F480268

General Info

Members Datasets Scaffolds Average Seq Length
775 433 1550 163

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0359973|Ga0373955_0359973_22_507
Length 161
Sequence MIVETQLREGEVAVDMPTTNDAGLVFIGRIRTPWKSREETPRQGDHDGPVCRLEIFEPWVPALKGIELYQYLEVLYWLDRSRRNLVLQNPRGTLRGTFSLRSPVRPNPIGTSIVKFVGVEGSSVLVRGLDCLDETPLIDLKPDRCEFSPLAAQSAGASGAR

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
86 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
87 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
176 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
177 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
201 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
202 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
203 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
235 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
238 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
239 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
240 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
241 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
277 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
305 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
310 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
357 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
358 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
364 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
365 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
366 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
367 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
368 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
369 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
370 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
371 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
372 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
373 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
374 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
375 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
376 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
377 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
378 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
379 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
380 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
381 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
382 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
383 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
384 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
385 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
386 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
387 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
388 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
389 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
390 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
391 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
392 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
393 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
394 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
395 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
396 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
397 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
398 2791355199
399 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
400 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
401 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
402 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
403 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
404 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
405 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
406 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
407 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
408 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
409 2904699407
410 2906610324
411 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
412 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
413 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
414 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
415 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
416 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
417 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
418 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
419 2922425934
420 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
421 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
422 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
423 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
424 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
425 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
426 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
427 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
428 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
429 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
430 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
431 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
432 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
433 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.9
Metatranscriptomes 0.13
Isolates 5.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.52
Nodule 4.9
Rhizoplane 7.1
Rhizosphere 69.55
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0359973 3300035172 Bacteria 882
2 JGI24740J21852_10018916 3300001979 Bacteria 2433
3 JGI24737J22298_10017235 3300001990 Bacteria 2329
4 JGI25406J46586_10000026 3300003203 Bacteria 70727
5 JGI25153J46596_10002939 3300003215 Bacteria 9644
6 Ga0070658_10465709 3300005327 Bacteria 1090
7 Ga0070683_100196501 3300005329 Bacteria 1915
8 Ga0070690_100470056 3300005330 Bacteria 936
9 Ga0070690_101109314 3300005330 Bacteria 628
10 Ga0068869_100989412 3300005334 Bacteria 732
11 Ga0070680_100168198 3300005336 Bacteria 1844
12 Ga0070682_100306470 3300005337 Bacteria 1167
13 Ga0068868_100207938 3300005338 Bacteria 1634
14 Ga0070660_100045225 3300005339 Bacteria 3369
15 Ga0070660_100800078 3300005339 Bacteria 793
16 Ga0070661_100068228 3300005344 Bacteria 2613
17 Ga0070661_100250698 3300005344 Bacteria 1366
18 Ga0070668_100265230 3300005347 Bacteria 1429
19 Ga0070668_100270717 3300005347 Bacteria 1416
20 Ga0070671_100182153 3300005355 Bacteria 1778
21 Ga0070674_100920837 3300005356 Bacteria 763
22 Ga0070673_100202823 3300005364 Bacteria 1709
23 Ga0070673_100422201 3300005364 Bacteria 1196
24 Ga0070673_100436720 3300005364 Bacteria 1176
25 Ga0070688_100148337 3300005365 Bacteria 1601
26 Ga0070659_100117803 3300005366 Bacteria 2148
27 Ga0070659_102032813 3300005366 Unclassified 516
28 Ga0070709_10003671 3300005434 Bacteria 8246
29 Ga0070709_10036185 3300005434 Bacteria 3006
30 Ga0070714_100049152 3300005435 Bacteria 3590
31 Ga0070714_100358971 3300005435 Bacteria 1370
32 Ga0070713_100228506 3300005436 Bacteria 1690
33 Ga0070713_101545528 3300005436 Bacteria 644
34 Ga0070710_10138567 3300005437 Bacteria 1489
35 Ga0070710_11198120 3300005437 Bacteria 561
36 Ga0070701_10247114 3300005438 Bacteria 1076
37 Ga0070711_100001695 3300005439 Bacteria 12207
38 Ga0070711_100093815 3300005439 Bacteria 2168
39 Ga0070700_100324905 3300005441 Bacteria 1132
40 Ga0070694_100435457 3300005444 Bacteria 1032
41 Ga0070708_101187742 3300005445 Bacteria 714
42 Ga0070663_100012415 3300005455 Bacteria 5389
43 Ga0070663_100102906 3300005455 Bacteria 2134
44 Ga0070663_100268858 3300005455 Bacteria 1355
45 Ga0070678_100585220 3300005456 Bacteria 995
46 Ga0070681_10574633 3300005458 Bacteria 1041
