F480274

General Info

Members Datasets Scaffolds Average Seq Length
775 542 1550 504

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0000103|Ga0466972_0000103_14143_15750
Length 535
Sequence MSFCSGGAADDHARRAEETRRPVKGGHNATRQEAIMNVAVRSQATAKQITEHFDVLIVGAGISGIGSAYHLTKQLPGTSFVILETQATFGGTWTTHRYPGIRSDSDLHTFGYRFKPWVGPPIATADEILAYMNEVIEENDLARHIRYKHRINSASWSSEDNLWTIEAVVTDTGEPKRFTANFLWMCQGYYRHSEGYTPEWKGMDRFKGRIVHPQTWPDDIDLTDKKVVVIGSGATAATLVPNIADKCAHVTMLQRSPTYFRLGRNAIEIAEELRRLQVDEEWIHEIVRRKILFEQDAFTKLCVSKPEQVKQELIGQIRAVLGPDYDVETHFTPKYRPWRQRIAFVPDADLFKGIASGKASVVTDEIECFVENGIQLKSGKLLEADIIITATGFNLAALGDIAFEIDGKPLAFGDTVTYRGMMFTGVPNMVWVFGYFRASWTLRVDLVADFVCRLLGHMKAKGARKVEVKLRPEDHNMPILPWIDPENFNPGYMMRNMDLLPKRGDKPEWQHSQDYWTEKDEIPKTDLDDAAFVYG

