F480289

General Info

Members Datasets Scaffolds Average Seq Length
776 401 736 138

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1128315|Ga0006562J51391_11283152
Length 147
Sequence MSRGRMQFRHGARDEPEINLIPFIDVLLVILIFLMLSTTYSKFTEMQLRLPTADVDSQRDYPKEVIVAVSADGRYSINKKPVADRNVDTVAAALGAAATGGKDSVVIISADASSPHQAVITVMEAARRVGLVQITFAAQSSAQQAGH

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221658 Variovorax sp. Root411 Isolate Unclassified
9 2643221672 Variovorax sp. Root434 Isolate Unclassified
10 2643221683 Variovorax sp. Root473 Isolate Unclassified
11 2738541277 Variovorax sp. GV051 Isolate Unclassified
12 2738541307 Variovorax sp. GV008 Isolate Unclassified
13 2738543013 Variovorax sp. BT01 Isolate Unclassified
14 2738543019 Variovorax sp. GV040 Isolate Unclassified
15 2818991446 Variovorax sp. 1180 Isolate Unclassified
16 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
17 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
18 2842677519 Variovorax sp. R-72495 Isolate Unclassified
19 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
20 2885198086 Variovorax sp. 679 Isolate Unclassified
21 2885211737 Variovorax sp. 553 Isolate Unclassified
22 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
23 2899924645 Variovorax sp. 369 Isolate Unclassified
24 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
25 2904456579 Variovorax sp. 2002 Isolate Unclassified
26 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
27 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
28 2928037797 Variovorax sp. 1126 Isolate Unclassified
29 2928044640 Variovorax sp. 1128 Isolate Unclassified
30 2928051484 Variovorax sp. 1133 Isolate Unclassified
31 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
32 2928070936 Variovorax gossypii 1167 Isolate Unclassified
33 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
34 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
35 2929520902 Variovorax beijingensis 502 Isolate Unclassified
36 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
37 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
38 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
39 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
40 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
41 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
42 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
43 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
44 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
45 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
46 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
47 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
50 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
51 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
52 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
53 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
54 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
58 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
125 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
126 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
143 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
147 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
148 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
151 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
198 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
205 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
206 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
207 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
208 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
209 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
210 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
211 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
241 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
242 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
243 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
244 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
245 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
246 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
247 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
248 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
249 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
250 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
251 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
252 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
253 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
257 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
258 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
259 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
260 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
261 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
262 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
263 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
264 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
265 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
266 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
267 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
268 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
269 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
270 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
271 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
272 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
273 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
274 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
275 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
276 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
279 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
280 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
281 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
282 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
285 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
286 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
287 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
288 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
289 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
297 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
298 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
303 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
304 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
305 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
308 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
309 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
323 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
326 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
329 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
330 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
339 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
353 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
356 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
360 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
368 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
369 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
372 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
373 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
374 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
375 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
376 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
377 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
378 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
379 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
380 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
381 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
382 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
383 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
384 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
385 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
386 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
387 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
388 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
389 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
390 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
391 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
394 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
395 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
396 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
397 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
398 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
399 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
400 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 0.13
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.15
Nodule 1.42
Rhizoplane 1.29
Rhizosphere 54.25
Stem 0
Stem Tuber 0
Unclassified 8.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000002 3300002704 Bacteria 292156
2 JGI25156J39149_1000003 3300002705 Bacteria 305434
3 JGI25154J39366_1000009 3300002738 Bacteria 305408
4 JGI25158J39367_1002521 3300002739 Bacteria 2962
5 JGI25157J39369_1000002 3300002741 Bacteria 305434
6 JGI25150J39212_1001290 3300002774 Bacteria 7148
7 JGI25159J45721_1001861 3300002987 Bacteria 8437
8 JGI25159J45721_1002062 3300002987 Bacteria 7934
9 JGI25151J46595_10003617 3300003187 Bacteria 8453
10 JGI25151J46595_10010954 3300003187 Bacteria 4192
11 JGI25151J46595_10013500 3300003187 Bacteria 3673
12 JGI25151J46595_10016857 3300003187 Bacteria 3185
13 JGI25151J46595_10109725 3300003187 Bacteria 723
14 JGI25153J46596_10025433 3300003215 Bacteria 2115
15 rootH1_10020189 3300003316 Bacteria 3283
16 rootL2_10002429 3300003322 Bacteria 20561
17 JGI25160J50197_1000646 3300003354 Bacteria 19384
18 JGI25160J50197_1000712 3300003354 Bacteria 18321
19 JGI25161J50226_1000018 3300003374 Bacteria 172599
20 Ga0006562J51391_1128315 3300003578 Bacteria 5254
21 Ga0055535_1004635 3300003761 Bacteria 3268
22 Ga0055542_1000004 3300003762 Bacteria 553532
23 Ga0055526_1001518 3300003771 Bacteria 16425
24 Ga0055526_1010011 3300003771 Bacteria 4472
25 Ga0055526_1083266 3300003771 Bacteria 618
26 Ga0055537_1000611 3300003773 Bacteria 19655
27 Ga0055524_1000012 3300003775 Bacteria 260384
28 Ga0055524_1000467 3300003775 Bacteria 32384
29 Ga0055536_1000619 3300003781 Bacteria 24142
30 Ga0055536_1009081 3300003781 Bacteria 4176
31 Ga0055536_1009125 3300003781 Bacteria 4153
32 Ga0055534_1000566 3300003784 Bacteria 19542
33 Ga0055534_1012050 3300003784 Bacteria 1729
34 Ga0055528_1000925 3300003790 Bacteria 19615
35 Ga0055528_1000932 3300003790 Bacteria 19542
36 Ga0055530_10000258 3300003791 Bacteria 47803
37 Ga0055530_10000468 3300003791 Bacteria 35281
38 Ga0055530_10002096 3300003791 Bacteria 13321
39 Ga0055530_10002329 3300003791 Bacteria 12409
40 Ga0055530_10012755 3300003791 Bacteria 2910
41 Ga0055530_10095340 3300003791 Bacteria 604
42 Ga0055540_1000012 3300003792 Bacteria 262667
43 Ga0055540_1000023 3300003792 Bacteria 201131
44 Ga0055540_1001593 3300003792 Bacteria 13220
45 Ga0055540_1001668 3300003792 Bacteria 12860
46 Ga0055540_1002522 3300003792 Bacteria 9562
47 Ga0055540_1006194 3300003792 Bacteria 4809
48 Ga0055531_10000345 3300003794 Bacteria 45594
49 Ga0055531_10001882 3300003794 Bacteria 14698
50 Ga0055531_10002317 3300003794 Bacteria 12860
51 Ga0055531_10005462 3300003794 Bacteria 7439
52 Ga0055531_10021287 3300003794 Bacteria 2521