47 Ga0070681_10665871 3300005458 Bacteria 956
48 Ga0068867_100192607 3300005459 Bacteria 1628
49 Ga0070685_10346350 3300005466 Bacteria 1014
50 Ga0070685_11109969 3300005466 Bacteria 598
51 Ga0070706_100519340 3300005467 Bacteria 1108
52 Ga0070706_100602553 3300005467 Bacteria 1021
53 Ga0070707_100319127 3300005468 Bacteria 1510
54 Ga0070698_100687677 3300005471 Bacteria 965
55 Ga0070679_100010022 3300005530 Bacteria 8973
56 Ga0070679_100498782 3300005530 Bacteria 1161
57 Ga0070679_100649621 3300005530 Bacteria 997
58 Ga0070684_100053948 3300005535 Bacteria 3501
59 Ga0070697_100078777 3300005536 Bacteria 2712
60 Ga0068853_100006903 3300005539 Bacteria 9063
61 Ga0068853_100066585 3300005539 Bacteria 3128
62 Ga0068853_100400370 3300005539 Bacteria 1285
63 Ga0068853_100468955 3300005539 Bacteria 1186
64 Ga0070672_101054319 3300005543 Bacteria 722
65 Ga0070686_100595452 3300005544 Bacteria 870
66 Ga0070693_100659680 3300005547 Bacteria 762
67 Ga0070665_100002761 3300005548 Bacteria 19030
68 Ga0070665_100036089 3300005548 Bacteria 4974
69 Ga0070665_100194793 3300005548 Bacteria 2027
70 Ga0070704_101599839 3300005549 Bacteria 601
71 Ga0068855_100005114 3300005563 Bacteria 15990
72 Ga0068855_100049610 3300005563 Bacteria 4950
73 Ga0068855_100088947 3300005563 Bacteria 3567
74 Ga0068855_100475617 3300005563 Bacteria 1361
75 Ga0068857_100029142 3300005577 Bacteria 4871
76 Ga0068857_100029970 3300005577 Bacteria 4801
77 Ga0068857_100048463 3300005577 Bacteria 3772
78 Ga0068854_100024882 3300005578 Bacteria 4104
79 Ga0068854_100053700 3300005578 Bacteria 2895
80 Ga0068854_100119515 3300005578 Bacteria 1998
81 Ga0068856_100010355 3300005614 Bacteria 9057
82 Ga0068856_100016084 3300005614 Bacteria 7231
83 Ga0068856_100233969 3300005614 Bacteria 1853
84 Ga0070702_100017077 3300005615 Bacteria 3736
85 Ga0068852_100210962 3300005616 Bacteria 1842
86 Ga0068852_100792268 3300005616 Bacteria 962
87 Ga0068859_100465767 3300005617 Bacteria 1359
88 Ga0068864_100104347 3300005618 Bacteria 2518
89 Ga0068864_100132665 3300005618 Bacteria 2239
90 Ga0068864_100770823 3300005618 Bacteria 944
91 Ga0068864_101668592 3300005618 Bacteria 642
92 Ga0068861_100277973 3300005719 Bacteria 1441
93 Ga0068851_10002904 3300005834 Bacteria 7569
94 Ga0068851_10145550 3300005834 Bacteria 1292
95 Ga0068851_10800322 3300005834 Bacteria 585
96 Ga0068870_10464916 3300005840 Bacteria 836
97 Ga0068870_10720524 3300005840 Bacteria 690
98 Ga0068863_100933711 3300005841 Bacteria 869
99 Ga0068858_100015447 3300005842 Bacteria 7180
100 Ga0068860_100000149 3300005843 Bacteria 113068
101 Ga0068860_100183487 3300005843 Bacteria 2023
102 Ga0068862_100372673 3300005844 Bacteria 1329
103 Ga0068862_100698615 3300005844 Bacteria 982
104 Ga0068862_100793013 3300005844 Bacteria 924
105 Ga0068862_101186002 3300005844 Bacteria 761
106 Ga0081455_10038775 3300005937 Bacteria 4217
107 Ga0081455_10233969 3300005937 Bacteria 1354
108 Ga0081540_1001309 3300005983 Bacteria 21732
109 Ga0081540_1002273 3300005983 Bacteria 15792
110 Ga0081540_1009658 3300005983 Bacteria 6630
111 Ga0081540_1018007 3300005983 Bacteria 4349
112 Ga0081540_1153940 3300005983 Bacteria 902
113 Ga0081539_10000176 3300005985 Bacteria 150292
114 Ga0070717_10007137 3300006028 Bacteria 8279
115 Ga0070717_10301000 3300006028 Bacteria 1426
116 Ga0070717_10420016 3300006028 Bacteria 1203
117 Ga0070717_11024552 3300006028 Bacteria 752
118 Ga0075365_10131475 3300006038 Bacteria 1732
119 Ga0075365_10420749 3300006038 Bacteria 943
120 Ga0075365_10438328 3300006038 Bacteria 922
121 Ga0075368_10086374 3300006042 Bacteria 1280
122 Ga0075368_10167409 3300006042 Bacteria 923
123 Ga0075363_100145975 3300006048 Bacteria 1334
124 Ga0075363_100363618 3300006048 Bacteria 846
125 Ga0075364_10117612 3300006051 Bacteria 1777
126 Ga0075364_10190475 3300006051 Bacteria 1389
127 Ga0070716_100062588 3300006173 Bacteria 2158
128 Ga0070716_100194549 3300006173 Bacteria 1343
129 Ga0070716_100352932 3300006173 Bacteria 1042
130 Ga0070712_100002927 3300006175 Bacteria 10579
131 Ga0070712_100023775 3300006175 Bacteria 4052
132 Ga0070712_100517229 3300006175 Bacteria 1002
133 Ga0070712_101021944 3300006175 Bacteria 716
134 Ga0075362_10134404 3300006177 Bacteria 1178
135 Ga0075362_10363621 3300006177 Bacteria 726
136 Ga0075362_10527472 3300006177 Bacteria 606
137 Ga0075367_10021951 3300006178 Bacteria 3573
138 Ga0075367_10066205 3300006178 Bacteria 2164
139 Ga0075367_10080292 3300006178 Bacteria 1972
140 Ga0075367_10150524 3300006178 Bacteria 1444
141 Ga0075367_10155648 3300006178 Bacteria 1420
142 Ga0075369_10030536 3300006186 Bacteria 2270
143 Ga0075369_10042129 3300006186 Bacteria 1956
144 Ga0075366_10242957 3300006195 Bacteria 1098
145 Ga0097621_100091544 3300006237 Bacteria 2545
146 Ga0097621_100110476 3300006237 Bacteria 2323
147 Ga0075370_10705337 3300006353 Bacteria 613
148 Ga0075428_100066108 3300006844 Bacteria 3959
149 Ga0075428_100205307 3300006844 Bacteria 2129
150 Ga0075431_100049151 3300006847 Bacteria 4350
151 Ga0075434_101227201 3300006871 Bacteria 761
152 Ga0075429_100131708 3300006880 Bacteria 2188
153 Ga0068865_100575830 3300006881 Bacteria 949
154 Ga0075436_100085391 3300006914 Bacteria 2191
155 Ga0097620_100465756 3300006931 Bacteria 1359
156 Ga0099825_1032409 3300006941 Bacteria 2121
157 Ga0099824_1020283 3300006942 Bacteria 4938
158 Ga0099822_1004892 3300006943 Bacteria 17473
159 Ga0099794_10141928 3300007265 Bacteria 1217
160 Ga0099795_10025448 3300007788 Bacteria 1985
161 Ga0099795_10027848 3300007788 Bacteria 1916
162 Ga0099795_10191032 3300007788 Bacteria 860
163 Ga0105250_10091560 3300009092 Bacteria 1237
164 Ga0105250_10246468 3300009092 Bacteria 763
165 Ga0105240_10004765 3300009093 Bacteria 20483
166 Ga0105240_10034450 3300009093 Bacteria 6531
167 Ga0105240_10078859 3300009093 Bacteria 4054
168 Ga0111539_10039686 3300009094 Bacteria 5672
169 Ga0105245_10106409 3300009098 Bacteria 2603
170 Ga0105245_10310203 3300009098 Bacteria 1551
171 Ga0105247_10025319 3300009101 Bacteria 3578
172 Ga0105247_10097298 3300009101 Bacteria 1877
173 Ga0105247_10162460 3300009101 Bacteria 1480
174 Ga0114129_10359744 3300009147 Bacteria 1926
175 Ga0105243_12042779 3300009148 Bacteria 608
176 Ga0105241_10001875 3300009174 Bacteria 15935
177 Ga0105241_10049725 3300009174 Bacteria 3194
178 Ga0105241_10134762 3300009174 Bacteria 2004
179 Ga0105241_10411186 3300009174 Bacteria 1189
180 Ga0105242_11038082 3300009176 Bacteria 830
181 Ga0105248_10411451 3300009177 Bacteria 1523
182 Ga0105248_10992350 3300009177 Bacteria 949
183 Ga0105237_10011939 3300009545 Bacteria 9181
184 Ga0105237_10057288 3300009545 Bacteria 3900
185 Ga0105237_10074813 3300009545 Bacteria 3379
186 Ga0105237_10182633 3300009545 Bacteria 2097
187 Ga0105237_10252839 3300009545 Bacteria 1764
188 Ga0105237_12084758 3300009545 Bacteria 576
189 Ga0105238_10010766 3300009551 Bacteria 9187
190 Ga0105238_10022965 3300009551 Bacteria 6358
191 Ga0105238_10105365 3300009551 Bacteria 2801
192 Ga0105238_10224008 3300009551 Bacteria 1857
193 Ga0105238_10229948 3300009551 Bacteria 1831
194 Ga0105249_11209533 3300009553 Bacteria 827
195 Ga0099796_10004763 3300010159 Bacteria 3316
196 Ga0099796_10081789 3300010159 Bacteria 1185
197 Ga0099796_10160585 3300010159 Bacteria 890
198 Ga0105239_10343567 3300010375 Bacteria 1685
199 Ga0105239_10363184 3300010375 Bacteria 1635
200 Ga0105239_10612264 3300010375 Bacteria 1243
201 Ga0105246_10133469 3300011119 Bacteria 1857
202 Ga0157341_1018539 3300012494 Bacteria 667
203 Ga0157370_10204811 3300013104 Bacteria 1830
204 Ga0157370_11756054 3300013104 Bacteria 557
205 Ga0157369_10252228 3300013105 Bacteria 1841