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
93 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
94 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
95 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
156 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
298 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
302 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
303 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
304 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
305 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
308 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
309 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
313 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
314 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
315 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
319 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
320 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
321 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
322 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
323 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
324 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
325 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
326 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
327 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
328 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
329 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
330 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
331 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
332 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
333 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
334 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
335 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
336 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
337 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
338 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
339 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
340 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
341 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
342 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
343 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
344 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
345 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
346 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
347 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
348 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
349 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
350 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
351 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
352 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
353 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
354 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
355 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
356 2791355199
357 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
358 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
359 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
360 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
361 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
362 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
363 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
364 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
365 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
366 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
367 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
368 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
369 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
370 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
371 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
372 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
373 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
374 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
375 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
376 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
377 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
378 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
379 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
380 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
381 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
382 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
383 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
384 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
385 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
386 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
387 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
388 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
389 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
390 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
391 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
392 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
393 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
394 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
395 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
396 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
397 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
398 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
399 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
400 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
401 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
402 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
403 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
404 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
405 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
406 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
407 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
408 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
409 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
410 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
411 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
412 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
413 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
414 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
415 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
416 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
417 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
418 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
419 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
420 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
421 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
422 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
423 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
424 2904699407
425 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
426 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
427 2906610324
428 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
429 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
430 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
431 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
432 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
433 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
434 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
435 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
436 2922368715
437 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
438 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
439 2922425934
440 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
441 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
442 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
443 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
444 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
445 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
446 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
447 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
448 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
449 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
450 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
451 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
452 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
453 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
454 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
455 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
456 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
457 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
458 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
459 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
460 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
461 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
462 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
463 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
464 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
465 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
466 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
467 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
468 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
469 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
470 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
471 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
472 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
473 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
474 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
475 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
476 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
477 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
478 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
479 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
480 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
481 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
482 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
483 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
484 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
485 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
486 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
487 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
488 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
489 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
490 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
491 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
492 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
493 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
494 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
495 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
496 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
497 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