53 Ga0065165_1059631 3300005262 Bacteria 1049
54 Ga0070658_10106566 3300005327 Bacteria 2319
55 Ga0070658_10173078 3300005327 Bacteria 1814
56 Ga0070658_10674937 3300005327 Bacteria 897
57 Ga0070670_100028698 3300005331 Bacteria 4789
58 Ga0068869_100055267 3300005334 Bacteria 2893
59 Ga0068869_101867476 3300005334 Bacteria 538
60 Ga0070682_100204466 3300005337 Bacteria 1395
61 Ga0068868_100144468 3300005338 Bacteria 1955
62 Ga0070660_100131394 3300005339 Bacteria 2004
63 Ga0070660_100773559 3300005339 Bacteria 807
64 Ga0070661_100185938 3300005344 Bacteria 1583
65 Ga0070669_100087546 3300005353 Bacteria 2329
66 Ga0070674_100397772 3300005356 Bacteria 1125
67 Ga0070688_101108853 3300005365 Bacteria 633
68 Ga0070659_100426046 3300005366 Bacteria 1123
69 Ga0070714_100176236 3300005435 Bacteria 1943
70 Ga0070678_100056601 3300005456 Bacteria 2869
71 Ga0070678_100606613 3300005456 Bacteria 978
72 Ga0070678_100650034 3300005456 Bacteria 946
73 Ga0070678_100843089 3300005456 Bacteria 835
74 Ga0070662_100020121 3300005457 Bacteria 4541
75 Ga0070662_100164083 3300005457 Bacteria 1739
76 Ga0068867_100167155 3300005459 Bacteria 1739
77 Ga0070706_101733894 3300005467 Bacteria 568
78 Ga0070707_100183676 3300005468 Bacteria 2039
79 Ga0070679_100082648 3300005530 Bacteria 3201
80 Ga0068853_100385910 3300005539 Bacteria 1309
81 Ga0068853_101448525 3300005539 Bacteria 665
82 Ga0070672_101412440 3300005543 Bacteria 623
83 Ga0070665_100273590 3300005548 Bacteria 1691
84 Ga0070704_100479568 3300005549 Bacteria 1076
85 Ga0068855_100067747 3300005563 Bacteria 4157
86 Ga0068855_100083077 3300005563 Bacteria 3711
87 Ga0068855_100104421 3300005563 Bacteria 3259
88 Ga0068855_101370166 3300005563 Bacteria 730
89 Ga0068857_100025225 3300005577 Bacteria 5235
90 Ga0068857_100139774 3300005577 Bacteria 2188
91 Ga0068854_100981658 3300005578 Bacteria 747
92 Ga0068852_100236525 3300005616 Bacteria 1744
93 Ga0068852_100322503 3300005616 Bacteria 1501
94 Ga0068852_101573826 3300005616 Bacteria 680
95 Ga0068852_101718896 3300005616 Bacteria 650
96 Ga0068859_101024603 3300005617 Bacteria 907
97 Ga0068864_100612088 3300005618 Bacteria 1058
98 Ga0068861_100563512 3300005719 Bacteria 1040
99 Ga0068862_100071635 3300005844 Bacteria 2992
100 Ga0075365_10012495 3300006038 Bacteria 5046
101 Ga0075365_10063578 3300006038 Bacteria 2471
102 Ga0075365_10393583 3300006038 Bacteria 978
103 Ga0075368_10024851 3300006042 Bacteria 2296
104 Ga0075368_10207967 3300006042 Bacteria 829
105 Ga0075368_10389531 3300006042 Bacteria 611
106 Ga0075363_100008603 3300006048 Bacteria 4763
107 Ga0075363_100009940 3300006048 Bacteria 4492
108 Ga0075363_100020743 3300006048 Bacteria 3299
109 Ga0075363_100049966 3300006048 Bacteria 2228
110 Ga0075363_100195854 3300006048 Bacteria 1154
111 Ga0075364_10006278 3300006051 Bacteria 6974
112 Ga0075364_10039374 3300006051 Bacteria 3064
113 Ga0075432_10048247 3300006058 Bacteria 1498
114 Ga0075432_10057023 3300006058 Bacteria 1385
115 Ga0075362_10009304 3300006177 Bacteria 3795
116 Ga0075362_10015316 3300006177 Bacteria 3116
117 Ga0075362_10027540 3300006177 Bacteria 2434
118 Ga0075362_10073744 3300006177 Bacteria 1563
119 Ga0075362_10089551 3300006177 Bacteria 1427
120 Ga0075362_10337089 3300006177 Bacteria 753
121 Ga0075367_10006255 3300006178 Bacteria 6000
122 Ga0075367_10052314 3300006178 Bacteria 2417
123 Ga0075367_10080808 3300006178 Bacteria 1966
124 Ga0075367_10186701 3300006178 Bacteria 1293
125 Ga0075367_10220216 3300006178 Bacteria 1188
126 Ga0075366_10003789 3300006195 Bacteria 8042
127 Ga0075366_10005303 3300006195 Bacteria 6983
128 Ga0075366_10016348 3300006195 Bacteria 4264
129 Ga0075366_10042200 3300006195 Bacteria 2700
130 Ga0075366_10112588 3300006195 Bacteria 1638
131 Ga0075366_10308221 3300006195 Bacteria 969
132 Ga0075366_10423949 3300006195 Bacteria 820
133 Ga0075366_10618825 3300006195 Bacteria 671
134 Ga0097621_100103874 3300006237 Bacteria 2394
135 Ga0075370_10000113 3300006353 Bacteria 26281
136 Ga0075370_10009267 3300006353 Bacteria 5105
137 Ga0075370_10009814 3300006353 Bacteria 4988
138 Ga0075370_10018917 3300006353 Bacteria 3741
139 Ga0075370_10021624 3300006353 Bacteria 3524
140 Ga0075370_10110265 3300006353 Bacteria 1598
141 Ga0075370_10176749 3300006353 Bacteria 1256
142 Ga0075370_10324294 3300006353 Bacteria 918
143 Ga0075370_10449390 3300006353 Bacteria 775
144 Ga0075370_10548821 3300006353 Bacteria 699
145 Ga0075370_10878057 3300006353 Bacteria 548
146 Ga0068871_100539829 3300006358 Bacteria 1055
147 Ga0075430_100276481 3300006846 Bacteria 1390
148 Ga0068865_101165209 3300006881 Bacteria 681
149 Ga0097620_101024706 3300006931 Bacteria 907
150 Ga0079104_1019897 3300006946 Bacteria 1863
151 Ga0099826_10018478 3300006948 Bacteria 5259
152 Ga0099826_10092532 3300006948 Bacteria 1845
153 Ga0099826_10275347 3300006948 Bacteria 873
154 Ga0099826_10297222 3300006948 Bacteria 827
155 Ga0105244_10006312 3300009036 Bacteria 7711
156 Ga0105240_10010481 3300009093 Bacteria 13031
157 Ga0105240_10038655 3300009093 Bacteria 6119
158 Ga0105245_10082783 3300009098 Bacteria 2936
159 Ga0105247_11419583 3300009101 Bacteria 563
160 Ga0114129_10420441 3300009147 Bacteria 1758
161 Ga0105243_10003718 3300009148 Bacteria 12244
162 Ga0105243_10009907 3300009148 Bacteria 7245
163 Ga0105243_10029931 3300009148 Bacteria 4189
164 Ga0105243_10510460 3300009148 Bacteria 1141
165 Ga0105241_10403179 3300009174 Bacteria 1200
166 Ga0105241_10446187 3300009174 Bacteria 1144
167 Ga0105237_10000674 3300009545 Bacteria 47165
168 Ga0105238_10084714 3300009551 Bacteria 3159
169 Ga0105238_10316590 3300009551 Bacteria 1546
170 Ga0105238_10521004 3300009551 Bacteria 1191
171 Ga0105239_10002955 3300010375 Bacteria 21201
172 Ga0105239_10180443 3300010375 Bacteria 2362
173 Ga0105239_10260861 3300010375 Bacteria 1947
174 Ga0105246_10123184 3300011119 Bacteria 1924
175 Ga0157319_1000013 3300012497 Bacteria 154883
176 Ga0157319_1036266 3300012497 Bacteria 557
177 Ga0157347_1010744 3300012502 Bacteria 965
178 Ga0157326_1002747 3300012513 Bacteria 1868
179 Ga0157373_10022709 3300013100 Bacteria 4550
180 Ga0157373_10039138 3300013100 Bacteria 3395
181 Ga0157371_10143363 3300013102 Bacteria 1702
182 Ga0157370_11553642 3300013104 Bacteria 595
183 Ga0157369_10005311 3300013105 Bacteria 15014
184 Ga0163162_10195517 3300013306 Bacteria 2151
185 Ga0157372_10028520 3300013307 Bacteria 6092
186 Ga0157375_11297136 3300013308 Bacteria 856
187 Ga0157380_12224018 3300014326 Bacteria 612
188 Ga0182008_10002197 3300014497 Bacteria 12389
189 Ga0182008_10053615 3300014497 Bacteria 1996
190 Ga0182008_10095818 3300014497 Bacteria 1464
191 Ga0157376_10756312 3300014969 Bacteria 981
192 Ga0157376_11456896 3300014969 Bacteria 717
193 Ga0157376_11473096 3300014969 Bacteria 713
194 Ga0157376_12587425 3300014969 Bacteria 547
195 Ga0182006_1174856 3300015261 Bacteria 718
196 Ga0182007_10000693 3300015262 Bacteria 19235
197 Ga0182005_1015209 3300015265 Bacteria 2149
198 Ga0183362_10001 3300015683 Bacteria 2046624
199 Ga0163161_10010831 3300017792 Bacteria 6320
200 Ga0163161_10131504 3300017792 Bacteria 1888
201 Ga0163161_10163139 3300017792 Bacteria 1700
202 Ga0163161_10228194 3300017792 Bacteria 1444
203 Ga0163161_10486216 3300017792 Bacteria 1003
204 Ga0209435_100001 3300025206 Bacteria 1424171
205 Ga0209436_102515 3300025208 Bacteria 5463
206 Ga0209436_111482 3300025208 Bacteria 1553
207 Ga0209672_103149 3300025228 Bacteria 3547
208 Ga0209258_100022 3300025242 Bacteria 553584
209 Ga0207425_1000450 3300025245 Bacteria 26760
210 Ga0207425_1000784 3300025245 Bacteria 16242
211 Ga0207425_1002389 3300025245 Bacteria 6644
212 Ga0207425_1003947 3300025245 Bacteria 4576
213 Ga0207425_1064914 3300025245 Bacteria 636
214 Ga0209646_1000001 3300025246 Bacteria 3092932
215 Ga0209026_1000003 3300025250 Bacteria 1060571
216 Ga0209148_1000034 3300025254 Bacteria 553584
217 Ga0209759_1000001 3300025256 Bacteria 2799452
218 Ga0209129_1000023 3300025258 Bacteria 420646
219 Ga0209129_1000718 3300025258 Bacteria 21373
220 Ga0209129_1001139 3300025258 Bacteria 15365
221 Ga0209129_1003872 3300025258 Bacteria 6232
222 Ga0209565_1000004 3300025263 Bacteria 983150
223 Ga0209565_1000114 3300025263 Bacteria 116078
224 Ga0209565_1000187 3300025263 Bacteria 76001
225 Ga0209565_1000892 3300025263 Bacteria 16282
226 Ga0209565_1001739 3300025263 Bacteria 8889
227 Ga0209673_1000074 3300025273 Bacteria 233552
228 Ga0209673_1000389 3300025273 Bacteria 79243
229 Ga0209673_1001621 3300025273 Bacteria 19594
230 Ga0209673_1002302 3300025273 Bacteria 13581
231 Ga0209673_1003621 3300025273 Bacteria 8940
232 Ga0209673_1007069 3300025273 Bacteria 5265
233 Ga0209673_1039655 3300025273 Bacteria 1357
234 Ga0209130_1000050 3300025284 Bacteria 222092
235 Ga0209130_1000069 3300025284 Bacteria 179177
236 Ga0209130_1001070 3300025284 Bacteria 20605
237 Ga0209675_1000029 3300025291 Bacteria 281053
238 Ga0209675_1000044 3300025291 Bacteria 230392
239 Ga0209675_1000232 3300025291 Bacteria 56301
240 Ga0209675_1001699 3300025291 Bacteria 12181
241 Ga0209675_1002669 3300025291 Bacteria 8997
242 Ga0209675_1003844 3300025291 Bacteria 6927
243 Ga0209675_1010724 3300025291 Bacteria 3103
244 Ga0209675_1041451 3300025291 Bacteria 1004
245 Ga0209675_1086622 3300025291 Bacteria 572
246 Ga0209676_1000005 3300025292 Bacteria 1076001
247 Ga0209676_1000029 3300025292 Bacteria 520536
248 Ga0209676_1000139 3300025292 Bacteria 177886
249 Ga0209676_1001285 3300025292 Bacteria 25953
250 Ga0209676_1001530 3300025292 Bacteria 21006
251 Ga0209676_1032620 3300025292 Bacteria 1564
252 Ga0209676_1032923 3300025292 Bacteria 1551
253 Ga0209025_1000316 3300025294 Bacteria 107447
254 Ga0209025_1000435 3300025294 Bacteria 82663
255 Ga0209025_1001778 3300025294 Bacteria 25651
256 Ga0209025_1005176 3300025294 Bacteria 10786
257 Ga0209025_1005467 3300025294 Bacteria 10348
258 Ga0209025_1005773 3300025294 Bacteria 9927
259 Ga0209025_1017247 3300025294 Bacteria 4184
260 Ga0209025_1020498 3300025294 Bacteria 3614
261 Ga0209025_1026531 3300025294 Bacteria 2903
262 Ga0209025_1036670 3300025294 Bacteria 2191
263 Ga0209564_1000090 3300025295 Bacteria 249298
264 Ga0209564_1001399 3300025295 Bacteria 25052
265 Ga0209564_1001809 3300025295 Bacteria 19735
266 Ga0209564_1003288 3300025295 Bacteria 11240
267 Ga0209564_1025454 3300025295 Bacteria 1989
268 Ga0209758_1000044 3300025297 Bacteria 398448
269 Ga0209758_1003942 3300025297 Bacteria 12892
270 Ga0209758_1015794 3300025297 Bacteria 3883
271 Ga0209758_1062172 3300025297 Bacteria 1224
272 Ga0209050_1000003 3300025298 Bacteria 1609245
273 Ga0209050_1000007 3300025298 Bacteria 1187891
274 Ga0209050_1000748 3300025298 Bacteria 46763
275 Ga0209050_1003012 3300025298 Bacteria 13065
276 Ga0209050_1004127 3300025298 Bacteria 10092
277 Ga0209050_1006734 3300025298 Bacteria 6709
278 Ga0209256_1000001 3300025299 Bacteria 2166974
279 Ga0209256_1000020 3300025299 Bacteria 542402
280 Ga0209256_1000022 3300025299 Bacteria 481843
281 Ga0209256_1001137 3300025299 Bacteria 30308
282 Ga0209256_1084653 3300025299 Bacteria 686
283 Ga0207426_1000001 3300025302 Bacteria 1341301
284 Ga0207426_1000031 3300025302 Bacteria 460699
285 Ga0207426_1000071 3300025302 Bacteria 329539
286 Ga0207426_1003300 3300025302 Bacteria 8974
287 Ga0209051_1000003 3300025303 Bacteria 1609245
288 Ga0209051_1000036 3300025303 Bacteria 339863
289 Ga0209051_1000079 3300025303 Bacteria 201183
290 Ga0209051_1000254 3300025303 Bacteria 90411
291 Ga0209051_1000465 3300025303 Bacteria 53039
292 Ga0209051_1000893 3300025303 Bacteria 29873
293 Ga0209051_1001299 3300025303 Bacteria 21972