206 Ga0157369_10287025 3300013105 Bacteria 1713
207 Ga0157369_10448363 3300013105 Bacteria 1336
208 Ga0157374_10141762 3300013296 Bacteria 2333
209 Ga0157378_10057540 3300013297 Bacteria 3465
210 Ga0157378_10375694 3300013297 Bacteria 1395
211 Ga0157378_11728827 3300013297 Bacteria 673
212 Ga0157378_12310041 3300013297 Bacteria 589
213 Ga0163163_10120043 3300014325 Bacteria 2662
214 Ga0163163_10348164 3300014325 Bacteria 1537
215 Ga0157380_10393542 3300014326 Bacteria 1312
216 Ga0157380_10618593 3300014326 Bacteria 1075
217 Ga0157377_10245173 3300014745 Bacteria 1158
218 Ga0157379_10028341 3300014968 Bacteria 4983
219 Ga0157379_10233257 3300014968 Bacteria 1669
220 Ga0157379_10546756 3300014968 Bacteria 1077
221 Ga0157376_10387508 3300014969 Bacteria 1348
222 Ga0157376_10577191 3300014969 Bacteria 1116
223 Ga0182007_10094056 3300015262 Bacteria 988
224 Ga0163161_10047763 3300017792 Bacteria 3090
225 Ga0163161_10138864 3300017792 Bacteria 1839
226 Ga0163161_10683252 3300017792 Bacteria 853
227 Ga0206356_11888330 3300020070 Bacteria 585
228 Ga0213872_10144174 3300021361 Bacteria 1044
229 Ga0213874_10015710 3300021377 Bacteria 2002
230 Ga0213876_10012439 3300021384 Bacteria 4529
231 Ga0209233_1005091 3300025261 Bacteria 4398
232 Ga0207666_1031231 3300025271 Bacteria 816
233 Ga0209758_1008123 3300025297 Bacteria 6901
234 Ga0209758_1056670 3300025297 Bacteria 1322
235 Ga0207697_10036674 3300025315 Bacteria 2008
236 Ga0207656_10074878 3300025321 Bacteria 1511
237 Ga0207696_1099484 3300025711 Bacteria 793
238 Ga0207653_10084620 3300025885 Bacteria 1103
239 Ga0207682_10307579 3300025893 Bacteria 744
240 Ga0207692_10100530 3300025898 Bacteria 1586
241 Ga0207710_10019866 3300025900 Bacteria 2868
242 Ga0207710_10350564 3300025900 Bacteria 752
243 Ga0207647_10000524 3300025904 Bacteria 30598
244 Ga0207647_10298795 3300025904 Bacteria 917
245 Ga0207699_10025318 3300025906 Bacteria 3256
246 Ga0207643_10065063 3300025908 Bacteria 2088
247 Ga0207705_10221347 3300025909 Bacteria 1438
248 Ga0207705_10369746 3300025909 Bacteria 1106
249 Ga0207684_10045107 3300025910 Bacteria 3740
250 Ga0207654_10007949 3300025911 Bacteria 5348
251 Ga0207654_10072134 3300025911 Bacteria 2055
252 Ga0207654_10142830 3300025911 Bacteria 1528
253 Ga0207654_10206516 3300025911 Bacteria 1296
254 Ga0207654_10639938 3300025911 Unclassified 761
255 Ga0207707_10062979 3300025912 Bacteria 3228
256 Ga0207707_10083696 3300025912 Bacteria 2786
257 Ga0207695_10000883 3300025913 Bacteria 54495
258 Ga0207695_10135969 3300025913 Bacteria 2411
259 Ga0207695_10246566 3300025913 Bacteria 1686
260 Ga0207695_10712875 3300025913 Bacteria 884
261 Ga0207671_10015920 3300025914 Bacteria 5864
262 Ga0207671_10121226 3300025914 Bacteria 1999
263 Ga0207671_10137988 3300025914 Bacteria 1877
264 Ga0207693_10007054 3300025915 Bacteria 9272
265 Ga0207693_10153063 3300025915 Bacteria 1814
266 Ga0207693_10288346 3300025915 Bacteria 1286
267 Ga0207693_10404597 3300025915 Bacteria 1067
268 Ga0207663_10013553 3300025916 Bacteria 4434
269 Ga0207663_10109514 3300025916 Bacteria 1872
270 Ga0207663_10368204 3300025916 Bacteria 1092
271 Ga0207663_10456523 3300025916 Bacteria 986
272 Ga0207660_10043609 3300025917 Bacteria 3152
273 Ga0207660_10255687 3300025917 Bacteria 1383
274 Ga0207657_10035231 3300025919 Bacteria 4490
275 Ga0207649_10910707 3300025920 Unclassified 690
276 Ga0207649_11340773 3300025920 Bacteria 566
277 Ga0207652_10004081 3300025921 Bacteria 11912
278 Ga0207652_10036809 3300025921 Bacteria 4139
279 Ga0207694_10000436 3300025924 Bacteria 38791
280 Ga0207694_10050538 3300025924 Bacteria 3220
281 Ga0207694_10096310 3300025924 Bacteria 2340
282 Ga0207694_10105993 3300025924 Bacteria 2232
283 Ga0207694_10328505 3300025924 Bacteria 1263
284 Ga0207650_11360921 3300025925 Bacteria 604
285 Ga0207687_10060012 3300025927 Bacteria 2681
286 Ga0207700_10046160 3300025928 Bacteria 3220
287 Ga0207700_10152294 3300025928 Bacteria 1912
288 Ga0207700_10869758 3300025928 Bacteria 807
289 Ga0207664_10004100 3300025929 Bacteria 9833
290 Ga0207664_10093755 3300025929 Bacteria 2466
291 Ga0207664_10346071 3300025929 Bacteria 1315
292 Ga0207690_11126493 3300025932 Unclassified 654
293 Ga0207686_10450227 3300025934 Bacteria 990
294 Ga0207686_10707723 3300025934 Bacteria 801
295 Ga0207709_10235186 3300025935 Bacteria 1329
296 Ga0207709_10532452 3300025935 Bacteria 921
297 Ga0207670_10520858 3300025936 Bacteria 968
298 Ga0207704_10994017 3300025938 Bacteria 709
299 Ga0207665_10032854 3300025939 Bacteria 3436
300 Ga0207665_10162020 3300025939 Bacteria 1610
301 Ga0207665_10195062 3300025939 Bacteria 1473
302 Ga0207711_10198385 3300025941 Bacteria 1831
303 Ga0207689_10022866 3300025942 Bacteria 5251
304 Ga0207689_10098774 3300025942 Bacteria 2398
305 Ga0207689_10470244 3300025942 Bacteria 1052
306 Ga0207667_10011785 3300025949 Bacteria 10128
307 Ga0207667_10016252 3300025949 Bacteria 8408
308 Ga0207667_10090457 3300025949 Bacteria 3163
309 Ga0207667_10090923 3300025949 Bacteria 3154
310 Ga0207667_10096660 3300025949 Bacteria 3048
311 Ga0207667_10727377 3300025949 Bacteria 993
312 Ga0207712_10598285 3300025961 Bacteria 954
313 Ga0207668_10081537 3300025972 Bacteria 2347
314 Ga0207668_10124667 3300025972 Bacteria 1956
315 Ga0207668_10529991 3300025972 Bacteria 1017
316 Ga0207640_10030276 3300025981 Bacteria 3331
317 Ga0207639_10009323 3300026041 Bacteria 6767
318 Ga0207639_10032959 3300026041 Bacteria 3818
319 Ga0207639_10082300 3300026041 Bacteria 2552
320 Ga0207639_10083086 3300026041 Bacteria 2541
321 Ga0207639_10083580 3300026041 Bacteria 2534
322 Ga0207639_10565670 3300026041 Bacteria 1045
323 Ga0207678_10042761 3300026067 Bacteria 3923
324 Ga0207678_10056499 3300026067 Bacteria 3378
325 Ga0207678_10074088 3300026067 Bacteria 2917
326 Ga0207678_10185724 3300026067 Bacteria 1775
327 Ga0207708_10077114 3300026075 Bacteria 2557
328 Ga0207708_10078138 3300026075 Bacteria 2541
329 Ga0207702_10000005 3300026078 Bacteria 420296
330 Ga0207702_10119147 3300026078 Bacteria 2359
331 Ga0207702_10413269 3300026078 Bacteria 1303
332 Ga0207702_10914827 3300026078 Bacteria 869
333 Ga0207641_10462458 3300026088 Bacteria 1228
334 Ga0207648_10118457 3300026089 Bacteria 2327
335 Ga0207648_11451790 3300026089 Bacteria 645
336 Ga0207676_11184629 3300026095 Bacteria 757
337 Ga0207674_10010135 3300026116 Bacteria 10716
338 Ga0207674_10012171 3300026116 Bacteria 9631
339 Ga0207674_10034888 3300026116 Bacteria 5254
340 Ga0207674_10279287 3300026116 Bacteria 1618
341 Ga0207675_101123439 3300026118 Bacteria 806
342 Ga0207683_10081522 3300026121 Bacteria 2872
343 Ga0207698_10244333 3300026142 Bacteria 1638
344 Ga0207698_10245153 3300026142 Bacteria 1636
345 Ga0209589_1000030 3300027357 Bacteria 147457
346 Ga0209489_100056 3300027361 Bacteria 147457
347 Ga0209700_100059 3300027363 Bacteria 147457
348 Ga0209813_10076378 3300027866 Bacteria 1099
349 Ga0268266_10015491 3300028379 Bacteria 6541
350 Ga0268266_10086654 3300028379 Bacteria 2738
351 Ga0268266_10215927 3300028379 Bacteria 1761
352 Ga0268266_10350389 3300028379 Bacteria 1387
353 Ga0268266_11001884 3300028379 Bacteria 808
354 Ga0268265_10086493 3300028380 Bacteria 2491
355 Ga0268264_10000084 3300028381 Bacteria 242128
356 Ga0268264_10181554 3300028381 Bacteria 1911
357 Ga0265334_10011893 3300028573 Bacteria 3656
358 Ga0307517_10000369 3300028786 Bacteria 77795
359 Ga0307515_10013420 3300028794 Bacteria 15318
360 Ga0307515_10161382 3300028794 Bacteria 2284
361 Ga0265332_10031536 3300031238 Bacteria 2312
362 Ga0265328_10301304 3300031239 Bacteria 619
363 Ga0265325_10083915 3300031241 Bacteria 1580
364 Ga0265340_10008535 3300031247 Bacteria 5529
365 Ga0265339_10002239 3300031249 Bacteria 13983