498 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
499 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
500 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
501 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
502 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
503 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
504 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
505 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
506 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
507 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
508 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
509 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
510 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
511 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
512 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
513 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
514 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
515 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
516 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
517 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
518 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
519 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
520 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
521 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
522 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
523 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
524 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
525 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
526 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
527 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
528 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
529 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
530 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
531 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
532 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
533 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
534 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
535 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
536 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
537 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
538 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
539 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
540 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
541 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
542 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.17
Metatranscriptomes 0
Isolates 28.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.45
Nodule 21.94
Rhizoplane 2.71
Rhizosphere 52.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0000103 3300044658 Bacteria 75095
2 JGI24741J21665_1000833 3300001915 Bacteria 9276
3 JGI24737J22298_10001234 3300001990 Bacteria 9027
4 JGI25406J46586_10009769 3300003203 Bacteria 4287
5 JGI25153J46596_10001223 3300003215 Bacteria 15476
6 JGI25153J46596_10002514 3300003215 Bacteria 10528
7 JGI25153J46596_10002599 3300003215 Bacteria 10345
8 JGI25153J46596_10007823 3300003215 Bacteria 5191
9 rootH2_10024294 3300003320 Bacteria 27838
10 rootL2_10003341 3300003322 Bacteria 2890
11 JGI25160J50197_1000470 3300003354 Bacteria 24686
12 Ga0055525_1000040 3300003759 Bacteria 286933
13 Ga0055542_1000046 3300003762 Bacteria 201922
14 Ga0055529_1000007 3300003763 Bacteria 403604
15 Ga0055536_1003010 3300003781 Bacteria 9229
16 Ga0055536_1005055 3300003781 Bacteria 6551
17 Ga0055530_10000616 3300003791 Bacteria 30895
18 Ga0055530_10002020 3300003791 Bacteria 13715
19 Ga0055530_10007670 3300003791 Bacteria 4492
20 Ga0055531_10002037 3300003794 Bacteria 13962
21 Ga0055531_10002474 3300003794 Bacteria 12326
22 Ga0055531_10020740 3300003794 Bacteria 2585
23 Ga0065165_1001024 3300005262 Bacteria 33944
24 Ga0065165_1002115 3300005262 Bacteria 18118
25 Ga0065165_1005641 3300005262 Bacteria 6921
26 Ga0065165_1008761 3300005262 Bacteria 4664
27 Ga0065712_10071442 3300005290 Bacteria 5259
28 Ga0065715_10097494 3300005293 Bacteria 3696
29 Ga0070658_10006842 3300005327 Bacteria 9217
30 Ga0070676_10040358 3300005328 Bacteria 2703
31 Ga0070683_100073753 3300005329 Bacteria 3186
32 Ga0070683_100074923 3300005329 Bacteria 3161
33 Ga0070670_100005916 3300005331 Bacteria 10340
34 Ga0070670_100106124 3300005331 Bacteria 2420
35 Ga0070677_10003465 3300005333 Bacteria 5090
36 Ga0068869_100023430 3300005334 Bacteria 4264
37 Ga0070666_10004262 3300005335 Bacteria 8693
38 Ga0070680_100019665 3300005336 Bacteria 5356
39 Ga0070691_10013914 3300005341 Bacteria 3692
40 Ga0070661_100002647 3300005344 Bacteria 12256
41 Ga0070668_100000586 3300005347 Bacteria 24429
42 Ga0070668_100033071 3300005347 Bacteria 3936
43 Ga0070668_100034189 3300005347 Bacteria 3873
44 Ga0070668_100044079 3300005347 Bacteria 3421
45 Ga0070669_100009186 3300005353 Bacteria 7046
46 Ga0070675_100002975 3300005354 Bacteria 12797
47 Ga0070671_100004006 3300005355 Bacteria 11605
48 Ga0070671_100079187 3300005355 Bacteria 2746
49 Ga0070674_100002225 3300005356 Bacteria 10669
50 Ga0070659_100005298 3300005366 Bacteria 9250
51 Ga0070667_100000100 3300005367 Bacteria 108128
52 Ga0070667_100024631 3300005367 Bacteria 5000
53 Ga0070667_100104200 3300005367 Bacteria 2453
54 Ga0070709_10007052 3300005434 Bacteria 6144
55 Ga0070709_10030803 3300005434 Bacteria 3222
56 Ga0070714_100036775 3300005435 Bacteria 4109
57 Ga0070714_100098448 3300005435 Bacteria 2573
58 Ga0070711_100001277 3300005439 Bacteria 13671
59 Ga0070700_100057392 3300005441 Bacteria 2443
60 Ga0070694_100005447 3300005444 Bacteria 7705
61 Ga0070663_100059914 3300005455 Bacteria 2736
62 Ga0070663_100062629 3300005455 Bacteria 2682
63 Ga0070678_100003383 3300005456 Bacteria 8894
64 Ga0070681_10034198 3300005458 Bacteria 5104
65 Ga0070681_10136381 3300005458 Bacteria 2385
66 Ga0068867_100004090 3300005459 Bacteria 10256
67 Ga0068867_100011654 3300005459 Bacteria 6208
68 Ga0068867_100086987 3300005459 Bacteria 2365
69 Ga0068867_100158940 3300005459 Bacteria 1781
70 Ga0070706_100110278 3300005467 Bacteria 2561
71 Ga0070679_100163016 3300005530 Bacteria 2203
72 Ga0070684_100047249 3300005535 Bacteria 3730
73 Ga0068853_100001820 3300005539 Bacteria 15690
74 Ga0070672_100001986 3300005543 Bacteria 12823
75 Ga0070695_100005305 3300005545 Bacteria 7586
76 Ga0070665_100036011 3300005548 Bacteria 4979
77 Ga0070665_100108929 3300005548 Bacteria 2772
78 Ga0068855_100011400 3300005563 Bacteria 10736
79 Ga0068855_100089290 3300005563 Bacteria 3558
80 Ga0068855_100249025 3300005563 Bacteria 1982
81 Ga0070664_100027595 3300005564 Bacteria 4719
82 Ga0068857_100000802 3300005577 Bacteria 23509
83 Ga0068857_100092557 3300005577 Bacteria 2707
84 Ga0068854_100068373 3300005578 Bacteria 2590
85 Ga0068856_100000799 3300005614 Bacteria 33936
86 Ga0068856_100003713 3300005614 Bacteria 15318
87 Ga0068856_100033271 3300005614 Bacteria 5047
88 Ga0068870_10055867 3300005840 Bacteria 2105
89 Ga0068863_100000075 3300005841 Bacteria 109825
90 Ga0068858_100112374 3300005842 Bacteria 2544
91 Ga0068860_100006200 3300005843 Bacteria 12023
92 Ga0068862_100062343 3300005844 Bacteria 3206
93 Ga0068862_100089361 3300005844 Bacteria 2681
94 Ga0081455_10000019 3300005937 Bacteria 173330
95 Ga0081455_10010996 3300005937 Bacteria 9122
96 Ga0081455_10017584 3300005937 Bacteria 6845
97 Ga0081455_10039563 3300005937 Bacteria 4166
98 Ga0081455_10048980 3300005937 Bacteria 3646
99 Ga0081540_1000090 3300005983 Bacteria 95488
100 Ga0081540_1002435 3300005983 Bacteria 15152
101 Ga0081540_1014905 3300005983 Bacteria 4945
102 Ga0081540_1021633 3300005983 Bacteria 3821
103 Ga0081539_10054255 3300005985 Bacteria 2239
104 Ga0075365_10030450 3300006038 Bacteria 3456
105 Ga0075365_10034809 3300006038 Bacteria 3254
106 Ga0075365_10081471 3300006038 Bacteria 2193
107 Ga0075365_10110055 3300006038 Bacteria 1892
108 Ga0075368_10008422 3300006042 Bacteria 3672
109 Ga0075363_100025853 3300006048 Bacteria 2999
110 Ga0075364_10033849 3300006051 Bacteria 3293
111 Ga0070712_100065947 3300006175 Bacteria 2572
112 Ga0075369_10029105 3300006186 Bacteria 2319
113 Ga0097621_100004354 3300006237 Bacteria 9845
114 Ga0097621_100147330 3300006237 Bacteria 2016
115 Ga0068871_100011724 3300006358 Bacteria 6438
116 Ga0075428_100011205 3300006844 Bacteria 9978
117 Ga0075436_100005097 3300006914 Bacteria 9043
118 Ga0075435_100001804 3300007076 Bacteria 13930
119 Ga0075435_100036153 3300007076 Bacteria 3923
120 Ga0105240_10001960 3300009093 Bacteria 34026
121 Ga0105240_10008998 3300009093 Bacteria 14190
122 Ga0105240_10029682 3300009093 Bacteria 7117
123 Ga0105240_10223714 3300009093 Bacteria 2191
124 Ga0105248_10029163 3300009177 Bacteria 6154
125 Ga0105248_10069567 3300009177 Bacteria 3952
126 Ga0105248_10350423 3300009177 Bacteria 1662
127 Ga0105237_10001963 3300009545 Bacteria 26185
128 Ga0105237_10005941 3300009545 Bacteria 13687
129 Ga0105237_10025481 3300009545 Bacteria 6048
130 Ga0105237_10199751 3300009545 Bacteria 1999
131 Ga0105238_10001275 3300009551 Bacteria 25338
132 Ga0105239_10002293 3300010375 Bacteria 24453
133 Ga0105239_10038741 3300010375 Bacteria 5222
134 Ga0105239_10211131 3300010375 Bacteria 2176
135 Ga0105239_10358269 3300010375 Bacteria 1647
136 Ga0105246_10151256 3300011119 Bacteria 1757
137 Ga0157373_10000796 3300013100 Bacteria 24360
138 Ga0157373_10001655 3300013100 Bacteria 17010
139 Ga0157373_10014754 3300013100 Bacteria 5722
140 Ga0157371_10000024 3300013102 Bacteria 281202
141 Ga0157371_10014209 3300013102 Bacteria 6018
142 Ga0157370_10000803 3300013104 Bacteria 39592
143 Ga0157370_10034927 3300013104 Bacteria 4892
144 Ga0157370_10046118 3300013104 Bacteria 4179
145 Ga0157369_10011290 3300013105 Bacteria 10148
146 Ga0157369_10052479 3300013105 Bacteria 4411
147 Ga0157369_10064859 3300013105 Bacteria 3932
148 Ga0157369_10077491 3300013105 Bacteria 3563
149 Ga0157374_10041555 3300013296 Bacteria 4238
150 Ga0157374_10073944 3300013296 Bacteria 3217
151 Ga0157374_10163504 3300013296 Bacteria 2169
152 Ga0157374_10235178 3300013296 Bacteria 1801
153 Ga0157378_10031807 3300013297 Bacteria 4660
154 Ga0157378_10074402 3300013297 Bacteria 3056
155 Ga0157378_10173446 3300013297 Bacteria 2024
156 Ga0157378_10251073 3300013297 Bacteria 1693
157 Ga0163162_10057102 3300013306 Bacteria 3931
158 Ga0163163_10075241 3300014325 Bacteria 3370
159 Ga0163163_10137312 3300014325 Bacteria 2486
160 Ga0157380_10051576 3300014326 Bacteria 3255
161 Ga0157377_10073911 3300014745 Bacteria 1977
162 Ga0157379_10009505 3300014968 Bacteria 8468
163 Ga0214544_1000003 3300021320 Bacteria 643752
164 Ga0214542_1000003 3300021321 Bacteria 435700
165 Ga0214545_1000004 3300021324 Bacteria 453352
166 Ga0214545_1032321 3300021324 Bacteria 2015
167 Ga0214543_1000007 3300021327 Bacteria 414744
168 Ga0213872_10005056 3300021361 Bacteria 6838
169 Ga0213872_10006773 3300021361 Bacteria 5705
170 Ga0213872_10021002 3300021361 Bacteria 3007
171 Ga0213876_10054534 3300021384 Bacteria 2110
172 Ga0213876_10074674 3300021384 Bacteria 1791
173 Ga0209563_100019 3300025230 Bacteria 697828
174 Ga0209563_102362 3300025230 Bacteria 4312
175 Ga0209677_100691 3300025253 Bacteria 17234
176 Ga0209148_1000026 3300025254 Bacteria 629213
177 Ga0209148_1000334 3300025254 Bacteria 64148
178 Ga0209455_1000005 3300025272 Bacteria 1416756
179 Ga0209455_1001915 3300025272 Bacteria 8611
180 Ga0209673_1017288 3300025273 Bacteria 2662
181 Ga0209676_1000031 3300025292 Bacteria 478976
182 Ga0209676_1001039 3300025292 Bacteria 32114
183 Ga0209564_1000407 3300025295 Bacteria 76572
184 Ga0209758_1000015 3300025297 Bacteria 851943
185 Ga0209758_1000224 3300025297 Bacteria 121530
186 Ga0209758_1000451 3300025297 Bacteria 68640
187 Ga0209758_1000692 3300025297 Bacteria 49946
188 Ga0209758_1002514 3300025297 Bacteria 18605
189 Ga0209050_1000274 3300025298 Bacteria 110441
190 Ga0209050_1001337 3300025298 Bacteria 27313
191 Ga0209050_1001369 3300025298 Bacteria 26651
192 Ga0209256_1002302 3300025299 Bacteria 16014
193 Ga0207426_1000201 3300025302 Bacteria 143975
194 Ga0207426_1000942 3300025302 Bacteria 28876
195 Ga0207426_1013591 3300025302 Bacteria 3011
196 Ga0209257_1000164 3300025304 Bacteria 173339
197 Ga0209257_1000294 3300025304 Bacteria 110164
198 Ga0209257_1000625 3300025304 Bacteria 56966
199 Ga0209257_1001187 3300025304 Bacteria 32795
200 Ga0209257_1017428 3300025304 Bacteria 2829
201 Ga0207697_10012823 3300025315 Bacteria 3505
202 Ga0207656_10027030 3300025321 Bacteria 2344
203 Ga0207682_10003417 3300025893 Bacteria 6908
204 Ga0207680_10007360 3300025903 Bacteria 5359
205 Ga0207647_10011348 3300025904 Bacteria 6253
206 Ga0207645_10008651 3300025907 Bacteria 7090
207 Ga0207645_10009718 3300025907 Bacteria 6644
208 Ga0207705_10000246 3300025909 Bacteria 53316
209 Ga0207654_10000322 3300025911 Bacteria 28667
210 Ga0207654_10015660 3300025911 Bacteria 3940
211 Ga0207654_10065300 3300025911 Bacteria 2142
212 Ga0207654_10077354 3300025911 Bacteria 1994
213 Ga0207707_10022843 3300025912 Bacteria 5470
214 Ga0207695_10000065 3300025913 Bacteria 336949
215 Ga0207695_10023256 3300025913 Bacteria 7010
216 Ga0207695_10031376 3300025913 Bacteria 5828
217 Ga0207695_10110026 3300025913 Bacteria 2736
218 Ga0207671_10002286 3300025914 Bacteria 20735
219 Ga0207671_10005589 3300025914 Bacteria 11549
220 Ga0207671_10103116 3300025914 Bacteria 2163
221 Ga0207671_10128303 3300025914 Bacteria 1945
222 Ga0207693_10058037 3300025915 Bacteria 3032
223 Ga0207660_10025804 3300025917 Bacteria 3994
224 Ga0207657_10001672 3300025919 Bacteria 23919
225 Ga0207657_10002325 3300025919 Bacteria 20602
226 Ga0207652_10043862 3300025921 Bacteria 3809
227 Ga0207681_10019631 3300025923 Bacteria 4273
228 Ga0207694_10011765 3300025924 Bacteria 6602
229 Ga0207694_10024903 3300025924 Bacteria 4546
230 Ga0207650_10000586 3300025925 Bacteria 29222
231 Ga0207659_10001806 3300025926 Bacteria 12661
232 Ga0207700_10005941 3300025928 Bacteria 7343
233 Ga0207700_10013065 3300025928 Bacteria 5388
234 Ga0207644_10000698 3300025931 Bacteria 21250
235 Ga0207690_10000421 3300025932 Bacteria 27634
236 Ga0207709_10007407 3300025935 Bacteria 6114
237 Ga0207709_10044641 3300025935 Bacteria 2679
238 Ga0207669_10003282 3300025937 Bacteria 6994
239 Ga0207669_10011394 3300025937 Bacteria 4324
240 Ga0207665_10044013 3300025939 Bacteria 2987
241 Ga0207691_10002196 3300025940 Bacteria 19083
242 Ga0207691_10030972 3300025940 Bacteria 4996
243 Ga0207711_10251688 3300025941 Bacteria 1622
244 Ga0207667_10000010 3300025949 Bacteria 477432
245 Ga0207667_10003761 3300025949 Bacteria 18701
246 Ga0207667_10037005 3300025949 Bacteria 5222
247 Ga0207651_10004618 3300025960 Bacteria 6973
248 Ga0207668_10000707 3300025972 Bacteria 20413
249 Ga0207668_10010436 3300025972 Bacteria 5610
250 Ga0207640_10016998 3300025981 Bacteria 4247
251 Ga0207658_10000079 3300025986 Bacteria 107980
252 Ga0207677_10018894 3300026023 Bacteria 4148
253 Ga0207639_10000380 3300026041 Bacteria 30557
254 Ga0207639_10000489 3300026041 Bacteria 27390
255 Ga0207639_10007232 3300026041 Bacteria 7563
256 Ga0207639_10023039 3300026041 Bacteria 4492
257 Ga0207639_10194205 3300026041 Bacteria 1736
258 Ga0207678_10012602 3300026067 Bacteria 7428
259 Ga0207678_10027540 3300026067 Bacteria 4959
260 Ga0207678_10031781 3300026067 Bacteria 4602
261 Ga0207678_10086134 3300026067 Bacteria 2685
262 Ga0207702_10000052 3300026078 Bacteria 137784
263 Ga0207702_10003125 3300026078 Bacteria 15355
264 Ga0207702_10008579 3300026078 Bacteria 8616
265 Ga0207641_10000381 3300026088 Bacteria 52796
266 Ga0207648_10008034 3300026089 Bacteria 10280
267 Ga0207648_10020435 3300026089 Bacteria 5962
268 Ga0207648_10025701 3300026089 Bacteria 5242
269 Ga0207648_10031888 3300026089 Bacteria 4656
270 Ga0207674_10001713 3300026116 Bacteria 28060
271 Ga0207674_10003867 3300026116 Bacteria 18252
272 Ga0207674_10075682 3300026116 Bacteria 3375
273 Ga0207675_100018348 3300026118 Bacteria 6524
274 Ga0207675_100065418 3300026118 Bacteria 3398
275 Ga0207675_100142298 3300026118 Bacteria 2279
276 Ga0207683_10003946 3300026121 Bacteria 12871
277 Ga0207698_10000929 3300026142 Bacteria 17044
278 Ga0209389_1000064 3300027296 Bacteria 102177
279 Ga0209589_1000007 3300027357 Bacteria 425699
280 Ga0209589_1000012 3300027357 Bacteria 229451
281 Ga0209589_1000013 3300027357 Bacteria 229273
282 Ga0209489_100008 3300027361 Bacteria 425699
283 Ga0209489_100013 3300027361 Bacteria 229831
284 Ga0209489_109381 3300027361 Bacteria 12236
285 Ga0209700_100009 3300027363 Bacteria 425699
286 Ga0209700_100014 3300027363 Bacteria 299349
287 Ga0209179_1002908 3300027512 Bacteria 2390
288 Ga0268266_10001911 3300028379 Bacteria 23444
289 Ga0268266_10011281 3300028379 Bacteria 7776
290 Ga0268266_10107483 3300028379 Bacteria 2467
291 Ga0268264_10012653 3300028381 Bacteria 6946
292 Ga0265338_10031720 3300028800 Bacteria 5173
293 Ga0307511_10045905 3300030521 Bacteria 3603
294 Ga0265340_10011675 3300031247 Bacteria 4662
295 Ga0265331_10000003 3300031250 Bacteria 499358
296 Ga0265327_10031434 3300031251 Bacteria 2983
297 Ga0307508_10077727 3300031616 Bacteria 2898
298 Ga0265314_10015298 3300031711 Bacteria 6093
299 Ga0307516_10023020 3300031730 Bacteria 6391
300 Ga0307409_100100565 3300031995 Bacteria 2397
301 Ga0307510_10005064 3300033180 Bacteria 15634
302 Ga0373936_0009202 3300035113 Bacteria 3723
303 Ga0373943_0021854 3300035170 Bacteria 2958
304 Ga0373946_0025494 3300035171 Bacteria 2325
305 Ga0373955_0014758 3300035172 Bacteria 3810
306 Ga0316574_0022236 3300035398 Bacteria 3775
307 Ga0373931_0009740 3300035691 Bacteria 4600
308 Ga0373931_0029194 3300035691 Bacteria 2829
309 Ga0373927_0000775 3300035695 Bacteria 24436
310 Ga0373927_0021818 3300035695 Bacteria 4196
311 Ga0373933_0016181 3300035724 Bacteria 4168
312 Ga0373933_0071263 3300035724 Bacteria 2115
313 Ga0373937_0144802 3300036401 Bacteria 2224
314 Ga0373925_0000028 3300037068 Bacteria 149654
315 Ga0373925_0046882 3300037068 Bacteria 3215
316 Ga0373925_0091061 3300037068 Bacteria 2332
317 Ga0395899_0000052 3300037312 Bacteria 221643
318 Ga0395900_0000002 3300037418 Bacteria 671103
319 Ga0395900_0000909 3300037418 Bacteria 38980
320 Ga0395900_0003112 3300037418 Bacteria 18015
321 Ga0395898_0003767 3300037466 Bacteria 16795
322 Ga0395898_0009456 3300037466 Bacteria 10238
323 Ga0395898_0011611 3300037466 Bacteria 9142
324 Ga0395898_0101277 3300037466 Bacteria 2766
325 Ga0395905_0002017 3300037471 Bacteria 23212
326 Ga0395905_0002542 3300037471 Bacteria 20129
327 Ga0395905_0108414 3300037471 Bacteria 2607
328 Ga0395901_0000013 3300038443 Bacteria 375733
329 Ga0395901_0011776 3300038443 Bacteria 8869
330 Ga0395901_0156031 3300038443 Bacteria 2397
331 Ga0400485_03340 3300038735 Bacteria 6144
332 Ga0436365_0331714 3300039437 Bacteria 2843
333 Ga0436365_0548581 3300039437 Bacteria 4554
334 Ga0436365_1283347 3300039437 Bacteria 1633
335 Ga0436360_1290082 3300039438 Bacteria 7626
336 Ga0436361_0258847 3300039447 Bacteria 6885
337 Ga0436361_0614681 3300039447 Bacteria 14415
338 Ga0436361_1109572 3300039447 Bacteria 6637
339 Ga0436363_1472254 3300039450 Bacteria 2537
340 Ga0436362_1044482 3300039453 Bacteria 5839
341 Ga0439459_0004356 3300042438 Bacteria 2276
342 Ga0466972_0010137 3300044658 Bacteria 4734
343 Ga0466965_0007271 3300044683 Bacteria 5076
344 Ga0466966_0000307 3300044684 Bacteria 31630
345 Ga0466961_0000019 3300044693 Bacteria 107624
346 Ga0453684_0015353 3300044712 Bacteria 12129
347 Ga0453684_0045664 3300044712 Bacteria 5839
348 Ga0466968_0007745 3300044735 Bacteria 4092
349 Ga0466959_0003016 3300045049 Bacteria 10877
350 Ga0466959_0029003 3300045049 Bacteria 4099
351 Ga0466967_0050491 3300045976 Bacteria 3642
352 Ga0495603_0000155 3300046455 Bacteria 34390
353 Ga0495629_0008861 3300046459 Bacteria 7397
354 Ga0495629_0081912 3300046459 Bacteria 2252
355 Ga0495638_0011434 3300046460 Bacteria 6115
356 Ga0495638_0060945 3300046460 Bacteria 2332
357 Ga0495641_0019321 3300046461 Bacteria 3490
358 Ga0495651_0009075 3300046462 Bacteria 7633
359 Ga0495650_0012495 3300046471 Bacteria 4564
360 Ga0495582_0001091 3300046473 Bacteria 15206
361 Ga0495639_0000146 3300046475 Bacteria 36496
362 Ga0495662_0000242 3300046476 Bacteria 23091
363 Ga0495662_0046405 3300046476 Bacteria 2098
364 Ga0495594_0009471 3300046499 Bacteria 5033
365 Ga0495594_0034604 3300046499 Bacteria 2749
366 Ga0495606_0042970 3300046507 Bacteria 3019
367 Ga0495618_0012862 3300046514 Bacteria 5086
368 Ga0495618_0014438 3300046514 Bacteria 4812
369 Ga0495628_0065385 3300046516 Bacteria 2845
370 Ga0495628_0078376 3300046516 Bacteria 2570
371 Ga0495630_0000634 3300046517 Bacteria 25446
372 Ga0495648_0016191 3300046524 Bacteria 5381
373 Ga0495652_0029126 3300046529 Bacteria 4851
374 Ga0495665_0000150 3300046531 Bacteria 34308
375 Ga0495640_0080623 3300046533 Bacteria 2164
376 Ga0495587_0005059 3300046536 Bacteria 8622
377 Ga0495645_0071672 3300046543 Bacteria 2498
378 Ga0495645_0090765 3300046543 Bacteria 2183
379 Ga0495622_0048081 3300046557 Bacteria 1982
380 Ga0495634_0004743 3300046642 Bacteria 10583
381 Ga0495635_0003884 3300046663 Bacteria 10383
382 Ga0495635_0004842 3300046663 Bacteria 9365
383 Ga0495635_0106150 3300046663 Bacteria 1918
384 Ga0495588_0003110 3300046674 Bacteria 7182
385 Ga0495588_0045938 3300046674 Bacteria 2240
386 Ga0495657_0079504 3300046675 Bacteria 2123
387 Ga0495646_0057941 3300046680 Bacteria 2317
388 Ga0495647_0007725 3300046681 Bacteria 3610
389 Ga0495658_0000284 3300046683 Bacteria 28686
390 Ga0495658_0005532 3300046683 Bacteria 6210
391 Ga0495613_0025101 3300046689 Bacteria 4441
392 Ga0495613_0040760 3300046689 Bacteria 3440
393 Ga0495624_0005153 3300046690 Bacteria 9440
394 Ga0495589_0082396 3300046794 Bacteria 1564
395 Ga0495600_0037047 3300046809 Bacteria 3170
396 Ga0495581_0004087 3300047315 Bacteria 8399
397 Ga0495581_0026572 3300047315 Bacteria 3355
398 Ga0495604_0006962 3300047317 Bacteria 8961
399 Ga0495604_0019089 3300047317 Bacteria 5490
400 Ga0495604_0093909 3300047317 Bacteria 2218
401 Ga0495674_0001343 3300047319 Bacteria 23998
402 Ga0495676_0032064 3300047321 Bacteria 4440
403 Ga0495676_0075253 3300047321 Bacteria 2583
404 Ga0495676_0129177 3300047321 Bacteria 1827
405 Ga0495680_0029476 3300047322 Bacteria 4494
406 Ga0495686_0020906 3300047472 Bacteria 4358
407 Ga0495593_0000406 3300047673 Bacteria 23955
408 Ga0495602_0132388 3300048088 Bacteria 1986
409 Ga0495614_0007106 3300048089 Bacteria 4993
410 Ga0496101_0006150 3300048904 Bacteria 7707
411 Ga0496103_0022544 3300048906 Bacteria 3792
412 Ga0496103_0085940 3300048906 Bacteria 1982
413 Ga0496104_0009643 3300048907 Bacteria 8598
414 Ga0496104_0086729 3300048907 Bacteria 2988
415 Ga0496104_0129332 3300048907 Bacteria 2425
416 Ga0496104_0190614 3300048907 Bacteria 1961
417 Ga0496105_0001282 3300048908 Bacteria 17583
418 Ga0496106_0035954 3300048909 Bacteria 3705
419 Ga0496107_0024390 3300048910 Bacteria 4278
420 Ga0496109_0238823 3300048912 Bacteria 1710
421 Ga0496110_0022399 3300048913 Bacteria 5365
422 Ga0496110_0027218 3300048913 Bacteria 4900
423 Ga0496112_0017745 3300048915 Bacteria 6698
424 Ga0496112_0028570 3300048915 Bacteria 5384
425 Ga0496113_0066391 3300048916 Bacteria 2732
426 Ga0496114_0110648 3300048917 Bacteria 2353
427 Ga0496115_0002807 3300048918 Bacteria 12524
428 Ga0496115_0023575 3300048918 Bacteria 4776
429 Ga0496115_0056812 3300048918 Bacteria 3146
430 Ga0496116_0041637 3300048919 Bacteria 3150
431 Ga0496118_0027761 3300048921 Bacteria 4782
432 Ga0496118_0033644 3300048921 Bacteria 4201
433 Ga0496119_0068273 3300048922 Bacteria 2093
434 Ga0496120_0014768 3300048923 Bacteria 5183
435 Ga0496121_0000194 3300048924 Bacteria 136324
436 Ga0496121_0047342 3300048924 Bacteria 3670
437 Ga0496122_0045154 3300048925 Bacteria 3428
438 Ga0496124_0087985 3300048927 Bacteria 2540
439 Ga0496124_0095460 3300048927 Bacteria 2417
440 Ga0496125_0000715 3300048928 Bacteria 54933
441 Ga0496125_0004868 3300048928 Bacteria 15240
442 Ga0496126_0001525 3300048929 Bacteria 35645
443 Ga0496126_0011236 3300048929 Bacteria 9289
444 Ga0496126_0054806 3300048929 Bacteria 3609
445 Ga0496126_0062911 3300048929 Bacteria 3328
446 Ga0496126_0065434 3300048929 Bacteria 3253
447 Ga0496126_0221947 3300048929 Bacteria 1587
448 Ga0501031_0006214 3300049568 Bacteria 7792
449 Ga0501032_0000189 3300049569 Bacteria 50924
450 Ga0501032_0000454 3300049569 Bacteria 33130
451 Ga0501033_0000206 3300049570 Bacteria 56405
452 Ga0501033_0000493 3300049570 Bacteria 37227
453 Ga0501034_0000159 3300049571 Bacteria 127397
454 Ga0501034_0007343 3300049571 Bacteria 11740
455 Ga0501034_0018658 3300049571 Bacteria 7110
456 Ga0501036_0000039 3300049572 Bacteria 83065
457 Ga0501036_0000134 3300049572 Bacteria 47683
458 Ga0501036_0157016 3300049572 Bacteria 1918
459 Ga0501037_0001316 3300049573 Bacteria 18220
460 Ga0501037_0002272 3300049573 Bacteria 13880
461 Ga0501038_0000371 3300049574 Bacteria 38754
462 Ga0501038_0070049 3300049574 Bacteria 2978
463 Ga0501039_0000064 3300049575 Bacteria 83415
464 Ga0501039_0000926 3300049575 Bacteria 21446
465 Ga0501042_0031530 3300049578 Bacteria 3750
466 Ga0501043_0000202 3300049579 Bacteria 54441
467 Ga0501043_0002576 3300049579 Bacteria 15337
468 Ga0501046_0000397 3300049580 Bacteria 43539
469 Ga0501046_0053080 3300049580 Bacteria 3193
470 Ga0501046_0072192 3300049580 Bacteria 2680
471 Ga0501047_0000288 3300049581 Bacteria 57965
472 Ga0501047_0000866 3300049581 Bacteria 30920
473 Ga0501047_0039014 3300049581 Bacteria 4594
474 Ga0501047_0069692 3300049581 Bacteria 3386
475 Ga0501047_0107131 3300049581 Bacteria 2676
476 Ga0501047_0114156 3300049581 Bacteria 2583
477 Ga0501048_0001300 3300049582 Bacteria 18963
478 Ga0501067_0000229 3300049583 Bacteria 31115
479 Ga0501067_0000333 3300049583 Bacteria 25656
480 Ga0501068_0003851 3300049584 Bacteria 8144
481 Ga0501068_0003945 3300049584 Bacteria 8067
482 Ga0501068_0012484 3300049584 Bacteria 4819
483 Ga0501069_0005415 3300049585 Bacteria 6637
484 Ga0501070_0003517 3300049586 Bacteria 13551
485 Ga0501070_0003638 3300049586 Bacteria 13324
486 Ga0501070_0033554 3300049586 Bacteria 4295
487 Ga0501072_0011869 3300049588 Bacteria 6654
488 Ga0501073_0000004 3300049589 Bacteria 261794
489 Ga0501073_0000034 3300049589 Bacteria 95224
490 Ga0501073_0008652 3300049589 Bacteria 7542
491 Ga0501074_0005987 3300049590 Bacteria 8773
492 Ga0501077_0000608 3300049593 Bacteria 21739
493 Ga0501079_0020670 3300049741 Bacteria 5032
494 Ga0501080_0000200 3300049742 Bacteria 44051
495 Ga0501080_0000846 3300049742 Bacteria 25014
496 Ga0501080_0003415 3300049742 Bacteria 14003
497 Ga0501080_0010149 3300049742 Bacteria 8611
498 Ga0501080_0016647 3300049742 Bacteria 6790
499 Ga0501080_0045311 3300049742 Bacteria 4094
500 Ga0501083_0000118 3300049744 Bacteria 54096
501 Ga0501083_0047396 3300049744 Bacteria 2903
502 Ga0501262_001551 3300049759 Bacteria 2573
503 Ga0501035_0000137 3300049822 Bacteria 89273
504 Ga0501035_0000598 3300049822 Bacteria 39723
505 Ga0501035_0103306 3300049822 Bacteria 2500
506 Ga0501044_0000246 3300049823 Bacteria 68756
507 Ga0501044_0000431 3300049823 Bacteria 51668
508 Ga0501044_0000887 3300049823 Bacteria 36069
509 Ga0501044_0001810 3300049823 Bacteria 24919
510 Ga0501044_0008629 3300049823 Bacteria 11158
511 Ga0501044_0067293 3300049823 Bacteria 3650
512 Ga0501044_0084442 3300049823 Bacteria 3209
513 Ga0501204_000205 3300049850 Bacteria 4762
514 nmdc:mga00v17_19332_c1 3300050491 Bacteria 3888
515 nmdc:mga0yw44_29695_c1 3300050492 Bacteria 3159
516 nmdc:mga0yw44_72772_c1 3300050492 Bacteria 2137
517 nmdc:mga06z11_5802_c1 3300050494 Bacteria 4980
518 nmdc:mga05p37_43459_c1 3300050507 Bacteria 5528
519 nmdc:mga08y16_46890_c1 3300050511 Bacteria 4523
520 nmdc:mga0n895_6061_c1 3300050512 Bacteria 10193
521 nmdc:mga0rr50_29370_c1 3300050513 Bacteria 3877
522 nmdc:mga0rr50_3571_c1 3300050513 Bacteria 8983
523 Ga0495601_0086286 3300053077 Bacteria 2017
524 Ga0495619_0002245 3300053085 Bacteria 12785
525 Ga0500643_000062 3300053087 Bacteria 122407
526 Ga0500583_0009396 3300053092 Bacteria 3572
527 Ga0500566_0000535 3300053094 Bacteria 21307
528 Ga0500641_0005395 3300053096 Bacteria 4533
529 Ga0500641_0027617 3300053096 Bacteria 2210
530 Ga0500557_000158 3300053105 Bacteria 15084
531 Ga0500562_005120 3300053108 Bacteria 3294
532 Ga0500595_000668 3300053119 Bacteria 20579
533 Ga0500595_000776 3300053119 Bacteria 18688
534 Ga0500642_0000350 3300053130 Bacteria 15587
535 Ga0500603_001364 3300053150 Bacteria 5582
536 Ga0500616_0088924 3300053153 Bacteria 1534
537 Ga0500619_003384 3300053154 Bacteria 3257
538 Ga0500627_0000020 3300053158 Bacteria 109977
539 Ga0500638_005004 3300053162 Bacteria 5213
540 Ga0500636_0000908 3300053177 Bacteria 15939
541 Ga0500637_0007521 3300053178 Bacteria 5451
542 Ga0500625_000845 3300053729 Bacteria 9398
543 Ga0500645_008626 3300053730 Bacteria 3465
544 Ga0500599_002001 3300053736 Bacteria 2409
545 Ga0500601_001310 3300053737 Bacteria 2753
546 Ga0501084_0037894 3300054114 Bacteria 4029
547 Ga0501084_0095078 3300054114 Bacteria 2502
548 Ga0501082_0002445 3300060353 Bacteria 16303
549 2507504892 2507262055 Bacteria 8048963
550 2508546245 2508501009 Bacteria 7784016
551 2508695177 2508501042 Bacteria 8719808
552 2509149833 2508501128 Bacteria 8613869
553 2511398348 2511231028 Bacteria 8046582
554 2513626714 2513237092 Bacteria 8341956
555 2513639600 2513237094 Bacteria 8789602
556 2513647914 2513237095 Bacteria 8976980
557 2513657647 2513237096 Bacteria 8722461
558 2513676172 2513237098 Bacteria 9902361
559 2513693335 2513237101 Bacteria 7952346
560 2513699011 2513237101 Bacteria 7952346
561 2513703995 2513237102 Bacteria 7703324
562 2513715750 2513237104 Bacteria 10034502
563 2513862114 2513237137 Bacteria 9558895
564 2513873861 2513237139 Bacteria 8737671
565 2513919646 2513237145 Bacteria 8979722
566 2514012832 2513237161 Bacteria 8871253
567 2515625814 2515154112 Bacteria 8294334
568 2517102337 2517093001 Bacteria 9002274
569 2517895357 2517572143 Bacteria 9484767
570 2524435785 2524023205 Bacteria 8918781
571 2524466530 2524023210 Bacteria 9029266
572 2524540935 2524023228 Bacteria 10118060
573 2528851639 2528768022 Bacteria 10457665
574 2617351756 2617270735 Bacteria 9163226
575 2617374068 2617270741 Bacteria 8201522
576 2643821389 2643221560 Bacteria 4801179
577 2643832649 2643221563 Bacteria 4726935
578 2644053556 2643221608 Bacteria 4724829
579 2644088584 2643221614 Bacteria 4260023
580 2644343819 2643221661 Bacteria 4267604
581 2644368702 2643221666 Bacteria 4265935
582 2671120274 2667528175 Bacteria 7532676
583 2723848249 2721755755 Bacteria 8322773
584 2728751267 2728368998 Bacteria 8720350
585 2745079082 2744054633 Bacteria 8678936
586 2793063064 2791355196 Bacteria 7323613
587 2793069330 2791355197 Bacteria 8420563
588 2793081955
589 2805915944 2802429603 Bacteria 8777136
590 2818237328 2816332527 Bacteria 8933356
591 2824602624 2824600985 Bacteria 8488197
592 2824612596 2824609381 Bacteria 8672835
593 2824621059 2824617872 Bacteria 8814715
594 2824630066 2824626560 Bacteria 8813858
595 2824637918 2824635225 Bacteria 8785348
596 2824646371 2824644064 Bacteria 8743947
597 2824654411 2824653114 Bacteria 8493680
598 2824664780 2824661429 Bacteria 9877870
599 2824676739 2824671348 Bacteria 8369588
600 2824682087 2824679649 Bacteria 8248951
601 2824692958 2824687955 Bacteria 8360029
602 2824697599 2824696289 Bacteria 8335049
603 2824708712 2824704595 Bacteria 9667483
604 2824718730 2824714736 Bacteria 8717648
605 2824726345 2824723954 Bacteria 8758240
606 2824735349 2824732956 Bacteria 7810675
607 2824749104 2824746037 Bacteria 7911610
608 2824757072 2824753945 Bacteria 9787441
609 2824768408 2824763712 Bacteria 9792355
610 2824774889 2824773399 Bacteria 8360218
611 2838124168 2838122688 Bacteria 8803140
612 2841944516 2841941048 Bacteria 8688029
613 2841951654 2841949485 Bacteria 8680857
614 2841964796 2841957949 Bacteria 8652217
615 2841969292 2841966195 Bacteria 8673214
616 2841980309 2841974524 Bacteria 8931498
617 2841985561 2841983080 Bacteria 8395090
618 2842043830 2842038055 Bacteria 8002051
619 2842052180 2842045827 Bacteria 8006841
620 2844321872 2844315083 Bacteria 8138177
621 2847931421 2847930680 Bacteria 9342022
622 2847941806 2847939898 Bacteria 8606328
623 2849082723 2849076700 Bacteria 7039503
624 2857511618 2857509624 Bacteria 7472071
625 2874596886 2874590934 Bacteria 8299676
626 2874607540 2874604998 Bacteria 7834745
627 2874617712 2874612657 Bacteria 8252029
628 2874624468 2874620515 Bacteria 8290088
629 2874629172 2874628541 Bacteria 8630250
630 2874648691 2874645413 Bacteria 8214782
631 2876768995 2876761206 Bacteria 10111113
632 2876777350 2876771140 Bacteria 8287509
633 2876809720 2876808645 Bacteria 8824342
634 2876825432 2876818435 Bacteria 8274608
635 2879077681 2879074833 Bacteria 8279565
636 2879087543 2879083081 Bacteria 8587928
637 2879107276 2879099564 Bacteria 10442239
638 2879110978 2879110137 Bacteria 8907982
639 2879131436 2879127579 Bacteria 8294491
640 2879144396 2879142872 Bacteria 8267021
641 2881370954 2881364244 Bacteria 7710352
642 2881665743 2881665667 Bacteria 8175609