294 Ga0209051_1015793 3300025303 Bacteria 3458
295 Ga0209051_1016913 3300025303 Bacteria 3276
296 Ga0209257_1000011 3300025304 Bacteria 1112630
297 Ga0209257_1000012 3300025304 Bacteria 1111138
298 Ga0209257_1000018 3300025304 Bacteria 836016
299 Ga0209257_1000045 3300025304 Bacteria 484429
300 Ga0209257_1000137 3300025304 Bacteria 204210
301 Ga0209257_1000183 3300025304 Bacteria 156618
302 Ga0209257_1000226 3300025304 Bacteria 133836
303 Ga0209257_1001249 3300025304 Bacteria 31428
304 Ga0209257_1004427 3300025304 Bacteria 10890
305 Ga0209257_1008548 3300025304 Bacteria 5778
306 Ga0207656_10016315 3300025321 Bacteria 2891
307 Ga0207655_1003605 3300025728 Bacteria 11448
308 Ga0207688_10876460 3300025901 Bacteria 569
309 Ga0207705_10540466 3300025909 Bacteria 906
310 Ga0207654_10495471 3300025911 Bacteria 862
311 Ga0207695_10062014 3300025913 Bacteria 3862
312 Ga0207671_10005512 3300025914 Bacteria 11641
313 Ga0207671_10214669 3300025914 Bacteria 1506
314 Ga0207660_10122893 3300025917 Bacteria 1968
315 Ga0207662_11117314 3300025918 Bacteria 560
316 Ga0207657_10055016 3300025919 Bacteria 3438
317 Ga0207657_10254540 3300025919 Bacteria 1399
318 Ga0207657_10812388 3300025919 Bacteria 723
319 Ga0207652_10185118 3300025921 Bacteria 1872
320 Ga0207652_10330106 3300025921 Bacteria 1377
321 Ga0207646_10386937 3300025922 Bacteria 1263
322 Ga0207681_10881116 3300025923 Bacteria 749
323 Ga0207694_10102299 3300025924 Bacteria 2271
324 Ga0207694_10111475 3300025924 Bacteria 2177
325 Ga0207694_10725186 3300025924 Bacteria 839
326 Ga0207650_10037174 3300025925 Bacteria 3547
327 Ga0207659_10565480 3300025926 Bacteria 967
328 Ga0207706_10043459 3300025933 Bacteria 3982
329 Ga0207709_10000308 3300025935 Bacteria 53075
330 Ga0207709_10030909 3300025935 Bacteria 3121
331 Ga0207709_10052492 3300025935 Bacteria 2504
332 Ga0207689_10033336 3300025942 Bacteria 4281
333 Ga0207689_10226241 3300025942 Bacteria 1546
334 Ga0207679_11108630 3300025945 Bacteria 726
335 Ga0207667_10141437 3300025949 Bacteria 2477
336 Ga0207667_10157592 3300025949 Bacteria 2336
337 Ga0207667_10324139 3300025949 Bacteria 1573
338 Ga0207667_11618739 3300025949 Bacteria 616
339 Ga0207667_11833770 3300025949 Bacteria 570
340 Ga0207651_10907851 3300025960 Bacteria 785
341 Ga0207658_10609204 3300025986 Bacteria 982
342 Ga0207677_10002959 3300026023 Bacteria 8975
343 Ga0207639_10033887 3300026041 Bacteria 3770
344 Ga0207639_10198421 3300026041 Bacteria 1719
345 Ga0207639_10348015 3300026041 Bacteria 1323
346 Ga0207678_10428100 3300026067 Bacteria 1148
347 Ga0207702_10201192 3300026078 Bacteria 1846
348 Ga0207648_10241467 3300026089 Bacteria 1608
349 Ga0207648_10845603 3300026089 Bacteria 853
350 Ga0207676_10491917 3300026095 Bacteria 1163
351 Ga0207676_11703705 3300026095 Bacteria 629
352 Ga0207674_10056108 3300026116 Bacteria 4001
353 Ga0207683_10091578 3300026121 Bacteria 2709
354 Ga0207683_10283950 3300026121 Bacteria 1513
355 Ga0207683_10733956 3300026121 Bacteria 916
356 Ga0207698_10199379 3300026142 Bacteria 1791
357 Ga0207698_11992815 3300026142 Bacteria 595
358 Ga0209281_1022425 3300027111 Bacteria 1209
359 Ga0209281_1054133 3300027111 Bacteria 631
360 Ga0209371_1010706 3300027312 Bacteria 2791
361 Ga0209282_1003375 3300027666 Bacteria 9482
362 Ga0209282_1094424 3300027666 Bacteria 1557
363 Ga0207428_10506245 3300027907 Bacteria 877
364 Ga0268266_10780709 3300028379 Bacteria 922
365 Ga0268265_11250284 3300028380 Bacteria 741
366 Ga0307515_10000302 3300028794 Bacteria 121875
367 Ga0307515_10739565 3300028794 Bacteria 602
368 Ga0268256_1015926 3300030500 Bacteria 2174
369 Ga0316177_1035191 3300030731 Bacteria 934
370 Ga0316177_1176206 3300030731 Bacteria 6146
371 Ga0314311_1132537 3300030733 Bacteria 15305
372 Ga0316178_1047908 3300030735 Bacteria 3382
373 Ga0316180_1016115 3300030736 Bacteria 3132
374 Ga0316183_1064677 3300030742 Bacteria 5372
375 Ga0316181_1016216 3300030744 Bacteria 2719
376 Ga0316181_1021957 3300030744 Bacteria 1525
377 Ga0316182_1198643 3300030745 Bacteria 2835
378 Ga0316182_1334382 3300030745 Bacteria 717
379 Ga0265332_10072160 3300031238 Bacteria 1470
380 Ga0265327_10006337 3300031251 Bacteria 9495
381 Ga0307513_10000010 3300031456 Bacteria 360812
382 Ga0307513_10000014 3300031456 Bacteria 303157
383 Ga0307513_10468809 3300031456 Bacteria 981
384 Ga0307513_10499396 3300031456 Bacteria 934
385 Ga0307408_100015159 3300031548 Bacteria 5129
386 Ga0307408_100032886 3300031548 Bacteria 3619
387 Ga0307408_100066851 3300031548 Bacteria 2641
388 Ga0307408_100198861 3300031548 Bacteria 1620
389 Ga0307408_100428283 3300031548 Bacteria 1143
390 Ga0307408_100656913 3300031548 Bacteria 938
391 Ga0307408_100691912 3300031548 Bacteria 915
392 Ga0307408_101592707 3300031548 Bacteria 620
393 Ga0307514_10117701 3300031649 Bacteria 1863
394 Ga0265314_10004251 3300031711 Bacteria 13421
395 Ga0265342_10050409 3300031712 Bacteria 2487
396 Ga0307516_10278932 3300031730 Bacteria 1354
397 Ga0307405_10050523 3300031731 Bacteria 2575
398 Ga0307405_10051342 3300031731 Bacteria 2558
399 Ga0307405_10055618 3300031731 Bacteria 2477
400 Ga0307405_10130429 3300031731 Bacteria 1736
401 Ga0307405_10195113 3300031731 Bacteria 1465
402 Ga0307405_10271674 3300031731 Bacteria 1271
403 Ga0307405_10506738 3300031731 Bacteria 968
404 Ga0307405_10599211 3300031731 Bacteria 899
405 Ga0307405_10989762 3300031731 Bacteria 717
406 Ga0307405_12104729 3300031731 Bacteria 506
407 Ga0307413_10112493 3300031824 Bacteria 1825
408 Ga0307413_10252644 3300031824 Bacteria 1309
409 Ga0307413_10466580 3300031824 Bacteria 1006
410 Ga0307413_11230010 3300031824 Bacteria 652
411 Ga0307410_10323675 3300031852 Bacteria 1224
412 Ga0307406_10002299 3300031901 Bacteria 10392
413 Ga0307406_10045966 3300031901 Bacteria 2744
414 Ga0307406_10108712 3300031901 Bacteria 1904
415 Ga0307406_10187614 3300031901 Bacteria 1511
416 Ga0307407_10098207 3300031903 Bacteria 1811
417 Ga0307412_10036873 3300031911 Bacteria 3136
418 Ga0307412_10040382 3300031911 Bacteria 3018
419 Ga0307412_10053604 3300031911 Bacteria 2674
420 Ga0307412_10076369 3300031911 Bacteria 2301
421 Ga0307412_10366799 3300031911 Bacteria 1161
422 Ga0307412_11186928 3300031911 Bacteria 683
423 Ga0307416_100049797 3300032002 Bacteria 3334
424 Ga0307416_100136503 3300032002 Bacteria 2220
425 Ga0307416_100181970 3300032002 Bacteria 1971
426 Ga0307416_100624517 3300032002 Bacteria 1160
427 Ga0307416_100786033 3300032002 Bacteria 1047
428 Ga0307414_10030934 3300032004 Bacteria 3503
429 Ga0307414_10032160 3300032004 Bacteria 3451
430 Ga0307411_10223096 3300032005 Bacteria 1463
431 Ga0307411_10264246 3300032005 Bacteria 1361
432 Ga0307411_10365444 3300032005 Bacteria 1181
433 Ga0373959_0028276 3300034820 Bacteria 1119
434 Ga0373945_0428465 3300035116 Bacteria 583
435 Ga0373943_0667045 3300035170 Bacteria 615
436 Ga0373931_0063924 3300035691 Bacteria 1990
437 Ga0395899_0001547 3300037312 Bacteria 19420
438 Ga0395899_0042593 3300037312 Bacteria 3388
439 Ga0395899_0963912 3300037312 Bacteria 516
440 Ga0395900_0009467 3300037418 Bacteria 9985
441 Ga0395900_0022998 3300037418 Bacteria 6379
442 Ga0395900_0030213 3300037418 Bacteria 5562
443 Ga0395900_0060679 3300037418 Bacteria 3891
444 Ga0395900_0066823 3300037418 Bacteria 3695
445 Ga0395900_0289197 3300037418 Bacteria 1628
446 Ga0395898_0007975 3300037466 Bacteria 11234
447 Ga0395898_0011010 3300037466 Bacteria 9425
448 Ga0395898_0122345 3300037466 Bacteria 2493
449 Ga0395898_0146785 3300037466 Bacteria 2258
450 Ga0395905_0241054 3300037471 Bacteria 1689
451 Ga0395905_0611090 3300037471 Bacteria 992
452 Ga0395905_0662779 3300037471 Bacteria 945
453 Ga0395905_1281416 3300037471 Bacteria 636
454 Ga0395901_0044247 3300038443 Bacteria 4618
455 Ga0395901_0164134 3300038443 Bacteria 2332
456 Ga0395901_0270467 3300038443 Bacteria 1767
457 Ga0395901_0462240 3300038443 Bacteria 1297
458 Ga0436365_0464954 3300039437 Bacteria 682
459 Ga0439436_0000703 3300041404 Bacteria 9012
460 Ga0439436_0002187 3300041404 Bacteria 5850
461 Ga0439436_0003327 3300041404 Bacteria 4876
462 Ga0439436_0021925 3300041404 Bacteria 1895
463 Ga0439436_0055865 3300041404 Bacteria 1109
464 Ga0439438_025903 3300041405 Bacteria 1593
465 Ga0439438_043899 3300041405 Bacteria 1153
466 Ga0439439_0000471 3300041406 Bacteria 6900
467 Ga0439439_0061343 3300041406 Bacteria 998
468 Ga0439439_0141143 3300041406 Bacteria 680
469 Ga0439439_0206487 3300041406 Bacteria 572
470 Ga0439447_004982 3300041407 Bacteria 4481
471 Ga0439447_022525 3300041407 Bacteria 1648
472 Ga0439447_088262 3300041407 Bacteria 714
473 Ga0439461_0022993 3300041410 Bacteria 1252
474 Ga0439466_0002529 3300041411 Bacteria 7156
475 Ga0439466_0025336 3300041411 Bacteria 2071
476 Ga0439466_0026442 3300041411 Bacteria 2017
477 Ga0439465_0003784 3300041413 Bacteria 4934
478 Ga0451791_1555033 3300041451 Bacteria 2476
479 Ga0451793_1183457 3300041452 Bacteria 771
480 Ga0451800_1627045 3300041459 Bacteria 623
481 Ga0451804_0299013 3300041463 Bacteria 626
482 Ga0451833_0100439 3300041491 Bacteria 533
483 Ga0451839_0586664 3300041496 Bacteria 618
484 Ga0451841_0276797 3300041498 Bacteria 533
485 Ga0451851_0287117 3300041507 Bacteria 1810
486 Ga0451853_1870137 3300041512 Bacteria 2421
487 Ga0439431_0003175 3300041997 Bacteria 3614
488 Ga0439431_0040566 3300041997 Bacteria 1184
489 Ga0439433_0004619 3300041999 Bacteria 2959
490 Ga0439442_011963 3300042002 Bacteria 1771
491 Ga0439442_056858 3300042002 Bacteria 827
492 Ga0439445_0000164 3300042004 Bacteria 11799
493 Ga0439445_0024412 3300042004 Bacteria 1537
494 Ga0439445_0030456 3300042004 Bacteria 1398
495 Ga0439432_006112 3300042006 Bacteria 4311
496 Ga0439432_016051 3300042006 Bacteria 2523
497 Ga0439449_0000494 3300042007 Bacteria 14768
498 Ga0439449_0001318 3300042007 Bacteria 9731
499 Ga0439449_0004819 3300042007 Bacteria 5204
500 Ga0439449_0005691 3300042007 Bacteria 4764
501 Ga0439449_0031646 3300042007 Bacteria 1972
502 Ga0439449_0151734 3300042007 Bacteria 864
503 Ga0439449_0200805 3300042007 Bacteria 746
504 Ga0439452_001807 3300042010 Bacteria 8321
505 Ga0439452_002182 3300042010 Bacteria 7394
506 Ga0439454_003682 3300042011 Bacteria 1724
507 Ga0439457_001873 3300042014 Bacteria 6215
508 Ga0439457_052152 3300042014 Bacteria 919
509 Ga0439462_0018325 3300042015 Bacteria 1818
510 Ga0439462_0061596 3300042015 Bacteria 1016
511 Ga0450911_000596 3300042115 Bacteria 10991
512 Ga0450923_011411 3300042125 Bacteria 1596
513 Ga0450890_006957 3300042127 Bacteria 1443
514 Ga0450894_008192 3300042131 Bacteria 1350
515 Ga0450896_003203 3300042133 Bacteria 2163
516 Ga0450898_005252 3300042134 Bacteria 1950
517 Ga0450903_025585 3300042138 Bacteria 902
518 Ga0450904_007394 3300042139 Bacteria 1091
519 Ga0450906_003663 3300042145 Bacteria 3275
520 Ga0450906_074638 3300042145 Bacteria 609
521 Ga0439446_0021931 3300042156 Bacteria 1807
522 Ga0439446_0029977 3300042156 Bacteria 1571
523 Ga0439446_0153374 3300042156 Bacteria 759
524 Ga0439446_0351384 3300042156 Bacteria 525
525 Ga0450908_008165 3300042184 Bacteria 1964
526 Ga0450909_005276 3300042185 Bacteria 1860
527 Ga0450909_057895 3300042185 Bacteria 610
528 Ga0439434_0007410 3300042435 Bacteria 3216
529 Ga0439434_0288955 3300042435 Bacteria 565
530 Ga0439434_0342747 3300042435 Bacteria 521
531 Ga0439459_0000926 3300042438 Bacteria 4131
532 Ga0439459_0042973 3300042438 Bacteria 967
533 Ga0439459_0074146 3300042438 Bacteria 792
534 Ga0439464_0044365 3300042439 Bacteria 1273
535 Ga0450916_011556 3300042530 Bacteria 1117
536 Ga0450918_002734 3300042531 Bacteria 3307
537 Ga0450893_0012894 3300042532 Bacteria 1390