366 Ga0265339_10184544 3300031249 Bacteria 1037
367 Ga0265316_10322192 3300031344 Bacteria 1123
368 Ga0265316_10322446 3300031344 Bacteria 1122
369 Ga0307513_10125213 3300031456 Bacteria 2527
370 Ga0307513_10167681 3300031456 Bacteria 2078
371 Ga0307513_10840222 3300031456 Bacteria 625
372 Ga0307509_10022959 3300031507 Bacteria 7015
373 Ga0307509_10072887 3300031507 Bacteria 3577
374 Ga0307509_10073475 3300031507 Bacteria 3560
375 Ga0307509_10268243 3300031507 Bacteria 1476
376 Ga0307508_10000105 3300031616 Bacteria 99107
377 Ga0307508_10047728 3300031616 Bacteria 3817
378 Ga0307508_10111632 3300031616 Bacteria 2334
379 Ga0265314_10170340 3300031711 Bacteria 1315
380 Ga0307516_10006693 3300031730 Bacteria 13466
381 Ga0307516_10021202 3300031730 Bacteria 6696
382 Ga0307516_10124721 3300031730 Bacteria 2361
383 Ga0307516_10126829 3300031730 Bacteria 2336
384 Ga0307516_10717806 3300031730 Bacteria 657
385 Ga0307411_10269500 3300032005 Bacteria 1349
386 Ga0307411_10406165 3300032005 Bacteria 1127
387 Ga0307415_100279890 3300032126 Bacteria 1371
388 Ga0307415_100285227 3300032126 Bacteria 1360
389 Ga0307507_10091342 3300033179 Bacteria 2607
390 Ga0307510_10009194 3300033180 Bacteria 11768
391 Ga0307510_10153086 3300033180 Bacteria 1919
392 Ga0307510_10198296 3300033180 Bacteria 1545
393 Ga0307510_10376245 3300033180 Bacteria 866
394 Ga0315911_1000020 3300033442 Bacteria 139809
395 Ga0316215_1002951 3300033544 Bacteria 1614
396 Ga0373930_0019643 3300034816 Bacteria 1309
397 Ga0373926_0218118 3300035083 Bacteria 736
398 Ga0373934_0002431 3300035086 Bacteria 6851
399 Ga0373934_0189173 3300035086 Bacteria 847
400 Ga0373940_0049878 3300035088 Bacteria 1173
401 Ga0373944_0036653 3300035089 Bacteria 1499
402 Ga0373952_0092220 3300035092 Bacteria 788
403 Ga0373923_0003726 3300035111 Bacteria 4939
404 Ga0373923_0054767 3300035111 Bacteria 1680
405 Ga0373932_0169421 3300035112 Bacteria 760
406 Ga0373936_0060101 3300035113 Bacteria 1550
407 Ga0373945_0116967 3300035116 Bacteria 1057
408 Ga0373953_0000929 3300035117 Bacteria 8201
409 Ga0373954_0000067 3300035118 Bacteria 37060
410 Ga0373956_0001639 3300035119 Bacteria 9221
411 Ga0373957_0000501 3300035120 Bacteria 9810
412 Ga0373943_0001888 3300035170 Bacteria 9476
413 Ga0373943_0089161 3300035170 Bacteria 1595
414 Ga0373946_0004239 3300035171 Bacteria 5120
415 Ga0373946_0309961 3300035171 Bacteria 782
416 Ga0373955_0000377 3300035172 Bacteria 18785
417 Ga0373924_0004215 3300035410 Bacteria 5011
418 Ga0373924_0254045 3300035410 Bacteria 778
419 Ga0373931_0055359 3300035691 Bacteria 2122
420 Ga0373935_0008893 3300035692 Bacteria 6011
421 Ga0373935_0415873 3300035692 Bacteria 967
422 Ga0373935_0874193 3300035692 Bacteria 665
423 Ga0373927_0003905 3300035695 Bacteria 10571
424 Ga0373927_0007408 3300035695 Bacteria 7428
425 Ga0373927_0068674 3300035695 Bacteria 2293
426 Ga0373927_0593051 3300035695 Bacteria 732
427 Ga0373933_0000324 3300035724 Bacteria 30843
428 Ga0373933_0000519 3300035724 Bacteria 24082
429 Ga0373933_0198221 3300035724 Bacteria 1284
430 Ga0373933_0512443 3300035724 Bacteria 786
431 Ga0373947_0007983 3300035725 Bacteria 6103
432 Ga0373947_0020182 3300035725 Bacteria 3846
433 Ga0373947_0196151 3300035725 Bacteria 1319
434 Ga0373937_0001425 3300036401 Bacteria 19991
435 Ga0373937_0505927 3300036401 Bacteria 1148
436 Ga0373937_1329937 3300036401 Bacteria 666
437 Ga0373925_0103380 3300037068 Bacteria 2193
438 Ga0373925_0197307 3300037068 Bacteria 1599
439 Ga0373925_0411074 3300037068 Bacteria 1104
440 Ga0373925_0851127 3300037068 Bacteria 752
441 Ga0395900_0331538 3300037418 Bacteria 1500
442 Ga0395898_0057313 3300037466 Bacteria 3797
443 Ga0395898_0173684 3300037466 Bacteria 2060
444 Ga0395898_0310247 3300037466 Bacteria 1505
445 Ga0395905_0083220 3300037471 Bacteria 2998
446 Ga0395905_0661307 3300037471 Bacteria 947
447 Ga0395901_0596621 3300038443 Bacteria 1114
448 Ga0436365_0871323 3300039437 Bacteria 58014
449 Ga0436360_0160802 3300039438 Bacteria 600
450 Ga0436360_0431558 3300039438 Bacteria 1598
451 Ga0436360_0844831 3300039438 Bacteria 3290
452 Ga0436361_0836412 3300039447 Bacteria 1104
453 Ga0436363_0691736 3300039450 Bacteria 2737
454 Ga0436363_0933367 3300039450 Bacteria 2850
455 Ga0436363_1439088 3300039450 Bacteria 703
456 Ga0436362_1177272 3300039453 Bacteria 2692
457 Ga0451787_381759 3300041441 Bacteria 912
458 Ga0451793_1505848 3300041452 Bacteria 802
459 Ga0451800_0877773 3300041459 Bacteria 625
460 Ga0451804_0785817 3300041463 Bacteria 788
461 Ga0451833_1444530 3300041491 Bacteria 681
462 Ga0451839_0242778 3300041496 Bacteria 955
463 Ga0451847_0804396 3300041503 Bacteria 595
464 Ga0451847_0967682 3300041503 Bacteria 607
465 Ga0451853_0833569 3300041512 Bacteria 863
466 Ga0439455_0174325 3300042012 Bacteria 618
467 Ga0466966_0244811 3300044684 Bacteria 1080
468 Ga0466963_0286380 3300044694 Bacteria 1158
469 Ga0466963_0505668 3300044694 Bacteria 853
470 Ga0466959_0198078 3300045049 Bacteria 1399
471 Ga0466967_0509034 3300045976 Bacteria 1182
472 Ga0466967_0604624 3300045976 Bacteria 1082
473 Ga0495617_106448 3300046452 Bacteria 909
474 Ga0495627_128409 3300046453 Bacteria 714
475 Ga0495592_0046096 3300046454 Bacteria 3250
476 Ga0495592_0046648 3300046454 Bacteria 3229
477 Ga0495603_0001576 3300046455 Bacteria 13338
478 Ga0495603_0150714 3300046455 Bacteria 1351
479 Ga0495629_0000117 3300046459 Bacteria 70838
480 Ga0495629_0009626 3300046459 Bacteria 7058
481 Ga0495629_0100390 3300046459 Bacteria 2020
482 Ga0495638_0093554 3300046460 Bacteria 1807
483 Ga0495638_0214098 3300046460 Bacteria 1080
484 Ga0495641_0002118 3300046461 Bacteria 16012
485 Ga0495651_0003726 3300046462 Bacteria 11675
486 Ga0495651_0042708 3300046462 Bacteria 3519
487 Ga0495651_0343954 3300046462 Bacteria 987
488 Ga0495653_0001052 3300046463 Bacteria 21243
489 Ga0495580_0004355 3300046472 Bacteria 11890
490 Ga0495582_0001007 3300046473 Bacteria 15801
491 Ga0495582_0545930 3300046473 Bacteria 670
492 Ga0495639_0001543 3300046475 Bacteria 10275
493 Ga0495639_0040605 3300046475 Bacteria 2094
494 Ga0495639_0058893 3300046475 Bacteria 1758
495 Ga0495662_0004867 3300046476 Bacteria 6729
496 Ga0495662_0334420 3300046476 Bacteria 745
497 Ga0495664_0025293 3300046477 Bacteria 3456
498 Ga0495664_0207717 3300046477 Bacteria 1186
499 Ga0495594_0000662 3300046499 Bacteria 17783
500 Ga0495594_0266344 3300046499 Bacteria 976
501 Ga0495606_0007334 3300046507 Bacteria 9914
502 Ga0495608_0002910 3300046511 Bacteria 12254
503 Ga0495618_0150134 3300046514 Bacteria 1489
504 Ga0495620_0053958 3300046515 Bacteria 1700
505 Ga0495620_0166016 3300046515 Bacteria 857
506 Ga0495628_0003826 3300046516 Bacteria 13414
507 Ga0495630_0001278 3300046517 Bacteria 17348
508 Ga0495631_0048462 3300046518 Bacteria 1863
509 Ga0495631_0351769 3300046518 Bacteria 627
510 Ga0495644_0315937 3300046523 Bacteria 612
511 Ga0495666_0020673 3300046526 Bacteria 3260
512 Ga0495652_0011186 3300046529 Bacteria 8129
513 Ga0495652_0067716 3300046529 Bacteria 2992
514 Ga0495652_0669151 3300046529 Bacteria 701
515 Ga0495665_0002979 3300046531 Bacteria 9154
516 Ga0495665_0159256 3300046531 Bacteria 1177
517 Ga0495640_0003398 3300046533 Bacteria 12815
518 Ga0495640_0538124 3300046533 Bacteria 709
519 Ga0495587_0039700 3300046536 Bacteria 2815
520 Ga0495598_0006094 3300046537 Bacteria 2708
521 Ga0495597_0053312 3300046542 Bacteria 1779
522 Ga0495645_0003011 3300046543 Bacteria 11398
523 Ga0495645_0333537 3300046543 Bacteria 981
524 Ga0495622_0009623 3300046557 Bacteria 4469
525 Ga0495622_0010153 3300046557 Bacteria 4353
526 Ga0495622_0044534 3300046557 Bacteria 2062
527 Ga0495667_0000305 3300046559 Bacteria 31224
528 Ga0495667_0055933 3300046559 Bacteria 2595
529 Ga0495656_0019096 3300046615 Bacteria 2641
530 Ga0495668_0147685 3300046616 Bacteria 1287
531 Ga0495668_0275825 3300046616 Bacteria 921
532 Ga0495634_0003435 3300046642 Bacteria 12708
533 Ga0495634_0012645 3300046642 Bacteria 6110
534 Ga0495635_0000102 3300046663 Bacteria 50623
535 Ga0495635_0004903 3300046663 Bacteria 9306
536 Ga0495661_0331242 3300046665 Bacteria 754
537 Ga0495588_0018542 3300046674 Bacteria 3395
538 Ga0495588_0034912 3300046674 Bacteria 2546
539 Ga0495588_0119379 3300046674 Bacteria 1390
540 Ga0495588_0330211 3300046674 Bacteria 802
541 Ga0495657_0008816 3300046675 Bacteria 7681
542 Ga0495657_0247965 3300046675 Bacteria 1073
543 Ga0495599_0011854 3300046678 Bacteria 5360
544 Ga0495623_0011690 3300046679 Bacteria 5687
545 Ga0495623_0342562 3300046679 Bacteria 816
546 Ga0495623_0570549 3300046679 Bacteria 590
547 Ga0495646_0058921 3300046680 Bacteria 2295
548 Ga0495646_0070496 3300046680 Bacteria 2058
549 Ga0495647_0033728 3300046681 Bacteria 1914
550 Ga0495647_0068929 3300046681 Bacteria 1412
551 Ga0495658_0002270 3300046683 Bacteria 9713
552 Ga0495613_0007307 3300046689 Bacteria 8226
553 Ga0495613_0012699 3300046689 Bacteria 6263
554 Ga0495613_0346267 3300046689 Bacteria 1021
555 Ga0495624_0001774 3300046690 Bacteria 16501
556 Ga0495624_0221275 3300046690 Bacteria 1148
557 Ga0495624_0405341 3300046690 Bacteria 818
558 Ga0495600_0000357 3300046809 Bacteria 24062
559 Ga0495600_0886703 3300046809 Bacteria 527
560 Ga0495581_0004221 3300047315 Bacteria 8282
561 Ga0495604_0001099 3300047317 Bacteria 22454
562 Ga0495604_0367603 3300047317 Bacteria 953
563 Ga0495636_0021311 3300047318 Bacteria 2617
564 Ga0495674_0029184 3300047319 Bacteria 5025
565 Ga0495674_0325463 3300047319 Bacteria 1251
566 Ga0495672_0047842 3300047320 Bacteria 2540
567 Ga0495672_0057186 3300047320 Bacteria 2266
568 Ga0495680_0003585 3300047322 Bacteria 15202
569 Ga0495680_0039030 3300047322 Bacteria 3791
570 Ga0495687_140249 3300047443 Bacteria 842
571 Ga0495675_0004354 3300047444 Bacteria 8568
572 Ga0495675_0352005 3300047444 Bacteria 866
573 Ga0495675_0395610 3300047444 Bacteria 806
574 Ga0495685_067087 3300047447 Bacteria 1205
575 Ga0495684_0000088 3300047471 Bacteria 64704
576 Ga0495593_0000167 3300047673 Bacteria 33674
577 Ga0495593_0001656 3300047673 Bacteria 13185
578 Ga0495602_0026534 3300048088 Bacteria 5584
579 Ga0495602_0410494 3300048088 Bacteria 964
580 Ga0495614_0028049 3300048089 Bacteria 2427
581 Ga0495614_0187546 3300048089 Bacteria 932
582 Ga0495615_0039510 3300048090 Bacteria 1171
583 Ga0495626_0093816 3300048091 Bacteria 1317
584 Ga0496100_0029955 3300048903 Bacteria 3371
585 Ga0496100_0060288 3300048903 Bacteria 2497
586 Ga0496100_0073756 3300048903 Bacteria 2285
587 Ga0496100_0294554 3300048903 Bacteria 1213
588 Ga0496100_0347260 3300048903 Bacteria 1120
589 Ga0496101_0766335 3300048904 Bacteria 761
590 Ga0496101_0994955 3300048904 Bacteria 659
591 Ga0496102_0218711 3300048905 Bacteria 1795
592 Ga0496102_0837366 3300048905 Bacteria 842
593 Ga0496104_0009359 3300048907 Bacteria 8712
594 Ga0496104_0085123 3300048907 Bacteria 3017
595 Ga0496105_0217714 3300048908 Bacteria 1555
596 Ga0496105_0336465 3300048908 Bacteria 1208
597 Ga0496106_0002876 3300048909 Bacteria 12793
598 Ga0496106_0103438 3300048909 Bacteria 2210
599 Ga0496106_0428877 3300048909 Bacteria 1062
600 Ga0496107_0020202 3300048910 Bacteria 4703
601 Ga0496107_0028836 3300048910 Bacteria 3946
602 Ga0496107_0258673 3300048910 Bacteria 1295
603 Ga0496108_0004100 3300048911 Bacteria 11699
604 Ga0496108_0025327 3300048911 Bacteria 4889
605 Ga0496108_0896295 3300048911 Bacteria 761
606 Ga0496109_0000399 3300048912 Bacteria 39304
607 Ga0496109_0109721 3300048912 Bacteria 2565
608 Ga0496109_0146203 3300048912 Bacteria 2212
609 Ga0496110_0057809 3300048913 Bacteria 3415
610 Ga0496110_0256267 3300048913 Bacteria 1593
611 Ga0496110_0453391 3300048913 Bacteria 1169
612 Ga0496110_0488194 3300048913 Bacteria 1122
613 Ga0496111_0034399 3300048914 Bacteria 3618
614 Ga0496111_0088163 3300048914 Bacteria 2272
615 Ga0496111_0479523 3300048914 Bacteria 916
616 Ga0496112_0000004 3300048915 Bacteria 553294
617 Ga0496112_0006192 3300048915 Bacteria 10469
618 Ga0496112_0097759 3300048915 Bacteria 2906
619 Ga0496112_0150375 3300048915 Bacteria 2295
620 Ga0496112_0151225 3300048915 Bacteria 2288
621 Ga0496112_0185080 3300048915 Bacteria 2046
622 Ga0496112_0553044 3300048915 Bacteria 1085
623 Ga0496112_1094808 3300048915 Bacteria 715
624 Ga0496113_0051955 3300048916 Bacteria 3059
625 Ga0496113_0272102 3300048916 Bacteria 1354
626 Ga0496114_0558041 3300048917 Bacteria 1011
627 Ga0496114_0673918 3300048917 Bacteria 908
628 Ga0496115_0068148 3300048918 Bacteria 2880
629 Ga0496115_0134285 3300048918 Bacteria 2040
630 Ga0496115_0153977 3300048918 Bacteria 1899
631 Ga0496115_0265535 3300048918 Bacteria 1411
632 Ga0496115_0563723 3300048918 Bacteria 909
633 Ga0496116_0153126 3300048919 Bacteria 1277
634 Ga0496117_0047158 3300048920 Bacteria 3093
635 Ga0496118_0002112 3300048921 Bacteria 27854
636 Ga0496118_0273110 3300048921 Bacteria 946
637 Ga0496118_0491946 3300048921 Bacteria 612
638 Ga0496121_0000077 3300048924 Bacteria 235293
639 Ga0496121_0005599 3300048924 Bacteria 16025
640 Ga0496121_0037086 3300048924 Bacteria 4334
641 Ga0496121_0045611 3300048924 Bacteria 3764
642 Ga0496121_0070241 3300048924 Bacteria 2822
643 Ga0496121_0101544 3300048924 Bacteria 2218
644 Ga0496121_0143246 3300048924 Bacteria 1770
645 Ga0496121_0434327 3300048924 Bacteria 851
646 Ga0496122_0018636 3300048925 Bacteria 6395
647 Ga0496124_0002375 3300048927 Bacteria 24818
648 Ga0496124_0283550 3300048927 Bacteria 1206
649 Ga0496125_0008508 3300048928 Bacteria 10731
650 Ga0496125_0053332 3300048928 Bacteria 3316
651 Ga0496126_0005960 3300048929 Bacteria 13713
652 Ga0496126_0006024 3300048929 Bacteria 13609
653 Ga0496126_0008959 3300048929 Bacteria 10711
654 Ga0496126_0015347 3300048929 Bacteria 7705
655 Ga0496126_0035465 3300048929 Bacteria 4675
656 Ga0496126_0311505 3300048929 Bacteria 1296
657 Ga0496126_0576361 3300048929 Bacteria 889
658 Ga0496126_0616471 3300048929 Bacteria 853
659 Ga0495682_0160449 3300049460 Bacteria 801
660 Ga0495682_0217445 3300049460 Bacteria 677
661 Ga0501036_0553388 3300049572 Bacteria 956
662 Ga0501067_0037376 3300049583 Bacteria 2697
663 Ga0501069_0139856 3300049585 Bacteria 1389
664 Ga0501076_0731521 3300049592 Bacteria 817
665 Ga0501206_077864 3300049653 Bacteria 571
666 Ga0501035_1105589 3300049822 Bacteria 619
667 nmdc:mga03683_37085_c1 3300050489 Bacteria 1985
668 nmdc:mga03n38_58290_c1 3300050490 Bacteria 1749
669 nmdc:mga0yw44_13577_c1 3300050492 Bacteria 4293
670 nmdc:mga0yw44_199326_c1 3300050492 Bacteria 1322
671 nmdc:mga06z11_102875_c1 3300050494 Bacteria 1570
672 nmdc:mga06z11_105713_c1 3300050494 Bacteria 1551
673 nmdc:mga06z11_239111_c1 3300050494 Bacteria 1066
674 nmdc:mga06z11_61084_c1 3300050494 Bacteria 1964
675 nmdc:mga04h51_326304_c1 3300050495 Bacteria 630
676 nmdc:mga07m45_94727_c1 3300050496 Bacteria 1712
677 nmdc:mga05p37_333324_c1 3300050507 Bacteria 1791
678 nmdc:mga05p37_521441_c1 3300050507 Bacteria 1359
679 nmdc:mga09592_446458_c1 3300050508 Bacteria 1116
680 nmdc:mga0qj67_54038_c1 3300050509 Bacteria 3180
681 nmdc:mga06r32_386731_c1 3300050510 Bacteria 1382
682 nmdc:mga08y16_93908_c1 3300050511 Bacteria 3125
683 nmdc:mga0n895_11740_c1 3300050512 Bacteria 7829
684 nmdc:mga08x19_53446_c1 3300050514 Bacteria 2599
685 nmdc:mga0sz30_279980_c1 3300050516 Bacteria 743
686 Ga0495601_0010740 3300053077 Bacteria 5464
687 Ga0495601_0053548 3300053077 Bacteria 2551
688 Ga0495601_0060712 3300053077 Bacteria 2399