643 2884964596 2884960567 Bacteria 5437054
644 2885371353 2885366525 Bacteria 8326213
645 2885377599 2885374607 Bacteria 8927485
646 2885411216 2885409591 Bacteria 9235467
647 2888379915 2888378607 Bacteria 9652610
648 2888390989 2888388044 Bacteria 7304136
649 2888420722 2888419890 Bacteria 7857137
650 2889037234 2889033259 Bacteria 9099371
651 2903727578 2903727486 Bacteria 8281579
652 2903757627 2903748898 Bacteria 9972761
653 2903774251 2903768456 Bacteria 9749579
654 2904672193 2904666416 Bacteria 8226587
655 2904698694 2904690495 Bacteria 9412302
656 2904710812
657 2904716225 2904711408 Bacteria 9771557
658 2906602932 2906602504 Bacteria 8295279
659 2906616034
660 2906633483 2906626472 Bacteria 8826946
661 2906635619 2906635258 Bacteria 8601019
662 2906649065 2906643746 Bacteria 8722424
663 2906665267 2906660503 Bacteria 8595048
664 2908741042 2908739725 Bacteria 8628932
665 2908763168 2908756301 Bacteria 8864324
666 2908776545 2908775508 Bacteria 8092255
667 2922361372 2922361189 Bacteria 7436256
668 2922378296
669 2922392988 2922386360 Bacteria 7017218
670 2922396623 2922393267 Bacteria 8285685
671 2922431998
672 2929622602 2929615660 Bacteria 9193770
673 2929631180 2929624759 Bacteria 9339455
674 2932786397 2932784394 Bacteria 9704911
675 2932794638 2932794094 Bacteria 7915132
676 2932806919 2932801729 Bacteria 7987968
677 2932812528 2932809354 Bacteria 9135765
678 2932822890 2932818245 Bacteria 9955613
679 2932829635 2932828146 Bacteria 9745859
680 2933584319 2933577622 Bacteria 9116884
681 2935614910 2935608549 Bacteria 8203142
682 2935618153 2935616580 Bacteria 9032984
683 2935631126 2935630451 Bacteria 8169952
684 2935641449 2935638405 Bacteria 10015038
685 2935652938 2935648319 Bacteria 8801166
686 2935661521 2935656913 Bacteria 8965014
687 2935669493 2935665750 Bacteria 9571747
688 2935677909 2935675223 Bacteria 9928132
689 2935689642 2935684952 Bacteria 9590419
690 2935698178 2935694250 Bacteria 9291695
691 2935707318 2935703347 Bacteria 10242284
692 2935717162 2935713505 Bacteria 9608509
693 2935730004 2935722832 Bacteria 9608746
694 2935738577 2935732158 Bacteria 9706831
695 2935749175 2935741537 Bacteria 9707219
696 2935756996 2935750917 Bacteria 9590372
697 2935764393 2935760218 Bacteria 9817913
698 2935772729 2935769743 Bacteria 7878163
699 2935778134 2935777560 Bacteria 8077691
700 2935787362 2935785616 Bacteria 7962367
701 2935795850 2935793552 Bacteria 8012592
702 2935804303 2935801545 Bacteria 9301974
703 2935815387 2935810662 Bacteria 9401221
704 2935826050 2935819856 Bacteria 8261050
705 2935831180 2935827899 Bacteria 10038562
706 2935841789 2935837841 Bacteria 9454360
707 2935851669 2935847175 Bacteria 8228321
708 2935856348 2935855204 Bacteria 9035059
709 2935866320 2935864058 Bacteria 9784707
710 2935874626 2935873716 Bacteria 9632195
711 2935890331 2935883170 Bacteria 7964738
712 2935910309 2935908558 Bacteria 8568796
713 2935918405 2935916978 Bacteria 9113783
714 2935927780 2935926038 Bacteria 8601059
715 2935936348 2935934488 Bacteria 8602579
716 2935944099 2935942939 Bacteria 8599779
717 2935952536 2935951376 Bacteria 8602333
718 2935962329 2935959822 Bacteria 7869783
719 2935969376 2935967501 Bacteria 8603075
720 2935977856 2935975950 Bacteria 8347125
721 2935984838 2935984226 Bacteria 8302647
722 2935994087 2935992306 Bacteria 9802711
723 2936004902 2936002035 Bacteria 9362176
724 2936015750 2936011229 Bacteria 8801034
725 2936024384 2936019824 Bacteria 8804134
726 2936031729 2936028420 Bacteria 8965941
727 2936045042 2936037263 Bacteria 9446081
728 2936051551 2936046547 Bacteria 8903709
729 2936056009 2936055302 Bacteria 8785755
730 2940562910 2940556831 Bacteria 9590747
731 2941507778 2941507105 Bacteria 8166816
732 2941516204 2941515067 Bacteria 8166720
733 2941523087 2941523033 Bacteria 8169134
734 2941532394 2941531003 Bacteria 7653939
735 2941543862 2941538514 Bacteria 9402094
736 3005476984 3005474847 Bacteria 9259049
737 3005487329 3005483717 Bacteria 7877331
738 3005509495 3005506211 Bacteria 6943378
739 3005589487 3005587118 Bacteria 7794411
740 3005602210 3005594810 Bacteria 8716512
741 3005717976 3005710791 Bacteria 7622528
742 3005724999 3005718088 Bacteria 8283608
743 8006932718 8006926726 Bacteria 6749210
744 8006934438 8006933436 Bacteria 10410654
745 8006970801 8006964411 Bacteria 8966052
746 8006974408 8006973647 Bacteria 10679141
747 8006988808 8006984368 Bacteria 9651211
748 8006998615 8006994254 Bacteria 8309700
749 8016518568 8016511872 Bacteria 9921665
750 8016526550 8016522445 Bacteria 8156687
751 8016544833 8016539877 Bacteria 8155419
752 8016557248 8016548790 Bacteria 8155074
753 8016582485 8016575299 Bacteria 8154085
754 8016603212 8016595262 Bacteria 8149947
755 8016606136 8016603502 Bacteria 8731218
756 8016623556 8016622563 Bacteria 7999408
757 8016636035 8016630954 Bacteria 9217207
758 8017058097 8017057580 Bacteria 10023680
759 8019531456 8019530166 Bacteria 8155624
760 8019540073 8019538911 Bacteria 7872763
761 8019577633 8019576017 Bacteria 10049540
762 8019606031 8019597564 Bacteria 10041141
763 8019622611 8019619141 Bacteria 9218857
764 8019630498 8019629233 Bacteria 8687553
765 8019640111 8019638758 Bacteria 9062356
766 8019652826 8019648815 Bacteria 10014479
767 8019667327 8019659431 Bacteria 8577854
768 8019678883 8019678201 Bacteria 8863603
769 8055751053 8055742211 Bacteria 9226248
770 8056675843 8056673599 Bacteria 7871253
771 8056687645 8056681323 Bacteria 8472857
772 8056690375 8056689827 Bacteria 6712655
773 8056970967 8056967851 Bacteria 9038162
774 8057101914 8057101203 Bacteria 5034064
775 8057104256 8057101203 Bacteria 5034064
776 Ga0466972_0000103
777 JGI24741J21665_1000833
778 JGI24737J22298_10001234
779 JGI25406J46586_10009769
780 JGI25153J46596_10001223
781 JGI25153J46596_10002514
782 JGI25153J46596_10002599
783 JGI25153J46596_10007823
784 rootH2_10024294
785 rootL2_10003341
786 JGI25160J50197_1000470
787 Ga0055525_1000040
788 Ga0055542_1000046
789 Ga0055529_1000007
790 Ga0055536_1003010
791 Ga0055536_1005055
792 Ga0055530_10000616
793 Ga0055530_10002020
794 Ga0055530_10007670
795 Ga0055531_10002037
796 Ga0055531_10002474
797 Ga0055531_10020740
798 Ga0065165_1001024
799 Ga0065165_1002115
800 Ga0065165_1005641
801 Ga0065165_1008761
802 Ga0065712_10071442
803 Ga0065715_10097494
804 Ga0070658_10006842
805 Ga0070676_10040358
806 Ga0070683_100073753
807 Ga0070683_100074923
808 Ga0070670_100005916
809 Ga0070670_100106124
810 Ga0070677_10003465
811 Ga0068869_100023430
812 Ga0070666_10004262
813 Ga0070680_100019665
814 Ga0070691_10013914
815 Ga0070661_100002647
816 Ga0070668_100000586
817 Ga0070668_100033071
818 Ga0070668_100034189
819 Ga0070668_100044079
820 Ga0070669_100009186
821 Ga0070675_100002975
822 Ga0070671_100004006
823 Ga0070671_100079187
824 Ga0070674_100002225
825 Ga0070659_100005298
826 Ga0070667_100000100
827 Ga0070667_100024631
828 Ga0070667_100104200
829 Ga0070709_10007052
830 Ga0070709_10030803
831 Ga0070714_100036775
832 Ga0070714_100098448
833 Ga0070711_100001277
834 Ga0070700_100057392
835 Ga0070694_100005447
836 Ga0070663_100059914
837 Ga0070663_100062629
838 Ga0070678_100003383
839 Ga0070681_10034198
840 Ga0070681_10136381
841 Ga0068867_100004090
842 Ga0068867_100011654
843 Ga0068867_100086987
844 Ga0068867_100158940
845 Ga0070706_100110278
846 Ga0070679_100163016
847 Ga0070684_100047249
848 Ga0068853_100001820
849 Ga0070672_100001986
850 Ga0070695_100005305
851 Ga0070665_100036011
852 Ga0070665_100108929
853 Ga0068855_100011400
854 Ga0068855_100089290
855 Ga0068855_100249025
856 Ga0070664_100027595
857 Ga0068857_100000802
858 Ga0068857_100092557
859 Ga0068854_100068373
860 Ga0068856_100000799
861 Ga0068856_100003713
862 Ga0068856_100033271
863 Ga0068870_10055867
864 Ga0068863_100000075
865 Ga0068858_100112374
866 Ga0068860_100006200
867 Ga0068862_100062343
868 Ga0068862_100089361
869 Ga0081455_10000019
870 Ga0081455_10010996
871 Ga0081455_10017584
872 Ga0081455_10039563
873 Ga0081455_10048980
874 Ga0081540_1000090
875 Ga0081540_1002435
876 Ga0081540_1014905
877 Ga0081540_1021633
878 Ga0081539_10054255
879 Ga0075365_10030450
880 Ga0075365_10034809
881 Ga0075365_10081471
882 Ga0075365_10110055
883 Ga0075368_10008422
884 Ga0075363_100025853
885 Ga0075364_10033849
886 Ga0070712_100065947
887 Ga0075369_10029105
888 Ga0097621_100004354
889 Ga0097621_100147330
890 Ga0068871_100011724
891 Ga0075428_100011205
892 Ga0075436_100005097
893 Ga0075435_100001804
894 Ga0075435_100036153
895 Ga0105240_10001960
896 Ga0105240_10008998
897 Ga0105240_10029682
898 Ga0105240_10223714
899 Ga0105248_10029163
900 Ga0105248_10069567
901 Ga0105248_10350423
902 Ga0105237_10001963
903 Ga0105237_10005941
904 Ga0105237_10025481
905 Ga0105237_10199751
906 Ga0105238_10001275
907 Ga0105239_10002293
908 Ga0105239_10038741
909 Ga0105239_10211131
910 Ga0105239_10358269
911 Ga0105246_10151256
912 Ga0157373_10000796
913 Ga0157373_10001655
914 Ga0157373_10014754
915 Ga0157371_10000024
916 Ga0157371_10014209
917 Ga0157370_10000803
918 Ga0157370_10034927
919 Ga0157370_10046118
920 Ga0157369_10011290
921 Ga0157369_10052479
922 Ga0157369_10064859
923 Ga0157369_10077491
924 Ga0157374_10041555
925 Ga0157374_10073944
926 Ga0157374_10163504
927 Ga0157374_10235178
928 Ga0157378_10031807
929 Ga0157378_10074402
930 Ga0157378_10173446
931 Ga0157378_10251073
932 Ga0163162_10057102
933 Ga0163163_10075241
934 Ga0163163_10137312
935 Ga0157380_10051576
936 Ga0157377_10073911
937 Ga0157379_10009505
938 Ga0214544_1000003
939 Ga0214542_1000003
940 Ga0214545_1000004
941 Ga0214545_1032321
942 Ga0214543_1000007
943 Ga0213872_10005056
944 Ga0213872_10006773
945 Ga0213872_10021002
946 Ga0213876_10054534
947 Ga0213876_10074674
948 Ga0209563_100019
949 Ga0209563_102362
950 Ga0209677_100691
951 Ga0209148_1000026
952 Ga0209148_1000334
953 Ga0209455_1000005
954 Ga0209455_1001915
955 Ga0209673_1017288
956 Ga0209676_1000031
957 Ga0209676_1001039
958 Ga0209564_1000407
959 Ga0209758_1000015
960 Ga0209758_1000224
961 Ga0209758_1000451
962 Ga0209758_1000692
963 Ga0209758_1002514
964 Ga0209050_1000274
965 Ga0209050_1001337
966 Ga0209050_1001369
967 Ga0209256_1002302
968 Ga0207426_1000201
969 Ga0207426_1000942
970 Ga0207426_1013591
971 Ga0209257_1000164
972 Ga0209257_1000294
973 Ga0209257_1000625
974 Ga0209257_1001187
975 Ga0209257_1017428
976 Ga0207697_10012823
977 Ga0207656_10027030
978 Ga0207682_10003417
979 Ga0207680_10007360
980 Ga0207647_10011348
981 Ga0207645_10008651
982 Ga0207645_10009718
983 Ga0207705_10000246
984 Ga0207654_10000322
985 Ga0207654_10015660
986 Ga0207654_10065300
987 Ga0207654_10077354
988 Ga0207707_10022843
989 Ga0207695_10000065
990 Ga0207695_10023256
991 Ga0207695_10031376
992 Ga0207695_10110026
993 Ga0207671_10002286
994 Ga0207671_10005589
995 Ga0207671_10103116
996 Ga0207671_10128303
997 Ga0207693_10058037
998 Ga0207660_10025804
999 Ga0207657_10001672
1000 Ga0207657_10002325
1001 Ga0207652_10043862
1002 Ga0207681_10019631
1003 Ga0207694_10011765
1004 Ga0207694_10024903
1005 Ga0207650_10000586
1006 Ga0207659_10001806
1007 Ga0207700_10005941
1008 Ga0207700_10013065
1009 Ga0207644_10000698
1010 Ga0207690_10000421
1011 Ga0207709_10007407
1012 Ga0207709_10044641
1013 Ga0207669_10003282
1014 Ga0207669_10011394
1015 Ga0207665_10044013
1016 Ga0207691_10002196
1017 Ga0207691_10030972
1018 Ga0207711_10251688
1019 Ga0207667_10000010
1020 Ga0207667_10003761
1021 Ga0207667_10037005
1022 Ga0207651_10004618
1023 Ga0207668_10000707
1024 Ga0207668_10010436
1025 Ga0207640_10016998
1026 Ga0207658_10000079
1027 Ga0207677_10018894
1028 Ga0207639_10000380
1029 Ga0207639_10000489
1030 Ga0207639_10007232
1031 Ga0207639_10023039
1032 Ga0207639_10194205
1033 Ga0207678_10012602
1034 Ga0207678_10027540
1035 Ga0207678_10031781
1036 Ga0207678_10086134
1037 Ga0207702_10000052
1038 Ga0207702_10003125
1039 Ga0207702_10008579
1040 Ga0207641_10000381
1041 Ga0207648_10008034
1042 Ga0207648_10020435
1043 Ga0207648_10025701
1044 Ga0207648_10031888
1045 Ga0207674_10001713
1046 Ga0207674_10003867
1047 Ga0207674_10075682
1048 Ga0207675_100018348
1049 Ga0207675_100065418
1050 Ga0207675_100142298
1051 Ga0207683_10003946
1052 Ga0207698_10000929
1053 Ga0209389_1000064
1054 Ga0209589_1000007
1055 Ga0209589_1000012
1056 Ga0209589_1000013
1057 Ga0209489_100008
1058 Ga0209489_100013
1059 Ga0209489_109381
1060 Ga0209700_100009
1061 Ga0209700_100014
1062 Ga0209179_1002908
1063 Ga0268266_10001911
1064 Ga0268266_10011281
1065 Ga0268266_10107483
1066 Ga0268264_10012653
1067 Ga0265338_10031720
1068 Ga0307511_10045905
1069 Ga0265340_10011675
1070 Ga0265331_10000003
1071 Ga0265327_10031434
1072 Ga0307508_10077727
1073 Ga0265314_10015298
1074 Ga0307516_10023020
1075 Ga0307409_100100565
1076 Ga0307510_10005064
1077 Ga0373936_0009202
1078 Ga0373943_0021854
1079 Ga0373946_0025494
1080 Ga0373955_0014758
1081 Ga0316574_0022236
1082 Ga0373931_0009740
1083 Ga0373931_0029194
1084 Ga0373927_0000775
1085 Ga0373927_0021818
1086 Ga0373933_0016181
1087 Ga0373933_0071263
1088 Ga0373937_0144802
1089 Ga0373925_0000028
1090 Ga0373925_0046882
1091 Ga0373925_0091061
1092 Ga0395899_0000052
1093 Ga0395900_0000002
1094 Ga0395900_0000909
1095 Ga0395900_0003112
1096 Ga0395898_0003767
1097 Ga0395898_0009456
1098 Ga0395898_0011611
1099 Ga0395898_0101277
1100 Ga0395905_0002017
1101 Ga0395905_0002542
1102 Ga0395905_0108414
1103 Ga0395901_0000013
1104 Ga0395901_0011776
1105 Ga0395901_0156031
1106 Ga0400485_03340
1107 Ga0436365_0331714
1108 Ga0436365_0548581
1109 Ga0436365_1283347
1110 Ga0436360_1290082
1111 Ga0436361_0258847
1112 Ga0436361_0614681
1113 Ga0436361_1109572
1114 Ga0436363_1472254
1115 Ga0436362_1044482
1116 Ga0439459_0004356
1117 Ga0466972_0010137
1118 Ga0466965_0007271
1119 Ga0466966_0000307
1120 Ga0466961_0000019
1121 Ga0453684_0015353
1122 Ga0453684_0045664
1123 Ga0466968_0007745
1124 Ga0466959_0003016
1125 Ga0466959_0029003
1126 Ga0466967_0050491
1127 Ga0495603_0000155
1128 Ga0495629_0008861
1129 Ga0495629_0081912
1130 Ga0495638_0011434
1131 Ga0495638_0060945
1132 Ga0495641_0019321
1133 Ga0495651_0009075
1134 Ga0495650_0012495
1135 Ga0495582_0001091
1136 Ga0495639_0000146
1137 Ga0495662_0000242
1138 Ga0495662_0046405
1139 Ga0495594_0009471
1140 Ga0495594_0034604
1141 Ga0495606_0042970
1142 Ga0495618_0012862
1143 Ga0495618_0014438
1144 Ga0495628_0065385
1145 Ga0495628_0078376
1146 Ga0495630_0000634
1147 Ga0495648_0016191
1148 Ga0495652_0029126
1149 Ga0495665_0000150
1150 Ga0495640_0080623
1151 Ga0495587_0005059
1152 Ga0495645_0071672
1153 Ga0495645_0090765
1154 Ga0495622_0048081
1155 Ga0495634_0004743
1156 Ga0495635_0003884
1157 Ga0495635_0004842
1158 Ga0495635_0106150
1159 Ga0495588_0003110
1160 Ga0495588_0045938
1161 Ga0495657_0079504
1162 Ga0495646_0057941
1163 Ga0495647_0007725
1164 Ga0495658_0000284
1165 Ga0495658_0005532
1166 Ga0495613_0025101
1167 Ga0495613_0040760
1168 Ga0495624_0005153
1169 Ga0495589_0082396
1170 Ga0495600_0037047
1171 Ga0495581_0004087
1172 Ga0495581_0026572
1173 Ga0495604_0006962
1174 Ga0495604_0019089
1175 Ga0495604_0093909
1176 Ga0495674_0001343
1177 Ga0495676_0032064
1178 Ga0495676_0075253
1179 Ga0495676_0129177
1180 Ga0495680_0029476
1181 Ga0495686_0020906
1182 Ga0495593_0000406
1183 Ga0495602_0132388
1184 Ga0495614_0007106
1185 Ga0496101_0006150
1186 Ga0496103_0022544
1187 Ga0496103_0085940
1188 Ga0496104_0009643
1189 Ga0496104_0086729
1190 Ga0496104_0129332
1191 Ga0496104_0190614
1192 Ga0496105_0001282
1193 Ga0496106_0035954
1194 Ga0496107_0024390
1195 Ga0496109_0238823
1196 Ga0496110_0022399
1197 Ga0496110_0027218
1198 Ga0496112_0017745
1199 Ga0496112_0028570
1200 Ga0496113_0066391
1201 Ga0496114_0110648
1202 Ga0496115_0002807
1203 Ga0496115_0023575
1204 Ga0496115_0056812
1205 Ga0496116_0041637
1206 Ga0496118_0027761
1207 Ga0496118_0033644
1208 Ga0496119_0068273
1209 Ga0496120_0014768
1210 Ga0496121_0000194
1211 Ga0496121_0047342
1212 Ga0496122_0045154
1213 Ga0496124_0087985
1214 Ga0496124_0095460
1215 Ga0496125_0000715
1216 Ga0496125_0004868
1217 Ga0496126_0001525
1218 Ga0496126_0011236
1219 Ga0496126_0054806
1220 Ga0496126_0062911
1221 Ga0496126_0065434
1222 Ga0496126_0221947
1223 Ga0501031_0006214
1224 Ga0501032_0000189
1225 Ga0501032_0000454
1226 Ga0501033_0000206
1227 Ga0501033_0000493
1228 Ga0501034_0000159
1229 Ga0501034_0007343
1230 Ga0501034_0018658
1231 Ga0501036_0000039
1232 Ga0501036_0000134
1233 Ga0501036_0157016
1234 Ga0501037_0001316
1235 Ga0501037_0002272
1236 Ga0501038_0000371
1237 Ga0501038_0070049
1238 Ga0501039_0000064
1239 Ga0501039_0000926
1240 Ga0501042_0031530
1241 Ga0501043_0000202
1242 Ga0501043_0002576
1243 Ga0501046_0000397
1244 Ga0501046_0053080
1245 Ga0501046_0072192
1246 Ga0501047_0000288
1247 Ga0501047_0000866
1248 Ga0501047_0039014
1249 Ga0501047_0069692
1250 Ga0501047_0107131
1251 Ga0501047_0114156
1252 Ga0501048_0001300
1253 Ga0501067_0000229
1254 Ga0501067_0000333
1255 Ga0501068_0003851
1256 Ga0501068_0003945
1257 Ga0501068_0012484
1258 Ga0501069_0005415
1259 Ga0501070_0003517
1260 Ga0501070_0003638
1261 Ga0501070_0033554
1262 Ga0501072_0011869
1263 Ga0501073_0000004
1264 Ga0501073_0000034
1265 Ga0501073_0008652
1266 Ga0501074_0005987
1267 Ga0501077_0000608
1268 Ga0501079_0020670
1269 Ga0501080_0000200
1270 Ga0501080_0000846
1271 Ga0501080_0003415
1272 Ga0501080_0010149
1273 Ga0501080_0016647
1274 Ga0501080_0045311
1275 Ga0501083_0000118
1276 Ga0501083_0047396
1277 Ga0501262_001551
1278 Ga0501035_0000137
1279 Ga0501035_0000598
1280 Ga0501035_0103306
1281 Ga0501044_0000246
1282 Ga0501044_0000431
1283 Ga0501044_0000887
1284 Ga0501044_0001810
1285 Ga0501044_0008629
1286 Ga0501044_0067293
1287 Ga0501044_0084442
1288 Ga0501204_000205
1289 nmdc:mga00v17_19332_c1
1290 nmdc:mga0yw44_29695_c1
1291 nmdc:mga0yw44_72772_c1
1292 nmdc:mga06z11_5802_c1
1293 nmdc:mga05p37_43459_c1
1294 nmdc:mga08y16_46890_c1
1295 nmdc:mga0n895_6061_c1
1296 nmdc:mga0rr50_29370_c1
1297 nmdc:mga0rr50_3571_c1
1298 Ga0495601_0086286
1299 Ga0495619_0002245
1300 Ga0500643_000062
1301 Ga0500583_0009396
1302 Ga0500566_0000535
1303 Ga0500641_0005395
1304 Ga0500641_0027617
1305 Ga0500557_000158
1306 Ga0500562_005120
1307 Ga0500595_000668
1308 Ga0500595_000776
1309 Ga0500642_0000350
1310 Ga0500603_001364
1311 Ga0500616_0088924
1312 Ga0500619_003384
1313 Ga0500627_0000020
1314 Ga0500638_005004
1315 Ga0500636_0000908
1316 Ga0500637_0007521
1317 Ga0500625_000845
1318 Ga0500645_008626
1319 Ga0500599_002001
1320 Ga0500601_001310
1321 Ga0501084_0037894
1322 Ga0501084_0095078
1323 Ga0501082_0002445
1324 2507504892
1325 2508546245
1326 2508695177
1327 2509149833
1328 2511398348
1329 2513626714
1330 2513639600
1331 2513647914
1332 2513657647
1333 2513676172
1334 2513693335
1335 2513699011
1336 2513703995
1337 2513715750
1338 2513862114
1339 2513873861
1340 2513919646
1341 2514012832
1342 2515625814
1343 2517102337
1344 2517895357
1345 2524435785
1346 2524466530
1347 2524540935
1348 2528851639
1349 2617351756
1350 2617374068
1351 2643821389
1352 2643832649
1353 2644053556
1354 2644088584
1355 2644343819
1356 2644368702
1357 2671120274
1358 2723848249
1359 2728751267
1360 2745079082
1361 2793063064
1362 2793069330
1363 2793081955
1364 2805915944
1365 2818237328
1366 2824602624
1367 2824612596
1368 2824621059
1369 2824630066
1370 2824637918
1371 2824646371
1372 2824654411
1373 2824664780
1374 2824676739
1375 2824682087
1376 2824692958
1377 2824697599
1378 2824708712
1379 2824718730
1380 2824726345
1381 2824735349
1382 2824749104
1383 2824757072
1384 2824768408
1385 2824774889
1386 2838124168
1387 2841944516
1388 2841951654
1389 2841964796
1390 2841969292
1391 2841980309
1392 2841985561
1393 2842043830
1394 2842052180
1395 2844321872
1396 2847931421
1397 2847941806
1398 2849082723
1399 2857511618
1400 2874596886
1401 2874607540
1402 2874617712
1403 2874624468
1404 2874629172
1405 2874648691
1406 2876768995
1407 2876777350
1408 2876809720
1409 2876825432
1410 2879077681
1411 2879087543
1412 2879107276
1413 2879110978
1414 2879131436
1415 2879144396
1416 2881370954
1417 2881665743
1418 2884964596
1419 2885371353
1420 2885377599
1421 2885411216
1422 2888379915
1423 2888390989
1424 2888420722
1425 2889037234
1426 2903727578
1427 2903757627
1428 2903774251
1429 2904672193
1430 2904698694
1431 2904710812
1432 2904716225
1433 2906602932
1434 2906616034
1435 2906633483
1436 2906635619
1437 2906649065
1438 2906665267
1439 2908741042
1440 2908763168
1441 2908776545
1442 2922361372
1443 2922378296
1444 2922392988
1445 2922396623
1446 2922431998
1447 2929622602
1448 2929631180
1449 2932786397
1450 2932794638
1451 2932806919
1452 2932812528
1453 2932822890
1454 2932829635
1455 2933584319
1456 2935614910
1457 2935618153
1458 2935631126
1459 2935641449
1460 2935652938
1461 2935661521
1462 2935669493
1463 2935677909
1464 2935689642
1465 2935698178
1466 2935707318
1467 2935717162
1468 2935730004
1469 2935738577
1470 2935749175
1471 2935756996
1472 2935764393
1473 2935772729
1474 2935778134
1475 2935787362
1476 2935795850
1477 2935804303
1478 2935815387
1479 2935826050
1480 2935831180
1481 2935841789
1482 2935851669
1483 2935856348
1484 2935866320
1485 2935874626
1486 2935890331
1487 2935910309
1488 2935918405
1489 2935927780
1490 2935936348
1491 2935944099
1492 2935952536
1493 2935962329
1494 2935969376
1495 2935977856
1496 2935984838
1497 2935994087
1498 2936004902
1499 2936015750
1500 2936024384
1501 2936031729
1502 2936045042
1503 2936051551
1504 2936056009
1505 2940562910
1506 2941507778
1507 2941516204
1508 2941523087
1509 2941532394
1510 2941543862
1511 3005476984
1512 3005487329
1513 3005509495
1514 3005589487
1515 3005602210
1516 3005717976
1517 3005724999
1518 8006932718
1519 8006934438
1520 8006970801
1521 8006974408
1522 8006988808
1523 8006998615
1524 8016518568
1525 8016526550
1526 8016544833
1527 8016557248
1528 8016582485
1529 8016603212
1530 8016606136
1531 8016623556
1532 8016636035
1533 8017058097
1534 8019531456
1535 8019540073
1536 8019577633
1537 8019606031
1538 8019622611
1539 8019630498
1540 8019640111
1541 8019652826
1542 8019667327
1543 8019678883
1544 8055751053
1545 8056675843
1546 8056687645
1547 8056690375
1548 8056970967
1549 8057101914
1550 8057104256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

57

118

0.95

PF01946

Thi4

Thi4 family

37

97

0.86

PF00743

FMO-like

Flavin-binding monooxygenase-like

116

266

0.84

PF13434

Lys_Orn_oxgnase

L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase

126

395

0.79

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

56

270

0.78

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

53

291

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gry-assembly1.cif.gz_A crystal structure of the complex between s-adenosyl methionine and methanocaldococcus jannaschi dim1. 0.8589 189 219
3ggp-assembly2.cif.gz_D crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+ 0.8316 15 50
7p3f-assembly1.cif.gz_C streptomyces coelicolor datp/atp-loaded nrdr in complex with its cognate dna 0.806 113 143
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.8035 185 219
7fik-assembly1.cif.gz_e the cryo-em structure of the cr subunit from x. laevis npc 0.7965 111 143
ID Description Score Start End Superfamily
af_O53762_6_249_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9568 14 254 3.50.50.60
af_P9WNF9_1_152_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9559 14 162 3.50.50.60
1nvtB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9539 187 219 3.40.50.720
af_P9WNF7_1_267_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9512 14 272 3.50.50.60
af_Q5AHE0_44_199_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9448 14 152 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3B9J125-F1-model_v4 FAD-containing monooxygenase EthA 0.9709 14 305 GO:0047091
AF-M4RRJ2-F1-model_v4 Monooxygenase 0.97 14 149 GO:0004497
GO:0016020
AF-A0A430KWX5-F1-model_v4 FAD-containing monooxygenase EthA 0.9691 370 499 GO:0004497
AF-A0A1V6SMG1-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9673 17 395 GO:0004497
AF-A0A2E5FTW3-F1-model_v4 FAD-containing monooxygenase EthA 0.9659 15 499 GO:0004499
GO:0050660
GO:0050661

Map