538 Ga0451577_0038579 3300042876 Bacteria 4296
539 Ga0451577_0058241 3300042876 Bacteria 3444
540 Ga0451577_1522291 3300042876 Bacteria 591
541 Ga0466969_0067571 3300044656 Bacteria 1724
542 Ga0466972_0278698 3300044658 Bacteria 781
543 Ga0453683_0003078 3300044673 Bacteria 12483
544 Ga0453683_0143784 3300044673 Bacteria 1506
545 Ga0466965_0388479 3300044683 Bacteria 769
546 Ga0466965_0506621 3300044683 Bacteria 677
547 Ga0466966_0176873 3300044684 Bacteria 1296
548 Ga0466966_0184178 3300044684 Bacteria 1266
549 Ga0466966_0614160 3300044684 Bacteria 655
550 Ga0466966_0631318 3300044684 Bacteria 645
551 Ga0466961_0005995 3300044693 Bacteria 7705
552 Ga0466961_0209177 3300044693 Bacteria 1205
553 Ga0466961_0222455 3300044693 Bacteria 1163
554 Ga0453684_0067284 3300044712 Bacteria 4556
555 Ga0453684_0881546 3300044712 Bacteria 959
556 Ga0453684_1431954 3300044712 Bacteria 715
557 Ga0466971_0250930 3300044719 Bacteria 843
558 Ga0466970_0107076 3300044765 Bacteria 1525
559 Ga0466970_0598210 3300044765 Bacteria 640
560 Ga0466957_0404582 3300044842 Bacteria 934
561 Ga0466957_0946927 3300044842 Bacteria 617
562 Ga0466957_1191610 3300044842 Bacteria 551
563 Ga0466959_0069510 3300045049 Bacteria 2551
564 Ga0451576_0008679 3300045051 Bacteria 11898
565 Ga0451576_0029573 3300045051 Bacteria 5861
566 Ga0451576_0105315 3300045051 Bacteria 2934
567 Ga0451576_0152880 3300045051 Bacteria 2407
568 Ga0466958_0254045 3300045836 Bacteria 1125
569 Ga0466958_0338814 3300045836 Bacteria 967
570 Ga0466967_0190524 3300045976 Bacteria 1938
571 Ga0495627_004217 3300046453 Bacteria 6082
572 Ga0495627_006704 3300046453 Bacteria 4484
573 Ga0495603_0654898 3300046455 Bacteria 601
574 Ga0495629_1111997 3300046459 Bacteria 510
575 Ga0495638_0092798 3300046460 Bacteria 1817
576 Ga0495610_0011592 3300046512 Bacteria 5376
577 Ga0495616_0002621 3300046513 Bacteria 11835
578 Ga0495620_0004869 3300046515 Bacteria 7533
579 Ga0495620_0228380 3300046515 Bacteria 711
580 Ga0495631_0000568 3300046518 Bacteria 24838
581 Ga0495637_0004150 3300046520 Bacteria 7543
582 Ga0495654_0261347 3300046530 Bacteria 717
583 Ga0495609_0070233 3300046538 Bacteria 1540
584 Ga0495621_0010004 3300046539 Bacteria 2894
585 Ga0495621_0060472 3300046539 Bacteria 1374
586 Ga0495633_0450493 3300046558 Bacteria 581
587 Ga0495633_0585553 3300046558 Bacteria 502
588 Ga0495656_0002985 3300046615 Bacteria 5681
589 Ga0495656_0024993 3300046615 Bacteria 2364
590 Ga0495668_0023820 3300046616 Bacteria 3487
591 Ga0495625_0002531 3300046660 Bacteria 19661
592 Ga0495635_0634580 3300046663 Bacteria 696
593 Ga0495588_0042065 3300046674 Bacteria 2335
594 Ga0495588_0115079 3300046674 Bacteria 1417
595 Ga0495658_0316311 3300046683 Bacteria 989
596 Ga0495669_0086357 3300046684 Bacteria 1445
597 Ga0495624_0274690 3300046690 Bacteria 1018
598 Ga0495670_0044540 3300046691 Bacteria 2215
599 Ga0495671_0001939 3300046692 Bacteria 13265
600 Ga0495600_0315275 3300046809 Bacteria 984
601 Ga0495660_0222956 3300046810 Bacteria 888
602 Ga0495636_0323965 3300047318 Bacteria 724
603 Ga0495676_0116290 3300047321 Bacteria 1953
604 Ga0495677_0040587 3300047445 Bacteria 1702
605 Ga0495681_0297021 3300047470 Bacteria 626
606 Ga0495602_0312107 3300048088 Bacteria 1147
607 Ga0495614_0072540 3300048089 Bacteria 1485
608 Ga0495615_0010655 3300048090 Bacteria 1845
609 Ga0496101_0002740 3300048904 Bacteria 10817
610 Ga0496108_0082018 3300048911 Bacteria 2734
611 Ga0496112_0181104 3300048915 Bacteria 2071
612 Ga0496116_0052800 3300048919 Bacteria 2689
613 Ga0496116_0355266 3300048919 Bacteria 669
614 Ga0496117_0020913 3300048920 Bacteria 5320
615 Ga0496117_0028486 3300048920 Bacteria 4324
616 Ga0496118_0015348 3300048921 Bacteria 7096
617 Ga0496118_0038026 3300048921 Bacteria 3863
618 Ga0496119_0135986 3300048922 Bacteria 1333
619 Ga0496121_0467566 3300048924 Bacteria 808
620 Ga0496122_0002359 3300048925 Bacteria 27157
621 Ga0496122_0021111 3300048925 Bacteria 5845
622 Ga0496122_0041912 3300048925 Bacteria 3610
623 Ga0496123_0000108 3300048926 Bacteria 166102
624 Ga0496123_0075695 3300048926 Bacteria 2076
625 Ga0496123_0080102 3300048926 Bacteria 1992
626 Ga0496123_0333285 3300048926 Bacteria 712
627 Ga0496124_0088091 3300048927 Bacteria 2538
628 Ga0496124_0114436 3300048927 Bacteria 2166
629 Ga0496125_0003980 3300048928 Bacteria 17384
630 Ga0496125_0022083 3300048928 Bacteria 5916
631 Ga0496125_0047676 3300048928 Bacteria 3580
632 Ga0496125_0149459 3300048928 Bacteria 1607
633 Ga0496126_0167849 3300048929 Bacteria 1872
634 Ga0496126_0399063 3300048929 Bacteria 1116
635 Ga0501031_0042512 3300049568 Bacteria 2966
636 Ga0501032_0117606 3300049569 Bacteria 1758
637 Ga0501034_0056036 3300049571 Bacteria 3967
638 Ga0501034_0220904 3300049571 Bacteria 1847
639 Ga0501038_0151237 3300049574 Bacteria 1892
640 Ga0501042_0826001 3300049578 Bacteria 675
641 Ga0501043_0074622 3300049579 Bacteria 2664
642 Ga0501046_0045717 3300049580 Bacteria 3477
643 Ga0501047_0031795 3300049581 Bacteria 5091
644 Ga0501073_0061270 3300049589 Bacteria 2626
645 Ga0501249_051157 3300049679 Bacteria 948
646 Ga0501249_134923 3300049679 Bacteria 611
647 Ga0501225_0188798 3300049705 Bacteria 648
648 Ga0501080_0012035 3300049742 Bacteria 7925
649 Ga0501262_000560 3300049759 Bacteria 4440
650 Ga0501270_159532 3300049767 Bacteria 520
651 Ga0501035_0085966 3300049822 Bacteria 2771
652 Ga0501035_0361986 3300049822 Bacteria 1212
653 Ga0501044_0042090 3300049823 Bacteria 4754
654 Ga0501044_1447177 3300049823 Bacteria 552
655 nmdc:mga03683_109941_c1 3300050489 Bacteria 1218
656 nmdc:mga03683_12001_c1 3300050489 Bacteria 3152
657 nmdc:mga03n38_11720_c1 3300050490 Bacteria 2505
658 nmdc:mga03n38_127693_c1 3300050490 Bacteria 1257
659 nmdc:mga03n38_400297_c1 3300050490 Bacteria 756
660 nmdc:mga03n38_45822_c1 3300050490 Bacteria 1928
661 nmdc:mga03n38_497101_c1 3300050490 Bacteria 684
662 nmdc:mga00v17_6700_c1 3300050491 Bacteria 6120
663 nmdc:mga00v17_68539_c1 3300050491 Bacteria 2193
664 nmdc:mga0yw44_28590_c1 3300050492 Bacteria 3209
665 nmdc:mga0yw44_679488_c1 3300050492 Bacteria 700
666 nmdc:mga0yw44_705968_c1 3300050492 Bacteria 685
667 nmdc:mga0k408_11586_c1 3300050493 Bacteria 4805
668 nmdc:mga0k408_128324_c1 3300050493 Bacteria 1505
669 nmdc:mga0k408_185190_c1 3300050493 Bacteria 1242
670 nmdc:mga0k408_246592_c1 3300050493 Bacteria 1067
671 nmdc:mga0k408_289333_c1 3300050493 Bacteria 978
672 nmdc:mga0k408_3613_c1 3300050493 Bacteria 8180
673 nmdc:mga0k408_37524_c1 3300050493 Bacteria 943
674 nmdc:mga0k408_434785_c1 3300050493 Bacteria 780
675 nmdc:mga0k408_69631_c1 3300050493 Bacteria 2053
676 nmdc:mga06z11_107501_c1 3300050494 Bacteria 1540
677 nmdc:mga06z11_40536_c1 3300050494 Bacteria 2324
678 nmdc:mga06z11_71013_c1 3300050494 Bacteria 1842
679 nmdc:mga04h51_34602_c1 3300050495 Bacteria 1614
680 nmdc:mga07m45_1691_c1 3300050496 Bacteria 10143
681 nmdc:mga07m45_20413_c1 3300050496 Bacteria 3598
682 nmdc:mga07m45_272_c1 3300050496 Bacteria 20977
683 nmdc:mga07m45_36337_c1 3300050496 Bacteria 2743
684 nmdc:mga07m45_597_c2 3300050496 Bacteria 11502
685 nmdc:mga07m45_65458_c1 3300050496 Bacteria 2064
686 nmdc:mga07m45_7411_c1 3300050496 Bacteria 5607
687 nmdc:mga07m45_849866_c1 3300050496 Bacteria 522
688 nmdc:mga0qj67_515225_c1 3300050509 Bacteria 961
689 nmdc:mga0sz30_449367_c1 3300050516 Bacteria 578
690 nmdc:mga0sz30_77922_c1 3300050516 Bacteria 1432
691 Ga0500610_0009345 3300053079 Bacteria 4339
692 Ga0500610_0050716 3300053079 Bacteria 2159
693 Ga0495619_1175273 3300053085 Bacteria 509
694 Ga0500643_003384 3300053087 Bacteria 7710
695 Ga0500644_0026473 3300053088 Bacteria 1795
696 Ga0500644_0271875 3300053088 Bacteria 719
697 Ga0500651_0005180 3300053093 Bacteria 7418
698 Ga0500651_0015201 3300053093 Bacteria 4721
699 Ga0500566_0046267 3300053094 Bacteria 2501
700 Ga0500566_0100837 3300053094 Bacteria 1583
701 Ga0500562_011537 3300053108 Bacteria 2243
702 Ga0500571_000362 3300053110 Bacteria 17940
703 Ga0500572_099449 3300053111 Bacteria 929
704 Ga0500593_000566 3300053117 Bacteria 14276
705 Ga0500593_004570 3300053117 Bacteria 5378
706 Ga0500593_009718 3300053117 Bacteria 4006
707 Ga0500594_0001381 3300053118 Bacteria 5265
708 Ga0500595_070601 3300053119 Bacteria 1037
709 Ga0500607_001562 3300053121 Bacteria 20266
710 Ga0500607_033472 3300053121 Bacteria 2816
711 Ga0500608_001521 3300053122 Bacteria 8295
712 Ga0500608_038569 3300053122 Bacteria 2286
713 Ga0500626_017642 3300053128 Bacteria 3140
714 Ga0500628_002174 3300053129 Bacteria 3270
715 Ga0500652_364739 3300053131 Bacteria 543
716 Ga0500655_000498 3300053133 Bacteria 7923
717 Ga0500658_0000990 3300053134 Bacteria 11609
718 Ga0500658_0002589 3300053134 Bacteria 6994
719 Ga0500659_0240320 3300053135 Bacteria 846
720 Ga0500559_0001129 3300053136 Bacteria 16078
721 Ga0500559_0034466 3300053136 Bacteria 2183
722 Ga0500564_032919 3300053138 Bacteria 2392
723 Ga0500568_0007553 3300053139 Bacteria 5319
724 Ga0500616_0027696 3300053153 Bacteria 3128
725 Ga0500616_0049584 3300053153 Bacteria 2220
726 Ga0500616_0169504 3300053153 Bacteria 993
727 Ga0500622_0299524 3300053156 Bacteria 686
728 Ga0500627_0093608 3300053158 Bacteria 1345
729 Ga0500634_0023483 3300053161 Bacteria 3351
730 Ga0500638_030462 3300053162 Bacteria 2598
731 Ga0500625_054278 3300053729 Bacteria 1841
732 Ga0500645_010500 3300053730 Bacteria 3059
733 Ga0500661_010553 3300055283 Bacteria 1681
734 Ga0590075_006706 3300059424 Bacteria 2728
735 Ga0590075_065430 3300059424 Bacteria 938
736 Ga0501082_0936442 3300060353 Bacteria 758

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0107076 Ga0466970_0107076_1175_1513 112
2 3300005456 Ga0070678_100606613 Ga0070678_1006066132 115
3 3300025901 Ga0207688_10876460 Ga0207688_108764601 115
4 3300025923 Ga0207681_10881116 Ga0207681_108811162 115
5 3300026089 Ga0207648_10845603 Ga0207648_108456031 115
6 3300026121 Ga0207683_10733956 Ga0207683_107339562 115
7 3300031911 Ga0307412_10053604 Ga0307412_100536043 115
8 3300017792 Ga0163161_10163139 Ga0163161_101631392 116
9 3300025291 Ga0209675_1001699 Ga0209675_100169911 117
10 3300025292 Ga0209676_1032923 Ga0209676_10329231 117
11 3300025294 Ga0209025_1026531 Ga0209025_10265313 117
12 3300025303 Ga0209051_1015793 Ga0209051_10157932 117
13 3300025304 Ga0209257_1008548 Ga0209257_10085488 117
14 3300053136 Ga0500559_0001129 Ga0500559_0001129_5822_6259 118
15 3300005456 Ga0070678_100056601 Ga0070678_1000566012 119
16 3300005539 Ga0068853_100385910 Ga0068853_1003859102 119
17 3300009093 Ga0105240_10038655 Ga0105240_100386554 119
18 3300009174 Ga0105241_10446187 Ga0105241_104461872 119
19 3300009545 Ga0105237_10000674 Ga0105237_1000067439 119
20 3300009551 Ga0105238_10084714 Ga0105238_100847142 119
21 3300010375 Ga0105239_10002955 Ga0105239_1000295512 119
22 3300025913 Ga0207695_10062014 Ga0207695_100620144 119
23 3300025914 Ga0207671_10005512 Ga0207671_100055126 119
24 3300025924 Ga0207694_10102299 Ga0207694_101022993 119
25 3300026041 Ga0207639_10348015 Ga0207639_103480152 119
26 3300026121 Ga0207683_10091578 Ga0207683_100915783 119
27 3300048928 Ga0496125_0047676 Ga0496125_0047676_1330_1758 119
28 3300026041 Ga0207639_10033887 Ga0207639_100338874 120
29 3300048920 Ga0496117_0028486 Ga0496117_0028486_1540_1980 120
30 3300048921 Ga0496118_0015348 Ga0496118_0015348_4383_4823 120
31 3300048925 Ga0496122_0041912 Ga0496122_0041912_527_967 120
32 3300048926 Ga0496123_0333285 Ga0496123_0333285_52_477 120
33 3300048928 Ga0496125_0022083 Ga0496125_0022083_4418_4858 120
34 3300025914 Ga0207671_10214669 Ga0207671_102146692 121
35 3300031824 Ga0307413_10252644 Ga0307413_102526442 121
36 3300042007 Ga0439449_0151734 Ga0439449_0151734_150_575 121
37 3300003187 JGI25151J46595_10016857 JGI25151J46595_100168572 122
38 3300003791 Ga0055530_10000258 Ga0055530_1000025816 122
39 3300003792 Ga0055540_1000023 Ga0055540_100002383 122
40 3300003794 Ga0055531_10005462 Ga0055531_100054627 122
41 3300005339 Ga0070660_100773559 Ga0070660_1007735592 122
42 3300005344 Ga0070661_100185938 Ga0070661_1001859381 122
43 3300005457 Ga0070662_100164083 Ga0070662_1001640833 122
44 3300005563 Ga0068855_100083077 Ga0068855_1000830775 122
45 3300005577 Ga0068857_100139774 Ga0068857_1001397742 122
46 3300005616 Ga0068852_100236525 Ga0068852_1002365252 122
47 3300005616 Ga0068852_100322503 Ga0068852_1003225032 122
48 3300006237 Ga0097621_100103874 Ga0097621_1001038742 122
49 3300006353 Ga0075370_10449390 Ga0075370_104493901 122
50 3300009036 Ga0105244_10006312 Ga0105244_100063124 122
51 3300009098 Ga0105245_10082783 Ga0105245_100827835 122
52 3300009148 Ga0105243_10003718 Ga0105243_1000371812 122
53 3300011119 Ga0105246_10123184 Ga0105246_101231841 122
54 3300013100 Ga0157373_10039138 Ga0157373_100391382 122
55 3300013102 Ga0157371_10143363 Ga0157371_101433633 122
56 3300013104 Ga0157370_11553642 Ga0157370_115536421 122
57 3300013105 Ga0157369_10005311 Ga0157369_1000531117 122
58 3300014497 Ga0182008_10002197 Ga0182008_100021974 122
59 3300015262 Ga0182007_10000693 Ga0182007_1000069319 122
60 3300015265 Ga0182005_1015209 Ga0182005_10152094 122
61 3300025298 Ga0209050_1000748 Ga0209050_100074822 122
62 3300025303 Ga0209051_1000079 Ga0209051_1000079104 122
63 3300025304 Ga0209257_1000183 Ga0209257_100018362 122
64 3300025919 Ga0207657_10254540 Ga0207657_102545402 122
65 3300025935 Ga0207709_10030909 Ga0207709_100309092 122
66 3300025945 Ga0207679_11108630 Ga0207679_111086302 122
67 3300025949 Ga0207667_10157592 Ga0207667_101575922 122
68 3300025949 Ga0207667_11618739 Ga0207667_116187391 122
69 3300026067 Ga0207678_10428100 Ga0207678_104281002 122
70 3300026116 Ga0207674_10056108 Ga0207674_100561082 122
71 3300026142 Ga0207698_10199379 Ga0207698_101993792 122
72 3300048920 Ga0496117_0020913 Ga0496117_0020913_1977_2417 122
73 3300048921 Ga0496118_0038026 Ga0496118_0038026_2575_3015 122
74 3300048928 Ga0496125_0149459 Ga0496125_0149459_760_1200 122
75 3300050496 nmdc:mga07m45_1691_c1 nmdc:mga07m45_1691_c1_787_1227 122
76 3300003781 Ga0055536_1009125 Ga0055536_10091254 123
77 3300003791 Ga0055530_10012755 Ga0055530_100127552 123
78 3300003792 Ga0055540_1001668 Ga0055540_10016684 123
79 3300003794 Ga0055531_10002317 Ga0055531_1000231712 123
80 3300006048 Ga0075363_100020743 Ga0075363_1000207432 123
81 3300006178 Ga0075367_10052314 Ga0075367_100523142 123
82 3300006195 Ga0075366_10005303 Ga0075366_1000530310 123
83 3300006353 Ga0075370_10021624 Ga0075370_100216244 123
84 3300025292 Ga0209676_1001285 Ga0209676_100128526 123
85 3300025298 Ga0209050_1004127 Ga0209050_10041274 123
86 3300025303 Ga0209051_1000893 Ga0209051_100089326 123
87 3300025304 Ga0209257_1000226 Ga0209257_100022626 123
88 3300042133 Ga0450896_003203 Ga0450896_003203_1169_1558 123
89 3300046453 Ga0495627_004217 Ga0495627_004217_1676_2116 123
90 3300046674 Ga0495588_0115079 Ga0495588_0115079_647_1072 123
91 3300048925 Ga0496122_0021111 Ga0496122_0021111_701_1141 123
92 3300048926 Ga0496123_0080102 Ga0496123_0080102_605_1045 123
93 3300050490 nmdc:mga03n38_127693_c1 nmdc:mga03n38_127693_c1_534_959 123
94 3300050493 nmdc:mga0k408_128324_c1 nmdc:mga0k408_128324_c1_596_1021 123
95 3300050496 nmdc:mga07m45_20413_c1 nmdc:mga07m45_20413_c1_2112_2537 123
96 3300005356 Ga0070674_100397772 Ga0070674_1003977722 124
97 3300005543 Ga0070672_101412440 Ga0070672_1014124402 124
98 3300014969 Ga0157376_11473096 Ga0157376_114730962 124
99 3300025926 Ga0207659_10565480 Ga0207659_105654802 124
100 3300046539 Ga0495621_0010004 Ga0495621_0010004_1678_2103 124
101 3300046615 Ga0495656_0002985 Ga0495656_0002985_432_857 124
102 3300048090 Ga0495615_0010655 Ga0495615_0010655_1272_1697 124
103 3300053156 Ga0500622_0299524 Ga0500622_0299524_59_481 124
104 3300010375 Ga0105239_10260861 Ga0105239_102608613 126
105 3300017792 Ga0163161_10228194 Ga0163161_102281942 126
106 3300025728 Ga0207655_1003605 Ga0207655_100360511 126
107 3300025924 Ga0207694_10111475 Ga0207694_101114752 126
108 3300031251 Ga0265327_10006337 Ga0265327_100063376 126
109 3300045051 Ga0451576_0152880 Ga0451576_0152880_1320_1748 126
110 3300048929 Ga0496126_0399063 Ga0496126_0399063_241_681 126
111 3300053128 Ga0500626_017642 Ga0500626_017642_1319_1759 126
112 3300053136 Ga0500559_0034466 Ga0500559_0034466_1675_2115 126
113 3300002739 JGI25158J39367_1002521 JGI25158J39367_10025214 127
114 3300002774 JGI25150J39212_1001290 JGI25150J39212_10012907 127
115 3300003215 JGI25153J46596_10025433 JGI25153J46596_100254333 127
116 3300003761 Ga0055535_1004635 Ga0055535_10046354 127
117 3300003762 Ga0055542_1000004 Ga0055542_10000044 127
118 3300003781 Ga0055536_1000619 Ga0055536_100061921 127
119 3300003781 Ga0055536_1009081 Ga0055536_10090813 127
120 3300003784 Ga0055534_1012050 Ga0055534_10120502 127
121 3300003791 Ga0055530_10000468 Ga0055530_1000046820 127
122 3300003792 Ga0055540_1002522 Ga0055540_100252210 127
123 3300005457 Ga0070662_100020121 Ga0070662_1000201212 127
124 3300005617 Ga0068859_101024603 Ga0068859_1010246032 127
125 3300006931 Ga0097620_101024706 Ga0097620_1010247062 127
126 3300009148 Ga0105243_10009907 Ga0105243_100099077 127
127 3300013307 Ga0157372_10028520 Ga0157372_100285206 127
128 3300017792 Ga0163161_10131504 Ga0163161_101315042 127
129 3300025208 Ga0209436_111482 Ga0209436_1114822 127
130 3300025228 Ga0209672_103149 Ga0209672_1031493 127
131 3300025242 Ga0209258_100022 Ga0209258_1000224 127
132 3300025245 Ga0207425_1000450 Ga0207425_100045026 127
133 3300025245 Ga0207425_1003947 Ga0207425_10039474 127
134 3300025254 Ga0209148_1000034 Ga0209148_10000344 127
135 3300025258 Ga0209129_1000023 Ga0209129_100002382 127
136 3300025258 Ga0209129_1001139 Ga0209129_100113911 127
137 3300025258 Ga0209129_1003872 Ga0209129_10038724 127
138 3300025263 Ga0209565_1000187 Ga0209565_100018760 127
139 3300025263 Ga0209565_1001739 Ga0209565_10017394 127
140 3300025273 Ga0209673_1000389 Ga0209673_100038960 127
141 3300025273 Ga0209673_1003621 Ga0209673_10036219 127
142 3300025284 Ga0209130_1000069 Ga0209130_100006985 127
143 3300025291 Ga0209675_1000232 Ga0209675_100023244 127
144 3300025291 Ga0209675_1002669 Ga0209675_10026694 127
145 3300025292 Ga0209676_1000005 Ga0209676_1000005719 127
146 3300025292 Ga0209676_1000139 Ga0209676_1000139151 127
147 3300025294 Ga0209025_1000316 Ga0209025_100031625 127
148 3300025294 Ga0209025_1005467 Ga0209025_10054674 127
149 3300025295 Ga0209564_1000090 Ga0209564_1000090212 127
150 3300025295 Ga0209564_1003288 Ga0209564_10032884 127
151 3300025297 Ga0209758_1000044 Ga0209758_1000044351 127
152 3300025297 Ga0209758_1003942 Ga0209758_10039427 127
153 3300025298 Ga0209050_1000007 Ga0209050_1000007378 127
154 3300025299 Ga0209256_1000020 Ga0209256_1000020354 127
155 3300025299 Ga0209256_1000022 Ga0209256_100002281 127
156 3300025302 Ga0207426_1000001 Ga0207426_1000001989 127
157 3300025302 Ga0207426_1000031 Ga0207426_1000031237 127
158 3300025303 Ga0209051_1000036 Ga0209051_100003670 127
159 3300025303 Ga0209051_1001299 Ga0209051_10012999 127
160 3300025304 Ga0209257_1000011 Ga0209257_1000011693 127
161 3300025304 Ga0209257_1004427 Ga0209257_10044277 127
162 3300025321 Ga0207656_10016315 Ga0207656_100163153 127
163 3300025933 Ga0207706_10043459 Ga0207706_100434593 127
164 3300025935 Ga0207709_10000308 Ga0207709_1000030848 127
165 3300025986 Ga0207658_10609204 Ga0207658_106092042 127
166 3300031731 Ga0307405_10055618 Ga0307405_100556184 127
167 3300031731 Ga0307405_10130429 Ga0307405_101304292 127
168 3300046459 Ga0495629_1111997 Ga0495629_1111997_74_499 127
169 3300046460 Ga0495638_0092798 Ga0495638_0092798_1127_1567 127
170 3300046512 Ga0495610_0011592 Ga0495610_0011592_3033_3473 127
171 3300046513 Ga0495616_0002621 Ga0495616_0002621_10812_11252 127
172 3300046515 Ga0495620_0228380 Ga0495620_0228380_49_489 127
173 3300046518 Ga0495631_0000568 Ga0495631_0000568_10765_11205 127
174 3300046530 Ga0495654_0261347 Ga0495654_0261347_225_665 127
175 3300046616 Ga0495668_0023820 Ga0495668_0023820_41_481 127
176 3300046683 Ga0495658_0316311 Ga0495658_0316311_364_804 127
177 3300046690 Ga0495624_0274690 Ga0495624_0274690_492_932 127
178 3300047321 Ga0495676_0116290 Ga0495676_0116290_1366_1806 127
179 3300048088 Ga0495602_0312107 Ga0495602_0312107_553_978 127
180 3300048089 Ga0495614_0072540 Ga0495614_0072540_198_638 127
181 3300048904 Ga0496101_0002740 Ga0496101_0002740_562_1002 127
182 3300048922 Ga0496119_0135986 Ga0496119_0135986_729_1169 127
183 3300048924 Ga0496121_0467566 Ga0496121_0467566_328_768 127
184 3300048926 Ga0496123_0075695 Ga0496123_0075695_392_832 127
185 3300053087 Ga0500643_003384 Ga0500643_003384_2529_2969 127
186 3300053093 Ga0500651_0005180 Ga0500651_0005180_2617_3057 127
187 3300053094 Ga0500566_0046267 Ga0500566_0046267_923_1363 127
188 3300053110 Ga0500571_000362 Ga0500571_000362_11999_12439 127
189 3300053118 Ga0500594_0001381 Ga0500594_0001381_1948_2388 127
190 3300053119 Ga0500595_070601 Ga0500595_070601_332_772 127
191 3300053122 Ga0500608_038569 Ga0500608_038569_599_1039 127
192 3300053133 Ga0500655_000498 Ga0500655_000498_2554_2994 127
193 3300053134 Ga0500658_0000990 Ga0500658_0000990_7325_7765 127
194 3300053134 Ga0500658_0002589 Ga0500658_0002589_2710_3150 127
195 3300053135 Ga0500659_0240320 Ga0500659_0240320_134_574 127
196 3300053138 Ga0500564_032919 Ga0500564_032919_1745_2185 127
197 3300053139 Ga0500568_0007553 Ga0500568_0007553_2174_2614 127
198 3300053153 Ga0500616_0049584 Ga0500616_0049584_811_1251 127
199 3300053161 Ga0500634_0023483 Ga0500634_0023483_261_701 127
200 3300053162 Ga0500638_030462 Ga0500638_030462_1833_2273 127
201 3300005327 Ga0070658_10173078 Ga0070658_101730782 128
202 3300025292 Ga0209676_1032620 Ga0209676_10326202 128
203 3300025303 Ga0209051_1016913 Ga0209051_10169132 128
204 3300053122 Ga0500608_001521 Ga0500608_001521_5378_5818 128
205 3300037312 Ga0395899_0001547 Ga0395899_0001547_18969_19394 129
206 3300037418 Ga0395900_0009467 Ga0395900_0009467_2939_3364 129
207 3300037466 Ga0395898_0007975 Ga0395898_0007975_2103_2528 129
208 3300037471 Ga0395905_0662779 Ga0395905_0662779_218_643 129
209 3300038443 Ga0395901_0270467 Ga0395901_0270467_648_1073 129
210 3300015683 Ga0183362_10001 Ga0183362_100011380 130
211 3300025273 Ga0209673_1007069 Ga0209673_10070697 130
212 3300025291 Ga0209675_1086622 Ga0209675_10866222 130
213 3300037312 Ga0395899_0042593 Ga0395899_0042593_1187_1615 130
214 3300037418 Ga0395900_0022998 Ga0395900_0022998_281_709 130
215 3300037466 Ga0395898_0122345 Ga0395898_0122345_184_612 130
216 3300037471 Ga0395905_0611090 Ga0395905_0611090_184_612 130
217 3300044842 Ga0466957_1191610 Ga0466957_1191610_14_442 130
218 3300037471 Ga0395905_0241054 Ga0395905_0241054_655_1083 131
219 3300048915 Ga0496112_0181104 Ga0496112_0181104_95_526 131
220 3300003187 JGI25151J46595_10109725 JGI25151J46595_101097252 133
221 3300005327 Ga0070658_10106566 Ga0070658_101065662 133
222 3300005563 Ga0068855_100067747 Ga0068855_1000677472 133
223 3300025291 Ga0209675_1010724 Ga0209675_10107242 133
224 3300025294 Ga0209025_1036670 Ga0209025_10366702 133
225 3300025298 Ga0209050_1006734 Ga0209050_10067347 133
226 3300025909 Ga0207705_10540466 Ga0207705_105404661 133
227 3300037312 Ga0395899_0963912 Ga0395899_0963912_54_479 133
228 3300037418 Ga0395900_0030213 Ga0395900_0030213_613_1038 133
229 3300037418 Ga0395900_0066823 Ga0395900_0066823_2231_2656 133
230 3300037466 Ga0395898_0011010 Ga0395898_0011010_8836_9261 133
231 3300037471 Ga0395905_1281416 Ga0395905_1281416_153_578 133
232 3300038443 Ga0395901_0164134 Ga0395901_0164134_194_619 133
233 3300038443 Ga0395901_0462240 Ga0395901_0462240_756_1181 133
234 3300044684 Ga0466966_0631318 Ga0466966_0631318_34_459 133
235 3300044693 Ga0466961_0222455 Ga0466961_0222455_30_455 133
236 3300044719 Ga0466971_0250930 Ga0466971_0250930_142_567 133
237 3300045836 Ga0466958_0254045 Ga0466958_0254045_335_760 133
238 3300045836 Ga0466958_0338814 Ga0466958_0338814_233_658 133
239 3300053111 Ga0500572_099449 Ga0500572_099449_68_508 133
240 3300053121 Ga0500607_033472 Ga0500607_033472_1755_2195 133
241 3300053729 Ga0500625_054278 Ga0500625_054278_1087_1527 133
242 3300026095 Ga0207676_11703705 Ga0207676_117037051 134
243 3300044656 Ga0466969_0067571 Ga0466969_0067571_717_1142 134
244 3300044684 Ga0466966_0184178 Ga0466966_0184178_232_657 134
245 3300044693 Ga0466961_0005995 Ga0466961_0005995_5988_6413 134
246 3300045049 Ga0466959_0069510 Ga0466959_0069510_334_759 134
247 3300049568 Ga0501031_0042512 Ga0501031_0042512_242_667 135
248 3300049571 Ga0501034_0056036 Ga0501034_0056036_1183_1608 135
249 3300049571 Ga0501034_0220904 Ga0501034_0220904_956_1381 135
250 3300049574 Ga0501038_0151237 Ga0501038_0151237_323_748 135
251 3300049578 Ga0501042_0826001 Ga0501042_0826001_224_649 135
252 3300049579 Ga0501043_0074622 Ga0501043_0074622_972_1397 135
253 3300049580 Ga0501046_0045717 Ga0501046_0045717_2584_3009 135
254 3300049581 Ga0501047_0031795 Ga0501047_0031795_3398_3823 135
255 3300049589 Ga0501073_0061270 Ga0501073_0061270_291_716 135
256 3300049742 Ga0501080_0012035 Ga0501080_0012035_3903_4328 135
257 3300049822 Ga0501035_0085966 Ga0501035_0085966_97_522 135
258 3300049823 Ga0501044_0042090 Ga0501044_0042090_1757_2182 135
259 3300005366 Ga0070659_100426046 Ga0070659_1004260462 136
260 3300005563 Ga0068855_101370166 Ga0068855_1013701662 136
261 3300014969 Ga0157376_12587425 Ga0157376_125874251 136
262 3300025949 Ga0207667_11833770 Ga0207667_118337702 136
263 3300032005 Ga0307411_10264246 Ga0307411_102642462 136
264 3300041406 Ga0439439_0206487 Ga0439439_0206487_59_487 136
265 3300041407 Ga0439447_088262 Ga0439447_088262_244_672 136
266 3300042007 Ga0439449_0001318 Ga0439449_0001318_8302_8730 136
267 3300042435 Ga0439434_0342747 Ga0439434_0342747_44_472 136
268 3300044673 Ga0453683_0003078 Ga0453683_0003078_10241_10669 136
269 3300045051 Ga0451576_0008679 Ga0451576_0008679_9434_9862 136
270 3300059424 Ga0590075_006706 Ga0590075_006706_2279_2707 136
271 3300003322 rootL2_10002429 rootL2_100024299 137
272 3300003775 Ga0055524_1000467 Ga0055524_100046718 137
273 3300003794 Ga0055531_10021287 Ga0055531_100212874 137
274 3300005337 Ga0070682_100204466 Ga0070682_1002044662 137
275 3300012497 Ga0157319_1000013 Ga0157319_100001321 137
276 3300025299 Ga0209256_1001137 Ga0209256_100113716 137
277 3300025304 Ga0209257_1001249 Ga0209257_100124918 137
278 3300027312 Ga0209371_1010706 Ga0209371_10107064 137
279 3300030500 Ga0268256_1015926 Ga0268256_10159262 137
280 3300042011 Ga0439454_003682 Ga0439454_003682_616_1029 137
281 3300042127 Ga0450890_006957 Ga0450890_006957_189_602 137
282 3300042438 Ga0439459_0000926 Ga0439459_0000926_3536_3949 137
283 3300042530 Ga0450916_011556 Ga0450916_011556_468_881 137
284 3300044765 Ga0466970_0598210 Ga0466970_0598210_94_522 137
285 3300050496 nmdc:mga07m45_36337_c1 nmdc:mga07m45_36337_c1_467_880 137
286 iso_pu_bacteria 2738541277 2738720317 137
287 iso_pu_bacteria 2738543019 2739279516 137
288 iso_pu_bacteria 2894023352 2894025836 137
289 iso_pu_bacteria 2929160207 2929163621 137
290 3300003316 rootH1_10020189 rootH1_100201895 138
291 3300005456 Ga0070678_100843089 Ga0070678_1008430892 138
292 3300006195 Ga0075366_10308221 Ga0075366_103082212 138
293 3300006195 Ga0075366_10423949 Ga0075366_104239492 138
294 3300009148 Ga0105243_10510460 Ga0105243_105104602 138
295 3300034820 Ga0373959_0028276 Ga0373959_0028276_420_836 138
296 3300035691 Ga0373931_0063924 Ga0373931_0063924_217_633 138
297 3300041459 Ga0451800_1627045 Ga0451800_1627045_196_612 138
298 3300041491 Ga0451833_0100439 Ga0451833_0100439_102_518 138
299 3300045051 Ga0451576_0105315 Ga0451576_0105315_692_1108 138
300 3300046663 Ga0495635_0634580 Ga0495635_0634580_64_480 138
301 3300050493 nmdc:mga0k408_37524_c1 nmdc:mga0k408_37524_c1_182_598 138
302 3300050496 nmdc:mga07m45_597_c2 nmdc:mga07m45_597_c2_4916_5332 138
303 3300053085 Ga0495619_1175273 Ga0495619_1175273_11_427 138
304 iso_pu_bacteria 2511231002 2511246182 138
305 3300005353 Ga0070669_100087546 Ga0070669_1000875462 140
306 3300006038 Ga0075365_10063578 Ga0075365_100635784 140
307 3300006042 Ga0075368_10207967 Ga0075368_102079672 140
308 3300006042 Ga0075368_10389531 Ga0075368_103895311 140
309 3300014497 Ga0182008_10095818 Ga0182008_100958182 140
310 3300017792 Ga0163161_10486216 Ga0163161_104862162 140
311 3300028794 Ga0307515_10000302 Ga0307515_1000030223 140
312 3300030731 Ga0316177_1035191 Ga0316177_10351911 140
313 3300030744 Ga0316181_1021957 Ga0316181_10219572 140
314 3300030745 Ga0316182_1334382 Ga0316182_13343822 140
315 3300031731 Ga0307405_10271674 Ga0307405_102716742 140
316 3300032002 Ga0307416_100624517 Ga0307416_1006245172 140
317 3300041452 Ga0451793_1183457 Ga0451793_1183457_240_662 140
318 3300042004 Ga0439445_0030456 Ga0439445_0030456_322_744 140
319 3300042115 Ga0450911_000596 Ga0450911_000596_8012_8434 140
320 3300048919 Ga0496116_0355266 Ga0496116_0355266_164_601 140
321 3300048925 Ga0496122_0002359 Ga0496122_0002359_20772_21209 140
322 3300048926 Ga0496123_0000108 Ga0496123_0000108_38542_38979 140
323 3300048927 Ga0496124_0088091 Ga0496124_0088091_853_1275 140
324 3300048927 Ga0496124_0114436 Ga0496124_0114436_1618_2055 140
325 3300048928 Ga0496125_0003980 Ga0496125_0003980_3122_3544 140
326 3300048929 Ga0496126_0167849 Ga0496126_0167849_540_977 140
327 3300050492 nmdc:mga0yw44_28590_c1 nmdc:mga0yw44_28590_c1_2511_2933 140
328 3300053117 Ga0500593_009718 Ga0500593_009718_2422_2844 140
329 iso_pu_bacteria 2885192300 2885192739 140
330 iso_pu_bacteria 2954767861 2954772346 140
331 3300003187 JGI25151J46595_10010954 JGI25151J46595_100109544 141
332 3300003578 Ga0006562J51391_1128315 Ga0006562J51391_11283152 141
333 3300003773 Ga0055537_1000611 Ga0055537_100061119 141
334 3300003784 Ga0055534_1000566 Ga0055534_100056619 141
335 3300003790 Ga0055528_1000932 Ga0055528_100093219 141
336 3300003792 Ga0055540_1001593 Ga0055540_100159313 141
337 3300005456 Ga0070678_100650034 Ga0070678_1006500341 141
338 3300005459 Ga0068867_100167155 Ga0068867_1001671552 141
339 3300005548 Ga0070665_100273590 Ga0070665_1002735902 141
340 3300005577 Ga0068857_100025225 Ga0068857_1000252256 141
341 3300005578 Ga0068854_100981658 Ga0068854_1009816581 141
342 3300005719 Ga0068861_100563512 Ga0068861_1005635122 141
343 3300005844 Ga0068862_100071635 Ga0068862_1000716352 141
344 3300006038 Ga0075365_10012495 Ga0075365_100124952 141
345 3300006048 Ga0075363_100008603 Ga0075363_1000086034 141
346 3300006048 Ga0075363_100009940 Ga0075363_1000099402 141
347 3300006051 Ga0075364_10039374 Ga0075364_100393743 141
348 3300006058 Ga0075432_10048247 Ga0075432_100482472 141
349 3300006177 Ga0075362_10015316 Ga0075362_100153163 141
350 3300006177 Ga0075362_10027540 Ga0075362_100275403 141
351 3300006178 Ga0075367_10006255 Ga0075367_100062554 141
352 3300006178 Ga0075367_10186701 Ga0075367_101867012 141
353 3300006178 Ga0075367_10220216 Ga0075367_102202162 141
354 3300006195 Ga0075366_10003789 Ga0075366_100037899 141
355 3300006195 Ga0075366_10042200 Ga0075366_100422004 141
356 3300006353 Ga0075370_10000113 Ga0075370_1000011318 141
357 3300006353 Ga0075370_10009267 Ga0075370_100092675 141
358 3300006353 Ga0075370_10009814 Ga0075370_100098144 141
359 3300006353 Ga0075370_10018917 Ga0075370_100189172 141
360 3300006353 Ga0075370_10176749 Ga0075370_101767492 141
361 3300006353 Ga0075370_10878057 Ga0075370_108780571 141
362 3300006358 Ga0068871_100539829 Ga0068871_1005398291 141
363 3300006881 Ga0068865_101165209 Ga0068865_1011652092 141
364 3300006948 Ga0099826_10018478 Ga0099826_100184785 141
365 3300006948 Ga0099826_10092532 Ga0099826_100925322 141
366 3300006948 Ga0099826_10297222 Ga0099826_102972222 141
367 3300009148 Ga0105243_10029931 Ga0105243_100299313 141
368 3300012497 Ga0157319_1036266 Ga0157319_10362661 141
369 3300012502 Ga0157347_1010744 Ga0157347_10107442 141
370 3300013100 Ga0157373_10022709 Ga0157373_100227096 141
371 3300013306 Ga0163162_10195517 Ga0163162_101955172 141
372 3300013308 Ga0157375_11297136 Ga0157375_112971362 141
373 3300014497 Ga0182008_10053615 Ga0182008_100536153 141
374 3300014969 Ga0157376_10756312 Ga0157376_107563122 141
375 3300014969 Ga0157376_11456896 Ga0157376_114568962 141
376 3300015261 Ga0182006_1174856 Ga0182006_11748562 141
377 3300017792 Ga0163161_10010831 Ga0163161_100108312 141
378 3300025258 Ga0209129_1000718 Ga0209129_10007183 141
379 3300025263 Ga0209565_1000114 Ga0209565_10001144 141
380 3300025273 Ga0209673_1001621 Ga0209673_100162119 141
381 3300025273 Ga0209673_1002302 Ga0209673_10023024 141
382 3300025291 Ga0209675_1000029 Ga0209675_1000029169 141
383 3300025294 Ga0209025_1000435 Ga0209025_100043581 141
384 3300025294 Ga0209025_1017247 Ga0209025_10172472 141
385 3300025303 Ga0209051_1000465 Ga0209051_100046550 141
386 3300025935 Ga0207709_10052492 Ga0207709_100524922 141
387 3300026089 Ga0207648_10241467 Ga0207648_102414672 141
388 3300026121 Ga0207683_10283950 Ga0207683_102839502 141
389 3300027111 Ga0209281_1022425 Ga0209281_10224252 141
390 3300027666 Ga0209282_1003375 Ga0209282_100337510 141
391 3300027666 Ga0209282_1094424 Ga0209282_10944242 141
392 3300028379 Ga0268266_10780709 Ga0268266_107807092 141
393 3300028380 Ga0268265_11250284 Ga0268265_112502842 141
394 3300030731 Ga0316177_1176206 Ga0316177_11762064 141
395 3300030733 Ga0314311_1132537 Ga0314311_113253715 141
396 3300030735 Ga0316178_1047908 Ga0316178_10479082 141
397 3300030736 Ga0316180_1016115 Ga0316180_10161153 141
398 3300030742 Ga0316183_1064677 Ga0316183_10646772 141
399 3300030744 Ga0316181_1016216 Ga0316181_10162162 141
400 3300030745 Ga0316182_1198643 Ga0316182_11986435 141
401 3300031238 Ga0265332_10072160 Ga0265332_100721602 141
402 3300031548 Ga0307408_100015159 Ga0307408_1000151594 141
403 3300031548 Ga0307408_100066851 Ga0307408_1000668512 141
404 3300031548 Ga0307408_100198861 Ga0307408_1001988611 141
405 3300031548 Ga0307408_100691912 Ga0307408_1006919122 141
406 3300031649 Ga0307514_10117701 Ga0307514_101177011 141
407 3300031711 Ga0265314_10004251 Ga0265314_1000425116 141
408 3300031712 Ga0265342_10050409 Ga0265342_100504093 141
409 3300031731 Ga0307405_10050523 Ga0307405_100505233 141
410 3300031731 Ga0307405_10051342 Ga0307405_100513423 141
411 3300031731 Ga0307405_10195113 Ga0307405_101951132 141
412 3300031731 Ga0307405_10506738 Ga0307405_105067382 141
413 3300031731 Ga0307405_12104729 Ga0307405_121047291 141
414 3300031824 Ga0307413_10112493 Ga0307413_101124933 141
415 3300031824 Ga0307413_11230010 Ga0307413_112300101 141
416 3300031852 Ga0307410_10323675 Ga0307410_103236752 141
417 3300031901 Ga0307406_10002299 Ga0307406_1000229911 141
418 3300031901 Ga0307406_10108712 Ga0307406_101087123 141
419 3300031901 Ga0307406_10187614 Ga0307406_101876142 141
420 3300031903 Ga0307407_10098207 Ga0307407_100982072 141
421 3300031911 Ga0307412_10036873 Ga0307412_100368734 141
422 3300031911 Ga0307412_10040382 Ga0307412_100403824 141
423 3300031911 Ga0307412_10366799 Ga0307412_103667992 141
424 3300032002 Ga0307416_100136503 Ga0307416_1001365033 141
425 3300032002 Ga0307416_100181970 Ga0307416_1001819702 141
426 3300032002 Ga0307416_100786033 Ga0307416_1007860332 141
427 3300032004 Ga0307414_10030934 Ga0307414_100309342 141
428 3300032004 Ga0307414_10032160 Ga0307414_100321603 141
429 3300032005 Ga0307411_10223096 Ga0307411_102230962 141
430 3300032005 Ga0307411_10365444 Ga0307411_103654442 141
431 3300035116 Ga0373945_0428465 Ga0373945_0428465_115_549 141
432 3300035170 Ga0373943_0667045 Ga0373943_0667045_68_502 141
433 3300041404 Ga0439436_0000703 Ga0439436_0000703_7368_7793 141
434 3300041404 Ga0439436_0002187 Ga0439436_0002187_4820_5245 141
435 3300041404 Ga0439436_0003327 Ga0439436_0003327_1011_1454 141
436 3300041404 Ga0439436_0055865 Ga0439436_0055865_198_623 141
437 3300041405 Ga0439438_025903 Ga0439438_025903_882_1307 141
438 3300041405 Ga0439438_043899 Ga0439438_043899_283_708 141
439 3300041406 Ga0439439_0000471 Ga0439439_0000471_2113_2538 141
440 3300041406 Ga0439439_0061343 Ga0439439_0061343_525_950 141
441 3300041406 Ga0439439_0141143 Ga0439439_0141143_40_483 141
442 3300041407 Ga0439447_004982 Ga0439447_004982_1611_2036 141
443 3300041407 Ga0439447_022525 Ga0439447_022525_814_1239 141
444 3300041411 Ga0439466_0002529 Ga0439466_0002529_5680_6105 141
445 3300041411 Ga0439466_0025336 Ga0439466_0025336_354_779 141
446 3300041411 Ga0439466_0026442 Ga0439466_0026442_669_1112 141
447 3300041413 Ga0439465_0003784 Ga0439465_0003784_78_503 141
448 3300041498 Ga0451841_0276797 Ga0451841_0276797_95_520 141
449 3300041997 Ga0439431_0003175 Ga0439431_0003175_656_1081 141
450 3300041997 Ga0439431_0040566 Ga0439431_0040566_382_825 141
451 3300041999 Ga0439433_0004619 Ga0439433_0004619_688_1113 141
452 3300042002 Ga0439442_011963 Ga0439442_011963_812_1237 141
453 3300042002 Ga0439442_056858 Ga0439442_056858_240_665 141
454 3300042004 Ga0439445_0000164 Ga0439445_0000164_8676_9101 141
455 3300042004 Ga0439445_0024412 Ga0439445_0024412_753_1181 141
456 3300042006 Ga0439432_006112 Ga0439432_006112_708_1133 141
457 3300042006 Ga0439432_016051 Ga0439432_016051_235_660 141
458 3300042007 Ga0439449_0000494 Ga0439449_0000494_11778_12203 141
459 3300042007 Ga0439449_0004819 Ga0439449_0004819_797_1222 141
460 3300042007 Ga0439449_0005691 Ga0439449_0005691_549_974 141
461 3300042007 Ga0439449_0200805 Ga0439449_0200805_41_466 141
462 3300042010 Ga0439452_001807 Ga0439452_001807_622_1047 141
463 3300042010 Ga0439452_002182 Ga0439452_002182_1924_2349 141
464 3300042014 Ga0439457_001873 Ga0439457_001873_2810_3235 141
465 3300042014 Ga0439457_052152 Ga0439457_052152_254_679 141
466 3300042015 Ga0439462_0018325 Ga0439462_0018325_947_1372 141
467 3300042125 Ga0450923_011411 Ga0450923_011411_586_1011 141
468 3300042145 Ga0450906_003663 Ga0450906_003663_2500_2943 141
469 3300042145 Ga0450906_074638 Ga0450906_074638_55_480 141
470 3300042156 Ga0439446_0029977 Ga0439446_0029977_1126_1551 141
471 3300042156 Ga0439446_0351384 Ga0439446_0351384_11_454 141
472 3300042184 Ga0450908_008165 Ga0450908_008165_268_711 141
473 3300042185 Ga0450909_057895 Ga0450909_057895_109_534 141
474 3300042435 Ga0439434_0007410 Ga0439434_0007410_222_647 141
475 3300042438 Ga0439459_0074146 Ga0439459_0074146_182_607 141
476 3300042531 Ga0450918_002734 Ga0450918_002734_2500_2943 141
477 3300042532 Ga0450893_0012894 Ga0450893_0012894_737_1162 141
478 3300042876 Ga0451577_0038579 Ga0451577_0038579_2515_2943 141
479 3300042876 Ga0451577_1522291 Ga0451577_1522291_64_492 141
480 3300044673 Ga0453683_0143784 Ga0453683_0143784_941_1369 141
481 3300044683 Ga0466965_0388479 Ga0466965_0388479_237_662 141
482 3300044712 Ga0453684_0067284 Ga0453684_0067284_4036_4464 141
483 3300044712 Ga0453684_0881546 Ga0453684_0881546_93_521 141
484 3300045051 Ga0451576_0029573 Ga0451576_0029573_2014_2442 141
485 3300046453 Ga0495627_006704 Ga0495627_006704_1254_1694 141
486 3300046455 Ga0495603_0654898 Ga0495603_0654898_138_563 141
487 3300046515 Ga0495620_0004869 Ga0495620_0004869_4627_5067 141
488 3300046520 Ga0495637_0004150 Ga0495637_0004150_4117_4557 141
489 3300046538 Ga0495609_0070233 Ga0495609_0070233_145_585 141
490 3300046558 Ga0495633_0585553 Ga0495633_0585553_31_471 141
491 3300046660 Ga0495625_0002531 Ga0495625_0002531_16721_17161 141
492 3300046674 Ga0495588_0042065 Ga0495588_0042065_1897_2322 141
493 3300046691 Ga0495670_0044540 Ga0495670_0044540_1283_1723 141
494 3300046692 Ga0495671_0001939 Ga0495671_0001939_7924_8364 141
495 3300046809 Ga0495600_0315275 Ga0495600_0315275_399_824 141
496 3300046810 Ga0495660_0222956 Ga0495660_0222956_241_681 141
497 3300047470 Ga0495681_0297021 Ga0495681_0297021_154_594 141
498 3300048919 Ga0496116_0052800 Ga0496116_0052800_2195_2620 141
499 3300049679 Ga0501249_051157 Ga0501249_051157_189_614 141
500 3300049705 Ga0501225_0188798 Ga0501225_0188798_139_564 141
501 3300049759 Ga0501262_000560 Ga0501262_000560_2253_2693 141
502 3300050489 nmdc:mga03683_12001_c1 nmdc:mga03683_12001_c1_2533_2958 141
503 3300050490 nmdc:mga03n38_400297_c1 nmdc:mga03n38_400297_c1_205_645 141
504 3300050490 nmdc:mga03n38_45822_c1 nmdc:mga03n38_45822_c1_123_566 141
505 3300050490 nmdc:mga03n38_497101_c1 nmdc:mga03n38_497101_c1_75_515 141
506 3300050491 nmdc:mga00v17_6700_c1 nmdc:mga00v17_6700_c1_4775_5215 141
507 3300050493 nmdc:mga0k408_11586_c1 nmdc:mga0k408_11586_c1_1971_2396 141
508 3300050493 nmdc:mga0k408_3613_c1 nmdc:mga0k408_3613_c1_4972_5412 141
509 3300050494 nmdc:mga06z11_40536_c1 nmdc:mga06z11_40536_c1_1127_1567 141
510 3300050494 nmdc:mga06z11_71013_c1 nmdc:mga06z11_71013_c1_1286_1711 141
511 3300050496 nmdc:mga07m45_272_c1 nmdc:mga07m45_272_c1_3833_4273 141
512 3300050496 nmdc:mga07m45_65458_c1 nmdc:mga07m45_65458_c1_962_1405 141
513 3300050496 nmdc:mga07m45_7411_c1 nmdc:mga07m45_7411_c1_2999_3439 141
514 3300050516 nmdc:mga0sz30_77922_c1 nmdc:mga0sz30_77922_c1_768_1193 141
515 3300053079 Ga0500610_0009345 Ga0500610_0009345_1654_2094 141
516 3300053079 Ga0500610_0050716 Ga0500610_0050716_614_1054 141
517 3300053088 Ga0500644_0271875 Ga0500644_0271875_284_709 141
518 3300053108 Ga0500562_011537 Ga0500562_011537_30_455 141
519 3300053117 Ga0500593_000566 Ga0500593_000566_3648_4088 141
520 3300053121 Ga0500607_001562 Ga0500607_001562_3868_4308 141
521 3300053153 Ga0500616_0027696 Ga0500616_0027696_1303_1728 141
522 3300053158 Ga0500627_0093608 Ga0500627_0093608_877_1317 141
523 3300060353 Ga0501082_0936442 Ga0501082_0936442_251_676 141
524 iso_pu_bacteria 2513020051 2513230940 141
525 iso_pu_bacteria 2599185214 2599624383 141
526 iso_pu_bacteria 2599185226 2599672755 141
527 iso_pu_bacteria 2599185227 2599683755 141
528 iso_pu_bacteria 2599185229 2599694364 141
529 iso_pu_bacteria 2643221628 2644159559 141
530 iso_pu_bacteria 2643221658 2644327954 141
531 iso_pu_bacteria 2643221672 2644398739 141
532 iso_pu_bacteria 2643221683 2644468467 141
533 iso_pu_bacteria 2738541307 2738881858 141
534 iso_pu_bacteria 2738543013 2739250782 141
535 iso_pu_bacteria 2818991446 2819595797 141
536 iso_pu_bacteria 2831265667 2831267057 141
537 iso_pu_bacteria 2838054893 2838057115 141
538 iso_pu_bacteria 2842677519 2842678917 141
539 iso_pu_bacteria 2885198086 2885198887 141
540 iso_pu_bacteria 2885211737 2885212850 141
541 iso_pu_bacteria 2899924645 2899925143 141
542 iso_pu_bacteria 2904449895 2904454467 141
543 iso_pu_bacteria 2904456579 2904461090 141
544 iso_pu_bacteria 2904541872 2904544707 141
545 iso_pu_bacteria 2919462493 2919465967 141
546 iso_pu_bacteria 2928037797 2928038732 141
547 iso_pu_bacteria 2928044640 2928045663 141
548 iso_pu_bacteria 2928051484 2928053280 141
549 iso_pu_bacteria 2928064002 2928066885 141
550 iso_pu_bacteria 2928070936 2928071234 141
551 iso_pu_bacteria 2928084124 2928084841 141
552 iso_pu_bacteria 2929520902 2929526974 141
553 iso_pu_bacteria 2945909444 2945912305 141
554 iso_pu_bacteria 2945945610 2945948225 141
555 iso_pu_bacteria 2945972063 2945977133 141
556 iso_pu_bacteria 2945984333 2945985382 141
557 3300002704 JGI25155J39150_1000002 JGI25155J39150_1000002140 142
558 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003166 142
559 3300002738 JGI25154J39366_1000009 JGI25154J39366_1000009140 142
560 3300002741 JGI25157J39369_1000002 JGI25157J39369_1000002140 142
561 3300002987 JGI25159J45721_1001861 JGI25159J45721_10018613 142
562 3300002987 JGI25159J45721_1002062 JGI25159J45721_10020623 142
563 3300003187 JGI25151J46595_10003617 JGI25151J46595_100036173 142
564 3300003187 JGI25151J46595_10013500 JGI25151J46595_100135002 142
565 3300003354 JGI25160J50197_1000646 JGI25160J50197_10006468 142
566 3300003354 JGI25160J50197_1000712 JGI25160J50197_10007128 142
567 3300003374 JGI25161J50226_1000018 JGI25161J50226_1000018170 142
568 3300003771 Ga0055526_1001518 Ga0055526_10015184 142
569 3300003771 Ga0055526_1010011 Ga0055526_10100113 142
570 3300003771 Ga0055526_1083266 Ga0055526_10832661 142
571 3300003775 Ga0055524_1000012 Ga0055524_10000128 142
572 3300003790 Ga0055528_1000925 Ga0055528_100092521 142
573 3300003791 Ga0055530_10002096 Ga0055530_100020968 142
574 3300003791 Ga0055530_10002329 Ga0055530_100023298 142
575 3300003791 Ga0055530_10095340 Ga0055530_100953401 142
576 3300003792 Ga0055540_1000012 Ga0055540_1000012126 142
577 3300003792 Ga0055540_1006194 Ga0055540_10061946 142
578 3300003794 Ga0055531_10000345 Ga0055531_1000034530 142
579 3300003794 Ga0055531_10001882 Ga0055531_1000188217 142
580 3300005262 Ga0065165_1059631 Ga0065165_10596312 142
581 3300005327 Ga0070658_10674937 Ga0070658_106749372 142
582 3300005331 Ga0070670_100028698 Ga0070670_1000286983 142
583 3300005334 Ga0068869_100055267 Ga0068869_1000552671 142
584 3300005334 Ga0068869_101867476 Ga0068869_1018674761 142
585 3300005338 Ga0068868_100144468 Ga0068868_1001444682 142
586 3300005339 Ga0070660_100131394 Ga0070660_1001313942 142
587 3300005365 Ga0070688_101108853 Ga0070688_1011088532 142
588 3300005435 Ga0070714_100176236 Ga0070714_1001762361 142
589 3300005467 Ga0070706_101733894 Ga0070706_1017338941 142
590 3300005468 Ga0070707_100183676 Ga0070707_1001836763 142
591 3300005530 Ga0070679_100082648 Ga0070679_1000826483 142
592 3300005539 Ga0068853_101448525 Ga0068853_1014485251 142
593 3300005549 Ga0070704_100479568 Ga0070704_1004795682 142
594 3300005563 Ga0068855_100104421 Ga0068855_1001044213 142
595 3300005616 Ga0068852_101573826 Ga0068852_1015738262 142
596 3300005616 Ga0068852_101718896 Ga0068852_1017188962 142
597 3300005618 Ga0068864_100612088 Ga0068864_1006120882 142
598 3300006038 Ga0075365_10393583 Ga0075365_103935832 142
599 3300006042 Ga0075368_10024851 Ga0075368_100248512 142
600 3300006048 Ga0075363_100049966 Ga0075363_1000499662 142
601 3300006048 Ga0075363_100195854 Ga0075363_1001958542 142
602 3300006051 Ga0075364_10006278 Ga0075364_100062785 142
603 3300006058 Ga0075432_10057023 Ga0075432_100570232 142
604 3300006177 Ga0075362_10009304 Ga0075362_100093042 142
605 3300006177 Ga0075362_10073744 Ga0075362_100737442 142
606 3300006177 Ga0075362_10089551 Ga0075362_100895513 142
607 3300006177 Ga0075362_10337089 Ga0075362_103370892 142
608 3300006178 Ga0075367_10080808 Ga0075367_100808082 142
609 3300006195 Ga0075366_10016348 Ga0075366_100163485 142
610 3300006195 Ga0075366_10112588 Ga0075366_101125882 142
611 3300006195 Ga0075366_10618825 Ga0075366_106188252 142
612 3300006353 Ga0075370_10110265 Ga0075370_101102652 142
613 3300006353 Ga0075370_10324294 Ga0075370_103242942 142
614 3300006353 Ga0075370_10548821 Ga0075370_105488212 142
615 3300006846 Ga0075430_100276481 Ga0075430_1002764812 142
616 3300006946 Ga0079104_1019897 Ga0079104_10198972 142
617 3300006948 Ga0099826_10275347 Ga0099826_102753472 142
618 3300009093 Ga0105240_10010481 Ga0105240_1001048111 142
619 3300009101 Ga0105247_11419583 Ga0105247_114195832 142
620 3300009147 Ga0114129_10420441 Ga0114129_104204411 142
621 3300009174 Ga0105241_10403179 Ga0105241_104031792 142
622 3300009551 Ga0105238_10316590 Ga0105238_103165902 142
623 3300009551 Ga0105238_10521004 Ga0105238_105210042 142
624 3300010375 Ga0105239_10180443 Ga0105239_101804432 142
625 3300012513 Ga0157326_1002747 Ga0157326_10027472 142
626 3300014326 Ga0157380_12224018 Ga0157380_122240181 142
627 3300025206 Ga0209435_100001 Ga0209435_100001577 142
628 3300025208 Ga0209436_102515 Ga0209436_1025155 142
629 3300025245 Ga0207425_1000784 Ga0207425_100078415 142
630 3300025245 Ga0207425_1002389 Ga0207425_10023898 142
631 3300025245 Ga0207425_1064914 Ga0207425_10649141 142
632 3300025246 Ga0209646_1000001 Ga0209646_1000001946 142
633 3300025250 Ga0209026_1000003 Ga0209026_1000003577 142
634 3300025256 Ga0209759_1000001 Ga0209759_1000001577 142
635 3300025263 Ga0209565_1000004 Ga0209565_1000004627 142
636 3300025263 Ga0209565_1000892 Ga0209565_10008927 142
637 3300025273 Ga0209673_1000074 Ga0209673_1000074155 142
638 3300025273 Ga0209673_1039655 Ga0209673_10396552 142
639 3300025284 Ga0209130_1000050 Ga0209130_1000050170 142
640 3300025284 Ga0209130_1001070 Ga0209130_100107017 142
641 3300025291 Ga0209675_1000044 Ga0209675_100004450 142
642 3300025291 Ga0209675_1003844 Ga0209675_10038447 142
643 3300025291 Ga0209675_1041451 Ga0209675_10414511 142
644 3300025292 Ga0209676_1000029 Ga0209676_1000029274 142
645 3300025292 Ga0209676_1001530 Ga0209676_100153010 142
646 3300025294 Ga0209025_1001778 Ga0209025_10017783 142
647 3300025294 Ga0209025_1005176 Ga0209025_100517611 142
648 3300025294 Ga0209025_1005773 Ga0209025_100577310 142
649 3300025294 Ga0209025_1020498 Ga0209025_10204982 142
650 3300025295 Ga0209564_1001399 Ga0209564_10013995 142
651 3300025295 Ga0209564_1001809 Ga0209564_100180914 142
652 3300025295 Ga0209564_1025454 Ga0209564_10254542 142
653 3300025297 Ga0209758_1015794 Ga0209758_10157944 142
654 3300025297 Ga0209758_1062172 Ga0209758_10621722 142
655 3300025298 Ga0209050_1000003 Ga0209050_1000003336 142
656 3300025298 Ga0209050_1003012 Ga0209050_10030123 142
657 3300025299 Ga0209256_1000001 Ga0209256_1000001340 142
658 3300025299 Ga0209256_1084653 Ga0209256_10846531 142
659 3300025302 Ga0207426_1000071 Ga0207426_100007186 142
660 3300025302 Ga0207426_1003300 Ga0207426_10033008 142
661 3300025303 Ga0209051_1000003 Ga0209051_1000003336 142
662 3300025303 Ga0209051_1000254 Ga0209051_100025413 142
663 3300025304 Ga0209257_1000012 Ga0209257_1000012639 142
664 3300025304 Ga0209257_1000018 Ga0209257_1000018336 142
665 3300025304 Ga0209257_1000045 Ga0209257_100004545 142
666 3300025304 Ga0209257_1000137 Ga0209257_1000137111 142
667 3300025911 Ga0207654_10495471 Ga0207654_104954712 142
668 3300025917 Ga0207660_10122893 Ga0207660_101228933 142
669 3300025918 Ga0207662_11117314 Ga0207662_111173141 142
670 3300025919 Ga0207657_10055016 Ga0207657_100550164 142
671 3300025919 Ga0207657_10812388 Ga0207657_108123881 142
672 3300025921 Ga0207652_10185118 Ga0207652_101851182 142
673 3300025921 Ga0207652_10330106 Ga0207652_103301062 142
674 3300025922 Ga0207646_10386937 Ga0207646_103869372 142
675 3300025924 Ga0207694_10725186 Ga0207694_107251862 142
676 3300025925 Ga0207650_10037174 Ga0207650_100371743 142
677 3300025942 Ga0207689_10033336 Ga0207689_100333364 142
678 3300025942 Ga0207689_10226241 Ga0207689_102262412 142
679 3300025949 Ga0207667_10141437 Ga0207667_101414372 142
680 3300025949 Ga0207667_10324139 Ga0207667_103241392 142
681 3300025960 Ga0207651_10907851 Ga0207651_109078512 142
682 3300026023 Ga0207677_10002959 Ga0207677_100029599 142
683 3300026041 Ga0207639_10198421 Ga0207639_101984213 142
684 3300026078 Ga0207702_10201192 Ga0207702_102011922 142
685 3300026095 Ga0207676_10491917 Ga0207676_104919172 142
686 3300026142 Ga0207698_11992815 Ga0207698_119928152 142
687 3300027111 Ga0209281_1054133 Ga0209281_10541332 142
688 3300027907 Ga0207428_10506245 Ga0207428_105062451 142
689 3300028794 Ga0307515_10739565 Ga0307515_107395651 142
690 3300031456 Ga0307513_10000010 Ga0307513_1000001049 142
691 3300031456 Ga0307513_10000014 Ga0307513_10000014251 142
692 3300031456 Ga0307513_10468809 Ga0307513_104688092 142
693 3300031456 Ga0307513_10499396 Ga0307513_104993961 142
694 3300031548 Ga0307408_100032886 Ga0307408_1000328862 142
695 3300031548 Ga0307408_100428283 Ga0307408_1004282832 142
696 3300031548 Ga0307408_100656913 Ga0307408_1006569131 142
697 3300031548 Ga0307408_101592707 Ga0307408_1015927071 142
698 3300031730 Ga0307516_10278932 Ga0307516_102789322 142
699 3300031731 Ga0307405_10599211 Ga0307405_105992112 142
700 3300031731 Ga0307405_10989762 Ga0307405_109897622 142
701 3300031824 Ga0307413_10466580 Ga0307413_104665802 142
702 3300031901 Ga0307406_10045966 Ga0307406_100459664 142
703 3300031911 Ga0307412_10076369 Ga0307412_100763694 142
704 3300031911 Ga0307412_11186928 Ga0307412_111869282 142
705 3300032002 Ga0307416_100049797 Ga0307416_1000497972 142
706 3300037418 Ga0395900_0060679 Ga0395900_0060679_3107_3535 142
707 3300037418 Ga0395900_0289197 Ga0395900_0289197_77_505 142
708 3300037466 Ga0395898_0146785 Ga0395898_0146785_1196_1624 142
709 3300038443 Ga0395901_0044247 Ga0395901_0044247_807_1235 142
710 3300039437 Ga0436365_0464954 Ga0436365_0464954_114_542 142
711 3300041404 Ga0439436_0021925 Ga0439436_0021925_1028_1456 142
712 3300041410 Ga0439461_0022993 Ga0439461_0022993_606_1034 142
713 3300041451 Ga0451791_1555033 Ga0451791_1555033_1004_1432 142
714 3300041463 Ga0451804_0299013 Ga0451804_0299013_88_516 142
715 3300041496 Ga0451839_0586664 Ga0451839_0586664_174_602 142
716 3300041507 Ga0451851_0287117 Ga0451851_0287117_282_710 142
717 3300041512 Ga0451853_1870137 Ga0451853_1870137_146_574 142
718 3300042007 Ga0439449_0031646 Ga0439449_0031646_822_1250 142
719 3300042015 Ga0439462_0061596 Ga0439462_0061596_268_696 142
720 3300042131 Ga0450894_008192 Ga0450894_008192_131_559 142
721 3300042134 Ga0450898_005252 Ga0450898_005252_503_931 142
722 3300042138 Ga0450903_025585 Ga0450903_025585_401_829 142
723 3300042139 Ga0450904_007394 Ga0450904_007394_602_1030 142
724 3300042156 Ga0439446_0021931 Ga0439446_0021931_215_643 142
725 3300042156 Ga0439446_0153374 Ga0439446_0153374_283_711 142
726 3300042185 Ga0450909_005276 Ga0450909_005276_985_1413 142
727 3300042435 Ga0439434_0288955 Ga0439434_0288955_64_498 142
728 3300042438 Ga0439459_0042973 Ga0439459_0042973_425_853 142
729 3300042439 Ga0439464_0044365 Ga0439464_0044365_438_866 142
730 3300042876 Ga0451577_0058241 Ga0451577_0058241_480_908 142
731 3300044658 Ga0466972_0278698 Ga0466972_0278698_303_731 142
732 3300044683 Ga0466965_0506621 Ga0466965_0506621_127_555 142
733 3300044684 Ga0466966_0176873 Ga0466966_0176873_692_1120 142
734 3300044684 Ga0466966_0614160 Ga0466966_0614160_10_441 142
735 3300044693 Ga0466961_0209177 Ga0466961_0209177_632_1060 142
736 3300044712 Ga0453684_1431954 Ga0453684_1431954_197_631 142
737 3300044842 Ga0466957_0404582 Ga0466957_0404582_147_575 142
738 3300044842 Ga0466957_0946927 Ga0466957_0946927_66_494 142
739 3300045976 Ga0466967_0190524 Ga0466967_0190524_341_769 142
740 3300046539 Ga0495621_0060472 Ga0495621_0060472_744_1172 142
741 3300046558 Ga0495633_0450493 Ga0495633_0450493_33_461 142
742 3300046615 Ga0495656_0024993 Ga0495656_0024993_1024_1452 142
743 3300046684 Ga0495669_0086357 Ga0495669_0086357_420_848 142
744 3300047318 Ga0495636_0323965 Ga0495636_0323965_148_576 142
745 3300047445 Ga0495677_0040587 Ga0495677_0040587_581_1009 142
746 3300048911 Ga0496108_0082018 Ga0496108_0082018_1502_1930 142
747 3300049569 Ga0501032_0117606 Ga0501032_0117606_19_447 142
748 3300049679 Ga0501249_134923 Ga0501249_134923_61_492 142
749 3300049767 Ga0501270_159532 Ga0501270_159532_37_465 142
750 3300049822 Ga0501035_0361986 Ga0501035_0361986_53_481 142
751 3300049823 Ga0501044_1447177 Ga0501044_1447177_107_535 142
752 3300050489 nmdc:mga03683_109941_c1 nmdc:mga03683_109941_c1_162_590 142
753 3300050490 nmdc:mga03n38_11720_c1 nmdc:mga03n38_11720_c1_1132_1560 142
754 3300050491 nmdc:mga00v17_68539_c1 nmdc:mga00v17_68539_c1_1660_2088 142
755 3300050492 nmdc:mga0yw44_679488_c1 nmdc:mga0yw44_679488_c1_109_537 142
756 3300050492 nmdc:mga0yw44_705968_c1 nmdc:mga0yw44_705968_c1_45_473 142
757 3300050493 nmdc:mga0k408_185190_c1 nmdc:mga0k408_185190_c1_749_1177 142
758 3300050493 nmdc:mga0k408_246592_c1 nmdc:mga0k408_246592_c1_199_627 142
759 3300050493 nmdc:mga0k408_289333_c1 nmdc:mga0k408_289333_c1_60_488 142
760 3300050493 nmdc:mga0k408_434785_c1 nmdc:mga0k408_434785_c1_191_619 142
761 3300050493 nmdc:mga0k408_69631_c1 nmdc:mga0k408_69631_c1_1387_1815 142
762 3300050494 nmdc:mga06z11_107501_c1 nmdc:mga06z11_107501_c1_265_693 142
763 3300050495 nmdc:mga04h51_34602_c1 nmdc:mga04h51_34602_c1_1081_1509 142
764 3300050496 nmdc:mga07m45_849866_c1 nmdc:mga07m45_849866_c1_70_498 142
765 3300050509 nmdc:mga0qj67_515225_c1 nmdc:mga0qj67_515225_c1_297_725 142
766 3300050516 nmdc:mga0sz30_449367_c1 nmdc:mga0sz30_449367_c1_97_525 142
767 3300053088 Ga0500644_0026473 Ga0500644_0026473_517_945 142
768 3300053093 Ga0500651_0015201 Ga0500651_0015201_1567_1995 142
769 3300053094 Ga0500566_0100837 Ga0500566_0100837_18_446 142
770 3300053117 Ga0500593_004570 Ga0500593_004570_2487_2915 142
771 3300053129 Ga0500628_002174 Ga0500628_002174_2451_2879 142
772 3300053131 Ga0500652_364739 Ga0500652_364739_63_491 142
773 3300053153 Ga0500616_0169504 Ga0500616_0169504_65_493 142
774 3300053730 Ga0500645_010500 Ga0500645_010500_2257_2685 142
775 3300055283 Ga0500661_010553 Ga0500661_010553_1083_1511 142
776 3300059424 Ga0590075_065430 Ga0590075_065430_366_794 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

12

141

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.896 59 132
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8628 59 132
8pek-assembly1.cif.gz_B structure of the dimeric, periplasmic domain of exbd 0.7376 45 142
5by4-assembly1.cif.gz_A-2 structure and function of the escherichia coli tol-pal stator protein tolr 0.7295 55 135
4h5n-assembly1.cif.gz_A hsc70 nbd with po4, na, cl 0.7221 82 131
ID Description Score Start End Superfamily
af_Q8ILM5_15_201_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7863 96 134 3.30.420.40
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7698 60 130 3.30.420.270
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7439 60 130 3.30.420.270
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7425 96 133 3.40.50.2020
af_Q86IH8_5_206_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7391 82 139 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A519M6W1-F1-model_v4 Biopolymer transporter ExbD 0.9637 67 141 GO:0005886
GO:0015031
GO:0022857
AF-A0A4Q3Q352-F1-model_v4 deleted 0.9611 56 142
AF-F3LFH7-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.954 59 137 GO:0005886
GO:0015031
GO:0022857
AF-A0A1Y5Q6K5-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.9508 61 133 GO:0005886
GO:0015031
GO:0022857
AF-A0A139DB72-F1-model_v4 Biopolymer transport protein ExbD 0.9484 59 137 GO:0005886
GO:0015031
GO:0022857

Feature Viewer

pLDDT pTM Quality
74.86 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map