689 Ga0495612_0141778 3300053078 Bacteria 1043
690 Ga0495612_0233008 3300053078 Bacteria 817
691 Ga0500635_0004570 3300053080 Bacteria 3573
692 Ga0495655_0138671 3300053083 Bacteria 755
693 Ga0495595_0001173 3300053084 Bacteria 10166
694 Ga0495595_0086348 3300053084 Bacteria 1501
695 Ga0495595_0313419 3300053084 Bacteria 790
696 Ga0495619_0000166 3300053085 Bacteria 48296
697 Ga0495619_0010230 3300053085 Bacteria 5909
698 Ga0500566_0160187 3300053094 Bacteria 1174
699 Ga0500641_0162866 3300053096 Bacteria 961
700 Ga0500641_0195270 3300053096 Bacteria 865
701 Ga0500650_0104518 3300053098 Bacteria 1324
702 Ga0500554_002072 3300053102 Bacteria 3884
703 Ga0500555_035785 3300053103 Bacteria 1394
704 Ga0500556_0018683 3300053104 Bacteria 2192
705 Ga0500594_0283958 3300053118 Bacteria 554
706 Ga0500595_005395 3300053119 Bacteria 5590
707 Ga0500595_018142 3300053119 Bacteria 2579
708 Ga0500614_013838 3300053123 Bacteria 1778
709 Ga0500617_236231 3300053124 Bacteria 634
710 Ga0500658_0282148 3300053134 Bacteria 763
711 Ga0500568_0032485 3300053139 Bacteria 2146
712 Ga0500573_0230269 3300053140 Bacteria 966
713 Ga0500590_108047 3300053148 Bacteria 1325
714 Ga0500603_000516 3300053150 Bacteria 9817
715 Ga0500603_060524 3300053150 Bacteria 1058
716 Ga0500619_136261 3300053154 Bacteria 837
717 Ga0500622_0002020 3300053156 Bacteria 15148
718 Ga0500622_0081922 3300053156 Bacteria 1615
719 Ga0500633_0088828 3300053160 Bacteria 1127
720 Ga0500636_0184947 3300053177 Bacteria 1115
721 Ga0500636_0293969 3300053177 Bacteria 804
722 Ga0500637_0111325 3300053178 Bacteria 1587
723 Ga0500645_072258 3300053730 Bacteria 989
724 Ga0500609_038256 3300053731 Bacteria 663
725 Ga0500596_000256 3300053735 Bacteria 9337
726 2509149247 2508501128 Bacteria 8613869
727 2513659609 2513237096 Bacteria 8722461
728 2513673608 2513237098 Bacteria 9902361
729 2513691623 2513237101 Bacteria 7952346
730 2513862637 2513237137 Bacteria 9558895
731 2513889417 2513237141 Bacteria 8496279
732 2513921671 2513237145 Bacteria 8979722
733 2517893293 2517572143 Bacteria 9484767
734 2524467656 2524023210 Bacteria 9029266
735 2524539963 2524023228 Bacteria 10118060
736 2603859799 2602042107 Bacteria 6226103
737 2671117937 2667528175 Bacteria 7532676
738 2723845955 2721755755 Bacteria 8322773
739 2793069838 2791355197 Bacteria 8420563
740 2793079717
741 2857530596 2857524615 Bacteria 6615449
742 2874609382 2874604998 Bacteria 7834745
743 2876813238 2876808645 Bacteria 8824342
744 2879110396 2879110137 Bacteria 8907982
745 2885374887 2885374607 Bacteria 8927485
746 2885387566 2885383462 Bacteria 9473874
747 2889040819 2889033259 Bacteria 9099371
748 2893070245 2893066018 Bacteria 6158120
749 2903756493 2903748898 Bacteria 9972761
750 2903775021 2903768456 Bacteria 9749579
751 2904701990
752 2906617502
753 2906636196 2906635258 Bacteria 8601019
754 2906667999 2906660503 Bacteria 8595048
755 2908743689 2908739725 Bacteria 8628932
756 2908761283 2908756301 Bacteria 8864324
757 2917699780 2917699015 Bacteria 7043791
758 2919076191 2919073203 Bacteria 6531949
759 2922367913 2922361189 Bacteria 7436256
760 2922392198 2922386360 Bacteria 7017218
761 2922429179
762 2935634230 2935630451 Bacteria 8169952
763 2941511120 2941507105 Bacteria 8166816
764 2941518504 2941515067 Bacteria 8166720
765 2941527233 2941523033 Bacteria 8169134
766 3005479348 3005474847 Bacteria 9259049
767 8006941813 8006933436 Bacteria 10410654
768 8006968741 8006964411 Bacteria 8966052
769 8006981561 8006973647 Bacteria 10679141
770 8006990517 8006984368 Bacteria 9651211
771 8006996270 8006994254 Bacteria 8309700
772 8019557708 8019555841 Bacteria 9642137
773 8056680643 8056673599 Bacteria 7871253
774 8056684058 8056681323 Bacteria 8472857
775 8056695758 8056689827 Bacteria 6712655
776 Ga0373955_0359973
777 JGI24740J21852_10018916
778 JGI24737J22298_10017235
779 JGI25406J46586_10000026
780 JGI25153J46596_10002939
781 Ga0070658_10465709
782 Ga0070683_100196501
783 Ga0070690_100470056
784 Ga0070690_101109314
785 Ga0068869_100989412
786 Ga0070680_100168198
787 Ga0070682_100306470
788 Ga0068868_100207938
789 Ga0070660_100045225
790 Ga0070660_100800078
791 Ga0070661_100068228
792 Ga0070661_100250698
793 Ga0070668_100265230
794 Ga0070668_100270717
795 Ga0070671_100182153
796 Ga0070674_100920837
797 Ga0070673_100202823
798 Ga0070673_100422201
799 Ga0070673_100436720
800 Ga0070688_100148337
801 Ga0070659_100117803
802 Ga0070659_102032813
803 Ga0070709_10003671
804 Ga0070709_10036185
805 Ga0070714_100049152
806 Ga0070714_100358971
807 Ga0070713_100228506
808 Ga0070713_101545528
809 Ga0070710_10138567
810 Ga0070710_11198120
811 Ga0070701_10247114
812 Ga0070711_100001695
813 Ga0070711_100093815
814 Ga0070700_100324905
815 Ga0070694_100435457
816 Ga0070708_101187742
817 Ga0070663_100012415
818 Ga0070663_100102906
819 Ga0070663_100268858
820 Ga0070678_100585220
821 Ga0070681_10574633
822 Ga0070681_10665871
823 Ga0068867_100192607
824 Ga0070685_10346350
825 Ga0070685_11109969
826 Ga0070706_100519340
827 Ga0070706_100602553
828 Ga0070707_100319127
829 Ga0070698_100687677
830 Ga0070679_100010022
831 Ga0070679_100498782
832 Ga0070679_100649621
833 Ga0070684_100053948
834 Ga0070697_100078777
835 Ga0068853_100006903
836 Ga0068853_100066585
837 Ga0068853_100400370
838 Ga0068853_100468955
839 Ga0070672_101054319
840 Ga0070686_100595452
841 Ga0070693_100659680
842 Ga0070665_100002761
843 Ga0070665_100036089
844 Ga0070665_100194793
845 Ga0070704_101599839
846 Ga0068855_100005114
847 Ga0068855_100049610
848 Ga0068855_100088947
849 Ga0068855_100475617
850 Ga0068857_100029142
851 Ga0068857_100029970
852 Ga0068857_100048463
853 Ga0068854_100024882
854 Ga0068854_100053700
855 Ga0068854_100119515
856 Ga0068856_100010355
857 Ga0068856_100016084
858 Ga0068856_100233969
859 Ga0070702_100017077
860 Ga0068852_100210962
861 Ga0068852_100792268
862 Ga0068859_100465767
863 Ga0068864_100104347
864 Ga0068864_100132665
865 Ga0068864_100770823
866 Ga0068864_101668592
867 Ga0068861_100277973
868 Ga0068851_10002904
869 Ga0068851_10145550
870 Ga0068851_10800322
871 Ga0068870_10464916
872 Ga0068870_10720524
873 Ga0068863_100933711
874 Ga0068858_100015447
875 Ga0068860_100000149
876 Ga0068860_100183487
877 Ga0068862_100372673
878 Ga0068862_100698615
879 Ga0068862_100793013
880 Ga0068862_101186002
881 Ga0081455_10038775
882 Ga0081455_10233969
883 Ga0081540_1001309
884 Ga0081540_1002273
885 Ga0081540_1009658
886 Ga0081540_1018007
887 Ga0081540_1153940
888 Ga0081539_10000176
889 Ga0070717_10007137
890 Ga0070717_10301000
891 Ga0070717_10420016
892 Ga0070717_11024552
893 Ga0075365_10131475
894 Ga0075365_10420749
895 Ga0075365_10438328
896 Ga0075368_10086374
897 Ga0075368_10167409
898 Ga0075363_100145975
899 Ga0075363_100363618
900 Ga0075364_10117612
901 Ga0075364_10190475
902 Ga0070716_100062588
903 Ga0070716_100194549
904 Ga0070716_100352932
905 Ga0070712_100002927
906 Ga0070712_100023775
907 Ga0070712_100517229
908 Ga0070712_101021944
909 Ga0075362_10134404
910 Ga0075362_10363621
911 Ga0075362_10527472
912 Ga0075367_10021951
913 Ga0075367_10066205
914 Ga0075367_10080292
915 Ga0075367_10150524
916 Ga0075367_10155648
917 Ga0075369_10030536
918 Ga0075369_10042129
919 Ga0075366_10242957
920 Ga0097621_100091544
921 Ga0097621_100110476
922 Ga0075370_10705337
923 Ga0075428_100066108
924 Ga0075428_100205307
925 Ga0075431_100049151
926 Ga0075434_101227201
927 Ga0075429_100131708
928 Ga0068865_100575830
929 Ga0075436_100085391
930 Ga0097620_100465756
931 Ga0099825_1032409
932 Ga0099824_1020283
933 Ga0099822_1004892
934 Ga0099794_10141928
935 Ga0099795_10025448
936 Ga0099795_10027848
937 Ga0099795_10191032
938 Ga0105250_10091560
939 Ga0105250_10246468
940 Ga0105240_10004765
941 Ga0105240_10034450
942 Ga0105240_10078859
943 Ga0111539_10039686
944 Ga0105245_10106409
945 Ga0105245_10310203
946 Ga0105247_10025319
947 Ga0105247_10097298
948 Ga0105247_10162460
949 Ga0114129_10359744
950 Ga0105243_12042779
951 Ga0105241_10001875
952 Ga0105241_10049725
953 Ga0105241_10134762
954 Ga0105241_10411186
955 Ga0105242_11038082
956 Ga0105248_10411451
957 Ga0105248_10992350
958 Ga0105237_10011939
959 Ga0105237_10057288
960 Ga0105237_10074813
961 Ga0105237_10182633
962 Ga0105237_10252839
963 Ga0105237_12084758
964 Ga0105238_10010766
965 Ga0105238_10022965
966 Ga0105238_10105365
967 Ga0105238_10224008
968 Ga0105238_10229948
969 Ga0105249_11209533
970 Ga0099796_10004763
971 Ga0099796_10081789
972 Ga0099796_10160585
973 Ga0105239_10343567
974 Ga0105239_10363184
975 Ga0105239_10612264
976 Ga0105246_10133469
977 Ga0157341_1018539
978 Ga0157370_10204811
979 Ga0157370_11756054
980 Ga0157369_10252228
981 Ga0157369_10287025
982 Ga0157369_10448363
983 Ga0157374_10141762
984 Ga0157378_10057540
985 Ga0157378_10375694
986 Ga0157378_11728827
987 Ga0157378_12310041
988 Ga0163163_10120043
989 Ga0163163_10348164
990 Ga0157380_10393542
991 Ga0157380_10618593
992 Ga0157377_10245173
993 Ga0157379_10028341
994 Ga0157379_10233257
995 Ga0157379_10546756
996 Ga0157376_10387508
997 Ga0157376_10577191
998 Ga0182007_10094056
999 Ga0163161_10047763
1000 Ga0163161_10138864
1001 Ga0163161_10683252
1002 Ga0206356_11888330
1003 Ga0213872_10144174
1004 Ga0213874_10015710
1005 Ga0213876_10012439
1006 Ga0209233_1005091
1007 Ga0207666_1031231
1008 Ga0209758_1008123
1009 Ga0209758_1056670
1010 Ga0207697_10036674
1011 Ga0207656_10074878
1012 Ga0207696_1099484
1013 Ga0207653_10084620
1014 Ga0207682_10307579
1015 Ga0207692_10100530
1016 Ga0207710_10019866
1017 Ga0207710_10350564
1018 Ga0207647_10000524
1019 Ga0207647_10298795
1020 Ga0207699_10025318
1021 Ga0207643_10065063
1022 Ga0207705_10221347
1023 Ga0207705_10369746
1024 Ga0207684_10045107
1025 Ga0207654_10007949
1026 Ga0207654_10072134
1027 Ga0207654_10142830
1028 Ga0207654_10206516
1029 Ga0207654_10639938
1030 Ga0207707_10062979
1031 Ga0207707_10083696
1032 Ga0207695_10000883
1033 Ga0207695_10135969
1034 Ga0207695_10246566
1035 Ga0207695_10712875
1036 Ga0207671_10015920
1037 Ga0207671_10121226
1038 Ga0207671_10137988
1039 Ga0207693_10007054
1040 Ga0207693_10153063
1041 Ga0207693_10288346
1042 Ga0207693_10404597
1043 Ga0207663_10013553
1044 Ga0207663_10109514
1045 Ga0207663_10368204
1046 Ga0207663_10456523
1047 Ga0207660_10043609
1048 Ga0207660_10255687
1049 Ga0207657_10035231
1050 Ga0207649_10910707
1051 Ga0207649_11340773
1052 Ga0207652_10004081
1053 Ga0207652_10036809
1054 Ga0207694_10000436
1055 Ga0207694_10050538
1056 Ga0207694_10096310
1057 Ga0207694_10105993
1058 Ga0207694_10328505
1059 Ga0207650_11360921
1060 Ga0207687_10060012
1061 Ga0207700_10046160
1062 Ga0207700_10152294
1063 Ga0207700_10869758
1064 Ga0207664_10004100
1065 Ga0207664_10093755
1066 Ga0207664_10346071
1067 Ga0207690_11126493
1068 Ga0207686_10450227
1069 Ga0207686_10707723
1070 Ga0207709_10235186
1071 Ga0207709_10532452
1072 Ga0207670_10520858
1073 Ga0207704_10994017
1074 Ga0207665_10032854
1075 Ga0207665_10162020
1076 Ga0207665_10195062
1077 Ga0207711_10198385
1078 Ga0207689_10022866
1079 Ga0207689_10098774
1080 Ga0207689_10470244
1081 Ga0207667_10011785
1082 Ga0207667_10016252
1083 Ga0207667_10090457
1084 Ga0207667_10090923
1085 Ga0207667_10096660
1086 Ga0207667_10727377
1087 Ga0207712_10598285
1088 Ga0207668_10081537
1089 Ga0207668_10124667
1090 Ga0207668_10529991
1091 Ga0207640_10030276
1092 Ga0207639_10009323
1093 Ga0207639_10032959
1094 Ga0207639_10082300
1095 Ga0207639_10083086
1096 Ga0207639_10083580
1097 Ga0207639_10565670
1098 Ga0207678_10042761
1099 Ga0207678_10056499
1100 Ga0207678_10074088
1101 Ga0207678_10185724
1102 Ga0207708_10077114
1103 Ga0207708_10078138
1104 Ga0207702_10000005
1105 Ga0207702_10119147
1106 Ga0207702_10413269
1107 Ga0207702_10914827
1108 Ga0207641_10462458
1109 Ga0207648_10118457
1110 Ga0207648_11451790
1111 Ga0207676_11184629
1112 Ga0207674_10010135
1113 Ga0207674_10012171
1114 Ga0207674_10034888
1115 Ga0207674_10279287
1116 Ga0207675_101123439
1117 Ga0207683_10081522
1118 Ga0207698_10244333
1119 Ga0207698_10245153
1120 Ga0209589_1000030
1121 Ga0209489_100056
1122 Ga0209700_100059
1123 Ga0209813_10076378
1124 Ga0268266_10015491
1125 Ga0268266_10086654
1126 Ga0268266_10215927
1127 Ga0268266_10350389
1128 Ga0268266_11001884
1129 Ga0268265_10086493
1130 Ga0268264_10000084
1131 Ga0268264_10181554
1132 Ga0265334_10011893
1133 Ga0307517_10000369
1134 Ga0307515_10013420
1135 Ga0307515_10161382
1136 Ga0265332_10031536
1137 Ga0265328_10301304
1138 Ga0265325_10083915
1139 Ga0265340_10008535
1140 Ga0265339_10002239
1141 Ga0265339_10184544
1142 Ga0265316_10322192
1143 Ga0265316_10322446
1144 Ga0307513_10125213
1145 Ga0307513_10167681
1146 Ga0307513_10840222
1147 Ga0307509_10022959
1148 Ga0307509_10072887
1149 Ga0307509_10073475
1150 Ga0307509_10268243
1151 Ga0307508_10000105
1152 Ga0307508_10047728
1153 Ga0307508_10111632
1154 Ga0265314_10170340
1155 Ga0307516_10006693
1156 Ga0307516_10021202
1157 Ga0307516_10124721
1158 Ga0307516_10126829
1159 Ga0307516_10717806
1160 Ga0307411_10269500
1161 Ga0307411_10406165
1162 Ga0307415_100279890
1163 Ga0307415_100285227
1164 Ga0307507_10091342
1165 Ga0307510_10009194
1166 Ga0307510_10153086
1167 Ga0307510_10198296
1168 Ga0307510_10376245
1169 Ga0315911_1000020
1170 Ga0316215_1002951
1171 Ga0373930_0019643
1172 Ga0373926_0218118
1173 Ga0373934_0002431
1174 Ga0373934_0189173
1175 Ga0373940_0049878
1176 Ga0373944_0036653
1177 Ga0373952_0092220
1178 Ga0373923_0003726
1179 Ga0373923_0054767
1180 Ga0373932_0169421
1181 Ga0373936_0060101
1182 Ga0373945_0116967
1183 Ga0373953_0000929
1184 Ga0373954_0000067
1185 Ga0373956_0001639
1186 Ga0373957_0000501
1187 Ga0373943_0001888
1188 Ga0373943_0089161
1189 Ga0373946_0004239
1190 Ga0373946_0309961
1191 Ga0373955_0000377
1192 Ga0373924_0004215
1193 Ga0373924_0254045
1194 Ga0373931_0055359
1195 Ga0373935_0008893
1196 Ga0373935_0415873
1197 Ga0373935_0874193
1198 Ga0373927_0003905
1199 Ga0373927_0007408
1200 Ga0373927_0068674
1201 Ga0373927_0593051
1202 Ga0373933_0000324
1203 Ga0373933_0000519
1204 Ga0373933_0198221
1205 Ga0373933_0512443
1206 Ga0373947_0007983
1207 Ga0373947_0020182
1208 Ga0373947_0196151
1209 Ga0373937_0001425
1210 Ga0373937_0505927
1211 Ga0373937_1329937
1212 Ga0373925_0103380
1213 Ga0373925_0197307
1214 Ga0373925_0411074
1215 Ga0373925_0851127
1216 Ga0395900_0331538
1217 Ga0395898_0057313
1218 Ga0395898_0173684
1219 Ga0395898_0310247
1220 Ga0395905_0083220
1221 Ga0395905_0661307
1222 Ga0395901_0596621
1223 Ga0436365_0871323
1224 Ga0436360_0160802
1225 Ga0436360_0431558
1226 Ga0436360_0844831
1227 Ga0436361_0836412
1228 Ga0436363_0691736
1229 Ga0436363_0933367
1230 Ga0436363_1439088
1231 Ga0436362_1177272
1232 Ga0451787_381759
1233 Ga0451793_1505848
1234 Ga0451800_0877773
1235 Ga0451804_0785817
1236 Ga0451833_1444530
1237 Ga0451839_0242778
1238 Ga0451847_0804396
1239 Ga0451847_0967682
1240 Ga0451853_0833569
1241 Ga0439455_0174325
1242 Ga0466966_0244811
1243 Ga0466963_0286380
1244 Ga0466963_0505668
1245 Ga0466959_0198078
1246 Ga0466967_0509034
1247 Ga0466967_0604624
1248 Ga0495617_106448
1249 Ga0495627_128409
1250 Ga0495592_0046096
1251 Ga0495592_0046648
1252 Ga0495603_0001576
1253 Ga0495603_0150714
1254 Ga0495629_0000117
1255 Ga0495629_0009626
1256 Ga0495629_0100390
1257 Ga0495638_0093554
1258 Ga0495638_0214098
1259 Ga0495641_0002118
1260 Ga0495651_0003726
1261 Ga0495651_0042708
1262 Ga0495651_0343954
1263 Ga0495653_0001052
1264 Ga0495580_0004355
1265 Ga0495582_0001007
1266 Ga0495582_0545930
1267 Ga0495639_0001543
1268 Ga0495639_0040605
1269 Ga0495639_0058893
1270 Ga0495662_0004867
1271 Ga0495662_0334420
1272 Ga0495664_0025293
1273 Ga0495664_0207717
1274 Ga0495594_0000662
1275 Ga0495594_0266344
1276 Ga0495606_0007334
1277 Ga0495608_0002910
1278 Ga0495618_0150134
1279 Ga0495620_0053958
1280 Ga0495620_0166016
1281 Ga0495628_0003826
1282 Ga0495630_0001278
1283 Ga0495631_0048462
1284 Ga0495631_0351769
1285 Ga0495644_0315937
1286 Ga0495666_0020673
1287 Ga0495652_0011186
1288 Ga0495652_0067716
1289 Ga0495652_0669151
1290 Ga0495665_0002979
1291 Ga0495665_0159256
1292 Ga0495640_0003398
1293 Ga0495640_0538124
1294 Ga0495587_0039700
1295 Ga0495598_0006094
1296 Ga0495597_0053312
1297 Ga0495645_0003011
1298 Ga0495645_0333537
1299 Ga0495622_0009623
1300 Ga0495622_0010153
1301 Ga0495622_0044534
1302 Ga0495667_0000305
1303 Ga0495667_0055933
1304 Ga0495656_0019096
1305 Ga0495668_0147685
1306 Ga0495668_0275825
1307 Ga0495634_0003435
1308 Ga0495634_0012645
1309 Ga0495635_0000102
1310 Ga0495635_0004903
1311 Ga0495661_0331242
1312 Ga0495588_0018542
1313 Ga0495588_0034912
1314 Ga0495588_0119379
1315 Ga0495588_0330211
1316 Ga0495657_0008816
1317 Ga0495657_0247965
1318 Ga0495599_0011854
1319 Ga0495623_0011690
1320 Ga0495623_0342562
1321 Ga0495623_0570549
1322 Ga0495646_0058921
1323 Ga0495646_0070496
1324 Ga0495647_0033728
1325 Ga0495647_0068929
1326 Ga0495658_0002270
1327 Ga0495613_0007307
1328 Ga0495613_0012699
1329 Ga0495613_0346267
1330 Ga0495624_0001774
1331 Ga0495624_0221275
1332 Ga0495624_0405341
1333 Ga0495600_0000357
1334 Ga0495600_0886703
1335 Ga0495581_0004221
1336 Ga0495604_0001099
1337 Ga0495604_0367603
1338 Ga0495636_0021311
1339 Ga0495674_0029184
1340 Ga0495674_0325463
1341 Ga0495672_0047842
1342 Ga0495672_0057186
1343 Ga0495680_0003585
1344 Ga0495680_0039030
1345 Ga0495687_140249
1346 Ga0495675_0004354
1347 Ga0495675_0352005
1348 Ga0495675_0395610
1349 Ga0495685_067087
1350 Ga0495684_0000088
1351 Ga0495593_0000167
1352 Ga0495593_0001656
1353 Ga0495602_0026534
1354 Ga0495602_0410494
1355 Ga0495614_0028049
1356 Ga0495614_0187546
1357 Ga0495615_0039510
1358 Ga0495626_0093816
1359 Ga0496100_0029955
1360 Ga0496100_0060288
1361 Ga0496100_0073756
1362 Ga0496100_0294554
1363 Ga0496100_0347260
1364 Ga0496101_0766335
1365 Ga0496101_0994955
1366 Ga0496102_0218711
1367 Ga0496102_0837366
1368 Ga0496104_0009359
1369 Ga0496104_0085123
1370 Ga0496105_0217714
1371 Ga0496105_0336465
1372 Ga0496106_0002876
1373 Ga0496106_0103438
1374 Ga0496106_0428877
1375 Ga0496107_0020202
1376 Ga0496107_0028836
1377 Ga0496107_0258673
1378 Ga0496108_0004100
1379 Ga0496108_0025327
1380 Ga0496108_0896295
1381 Ga0496109_0000399
1382 Ga0496109_0109721
1383 Ga0496109_0146203
1384 Ga0496110_0057809
1385 Ga0496110_0256267
1386 Ga0496110_0453391
1387 Ga0496110_0488194
1388 Ga0496111_0034399
1389 Ga0496111_0088163
1390 Ga0496111_0479523
1391 Ga0496112_0000004
1392 Ga0496112_0006192
1393 Ga0496112_0097759
1394 Ga0496112_0150375
1395 Ga0496112_0151225
1396 Ga0496112_0185080
1397 Ga0496112_0553044
1398 Ga0496112_1094808
1399 Ga0496113_0051955
1400 Ga0496113_0272102
1401 Ga0496114_0558041
1402 Ga0496114_0673918
1403 Ga0496115_0068148
1404 Ga0496115_0134285
1405 Ga0496115_0153977
1406 Ga0496115_0265535
1407 Ga0496115_0563723
1408 Ga0496116_0153126
1409 Ga0496117_0047158
1410 Ga0496118_0002112
1411 Ga0496118_0273110
1412 Ga0496118_0491946
1413 Ga0496121_0000077
1414 Ga0496121_0005599
1415 Ga0496121_0037086
1416 Ga0496121_0045611
1417 Ga0496121_0070241
1418 Ga0496121_0101544
1419 Ga0496121_0143246
1420 Ga0496121_0434327
1421 Ga0496122_0018636
1422 Ga0496124_0002375
1423 Ga0496124_0283550
1424 Ga0496125_0008508
1425 Ga0496125_0053332
1426 Ga0496126_0005960
1427 Ga0496126_0006024
1428 Ga0496126_0008959
1429 Ga0496126_0015347
1430 Ga0496126_0035465
1431 Ga0496126_0311505
1432 Ga0496126_0576361
1433 Ga0496126_0616471
1434 Ga0495682_0160449
1435 Ga0495682_0217445
1436 Ga0501036_0553388
1437 Ga0501067_0037376
1438 Ga0501069_0139856
1439 Ga0501076_0731521
1440 Ga0501206_077864
1441 Ga0501035_1105589
1442 nmdc:mga03683_37085_c1
1443 nmdc:mga03n38_58290_c1
1444 nmdc:mga0yw44_13577_c1
1445 nmdc:mga0yw44_199326_c1
1446 nmdc:mga06z11_102875_c1
1447 nmdc:mga06z11_105713_c1
1448 nmdc:mga06z11_239111_c1
1449 nmdc:mga06z11_61084_c1
1450 nmdc:mga04h51_326304_c1
1451 nmdc:mga07m45_94727_c1
1452 nmdc:mga05p37_333324_c1
1453 nmdc:mga05p37_521441_c1
1454 nmdc:mga09592_446458_c1
1455 nmdc:mga0qj67_54038_c1
1456 nmdc:mga06r32_386731_c1
1457 nmdc:mga08y16_93908_c1
1458 nmdc:mga0n895_11740_c1
1459 nmdc:mga08x19_53446_c1
1460 nmdc:mga0sz30_279980_c1
1461 Ga0495601_0010740
1462 Ga0495601_0053548
1463 Ga0495601_0060712
1464 Ga0495612_0141778
1465 Ga0495612_0233008
1466 Ga0500635_0004570
1467 Ga0495655_0138671
1468 Ga0495595_0001173
1469 Ga0495595_0086348
1470 Ga0495595_0313419
1471 Ga0495619_0000166
1472 Ga0495619_0010230
1473 Ga0500566_0160187
1474 Ga0500641_0162866
1475 Ga0500641_0195270
1476 Ga0500650_0104518
1477 Ga0500554_002072
1478 Ga0500555_035785
1479 Ga0500556_0018683
1480 Ga0500594_0283958
1481 Ga0500595_005395
1482 Ga0500595_018142
1483 Ga0500614_013838
1484 Ga0500617_236231
1485 Ga0500658_0282148
1486 Ga0500568_0032485
1487 Ga0500573_0230269
1488 Ga0500590_108047
1489 Ga0500603_000516
1490 Ga0500603_060524
1491 Ga0500619_136261
1492 Ga0500622_0002020
1493 Ga0500622_0081922
1494 Ga0500633_0088828
1495 Ga0500636_0184947
1496 Ga0500636_0293969
1497 Ga0500637_0111325
1498 Ga0500645_072258
1499 Ga0500609_038256
1500 Ga0500596_000256
1501 2509149247
1502 2513659609
1503 2513673608
1504 2513691623
1505 2513862637
1506 2513889417
1507 2513921671
1508 2517893293
1509 2524467656
1510 2524539963
1511 2603859799
1512 2671117937
1513 2723845955
1514 2793069838
1515 2793079717
1516 2857530596
1517 2874609382
1518 2876813238
1519 2879110396
1520 2885374887
1521 2885387566
1522 2889040819
1523 2893070245
1524 2903756493
1525 2903775021
1526 2904701990
1527 2906617502
1528 2906636196
1529 2906667999
1530 2908743689
1531 2908761283
1532 2917699780
1533 2919076191
1534 2922367913
1535 2922392198
1536 2922429179
1537 2935634230
1538 2941511120
1539 2941518504
1540 2941527233
1541 3005479348
1542 8006941813
1543 8006968741
1544 8006981561
1545 8006990517
1546 8006996270
1547 8019557708
1548 8056680643
1549 8056684058
1550 8056695758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

39

147

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.7611 24 154
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.7383 11 151
7btz-assembly1.cif.gz_B crystal structure of trmo 0.7298 21 159
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.7246 24 154
7bu1-assembly1.cif.gz_A crystal structure of trmo from pseudomonas aeruginosa 0.721 21 159
ID Description Score Start End Superfamily
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.7508 24 154 2.40.30.70
3okxB00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.7421 11 150 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.7186 24 154 2.40.30.70
af_Q6NMB4_59_230_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.7061 20 151 2.40.30.70
af_A1Z759_99_248_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.6951 23 159 2.40.30.70
ID Description Score Start End GO Terms
AF-A0A7U8C403-F1-model_v4 Possible VirR protein 0.8078 23 144
AF-A0A7C0X7R9-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.7969 23 144
AF-A0A7C6FX22-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.7957 23 144 GO:0008168
GO:0032259
AF-F6D5E0-F1-model_v4 Uncharacterized protein family UPF0066 0.7946 23 144
AF-A0A2R6E2Y8-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.794 16 144 GO:0008168
GO:0032259

Map