042973 | Ga0439459_0042973_425_853 | 142 |
| 729 | 3300042439 | Ga0439464_0044365 | Ga0439464_0044365_438_866 | 142 |
| 730 | 3300042876 | Ga0451577_0058241 | Ga0451577_0058241_480_908 | 142 |
| 731 | 3300044658 | Ga0466972_0278698 | Ga0466972_0278698_303_731 | 142 |
| 732 | 3300044683 | Ga0466965_0506621 | Ga0466965_0506621_127_555 | 142 |
| 733 | 3300044684 | Ga0466966_0176873 | Ga0466966_0176873_692_1120 | 142 |
| 734 | 3300044684 | Ga0466966_0614160 | Ga0466966_0614160_10_441 | 142 |
| 735 | 3300044693 | Ga0466961_0209177 | Ga0466961_0209177_632_1060 | 142 |
| 736 | 3300044712 | Ga0453684_1431954 | Ga0453684_1431954_197_631 | 142 |
| 737 | 3300044842 | Ga0466957_0404582 | Ga0466957_0404582_147_575 | 142 |
| 738 | 3300044842 | Ga0466957_0946927 | Ga0466957_0946927_66_494 | 142 |
| 739 | 3300045976 | Ga0466967_0190524 | Ga0466967_0190524_341_769 | 142 |
| 740 | 3300046539 | Ga0495621_0060472 | Ga0495621_0060472_744_1172 | 142 |
| 741 | 3300046558 | Ga0495633_0450493 | Ga0495633_0450493_33_461 | 142 |
| 742 | 3300046615 | Ga0495656_0024993 | Ga0495656_0024993_1024_1452 | 142 |
| 743 | 3300046684 | Ga0495669_0086357 | Ga0495669_0086357_420_848 | 142 |
| 744 | 3300047318 | Ga0495636_0323965 | Ga0495636_0323965_148_576 | 142 |
| 745 | 3300047445 | Ga0495677_0040587 | Ga0495677_0040587_581_1009 | 142 |
| 746 | 3300048911 | Ga0496108_0082018 | Ga0496108_0082018_1502_1930 | 142 |
| 747 | 3300049569 | Ga0501032_0117606 | Ga0501032_0117606_19_447 | 142 |
| 748 | 3300049679 | Ga0501249_134923 | Ga0501249_134923_61_492 | 142 |
| 749 | 3300049767 | Ga0501270_159532 | Ga0501270_159532_37_465 | 142 |
| 750 | 3300049822 | Ga0501035_0361986 | Ga0501035_0361986_53_481 | 142 |
| 751 | 3300049823 | Ga0501044_1447177 | Ga0501044_1447177_107_535 | 142 |
| 752 | 3300050489 | nmdc:mga03683_109941_c1 | nmdc:mga03683_109941_c1_162_590 | 142 |
| 753 | 3300050490 | nmdc:mga03n38_11720_c1 | nmdc:mga03n38_11720_c1_1132_1560 | 142 |
| 754 | 3300050491 | nmdc:mga00v17_68539_c1 | nmdc:mga00v17_68539_c1_1660_2088 | 142 |
| 755 | 3300050492 | nmdc:mga0yw44_679488_c1 | nmdc:mga0yw44_679488_c1_109_537 | 142 |
| 756 | 3300050492 | nmdc:mga0yw44_705968_c1 | nmdc:mga0yw44_705968_c1_45_473 | 142 |
| 757 | 3300050493 | nmdc:mga0k408_185190_c1 | nmdc:mga0k408_185190_c1_749_1177 | 142 |
| 758 | 3300050493 | nmdc:mga0k408_246592_c1 | nmdc:mga0k408_246592_c1_199_627 | 142 |
| 759 | 3300050493 | nmdc:mga0k408_289333_c1 | nmdc:mga0k408_289333_c1_60_488 | 142 |
| 760 | 3300050493 | nmdc:mga0k408_434785_c1 | nmdc:mga0k408_434785_c1_191_619 | 142 |
| 761 | 3300050493 | nmdc:mga0k408_69631_c1 | nmdc:mga0k408_69631_c1_1387_1815 | 142 |
| 762 | 3300050494 | nmdc:mga06z11_107501_c1 | nmdc:mga06z11_107501_c1_265_693 | 142 |
| 763 | 3300050495 | nmdc:mga04h51_34602_c1 | nmdc:mga04h51_34602_c1_1081_1509 | 142 |
| 764 | 3300050496 | nmdc:mga07m45_849866_c1 | nmdc:mga07m45_849866_c1_70_498 | 142 |
| 765 | 3300050509 | nmdc:mga0qj67_515225_c1 | nmdc:mga0qj67_515225_c1_297_725 | 142 |
| 766 | 3300050516 | nmdc:mga0sz30_449367_c1 | nmdc:mga0sz30_449367_c1_97_525 | 142 |
| 767 | 3300053088 | Ga0500644_0026473 | Ga0500644_0026473_517_945 | 142 |
| 768 | 3300053093 | Ga0500651_0015201 | Ga0500651_0015201_1567_1995 | 142 |
| 769 | 3300053094 | Ga0500566_0100837 | Ga0500566_0100837_18_446 | 142 |
| 770 | 3300053117 | Ga0500593_004570 | Ga0500593_004570_2487_2915 | 142 |
| 771 | 3300053129 | Ga0500628_002174 | Ga0500628_002174_2451_2879 | 142 |
| 772 | 3300053131 | Ga0500652_364739 | Ga0500652_364739_63_491 | 142 |
| 773 | 3300053153 | Ga0500616_0169504 | Ga0500616_0169504_65_493 | 142 |
| 774 | 3300053730 | Ga0500645_010500 | Ga0500645_010500_2257_2685 | 142 |
| 775 | 3300055283 | Ga0500661_010553 | Ga0500661_010553_1083_1511 | 142 |
| 776 | 3300059424 | Ga0590075_065430 | Ga0590075_065430_366_794 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.896 | 59 | 132 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8628 | 59 | 132 |
| 8pek-assembly1.cif.gz_B | structure of the dimeric, periplasmic domain of exbd | 0.7376 | 45 | 142 |
| 5by4-assembly1.cif.gz_A-2 | structure and function of the escherichia coli tol-pal stator protein tolr | 0.7295 | 55 | 135 |
| 4h5n-assembly1.cif.gz_A | hsc70 nbd with po4, na, cl | 0.7221 | 82 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8ILM5_15_201_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7863 | 96 | 134 | 3.30.420.40 |
| 2pfuA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7698 | 60 | 130 | 3.30.420.270 |
| 2pfuA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7439 | 60 | 130 | 3.30.420.270 |
| af_Q2G056_117_224_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7425 | 96 | 133 | 3.40.50.2020 |
| af_Q86IH8_5_206_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7391 | 82 | 139 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519M6W1-F1-model_v4 | Biopolymer transporter ExbD | 0.9637 | 67 | 141 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A4Q3Q352-F1-model_v4 | deleted | 0.9611 | 56 | 142 |
|
| AF-F3LFH7-F1-model_v4 | Biopolymer transport protein ExbD/TolR | 0.954 | 59 | 137 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A1Y5Q6K5-F1-model_v4 | Biopolymer transport protein ExbD/TolR | 0.9508 | 61 | 133 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A139DB72-F1-model_v4 | Biopolymer transport protein ExbD | 0.9484 | 59 | 137 |
GO:0005886
GO:0015031 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar