F480265

General Info

Members Datasets Scaffolds Average Seq Length
775 552 469 246

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10002087|Ga0265318_100020876
Length 291
Sequence MYDIPKITRPSKDIIAQLKDIGTATVAGSLAHAGFRQPHMIGPVTQYPGKSIVGTALTLQFLPQRPDLFSEGEYADVEKQLHRHVLYQVEEGDVVVVDARGDMTSGVFGDMMSTYFKGRGGAGIVIDGVMRDRPNVDKLDLALWLRGWTPNYHVQTGIYPSAVNVPIACGGVQVIPGDIIMADDDGVVVLPVSMAAKVIEDSKKHAEWEVFSREKLKQGADLRRYYPLHADAQGEYEAWRKLNPIRNSAYPATSVKCSSNHLPGTMRRLRDSSSVARALASITGTAVSSGT

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
15 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
16 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
17 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
18 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
19 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
22 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
23 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
24 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
25 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
26 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
27 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
28 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
29 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
30 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
31 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
32 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
33 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
34 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
35 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
36 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
37 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
38 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
39 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
40 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
41 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
42 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
43 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
44 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
45 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
46 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
47 2643221580 Devosia sp. Root635 Isolate Unclassified
48 2643221591 Devosia sp. Root685 Isolate Unclassified
49 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
50 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
51 2643221629 Devosia sp. Root105 Isolate Unclassified
52 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
53 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
54 2643221662 Devosia sp. Root413D1 Isolate Unclassified
55 2643221674 Devosia sp. Root436 Isolate Unclassified
56 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
57 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
58 2718217882 Rhizobium sp. N741 Isolate Nodule
59 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
60 2718218009 Rhizobium sp. N561 Isolate Nodule
61 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
62 2718218363 Rhizobium sp. N113 Isolate Nodule
63 2718218365 Rhizobium sp. N731 Isolate Nodule
64 2718218366 Rhizobium sp. N621 Isolate Nodule
65 2721755514 Rhizobium sp. N6212 Isolate Nodule
66 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
67 2721755810 Rhizobium sp. N871 Isolate Nodule
68 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
69 2728369365 Rhizobium sp. N1341 Isolate Nodule
70 2728369397 Rhizobium sp. N1314 Isolate Nodule
71 2738541293 Rhizobium sp. GV031 Isolate Unclassified
72 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
73 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
74 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
75 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
76 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
77 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
78 2791355260 Rhizobium sp. L9 Isolate Nodule
79 2791355264 Rhizobium sp. S9 Isolate Nodule
80 2791355265 Rhizobium sp. H4 Isolate Nodule
81 2791355267 Rhizobium sp. L18 Isolate Nodule
82 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
83 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
84 2802429633 Rhizobium anhuiense J3 Isolate Nodule
85 2802429634 Rhizobium anhuiense S10 Isolate Nodule
86 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
87 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
88 2802429637 Rhizobium anhuiense C15 Isolate Nodule
89 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
90 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
91 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
92 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
93 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
94 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
95 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
96 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
97 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
98 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
99 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
100 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
101 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
102 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
103 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
104 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
105 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
106 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
107 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
108 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
109 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
110 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
111 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
112 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
113 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
114 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
115 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
116 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
117 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
118 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
119 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
120 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
121 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
122 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
123 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
124 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
125 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
126 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
127 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
128 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
129 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
130 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
131 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
132 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
133 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
134 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
135 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
136 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
137 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
138 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
139 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
140 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
141 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
142 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
143 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
144 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
145 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
146 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
147 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
148 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
149 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
150 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
151 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
152 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
153 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
154 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
155 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
156 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
157 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
158 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
159 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
160 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
161 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
162 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
163 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
164 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
165 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
166 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
167 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
168 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
169 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
170 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
171 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
172 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
173 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
174 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
175 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
176 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
177 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
178 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
179 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
180 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
181 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
182 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
183 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
184 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
185 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
186 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
187 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
188 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
189 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
190 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
191 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
192 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
193 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
194 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
195 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
196 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
197 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
198 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
199 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
200 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
201 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
202 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
203 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
204 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
205 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
206 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
207 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
208 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
209 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
210 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
211 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
212 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
213 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
214 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
215 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
216 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
217 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
218 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
219 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
220 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
221 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
222 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
223 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
224 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
225 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
226 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
227 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
228 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
229 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
230 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
231 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
232 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
233 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
234 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
235 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
236 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
237 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
238 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
239 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
240 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
241 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
242 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
243 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
244 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
245 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
246 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
247 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
248 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
249 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
250 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
251 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
252 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
253 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
254 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
255 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
256 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
257 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
258 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
259 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
260 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
261 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
262 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
263 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
264 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
265 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
266 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
267 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
268 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
269 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
270 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
271 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
272 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
273 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
274 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
275 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
276 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
277 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
278 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
279 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
280 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
281 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
282 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
283 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
284 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
285 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
286 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
287 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
288 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
289 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
290 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
291 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
292 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
293 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
294 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
295 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
296 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
297 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
298 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
299 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
300 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
301 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
302 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
303 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
304 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
305 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
306 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
307 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
308 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
309 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
310 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
311 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
312 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
313 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
314 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
315 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
316 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
317 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
318 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
319 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
320 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
321 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
322 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
323 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
324 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
325 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
326 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
327 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
328 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
329 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
330 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
331 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
332 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
333 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
334 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
335 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
336 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
337 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
338 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
339 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
340 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
341 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
342 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
343 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
344 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
345 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
346 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
347 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
348 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
349 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
350 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
351 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
352 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
353 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
354 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
355 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
356 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
357 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
358 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
359 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
360 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
361 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
362 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
363 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
364 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
365 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
367 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
368 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
369 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
370 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
371 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
372 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
373 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
374 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
376 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
377 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
378 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
379 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
417 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
418 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
419 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
420 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
421 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
422 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
423 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
424 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
425 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
426 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
427 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
428 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
429 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
430 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
431 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
432 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
433 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
434 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
435 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
436 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
437 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
438 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
439 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
440 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
441 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
442 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
443 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
444 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
445 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
446 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
447 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
448 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
449 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
450 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
451 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
452 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
453 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
454 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
455 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
456 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
457 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
458 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
459 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
460 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
461 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
462 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
463 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
464 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
465 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
466 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
467 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
468 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
469 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
470 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
471 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
472 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
473 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
474 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
475 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
476 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
477 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
478 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
479 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
492 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
493 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
494 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
495 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
496 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
497 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
498 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
499 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
500 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
501 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
504 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
505 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
506 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
507 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
508 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
509 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
510 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
511 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
512 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
513 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
514 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
515 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
516 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
517 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
518 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
519 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
520 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
521 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
522 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
523 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
524 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
525 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
526 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
527 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
528 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
529 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
530 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
531 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
532 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
533 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
534 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
535 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
536 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
537 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
538 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
539 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
540 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
541 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
542 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
543 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
544 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
545 8024501048 Rhizobium sp. H4 Isolate Nodule
546 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
547 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
548 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
549 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
550 8056382006 Rhizobium croatiense 13T Isolate Nodule
551 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
552 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.52
Metatranscriptomes 0
Isolates 39.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.23
Nodule 32.39
Rhizoplane 0.52
Rhizosphere 39.35
Stem 0
Stem Tuber 0
Unclassified 12.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1010079 3300001915 Bacteria 1708
2 JGI24739J22299_10018230 3300001989 Bacteria 2525
3 JGI25156J39149_1002223 3300002705 Bacteria 7181
4 JGI25158J39367_1000205 3300002739 Bacteria 14120
5 JGI25157J39369_1000599 3300002741 Bacteria 21188
6 JGI25152J39213_1004650 3300002773 Bacteria 4254
7 JGI25152J39213_1006150 3300002773 Bacteria 3337
8 JGI25152J39213_1009450 3300002773 Bacteria 2317
9 JGI25150J39212_1007385 3300002774 Bacteria 2212
10 JGI25159J45721_1001121 3300002987 Bacteria 11452
11 JGI25151J46595_10000867 3300003187 Bacteria 23973
12 JGI25151J46595_10004550 3300003187 Bacteria 7312
13 JGI25151J46595_10018558 3300003187 Bacteria 2981
14 rootL2_10015096 3300003322 Bacteria 17553
15 rootH1_10100374 3300003323 Bacteria 7653
16 JGI25161J50226_1000050 3300003374 Bacteria 110628
17 JGI25161J50226_1003954 3300003374 Bacteria 3223
18 Ga0055526_1000595 3300003771 Bacteria 28430
19 Ga0055526_1024018 3300003771 Bacteria 2010
20 Ga0055524_1000922 3300003775 Bacteria 18970
21 Ga0055524_1002690 3300003775 Bacteria 8994
22 Ga0055524_1018262 3300003775 Bacteria 2443
23 Ga0055536_1052975 3300003781 Bacteria 880
24 Ga0055528_1000096 3300003790 Bacteria 70375
25 Ga0055528_1000716 3300003790 Bacteria 23431
26 Ga0055528_1014786 3300003790 Bacteria 2863
27 Ga0055528_1018681 3300003790 Bacteria 2339
28 Ga0055528_1030026 3300003790 Bacteria 1454
29 Ga0055540_1000399 3300003792 Bacteria 35498
30 Ga0055540_1031822 3300003792 Bacteria 1209
31 Ga0055540_1049953 3300003792 Bacteria 866
32 Ga0055543_1000489 3300004625 Bacteria 22914
33 Ga0065165_1005024 3300005262 Bacteria 7736
34 Ga0065165_1007074 3300005262 Bacteria 5637
35 Ga0065165_1016267 3300005262 Bacteria 2793
36 Ga0065707_10120174 3300005295 Bacteria 2141
37 Ga0070658_10019519 3300005327 Bacteria 5428
38 Ga0070683_100108132 3300005329 Bacteria 2622
39 Ga0070683_100605748 3300005329 Bacteria 1048
40 Ga0070682_100068256 3300005337 Bacteria 2267
41 Ga0068868_100138538 3300005338 Bacteria 1996
42 Ga0070660_100030363 3300005339 Bacteria 4055
43 Ga0070660_100133813 3300005339 Bacteria 1986
44 Ga0070660_100145156 3300005339 Bacteria 1905
45 Ga0070660_100180793 3300005339 Bacteria 1706
46 Ga0070687_100332424 3300005343 Bacteria 975
47 Ga0070661_100005094 3300005344 Bacteria 9066
48 Ga0070661_100018671 3300005344 Bacteria 4934
49 Ga0070661_100042747 3300005344 Bacteria 3308
50 Ga0070661_100074458 3300005344 Bacteria 2501
51 Ga0070661_100079929 3300005344 Bacteria 2413
52 Ga0070668_100011517 3300005347 Bacteria 6586
53 Ga0070668_100176104 3300005347 Bacteria 1744
54 Ga0070669_100016868 3300005353 Bacteria 5213
55 Ga0070669_100086993 3300005353 Bacteria 2336
56 Ga0070669_100217606 3300005353 Bacteria 1509
57 Ga0070674_100016108 3300005356 Bacteria 4683
58 Ga0070674_100049340 3300005356 Bacteria 2893
59 Ga0070674_100433145 3300005356 Bacteria 1082
60 Ga0070673_100217950 3300005364 Bacteria 1651
61 Ga0070659_100017270 3300005366 Bacteria 5425
62 Ga0070659_100161964 3300005366 Bacteria 1830
63 Ga0070659_100378991 3300005366 Bacteria 1191
64 Ga0070710_10000809 3300005437 Bacteria 15018
65 Ga0070708_100222091 3300005445 Bacteria 1772
66 Ga0070663_100008664 3300005455 Bacteria 6271
67 Ga0070663_100028440 3300005455 Bacteria 3806
68 Ga0070662_100030424 3300005457 Bacteria 3777
69 Ga0068867_100338039 3300005459 Bacteria 1253
70 Ga0070707_100140234 3300005468 Bacteria 2353
71 Ga0070699_100422994 3300005518 Bacteria 1206
72 Ga0070679_100131508 3300005530 Bacteria 2483
73 Ga0070684_100328127 3300005535 Bacteria 1406
74 Ga0070684_100625806 3300005535 Bacteria 1001
75 Ga0070684_100914887 3300005535 Bacteria 822
76 Ga0068853_100001347 3300005539 Bacteria 17688
77 Ga0068853_100012183 3300005539 Bacteria 6993
78 Ga0068853_100022202 3300005539 Bacteria 5298
79 Ga0070686_100035123 3300005544 Bacteria 3094
80 Ga0070665_100008163 3300005548 Bacteria 10598
81 Ga0070665_100058286 3300005548 Bacteria 3872
82 Ga0070665_100336422 3300005548 Bacteria 1514
83 Ga0068855_100040893 3300005563 Bacteria 5498
84 Ga0068855_100353259 3300005563 Bacteria 1619
85 Ga0068857_100021902 3300005577 Bacteria 5624
86 Ga0068857_100074871 3300005577 Bacteria 3018
87 Ga0068857_100166175 3300005577 Bacteria 2004
88 Ga0068854_100001486 3300005578 Bacteria 14198
89 Ga0068854_100041169 3300005578 Bacteria 3264
90 Ga0068854_100044855 3300005578 Bacteria 3141
91 Ga0068856_100012342 3300005614 Bacteria 8274
92 Ga0068856_100154879 3300005614 Bacteria 2301
93 Ga0068856_100281122 3300005614 Bacteria 1681
94 Ga0068856_100322254 3300005614 Bacteria 1563
95 Ga0068856_100454630 3300005614 Bacteria 1301
96 Ga0068852_100017669 3300005616 Bacteria 5601
97 Ga0068852_100034234 3300005616 Bacteria 4224
98 Ga0068852_100050523 3300005616 Bacteria 3563
99 Ga0068852_100119104 3300005616 Bacteria 2413
100 Ga0068852_100375473 3300005616 Bacteria 1394
101 Ga0068852_100885067 3300005616 Bacteria 910
102 Ga0068851_10005070 3300005834 Bacteria 5974
103 Ga0068862_100003242 3300005844 Bacteria 14082
104 Ga0068862_100047167 3300005844 Bacteria 3676
105 Ga0068862_100547084 3300005844 Bacteria 1105
106 Ga0081540_1019814 3300005983 Bacteria 4072
107 Ga0081539_10000316 3300005985 Bacteria 107841
108 Ga0070717_10104762 3300006028 Bacteria 2407
109 Ga0075365_10020389 3300006038 Bacteria 4109
110 Ga0075365_10023833 3300006038 Bacteria 3853
111 Ga0075365_10036309 3300006038 Bacteria 3192
112 Ga0075365_10186122 3300006038 Bacteria 1452
113 Ga0075365_10228251 3300006038 Bacteria 1307
114 Ga0075368_10035242 3300006042 Bacteria 1952
115 Ga0075363_100072523 3300006048 Bacteria 1872
116 Ga0075363_100213452 3300006048 Bacteria 1105
117 Ga0075364_10222336 3300006051 Bacteria 1282
118 Ga0075364_10443482 3300006051 Bacteria 887
119 Ga0075362_10003549 3300006177 Bacteria 5474
120 Ga0075362_10128528 3300006177 Bacteria 1203
121 Ga0075367_10012197 3300006178 Bacteria 4572
122 Ga0075367_10016873 3300006178 Bacteria 3996
123 Ga0075367_10189720 3300006178 Bacteria 1282
124 Ga0075367_10310440 3300006178 Bacteria 993
125 Ga0075369_10030199 3300006186 Bacteria 2281
126 Ga0075369_10044691 3300006186 Bacteria 1903
127 Ga0075369_10105746 3300006186 Bacteria 1265
128 Ga0075366_10001329 3300006195 Bacteria 12354
129 Ga0075366_10200289 3300006195 Bacteria 1214
130 Ga0075370_10034041 3300006353 Bacteria 2855
131 Ga0075370_10076482 3300006353 Bacteria 1920
132 Ga0075370_10121047 3300006353 Bacteria 1523
133 Ga0075370_10332111 3300006353 Bacteria 906
134 Ga0068871_100533514 3300006358 Bacteria 1061
135 Ga0075431_100615695 3300006847 Bacteria 1069
136 Ga0075429_100564614 3300006880 Bacteria 997
137 Ga0068865_100108227 3300006881 Bacteria 2046
138 Ga0105244_10089445 3300009036 Bacteria 1516
139 Ga0105240_10000336 3300009093 Bacteria 87900
140 Ga0105240_10057132 3300009093 Bacteria 4878
141 Ga0111539_10698752 3300009094 Bacteria 1180
142 Ga0105245_10391104 3300009098 Bacteria 1387
143 Ga0114129_10080578 3300009147 Bacteria 4525
144 Ga0114129_10316295 3300009147 Bacteria 2076
145 Ga0114129_10384072 3300009147 Bacteria 1854
146 Ga0105241_10087477 3300009174 Bacteria 2453
147 Ga0105241_10105300 3300009174 Bacteria 2249
148 Ga0105241_10183428 3300009174 Bacteria 1737
149 Ga0105241_10350362 3300009174 Bacteria 1282
150 Ga0105237_10000690 3300009545 Bacteria 46704
151 Ga0105237_10167494 3300009545 Bacteria 2196
152 Ga0105237_10330040 3300009545 Bacteria 1530
153 Ga0105238_10013090 3300009551 Bacteria 8369
154 Ga0105238_10014048 3300009551 Bacteria 8097
155 Ga0105238_10034505 3300009551 Bacteria 5147
156 Ga0123341_1004539 3300009765 Bacteria 12198
157 Ga0123342_1017768 3300009766 Bacteria 5840
158 Ga0105032_103260 3300009979 Bacteria 1414
159 Ga0105239_10013586 3300010375 Bacteria 9038
160 Ga0105239_10183511 3300010375 Bacteria 2341
161 Ga0105239_10194870 3300010375 Bacteria 2269
162 Ga0105239_10281176 3300010375 Bacteria 1873
163 Ga0105239_10531845 3300010375 Bacteria 1338
164 Ga0157322_1004080 3300012490 Bacteria 934
165 Ga0157371_10028500 3300013102 Bacteria 4043
166 Ga0157370_10026622 3300013104 Bacteria 5707
167 Ga0157370_10658944 3300013104 Bacteria 956
168 Ga0157369_10113277 3300013105 Bacteria 2881
169 Ga0157374_10119111 3300013296 Bacteria 2546
170 Ga0157378_10082289 3300013297 Bacteria 2911
171 Ga0157378_10417244 3300013297 Bacteria 1326
172 Ga0157372_10128256 3300013307 Bacteria 2917
173 Ga0157372_10152488 3300013307 Bacteria 2668
174 Ga0157375_10149482 3300013308 Unclassified 2470
175 Ga0182008_10225101 3300014497 Bacteria 961
176 Ga0157379_10729142 3300014968 Bacteria 932
177 Ga0213876_10002694 3300021384 Bacteria 10371
178 Ga0209436_100031 3300025208 Bacteria 82827
179 Ga0209436_114778 3300025208 Bacteria 1231
180 Ga0207425_1002640 3300025245 Bacteria 6188
181 Ga0207425_1006193 3300025245 Bacteria 3302
182 Ga0207425_1017953 3300025245 Bacteria 1543
183 Ga0209026_1000029 3300025250 Bacteria 337109
184 Ga0209677_103335 3300025253 Bacteria 5282
185 Ga0209759_1000040 3300025256 Bacteria 254501
186 Ga0209129_1000016 3300025258 Bacteria 485491
187 Ga0209129_1000669 3300025258 Bacteria 22694
188 Ga0209129_1001340 3300025258 Bacteria 13927
189 Ga0209129_1002531 3300025258 Bacteria 8879
190 Ga0209233_1000097 3300025261 Bacteria 295452
191 Ga0209673_1000063 3300025273 Bacteria 256709
192 Ga0209673_1000252 3300025273 Bacteria 101552
193 Ga0209673_1000291 3300025273 Bacteria 93803
194 Ga0209673_1001400 3300025273 Bacteria 23490
195 Ga0209673_1002105 3300025273 Bacteria 14931
196 Ga0209673_1002242 3300025273 Bacteria 13961
197 Ga0209130_1000031 3300025284 Bacteria 322932
198 Ga0209130_1000048 3300025284 Bacteria 233357
199 Ga0209130_1005302 3300025284 Bacteria 4524
200 Ga0209025_1000338 3300025294 Bacteria 103479
201 Ga0209025_1000430 3300025294 Bacteria 83230
202 Ga0209025_1005207 3300025294 Bacteria 10728
203 Ga0209564_1000586 3300025295 Bacteria 57490
204 Ga0209564_1000664 3300025295 Bacteria 50898
205 Ga0209564_1000876 3300025295 Bacteria 40029
206 Ga0209564_1006096 3300025295 Bacteria 6625
207 Ga0209564_1013624 3300025295 Bacteria 3434
208 Ga0209758_1000490 3300025297 Bacteria 64714
209 Ga0209758_1001257 3300025297 Bacteria 31390
210 Ga0209758_1001647 3300025297 Bacteria 25345
211 Ga0209758_1002831 3300025297 Bacteria 16855
212 Ga0209758_1004719 3300025297 Bacteria 11117
213 Ga0209758_1013935 3300025297 Bacteria 4327
214 Ga0209758_1034009 3300025297 Bacteria 2036
215 Ga0209050_1003257 3300025298 Bacteria 12215
216 Ga0209256_1000463 3300025299 Bacteria 61298
217 Ga0209256_1001515 3300025299 Bacteria 23483
218 Ga0209256_1002067 3300025299 Bacteria 17689
219 Ga0209256_1004108 3300025299 Bacteria 9426
220 Ga0207426_1000042 3300025302 Bacteria 433289
221 Ga0207426_1000075 3300025302 Bacteria 321337
222 Ga0207426_1000136 3300025302 Bacteria 201401
223 Ga0209051_1000671 3300025303 Bacteria 38414
224 Ga0209051_1016239 3300025303 Bacteria 3382
225 Ga0209051_1025534 3300025303 Bacteria 2401
226 Ga0209257_1000504 3300025304 Bacteria 68999
227 Ga0209257_1065337 3300025304 Bacteria 975
228 Ga0207656_10003814 3300025321 Bacteria 5222
229 Ga0207692_10001415 3300025898 Bacteria 8982
230 Ga0207680_10179295 3300025903 Bacteria 1431
231 Ga0207647_10008504 3300025904 Bacteria 7354
232 Ga0207647_10107942 3300025904 Bacteria 1647
233 Ga0207645_10014079 3300025907 Bacteria 5360
234 Ga0207643_10338636 3300025908 Bacteria 942
235 Ga0207705_10184788 3300025909 Bacteria 1574
236 Ga0207705_10247464 3300025909 Bacteria 1359
237 Ga0207654_10035337 3300025911 Bacteria 2783
238 Ga0207654_10118616 3300025911 Bacteria 1658
239 Ga0207695_10000458 3300025913 Bacteria 88734
240 Ga0207695_10265603 3300025913 Bacteria 1613
241 Ga0207671_10000577 3300025914 Bacteria 49208
242 Ga0207671_10016228 3300025914 Bacteria 5797
243 Ga0207671_10373874 3300025914 Bacteria 1132
244 Ga0207657_10009115 3300025919 Bacteria 10011
245 Ga0207657_10011473 3300025919 Bacteria 8796
246 Ga0207657_10012411 3300025919 Bacteria 8419
247 Ga0207657_10020971 3300025919 Bacteria 6163
248 Ga0207649_10008971 3300025920 Bacteria 5464
249 Ga0207649_10011064 3300025920 Bacteria 4966
250 Ga0207649_10308811 3300025920 Bacteria 1158
251 Ga0207681_10092411 3300025923 Bacteria 2163
252 Ga0207694_10014161 3300025924 Bacteria 6013
253 Ga0207694_10033622 3300025924 Bacteria 3928
254 Ga0207694_10256710 3300025924 Bacteria 1431
255 Ga0207650_10318883 3300025925 Bacteria 1273
256 Ga0207687_10269151 3300025927 Bacteria 1361
257 Ga0207687_10364131 3300025927 Bacteria 1181
258 Ga0207664_10028791 3300025929 Bacteria 4225
259 Ga0207664_10398737 3300025929 Bacteria 1223
260 Ga0207690_10331894 3300025932 Bacteria 1198
261 Ga0207706_10511363 3300025933 Bacteria 1036
262 Ga0207669_10004321 3300025937 Bacteria 6244
263 Ga0207669_10025236 3300025937 Bacteria 3208
264 Ga0207669_10048578 3300025937 Bacteria 2522
265 Ga0207704_10232228 3300025938 Bacteria 1373
266 Ga0207691_10048476 3300025940 Bacteria 3895
267 Ga0207691_10466494 3300025940 Bacteria 1074
268 Ga0207679_10428795 3300025945 Bacteria 1168
269 Ga0207667_10004954 3300025949 Bacteria 16268
270 Ga0207667_10102920 3300025949 Bacteria 2945
271 Ga0207667_10201250 3300025949 Bacteria 2043
272 Ga0207651_10194905 3300025960 Bacteria 1619
273 Ga0207668_10009534 3300025972 Bacteria 5824
274 Ga0207668_10719554 3300025972 Bacteria 879
275 Ga0207640_10011282 3300025981 Bacteria 5055
276 Ga0207640_10011939 3300025981 Bacteria 4933
277 Ga0207677_10065799 3300026023 Bacteria 2531
278 Ga0207639_10042470 3300026041 Bacteria 3408
279 Ga0207639_10293587 3300026041 Bacteria 1434
280 Ga0207639_10895807 3300026041 Bacteria 829
281 Ga0207678_10012764 3300026067 Bacteria 7379
282 Ga0207678_10018975 3300026067 Bacteria 6041
283 Ga0207702_10132709 3300026078 Bacteria 2243
284 Ga0207702_10150220 3300026078 Bacteria 2118
285 Ga0207702_10373360 3300026078 Bacteria 1370
286 Ga0207702_10417985 3300026078 Bacteria 1296
287 Ga0207702_10571203 3300026078 Bacteria 1108
288 Ga0207648_10096669 3300026089 Bacteria 2584
289 Ga0207674_10004581 3300026116 Bacteria 16594
290 Ga0207674_10095351 3300026116 Bacteria 2961
291 Ga0207674_10159834 3300026116 Bacteria 2208
292 Ga0207674_10176501 3300026116 Bacteria 2089
293 Ga0207683_10046943 3300026121 Bacteria 3781
294 Ga0207698_10055985 3300026142 Bacteria 3043
295 Ga0207698_10073770 3300026142 Bacteria 2718
296 Ga0207698_10082567 3300026142 Bacteria 2598
297 Ga0207698_10247042 3300026142 Bacteria 1630
298 Ga0207698_10381936 3300026142 Bacteria 1340
299 Ga0268266_10003641 3300028379 Bacteria 15245
300 Ga0268266_10083243 3300028379 Bacteria 2793
301 Ga0268266_10236163 3300028379 Bacteria 1685
302 Ga0268265_10005163 3300028380 Bacteria 8944
303 Ga0268265_10028795 3300028380 Bacteria 3981
304 Ga0265318_10002087 3300028577 Bacteria 10931
305 Ga0307517_10225947 3300028786 Bacteria 1131
306 Ga0307515_10299599 3300028794 Bacteria 1294
307 Ga0307512_10009090 3300030522 Bacteria 9610
308 Ga0316177_1021166 3300030731 Bacteria 3048
309 Ga0316176_1184345 3300030732 Bacteria 1549
310 Ga0316180_1172947 3300030736 Bacteria 3542
311 Ga0265332_10039082 3300031238 Bacteria 2055
312 Ga0307513_10007748 3300031456 Bacteria 13861
313 Ga0307513_10204001 3300031456 Bacteria 1815
314 Ga0307513_10275582 3300031456 Bacteria 1463
315 Ga0307408_100079573 3300031548 Bacteria 2446
316 Ga0265314_10034609 3300031711 Bacteria 3689
317 Ga0265342_10252510 3300031712 Bacteria 941
318 Ga0316576_10378557 3300031727 Bacteria 1051
319 Ga0307516_10117405 3300031730 Bacteria 2455
320 Ga0307413_10320543 3300031824 Bacteria 1184
321 Ga0307407_10283933 3300031903 Bacteria 1148
322 Ga0307412_10096675 3300031911 Bacteria 2079
323 Ga0307414_10083504 3300032004 Bacteria 2346
324 Ga0307414_10254581 3300032004 Bacteria 1461
325 Ga0307414_10275573 3300032004 Bacteria 1411
326 Ga0307411_10243830 3300032005 Bacteria 1409
327 Ga0373939_0104884 3300035114 Bacteria 976
328 Ga0373942_0047873 3300035207 Bacteria 1189
329 Ga0316574_0124785 3300035398 Unclassified 1654
330 Ga0373931_0013840 3300035691 Bacteria 3935
331 Ga0373947_0300628 3300035725 Bacteria 1070
332 Ga0316584_0390262 3300036712 Bacteria 993
333 Ga0395899_0036782 3300037312 Bacteria 3670
334 Ga0395905_0000791 3300037471 Bacteria 41576
335 Ga0395905_0005397 3300037471 Bacteria 13065
336 Ga0395905_0046646 3300037471 Bacteria 4063
337 Ga0395905_0229782 3300037471 Bacteria 1735
338 Ga0436364_0393289 3300037853 Bacteria 14105
339 Ga0436364_0469241 3300037853 Bacteria 9261
340 Ga0436364_0579643 3300037853 Bacteria 34127
341 Ga0395901_0092105 3300038443 Bacteria 3173
342 Ga0436365_0257230 3300039437 Bacteria 39667
343 Ga0436360_0835435 3300039438 Bacteria 1712
344 Ga0436363_1085806 3300039450 Bacteria 1694
345 Ga0439465_0014043 3300041413 Bacteria 2494
346 Ga0439465_0109519 3300041413 Bacteria 960
347 Ga0451839_1234649 3300041496 Bacteria 957
348 Ga0451845_0296105 3300041501 Bacteria 1446
349 Ga0451847_0268177 3300041503 Bacteria 1132
350 Ga0451849_1289643 3300041505 Bacteria 1320
351 Ga0451851_0444680 3300041507 Bacteria 1033
352 Ga0439448_0083916 3300042005 Bacteria 1072
353 Ga0466972_0022762 3300044658 Bacteria 3119
354 Ga0466971_0194570 3300044719 Bacteria 956
355 Ga0466957_0137622 3300044842 Bacteria 1571
356 Ga0466960_0117731 3300044901 Bacteria 1388
357 Ga0495638_0062685 3300046460 Bacteria 2294
358 Ga0495606_0112874 3300046507 Bacteria 1637
359 Ga0495610_0004552 3300046512 Bacteria 10196
360 Ga0495620_0141236 3300046515 Bacteria 942
361 Ga0495632_0073066 3300046519 Bacteria 1645
362 Ga0495668_0115828 3300046616 Bacteria 1466
363 Ga0495625_0254448 3300046660 Bacteria 1139
364 Ga0496106_0008218 3300048909 Bacteria 7715
365 Ga0496106_0243119 3300048909 Bacteria 1438
366 Ga0496109_0198173 3300048912 Bacteria 1888
367 Ga0496116_0003206 3300048919 Bacteria 16345
368 Ga0496116_0093227 3300048919 Bacteria 1824
369 Ga0496116_0117283 3300048919 Bacteria 1549
370 Ga0496117_0010959 3300048920 Bacteria 8171
371 Ga0496117_0059067 3300048920 Bacteria 2652
372 Ga0496118_0024130 3300048921 Bacteria 5259
373 Ga0496118_0090434 3300048921 Bacteria 2109
374 Ga0496118_0139409 3300048921 Bacteria 1541
375 Ga0496119_0000750 3300048922 Bacteria 43609
376 Ga0496119_0042991 3300048922 Bacteria 2860
377 Ga0496121_0003823 3300048924 Bacteria 20961
378 Ga0496121_0009961 3300048924 Bacteria 10816
379 Ga0496121_0150370 3300048924 Bacteria 1714
380 Ga0496121_0407874 3300048924 Bacteria 888
381 Ga0496122_0033522 3300048925 Bacteria 4222
382 Ga0496122_0081372 3300048925 Bacteria 2254
383 Ga0496123_0002938 3300048926 Bacteria 19929
384 Ga0496123_0020166 3300048926 Bacteria 5224
385 Ga0496123_0030754 3300048926 Bacteria 3923
386 Ga0496124_0001914 3300048927 Bacteria 28559
387 Ga0496124_0030119 3300048927 Bacteria 4822
388 Ga0496124_0140144 3300048927 Bacteria 1909
389 Ga0496124_0204706 3300048927 Bacteria 1498
390 Ga0496125_0125650 3300048928 Bacteria 1818
391 Ga0496126_0008697 3300048929 Bacteria 10902
392 Ga0496126_0017755 3300048929 Bacteria 7082
393 Ga0496126_0097560 3300048929 Bacteria 2575
394 Ga0496126_0100364 3300048929 Bacteria 2533
395 Ga0495678_050663 3300049459 Bacteria 1608
396 Ga0501031_0001559 3300049568 Bacteria 14268
397 Ga0501031_0089125 3300049568 Bacteria 2011
398 Ga0501032_0001034 3300049569 Bacteria 22327
399 Ga0501033_0003222 3300049570 Bacteria 13496
400 Ga0501033_0137820 3300049570 Bacteria 1765
401 Ga0501034_0000222 3300049571 Bacteria 108857
402 Ga0501034_0002860 3300049571 Bacteria 20110
403 Ga0501034_0009509 3300049571 Bacteria 10176
404 Ga0501034_0012347 3300049571 Bacteria 8826
405 Ga0501034_0073930 3300049571 Bacteria 3417
406 Ga0501034_0141388 3300049571 Bacteria 2386
407 Ga0501034_0152259 3300049571 Bacteria 2288
408 Ga0501034_0266055 3300049571 Bacteria 1656
409 Ga0501036_0066386 3300049572 Bacteria 3052
410 Ga0501036_0277558 3300049572 Bacteria 1402
411 Ga0501037_0000514 3300049573 Bacteria 31087
412 Ga0501038_0015873 3300049574 Bacteria 6842
413 Ga0501038_0038552 3300049574 Bacteria 4184
414 Ga0501038_0069097 3300049574 Bacteria 3001
415 Ga0501039_0000432 3300049575 Bacteria 30229
416 Ga0501039_0012347 3300049575 Bacteria 6517
417 Ga0501043_0035006 3300049579 Bacteria 3949
418 Ga0501046_0001262 3300049580 Bacteria 24516
419 Ga0501047_0006274 3300049581 Bacteria 11175
420 Ga0501047_0030949 3300049581 Bacteria 5159
421 Ga0501048_0003846 3300049582 Bacteria 11447
422 Ga0501067_0011888 3300049583 Bacteria 4825
423 Ga0501067_0019049 3300049583 Bacteria 3798
424 Ga0501068_0016396 3300049584 Bacteria 4271
425 Ga0501068_0099705 3300049584 Bacteria 1799
426 Ga0501068_0162193 3300049584 Bacteria 1409
427 Ga0501069_0001119 3300049585 Bacteria 12944
428 Ga0501070_0006527 3300049586 Bacteria 9924
429 Ga0501070_0017904 3300049586 Bacteria 5948
430 Ga0501071_0366574 3300049587 Bacteria 1097
431 Ga0501072_0039944 3300049588 Bacteria 3684
432 Ga0501073_0000534 3300049589 Bacteria 26731
433 Ga0501073_0028100 3300049589 Bacteria 4018
434 Ga0501073_0091242 3300049589 Bacteria 2117
435 Ga0501074_0035429 3300049590 Bacteria 3616
436 Ga0501074_0219144 3300049590 Bacteria 1355
437 Ga0501080_0003677 3300049742 Bacteria 13522
438 Ga0501080_0010159 3300049742 Bacteria 8608
439 Ga0501083_0018962 3300049744 Bacteria 4789
440 Ga0501083_0041672 3300049744 Bacteria 3113
441 Ga0501035_0030566 3300049822 Bacteria 4908
442 Ga0501035_0096494 3300049822 Bacteria 2597
443 Ga0501044_0004665 3300049823 Bacteria 15333
444 Ga0501044_0011230 3300049823 Bacteria 9709
445 Ga0501044_0552394 3300049823 Bacteria 1048
446 Ga0501045_0363619 3300049824 Bacteria 1077
447 nmdc:mga0yw44_457015_c1 3300050492 Bacteria 865
448 nmdc:mga0k408_124785_c1 3300050493 Bacteria 1526
449 nmdc:mga06z11_31466_c1 3300050494 Bacteria 2578
450 nmdc:mga06z11_69250_c1 3300050494 Bacteria 1862
451 nmdc:mga07m45_15904_c2 3300050496 Bacteria 3356
452 nmdc:mga05p37_347060_c1 3300050507 Bacteria 1748
453 nmdc:mga05p37_357443_c1 3300050507 Bacteria 1718
454 nmdc:mga05p37_503593_c1 3300050507 Bacteria 1389
455 Ga0500651_0068385 3300053093 Bacteria 2212
456 Ga0500572_002091 3300053111 Bacteria 4954
457 Ga0500642_0001239 3300053130 Bacteria 7296
458 Ga0500658_0001646 3300053134 Bacteria 8888
459 Ga0500568_0000361 3300053139 Bacteria 35246
460 Ga0500568_0035779 3300053139 Bacteria 2024
461 Ga0500604_0008235 3300053151 Bacteria 2763
462 Ga0500604_0043014 3300053151 Bacteria 1371
463 Ga0500616_0000686 3300053153 Bacteria 39652
464 Ga0500620_002500 3300053155 Bacteria 3722
465 Ga0500624_022879 3300053157 Bacteria 1020
466 Ga0501084_0000193 3300054114 Bacteria 47522
467 Ga0501084_0015147 3300054114 Bacteria 6394
468 Ga0501082_0003570 3300060353 Bacteria 13580
469 Ga0466962_0094782 3300061719 Bacteria 1431

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0117731 Ga0466960_0117731_361_1065 226
2 3300053155 Ga0500620_002500 Ga0500620_002500_257_1000 229
3 3300037471 Ga0395905_0046646 Ga0395905_0046646_1147_1899 230
4 3300031730 Ga0307516_10117405 Ga0307516_101174053 231
5 3300002705 JGI25156J39149_1002223 JGI25156J39149_10022235 232
6 3300002741 JGI25157J39369_1000599 JGI25157J39369_100059914 232
7 3300006038 Ga0075365_10186122 Ga0075365_101861222 232
8 3300025250 Ga0209026_1000029 Ga0209026_1000029285 232
9 3300025256 Ga0209759_1000040 Ga0209759_1000040140 232
10 3300032005 Ga0307411_10243830 Ga0307411_102438301 234
11 3300005339 Ga0070660_100180793 Ga0070660_1001807932 235
12 3300006038 Ga0075365_10020389 Ga0075365_100203892 235
13 3300006051 Ga0075364_10443482 Ga0075364_104434821 235
14 3300009979 Ga0105032_103260 Ga0105032_1032602 235
15 3300025919 Ga0207657_10020971 Ga0207657_100209715 235
16 3300026142 Ga0207698_10073770 Ga0207698_100737702 235
17 3300037471 Ga0395905_0005397 Ga0395905_0005397_11069_11812 235
18 3300046460 Ga0495638_0062685 Ga0495638_0062685_214_963 235
19 3300050494 nmdc:mga06z11_31466_c1 nmdc:mga06z11_31466_c1_1502_2251 235
20 3300005353 Ga0070669_100217606 Ga0070669_1002176062 236
21 3300044658 Ga0466972_0022762 Ga0466972_0022762_2024_2758 237
22 3300048922 Ga0496119_0000750 Ga0496119_0000750_7567_8307 238
23 3300014968 Ga0157379_10729142 Ga0157379_107291422 239
24 3300044842 Ga0466957_0137622 Ga0466957_0137622_419_1159 239
25 3300053134 Ga0500658_0001646 Ga0500658_0001646_182_922 239
26 iso_pu_bacteria 2508501114 2509079424 239
27 3300009174 Ga0105241_10087477 Ga0105241_100874772 240
28 3300009545 Ga0105237_10167494 Ga0105237_101674942 240
29 3300009551 Ga0105238_10013090 Ga0105238_100130902 240
30 3300010375 Ga0105239_10013586 Ga0105239_100135863 240
31 3300013104 Ga0157370_10658944 Ga0157370_106589441 240
32 3300031548 Ga0307408_100079573 Ga0307408_1000795734 240
33 iso_pu_bacteria 2510065019 2510131579 240
34 iso_pu_bacteria 2513237305 2514423374 240
35 iso_pu_bacteria 2693429783 2694629063 240
36 iso_pu_bacteria 2693429784 2694637022 240
37 iso_pu_bacteria 2721755686 2723575031 240
38 iso_pu_bacteria 2738541293 2738802859 240
39 iso_pu_bacteria 2856349417 2856353204 240
40 iso_pu_bacteria 2856356410 2856356695 240
41 iso_pu_bacteria 2856364286 2856367107 240
42 iso_pu_bacteria 2857349434 2857354562 240
43 iso_pu_bacteria 2869285874 2869287357 240
44 iso_pu_bacteria 2871429161 2871430448 240
45 iso_pu_bacteria 2871488783 2871492394 240
46 iso_pu_bacteria 2871495908 2871501927 240
47 iso_pu_bacteria 2874146452 2874148936 240
48 iso_pu_bacteria 2874155637 2874155940 240
49 iso_pu_bacteria 2876369609 2876372923 240
50 iso_pu_bacteria 2876377896 2876381763 240
51 iso_pu_bacteria 2876392853 2876397883 240
52 iso_pu_bacteria 2876413966 2876415507 240
53 iso_pu_bacteria 2878745973 2878746881 240
54 iso_pu_bacteria 2878753008 2878758275 240
55 iso_pu_bacteria 2878760144 2878765836 240
56 iso_pu_bacteria 2878767105 2878772510 240
57 iso_pu_bacteria 2881155292 2881158089 240
58 iso_pu_bacteria 2881161766 2881166644 240
59 iso_pu_bacteria 2881845957 2881847663 240
60 iso_pu_bacteria 2881861095 2881864427 240
61 iso_pu_bacteria 2882912400 2882914840 240
62 iso_pu_bacteria 2885318864 2885320952 240
63 iso_pu_bacteria 2885342637 2885347300 240
64 iso_pu_bacteria 2885350715 2885353406 240
65 iso_pu_bacteria 2888350351 2888351297 240
66 iso_pu_bacteria 2889010040 2889013683 240
67 iso_pu_bacteria 2889016732 2889021600 240
68 iso_pu_bacteria 2903492973 2903496875 240
69 iso_pu_bacteria 2903492973 2903503323 240
70 iso_pu_bacteria 2903540706 2903546782 240
71 iso_pu_bacteria 2904659560 2904664534 240
72 iso_pu_bacteria 2906308376 2906309899 240
73 iso_pu_bacteria 2906321335 2906322329 240
74 iso_pu_bacteria 2906354277 2906357308 240
75 iso_pu_bacteria 2922130491 2922133428 240
76 iso_pu_bacteria 2922185730 2922190769 240
77 iso_pu_bacteria 2924762789 2924769021 240
78 iso_pu_bacteria 2924784321 2924784371 240
79 iso_pu_bacteria 2937813078 2937815096 240
80 iso_pu_bacteria 2937994558 2938000641 240
81 iso_pu_bacteria 2938014810 2938017458 240
82 iso_pu_bacteria 2958041894 2958042783 240
83 iso_pu_bacteria 2958100919 2958105591 240
84 iso_pu_bacteria 2958130278 2958131642 240
85 iso_pu_bacteria 2958165035 2958171012 240
86 iso_pu_bacteria 2958172287 2958177358 240
87 iso_pu_bacteria 2958179912 2958180714 240
88 iso_pu_bacteria 2961077736 2961078551 240
89 iso_pu_bacteria 2961114664 2961119533 240
90 iso_pu_bacteria 2961127735 2961132729 240
91 iso_pu_bacteria 2961163497 2961169456 240
92 iso_pu_bacteria 2961170736 2961173533 240
93 iso_pu_bacteria 2965018300 2965023708 240
94 iso_pu_bacteria 2965119406 2965125188 240
95 iso_pu_bacteria 2968003550 2968005872 240
96 iso_pu_bacteria 2968110612 2968115788 240
97 iso_pu_bacteria 2968117919 2968118866 240
98 iso_pu_bacteria 2968171901 2968177846 240
99 iso_pu_bacteria 2970503327 2970506125 240
100 iso_pu_bacteria 2970554993 2970560692 240
101 iso_pu_bacteria 2977821940 2977826807 240
102 iso_pu_bacteria 2977828996 2977835892 240
103 iso_pu_bacteria 2977843712 2977845759 240
104 iso_pu_bacteria 2977942078 2977946342 240
105 iso_pu_bacteria 2977971508 2977971895 240
106 iso_pu_bacteria 2979710463 2979716242 240
107 iso_pu_bacteria 2979742915 2979746924 240
108 iso_pu_bacteria 2979808191 2979810847 240
109 iso_pu_bacteria 2987636660 2987643164 240
110 iso_pu_bacteria 2987652177 2987658678 240
111 iso_pu_bacteria 2987659509 2987665566 240
112 iso_pu_bacteria 2987666974 2987672875 240
113 iso_pu_bacteria 3004188549 3004194644 240
114 iso_pu_bacteria 3004203850 3004206712 240
115 iso_pu_bacteria 8004374579 8004379789 240
116 iso_pu_bacteria 8004387939 8004389338 240
117 iso_pu_bacteria 8004640170 8004645013 240
118 iso_pu_bacteria 8004714634 8004716045 240
119 3300005577 Ga0068857_100166175 Ga0068857_1001661752 241
120 3300026116 Ga0207674_10176501 Ga0207674_101765012 241
121 iso_pu_bacteria 2718217997 2719667965 241
122 iso_pu_bacteria 2718218199 2720494728 241
123 iso_pu_bacteria 2842264693 2842267927 241
124 iso_pu_bacteria 2842311132 2842311869 241
125 iso_pu_bacteria 2842428310 2842432090 241
126 iso_pu_bacteria 2842434925 2842438202 241
127 iso_pu_bacteria 2842441272 2842443898 241
128 iso_pu_bacteria 2842447887 2842449840 241
129 iso_pu_bacteria 2842462802 2842466188 241
130 iso_pu_bacteria 2842469257 2842472828 241
131 iso_pu_bacteria 8005497431 8005502986 241
132 iso_pu_bacteria 8005668836 8005674904 241
133 3300002773 JGI25152J39213_1004650 JGI25152J39213_10046504 242
134 3300003187 JGI25151J46595_10004550 JGI25151J46595_100045504 242
135 3300005262 Ga0065165_1007074 Ga0065165_10070742 242
136 3300025258 Ga0209129_1000016 Ga0209129_1000016118 242
137 3300025284 Ga0209130_1005302 Ga0209130_10053023 242
138 3300025294 Ga0209025_1000338 Ga0209025_100033869 242
139 iso_pu_bacteria 2503198000 2503200613 242
140 iso_pu_bacteria 2508501123 2509118057 242
141 iso_pu_bacteria 2508501127 2509139777 242
142 iso_pu_bacteria 2509276021 2509389503 242
143 iso_pu_bacteria 2509276022 2509398449 242
144 iso_pu_bacteria 2509276033 2509446085 242
145 iso_pu_bacteria 2510461076 2510892217 242
146 iso_pu_bacteria 2512875016 2512932049 242
147 iso_pu_bacteria 2513237084 2513567371 242
148 iso_pu_bacteria 2513237085 2513579480 242
149 iso_pu_bacteria 2513237088 2513597063 242
150 iso_pu_bacteria 2513237090 2513611487 242
151 iso_pu_bacteria 2513237093 2513632155 242
152 iso_pu_bacteria 2513237103 2513712370 242
153 iso_pu_bacteria 2513237138 2513868674 242
154 iso_pu_bacteria 2513237144 2513909272 242
155 iso_pu_bacteria 2513237146 2513924751 242
156 iso_pu_bacteria 2513237162 2514023306 242
157 iso_pu_bacteria 2513237164 2514039254 242
158 iso_pu_bacteria 2515075009 2515113692 242
159 iso_pu_bacteria 2515154113 2515632142 242
160 iso_pu_bacteria 2515154114 2515644556 242
161 iso_pu_bacteria 2515154116 2515660003 242
162 iso_pu_bacteria 2515154134 2515738488 242
163 iso_pu_bacteria 2516653077 2517037308 242
164 iso_pu_bacteria 2516653085 2517080526 242
165 iso_pu_bacteria 2517093000 2517097873 242
166 iso_pu_bacteria 2517287029 2517409989 242
167 iso_pu_bacteria 2534681796 2535517502 242
168 iso_pu_bacteria 2582581308 2585277758 242
169 iso_pu_bacteria 2585427526 2585526849 242
170 iso_pu_bacteria 2585427527 2585533375 242
171 iso_pu_bacteria 2585427528 2585542391 242
172 iso_pu_bacteria 2585427530 2585557880 242
173 iso_pu_bacteria 2585427593 2585841863 242
174 iso_pu_bacteria 2585427633 2585996988 242
175 iso_pu_bacteria 2585427634 2586001577 242
176 iso_pu_bacteria 2588253730 2588517950 242
177 iso_pu_bacteria 2597489875 2597815921 242
178 iso_pu_bacteria 2599185170 2599416311 242
179 iso_pu_bacteria 2599185301 2599936922 242
180 iso_pu_bacteria 2615840624 2616295130 242
181 iso_pu_bacteria 2615840626 2616310565 242
182 iso_pu_bacteria 2643221580 2643911101 242
183 iso_pu_bacteria 2643221580 2643912164 242
184 iso_pu_bacteria 2643221591 2643966869 242
185 iso_pu_bacteria 2643221595 2643986503 242
186 iso_pu_bacteria 2643221627 2644152734 242
187 iso_pu_bacteria 2643221643 2644239084 242
188 iso_pu_bacteria 2643221674 2644413195 242
189 iso_pu_bacteria 2718217882 2719183614 242
190 iso_pu_bacteria 2718218009 2719728055 242
191 iso_pu_bacteria 2718218363 2721144916 242
192 iso_pu_bacteria 2718218365 2721155655 242
193 iso_pu_bacteria 2718218366 2721167003 242
194 iso_pu_bacteria 2721755514 2722837981 242
195 iso_pu_bacteria 2721755810 2724042249 242
196 iso_pu_bacteria 2724679232 2725949359 242
197 iso_pu_bacteria 2728369365 2730161754 242
198 iso_pu_bacteria 2728369397 2730300762 242
199 iso_pu_bacteria 2738541333 2739038475 242
200 iso_pu_bacteria 2756170246 2756676848 242
201 iso_pu_bacteria 2765235942 2766066962 242
202 iso_pu_bacteria 2775506901 2776265017 242
203 iso_pu_bacteria 2791355123 2792749628 242
204 iso_pu_bacteria 2791355259 2793313485 242
205 iso_pu_bacteria 2791355260 2793321614 242
206 iso_pu_bacteria 2791355264 2793346093 242
207 iso_pu_bacteria 2791355265 2793353955 242
208 iso_pu_bacteria 2791355267 2793365810 242
209 iso_pu_bacteria 2802429605 2805927182 242
210 iso_pu_bacteria 2802429606 2805934393 242
211 iso_pu_bacteria 2802429633 2806048819 242
212 iso_pu_bacteria 2802429634 2806056021 242
213 iso_pu_bacteria 2802429635 2806062832 242
214 iso_pu_bacteria 2802429636 2806070272 242
215 iso_pu_bacteria 2802429637 2806077258 242
216 iso_pu_bacteria 2818991453 2819643132 242
217 iso_pu_bacteria 2838035591 2838036429 242
218 iso_pu_bacteria 2838661181 2838668637 242
219 iso_pu_bacteria 2838668709 2838669513 242
220 iso_pu_bacteria 2838686498 2838690463 242
221 iso_pu_bacteria 2838701080 2838701885 242
222 iso_pu_bacteria 2838729681 2838733180 242
223 iso_pu_bacteria 2838742623 2838747231 242
224 iso_pu_bacteria 2841734538 2841734938 242
225 iso_pu_bacteria 2841851746 2841855384 242
226 iso_pu_bacteria 2841864319 2841867853 242
227 iso_pu_bacteria 2842110456 2842111551 242
228 iso_pu_bacteria 2842156927 2842160909 242
229 iso_pu_bacteria 2842163707 2842164438 242
230 iso_pu_bacteria 2842180545 2842184525 242
231 iso_pu_bacteria 2842192696 2842196158 242
232 iso_pu_bacteria 2842205361 2842207324 242
233 iso_pu_bacteria 2842217011 2842218521 242
234 iso_pu_bacteria 2842229732 2842232108 242
235 iso_pu_bacteria 2842243621 2842248490 242
236 iso_pu_bacteria 2842250916 2842251692 242
237 iso_pu_bacteria 2842257432 2842262702 242
238 iso_pu_bacteria 2842271015 2842275223 242
239 iso_pu_bacteria 2842278818 2842280965 242
240 iso_pu_bacteria 2842285085 2842288419 242
241 iso_pu_bacteria 2842304105 2842307341 242
242 iso_pu_bacteria 2842317721 2842323323 242
243 iso_pu_bacteria 2842341865 2842346676 242
244 iso_pu_bacteria 2842402390 2842406235 242
245 iso_pu_bacteria 2842409023 2842412820 242
246 iso_pu_bacteria 2842415677 2842419301 242
247 iso_pu_bacteria 2842489311 2842489668 242
248 iso_pu_bacteria 2842495871 2842500499 242
249 iso_pu_bacteria 2844002411 2844006594 242
250 iso_pu_bacteria 2844454524 2844460119 242
251 iso_pu_bacteria 2854916844 2854917320 242
252 iso_pu_bacteria 2856320880 2856326191 242
253 iso_pu_bacteria 2856342000 2856344125 242
254 iso_pu_bacteria 2857516855 2857518359 242
255 iso_pu_bacteria 2869162929 2869164682 242
256 iso_pu_bacteria 2869278585 2869284188 242
257 iso_pu_bacteria 2871466892 2871467041 242
258 iso_pu_bacteria 2871474448 2871476685 242
259 iso_pu_bacteria 2874123672 2874124542 242
260 iso_pu_bacteria 2874139085 2874144813 242
261 iso_pu_bacteria 2874168670 2874169120 242
262 iso_pu_bacteria 2876363079 2876365749 242
263 iso_pu_bacteria 2878738818 2878743818 242
264 iso_pu_bacteria 2878788777 2878790834 242
265 iso_pu_bacteria 2881147464 2881150092 242
266 iso_pu_bacteria 2882632389 2882639034 242
267 iso_pu_bacteria 2885305155 2885308938 242
268 iso_pu_bacteria 2885312484 2885318677 242
269 iso_pu_bacteria 2885326080 2885326835 242
270 iso_pu_bacteria 2885334103 2885337595 242
271 iso_pu_bacteria 2888337043 2888342221 242
272 iso_pu_bacteria 2888343758 2888348965 242
273 iso_pu_bacteria 2903448605 2903450736 242
274 iso_pu_bacteria 2903521522 2903521561 242
275 iso_pu_bacteria 2903528002 2903529892 242
276 iso_pu_bacteria 2906378014 2906379080 242
277 iso_pu_bacteria 2919100787 2919102404 242
278 iso_pu_bacteria 2923556063 2923561203 242
279 iso_pu_bacteria 2924718760 2924726097 242
280 iso_pu_bacteria 2924754689 2924761494 242
281 iso_pu_bacteria 2924776078 2924781735 242
282 iso_pu_bacteria 2933570622 2933574003 242
283 iso_pu_bacteria 2933586486 2933588105 242
284 iso_pu_bacteria 2935901341 2935906101 242
285 iso_pu_bacteria 2936367885 2936369476 242
286 iso_pu_bacteria 2936375103 2936380168 242
287 iso_pu_bacteria 2937822353 2937824250 242
288 iso_pu_bacteria 2937836603 2937838545 242
289 iso_pu_bacteria 2937848649 2937848690 242
290 iso_pu_bacteria 2937877337 2937878919 242
291 iso_pu_bacteria 2937972304 2937978210 242
292 iso_pu_bacteria 2958034702 2958040577 242
293 iso_pu_bacteria 2958041894 2958055425 242
294 iso_pu_bacteria 2958064165 2958065063 242
295 iso_pu_bacteria 2958071322 2958074627 242
296 iso_pu_bacteria 2958084443 2958087379 242
297 iso_pu_bacteria 2958092219 2958098931 242
298 iso_pu_bacteria 2958144490 2958144794 242
299 iso_pu_bacteria 2963644680 2963647156 242
300 iso_pu_bacteria 2968016561 2968021796 242
301 iso_pu_bacteria 2968083720 2968088009 242
302 iso_pu_bacteria 2970469710 2970474386 242
303 iso_pu_bacteria 2970524798 2970530287 242
304 iso_pu_bacteria 2970540015 2970545837 242
305 iso_pu_bacteria 2970593180 2970598800 242
306 iso_pu_bacteria 2977864932 2977871502 242
307 iso_pu_bacteria 2977922695 2977928272 242
308 iso_pu_bacteria 2977986579 2977990258 242
309 iso_pu_bacteria 2996348954 2996353798 242
310 iso_pu_bacteria 3000135777 3000136611 242
311 iso_pu_bacteria 3004211236 3004215724 242
312 iso_pu_bacteria 3004218560 3004224501 242
313 iso_pu_bacteria 3004275668 3004280466 242
314 iso_pu_bacteria 3005409236 3005414139 242
315 iso_pu_bacteria 3005445848 3005451175 242
316 iso_pu_bacteria 637000159 637075145 242
317 iso_pu_bacteria 639633055 639649731 242
318 iso_pu_bacteria 8004395343 8004398267 242
319 iso_pu_bacteria 8004633249 8004634596 242
320 iso_pu_bacteria 8005289223 8005294992 242
321 iso_pu_bacteria 8005301065 8005305133 242
322 iso_pu_bacteria 8005307578 8005308309 242
323 iso_pu_bacteria 8005376324 8005377984 242
324 iso_pu_bacteria 8005460587 8005464380 242
325 iso_pu_bacteria 8005542996 8005546328 242
326 iso_pu_bacteria 8005556819 8005561787 242
327 iso_pu_bacteria 8005563573 8005568566 242
328 iso_pu_bacteria 8005570704 8005571141 242
329 iso_pu_bacteria 8005688590 8005689154 242
330 iso_pu_bacteria 8018127388 8018127676 242
331 iso_pu_bacteria 8018163183 8018163192 242
332 iso_pu_bacteria 8023680758 8023681440 242
333 iso_pu_bacteria 8024479707 8024479743 242
334 iso_pu_bacteria 8024501048 8024507210 242
335 iso_pu_bacteria 8046767195 8046770617 242
336 iso_pu_bacteria 8047710418 8047712317 242
337 iso_pu_bacteria 8055617313 8055619066 242
338 iso_pu_bacteria 8056375014 8056380319 242
339 iso_pu_bacteria 8056382006 8056383891 242
340 iso_pu_bacteria 8057575449 8057578812 242
341 iso_pu_bacteria 8057874678 8057878874 242
342 3300005327 Ga0070658_10019519 Ga0070658_100195192 243
343 3300005339 Ga0070660_100030363 Ga0070660_1000303633 243
344 3300005344 Ga0070661_100042747 Ga0070661_1000427472 243
345 3300005366 Ga0070659_100017270 Ga0070659_1000172701 243
346 3300005535 Ga0070684_100625806 Ga0070684_1006258061 243
347 3300005539 Ga0068853_100012183 Ga0068853_1000121833 243
348 3300005614 Ga0068856_100454630 Ga0068856_1004546302 243
349 3300005616 Ga0068852_100017669 Ga0068852_1000176693 243
350 3300025909 Ga0207705_10184788 Ga0207705_101847882 243
351 3300025913 Ga0207695_10265603 Ga0207695_102656032 243
352 3300025919 Ga0207657_10011473 Ga0207657_100114738 243
353 3300025924 Ga0207694_10256710 Ga0207694_102567102 243
354 3300025932 Ga0207690_10331894 Ga0207690_103318942 243
355 3300025949 Ga0207667_10004954 Ga0207667_1000495414 243
356 3300026078 Ga0207702_10417985 Ga0207702_104179852 243
357 3300026142 Ga0207698_10381936 Ga0207698_103819361 243
358 3300031727 Ga0316576_10378557 Ga0316576_103785571 243
359 3300035398 Ga0316574_0124785 Ga0316574_0124785_824_1555 243
360 3300036712 Ga0316584_0390262 Ga0316584_0390262_186_917 243
361 3300041413 Ga0439465_0014043 Ga0439465_0014043_543_1283 243
362 iso_pu_bacteria 2643221634 2644195080 243
363 3300006038 Ga0075365_10036309 Ga0075365_100363093 244
364 3300006178 Ga0075367_10189720 Ga0075367_101897202 244
365 3300032004 Ga0307414_10254581 Ga0307414_102545811 244
366 3300037471 Ga0395905_0229782 Ga0395905_0229782_284_1018 244
367 3300038443 Ga0395901_0092105 Ga0395901_0092105_288_1022 244
368 3300049571 Ga0501034_0000222 Ga0501034_0000222_29105_29845 244
369 iso_pu_bacteria 2816332139 2816510364 244
370 3300001989 JGI24739J22299_10018230 JGI24739J22299_100182302 245
371 3300005329 Ga0070683_100108132 Ga0070683_1001081323 245
372 3300005338 Ga0068868_100138538 Ga0068868_1001385382 245
373 3300005339 Ga0070660_100133813 Ga0070660_1001338132 245
374 3300005339 Ga0070660_100145156 Ga0070660_1001451561 245
375 3300005344 Ga0070661_100018671 Ga0070661_1000186714 245
376 3300005344 Ga0070661_100074458 Ga0070661_1000744582 245
377 3300005344 Ga0070661_100079929 Ga0070661_1000799292 245
378 3300005347 Ga0070668_100176104 Ga0070668_1001761041 245
379 3300005356 Ga0070674_100049340 Ga0070674_1000493402 245
380 3300005364 Ga0070673_100217950 Ga0070673_1002179501 245
381 3300005366 Ga0070659_100161964 Ga0070659_1001619641 245
382 3300005457 Ga0070662_100030424 Ga0070662_1000304241 245
383 3300005459 Ga0068867_100338039 Ga0068867_1003380392 245
384 3300005535 Ga0070684_100328127 Ga0070684_1003281272 245
385 3300005548 Ga0070665_100008163 Ga0070665_1000081636 245
386 3300005548 Ga0070665_100058286 Ga0070665_1000582863 245
387 3300005563 Ga0068855_100040893 Ga0068855_1000408931 245
388 3300005563 Ga0068855_100353259 Ga0068855_1003532593 245
389 3300005578 Ga0068854_100041169 Ga0068854_1000411693 245
390 3300005578 Ga0068854_100044855 Ga0068854_1000448554 245
391 3300005614 Ga0068856_100012342 Ga0068856_1000123426 245
392 3300005614 Ga0068856_100281122 Ga0068856_1002811222 245
393 3300005614 Ga0068856_100322254 Ga0068856_1003222542 245
394 3300005616 Ga0068852_100050523 Ga0068852_1000505232 245
395 3300005616 Ga0068852_100119104 Ga0068852_1001191043 245
396 3300005616 Ga0068852_100375473 Ga0068852_1003754732 245
397 3300005983 Ga0081540_1019814 Ga0081540_10198142 245
398 3300006358 Ga0068871_100533514 Ga0068871_1005335141 245
399 3300006881 Ga0068865_100108227 Ga0068865_1001082271 245
400 3300009094 Ga0111539_10698752 Ga0111539_106987522 245
401 3300009098 Ga0105245_10391104 Ga0105245_103911042 245
402 3300009147 Ga0114129_10316295 Ga0114129_103162952 245
403 3300009174 Ga0105241_10183428 Ga0105241_101834282 245
404 3300009174 Ga0105241_10350362 Ga0105241_103503622 245
405 3300009545 Ga0105237_10330040 Ga0105237_103300402 245
406 3300009551 Ga0105238_10034505 Ga0105238_100345053 245
407 3300010375 Ga0105239_10183511 Ga0105239_101835112 245
408 3300010375 Ga0105239_10194870 Ga0105239_101948703 245
409 3300010375 Ga0105239_10531845 Ga0105239_105318452 245
410 3300013102 Ga0157371_10028500 Ga0157371_100285004 245
411 3300013296 Ga0157374_10119111 Ga0157374_101191111 245
412 3300013297 Ga0157378_10082289 Ga0157378_100822892 245
413 3300013307 Ga0157372_10128256 Ga0157372_101282562 245
414 3300013307 Ga0157372_10152488 Ga0157372_101524884 245
415 3300021384 Ga0213876_10002694 Ga0213876_100026948 245
416 3300025297 Ga0209758_1013935 Ga0209758_10139353 245
417 3300025904 Ga0207647_10008504 Ga0207647_100085042 245
418 3300025904 Ga0207647_10107942 Ga0207647_101079421 245
419 3300025907 Ga0207645_10014079 Ga0207645_100140792 245
420 3300025909 Ga0207705_10247464 Ga0207705_102474642 245
421 3300025911 Ga0207654_10118616 Ga0207654_101186162 245
422 3300025914 Ga0207671_10373874 Ga0207671_103738741 245
423 3300025919 Ga0207657_10009115 Ga0207657_100091153 245
424 3300025920 Ga0207649_10011064 Ga0207649_100110643 245
425 3300025920 Ga0207649_10308811 Ga0207649_103088112 245
426 3300025927 Ga0207687_10269151 Ga0207687_102691512 245
427 3300025933 Ga0207706_10511363 Ga0207706_105113631 245
428 3300025937 Ga0207669_10004321 Ga0207669_100043212 245
429 3300025938 Ga0207704_10232228 Ga0207704_102322282 245
430 3300025940 Ga0207691_10048476 Ga0207691_100484763 245
431 3300025940 Ga0207691_10466494 Ga0207691_104664941 245
432 3300025945 Ga0207679_10428795 Ga0207679_104287952 245
433 3300025949 Ga0207667_10102920 Ga0207667_101029202 245
434 3300025960 Ga0207651_10194905 Ga0207651_101949052 245
435 3300025981 Ga0207640_10011939 Ga0207640_100119393 245
436 3300026023 Ga0207677_10065799 Ga0207677_100657993 245
437 3300026041 Ga0207639_10293587 Ga0207639_102935872 245
438 3300026041 Ga0207639_10895807 Ga0207639_108958071 245
439 3300026078 Ga0207702_10132709 Ga0207702_101327091 245
440 3300026078 Ga0207702_10150220 Ga0207702_101502201 245
441 3300026078 Ga0207702_10571203 Ga0207702_105712032 245
442 3300026089 Ga0207648_10096669 Ga0207648_100966691 245
443 3300026116 Ga0207674_10004581 Ga0207674_1000458112 245
444 3300026116 Ga0207674_10159834 Ga0207674_101598342 245
445 3300026121 Ga0207683_10046943 Ga0207683_100469433 245
446 3300026142 Ga0207698_10055985 Ga0207698_100559853 245
447 3300026142 Ga0207698_10247042 Ga0207698_102470421 245
448 3300028379 Ga0268266_10003641 Ga0268266_100036417 245
449 3300028379 Ga0268266_10083243 Ga0268266_100832433 245
450 3300030732 Ga0316176_1184345 Ga0316176_11843451 245
451 3300031456 Ga0307513_10007748 Ga0307513_100077484 245
452 3300031903 Ga0307407_10283933 Ga0307407_102839331 245
453 3300035114 Ga0373939_0104884 Ga0373939_0104884_21_761 245
454 3300035207 Ga0373942_0047873 Ga0373942_0047873_433_1173 245
455 3300035691 Ga0373931_0013840 Ga0373931_0013840_1750_2490 245
456 3300037312 Ga0395899_0036782 Ga0395899_0036782_2458_3195 245
457 3300037853 Ga0436364_0469241 Ga0436364_0469241_1534_2283 245
458 3300037853 Ga0436364_0579643 Ga0436364_0579643_24901_25665 245
459 3300039437 Ga0436365_0257230 Ga0436365_0257230_27365_28129 245
460 3300039438 Ga0436360_0835435 Ga0436360_0835435_850_1590 245
461 3300039450 Ga0436363_1085806 Ga0436363_1085806_723_1487 245
462 3300048929 Ga0496126_0017755 Ga0496126_0017755_5509_6264 245
463 3300049571 Ga0501034_0009509 Ga0501034_0009509_2317_3054 245
464 3300050492 nmdc:mga0yw44_457015_c1 nmdc:mga0yw44_457015_c1_88_828 245
465 3300050493 nmdc:mga0k408_124785_c1 nmdc:mga0k408_124785_c1_16_759 245
466 3300050507 nmdc:mga05p37_347060_c1 nmdc:mga05p37_347060_c1_78_872 245
467 3300053111 Ga0500572_002091 Ga0500572_002091_1862_2605 245
468 3300002739 JGI25158J39367_1000205 JGI25158J39367_10002054 246
469 3300002773 JGI25152J39213_1006150 JGI25152J39213_10061501 246
470 3300002773 JGI25152J39213_1009450 JGI25152J39213_10094502 246
471 3300002774 JGI25150J39212_1007385 JGI25150J39212_10073852 246
472 3300002987 JGI25159J45721_1001121 JGI25159J45721_10011217 246
473 3300003187 JGI25151J46595_10000867 JGI25151J46595_100008675 246
474 3300003187 JGI25151J46595_10018558 JGI25151J46595_100185582 246
475 3300003322 rootL2_10015096 rootL2_1001509619 246
476 3300003323 rootH1_10100374 rootH1_1010037410 246
477 3300003374 JGI25161J50226_1000050 JGI25161J50226_100005091 246
478 3300003374 JGI25161J50226_1003954 JGI25161J50226_10039543 246
479 3300003771 Ga0055526_1000595 Ga0055526_100059515 246
480 3300003771 Ga0055526_1024018 Ga0055526_10240182 246
481 3300003775 Ga0055524_1000922 Ga0055524_100092218 246
482 3300003775 Ga0055524_1002690 Ga0055524_10026903 246
483 3300003775 Ga0055524_1018262 Ga0055524_10182621 246
484 3300003781 Ga0055536_1052975 Ga0055536_10529751 246
485 3300003790 Ga0055528_1000096 Ga0055528_100009617 246
486 3300003790 Ga0055528_1000716 Ga0055528_100071639 246
487 3300003790 Ga0055528_1014786 Ga0055528_10147863 246
488 3300003790 Ga0055528_1018681 Ga0055528_10186811 246
489 3300003790 Ga0055528_1030026 Ga0055528_10300262 246
490 3300003792 Ga0055540_1000399 Ga0055540_100039915 246
491 3300003792 Ga0055540_1031822 Ga0055540_10318222 246
492 3300003792 Ga0055540_1049953 Ga0055540_10499531 246
493 3300004625 Ga0055543_1000489 Ga0055543_100048912 246
494 3300005262 Ga0065165_1016267 Ga0065165_10162672 246
495 3300005295 Ga0065707_10120174 Ga0065707_101201741 246
496 3300005329 Ga0070683_100605748 Ga0070683_1006057482 246
497 3300005337 Ga0070682_100068256 Ga0070682_1000682563 246
498 3300005344 Ga0070661_100005094 Ga0070661_1000050946 246
499 3300005347 Ga0070668_100011517 Ga0070668_1000115173 246
500 3300005353 Ga0070669_100016868 Ga0070669_1000168683 246
501 3300005356 Ga0070674_100016108 Ga0070674_1000161083 246
502 3300005356 Ga0070674_100433145 Ga0070674_1004331452 246
503 3300005366 Ga0070659_100378991 Ga0070659_1003789911 246
504 3300005437 Ga0070710_10000809 Ga0070710_100008096 246
505 3300005445 Ga0070708_100222091 Ga0070708_1002220911 246
506 3300005455 Ga0070663_100008664 Ga0070663_1000086644 246
507 3300005455 Ga0070663_100028440 Ga0070663_1000284405 246
508 3300005468 Ga0070707_100140234 Ga0070707_1001402341 246
509 3300005518 Ga0070699_100422994 Ga0070699_1004229942 246
510 3300005530 Ga0070679_100131508 Ga0070679_1001315084 246
511 3300005535 Ga0070684_100914887 Ga0070684_1009148871 246
512 3300005539 Ga0068853_100001347 Ga0068853_1000013479 246
513 3300005539 Ga0068853_100022202 Ga0068853_1000222021 246
514 3300005544 Ga0070686_100035123 Ga0070686_1000351232 246
515 3300005577 Ga0068857_100021902 Ga0068857_1000219023 246
516 3300005577 Ga0068857_100074871 Ga0068857_1000748713 246
517 3300005578 Ga0068854_100001486 Ga0068854_1000014866 246
518 3300005614 Ga0068856_100154879 Ga0068856_1001548793 246
519 3300005616 Ga0068852_100034234 Ga0068852_1000342342 246
520 3300005616 Ga0068852_100885067 Ga0068852_1008850671 246
521 3300005834 Ga0068851_10005070 Ga0068851_100050705 246
522 3300005844 Ga0068862_100003242 Ga0068862_1000032426 246
523 3300005844 Ga0068862_100047167 Ga0068862_1000471674 246
524 3300005844 Ga0068862_100547084 Ga0068862_1005470841 246
525 3300005985 Ga0081539_10000316 Ga0081539_1000031633 246
526 3300006028 Ga0070717_10104762 Ga0070717_101047621 246
527 3300006038 Ga0075365_10023833 Ga0075365_100238334 246
528 3300006038 Ga0075365_10228251 Ga0075365_102282512 246
529 3300006042 Ga0075368_10035242 Ga0075368_100352422 246
530 3300006048 Ga0075363_100072523 Ga0075363_1000725232 246
531 3300006048 Ga0075363_100213452 Ga0075363_1002134522 246
532 3300006051 Ga0075364_10222336 Ga0075364_102223361 246
533 3300006177 Ga0075362_10003549 Ga0075362_100035492 246
534 3300006178 Ga0075367_10012197 Ga0075367_100121972 246
535 3300006186 Ga0075369_10030199 Ga0075369_100301992 246
536 3300006186 Ga0075369_10044691 Ga0075369_100446912 246
537 3300006195 Ga0075366_10001329 Ga0075366_100013291 246
538 3300006353 Ga0075370_10034041 Ga0075370_100340412 246
539 3300006353 Ga0075370_10332111 Ga0075370_103321111 246
540 3300006847 Ga0075431_100615695 Ga0075431_1006156952 246
541 3300006880 Ga0075429_100564614 Ga0075429_1005646142 246
542 3300009036 Ga0105244_10089445 Ga0105244_100894452 246
543 3300009093 Ga0105240_10000336 Ga0105240_1000033628 246
544 3300009093 Ga0105240_10057132 Ga0105240_100571322 246
545 3300009147 Ga0114129_10080578 Ga0114129_100805783 246
546 3300009147 Ga0114129_10384072 Ga0114129_103840722 246
547 3300009174 Ga0105241_10105300 Ga0105241_101053002 246
548 3300009545 Ga0105237_10000690 Ga0105237_1000069033 246
549 3300009551 Ga0105238_10014048 Ga0105238_100140482 246
550 3300009765 Ga0123341_1004539 Ga0123341_10045399 246
551 3300009766 Ga0123342_1017768 Ga0123342_10177684 246
552 3300010375 Ga0105239_10281176 Ga0105239_102811761 246
553 3300012490 Ga0157322_1004080 Ga0157322_10040802 246
554 3300013104 Ga0157370_10026622 Ga0157370_100266224 246
555 3300013105 Ga0157369_10113277 Ga0157369_101132772 246
556 3300013297 Ga0157378_10417244 Ga0157378_104172442 246
557 3300014497 Ga0182008_10225101 Ga0182008_102251011 246
558 3300025208 Ga0209436_100031 Ga0209436_10003162 246
559 3300025208 Ga0209436_114778 Ga0209436_1147781 246
560 3300025245 Ga0207425_1002640 Ga0207425_10026406 246
561 3300025245 Ga0207425_1006193 Ga0207425_10061932 246
562 3300025245 Ga0207425_1017953 Ga0207425_10179531 246
563 3300025253 Ga0209677_103335 Ga0209677_1033355 246
564 3300025258 Ga0209129_1000669 Ga0209129_100066920 246
565 3300025258 Ga0209129_1001340 Ga0209129_100134010 246
566 3300025258 Ga0209129_1002531 Ga0209129_10025312 246
567 3300025261 Ga0209233_1000097 Ga0209233_1000097277 246
568 3300025273 Ga0209673_1000063 Ga0209673_1000063233 246
569 3300025273 Ga0209673_1000252 Ga0209673_100025247 246
570 3300025273 Ga0209673_1000291 Ga0209673_100029151 246
571 3300025273 Ga0209673_1001400 Ga0209673_100140038 246
572 3300025273 Ga0209673_1002105 Ga0209673_100210511 246
573 3300025273 Ga0209673_1002242 Ga0209673_100224211 246
574 3300025284 Ga0209130_1000031 Ga0209130_100003111 246
575 3300025284 Ga0209130_1000048 Ga0209130_1000048197 246
576 3300025294 Ga0209025_1000430 Ga0209025_100043027 246
577 3300025294 Ga0209025_1005207 Ga0209025_10052075 246
578 3300025295 Ga0209564_1000586 Ga0209564_100058641 246
579 3300025295 Ga0209564_1000664 Ga0209564_100066435 246
580 3300025295 Ga0209564_1000876 Ga0209564_100087614 246
581 3300025295 Ga0209564_1006096 Ga0209564_10060962 246
582 3300025295 Ga0209564_1013624 Ga0209564_10136241 246
583 3300025297 Ga0209758_1000490 Ga0209758_100049010 246
584 3300025297 Ga0209758_1001257 Ga0209758_100125722 246
585 3300025297 Ga0209758_1001647 Ga0209758_10016472 246
586 3300025297 Ga0209758_1002831 Ga0209758_100283110 246
587 3300025297 Ga0209758_1004719 Ga0209758_10047195 246
588 3300025297 Ga0209758_1034009 Ga0209758_10340093 246
589 3300025298 Ga0209050_1003257 Ga0209050_10032572 246
590 3300025299 Ga0209256_1000463 Ga0209256_100046354 246
591 3300025299 Ga0209256_1001515 Ga0209256_100151538 246
592 3300025299 Ga0209256_1002067 Ga0209256_10020673 246
593 3300025299 Ga0209256_1004108 Ga0209256_10041083 246
594 3300025302 Ga0207426_1000042 Ga0207426_1000042399 246
595 3300025302 Ga0207426_1000075 Ga0207426_1000075244 246
596 3300025302 Ga0207426_1000136 Ga0207426_1000136197 246
597 3300025303 Ga0209051_1000671 Ga0209051_100067116 246
598 3300025303 Ga0209051_1016239 Ga0209051_10162393 246
599 3300025303 Ga0209051_1025534 Ga0209051_10255343 246
600 3300025304 Ga0209257_1000504 Ga0209257_100050439 246
601 3300025304 Ga0209257_1065337 Ga0209257_10653372 246
602 3300025321 Ga0207656_10003814 Ga0207656_100038142 246
603 3300025898 Ga0207692_10001415 Ga0207692_100014155 246
604 3300025903 Ga0207680_10179295 Ga0207680_101792951 246
605 3300025908 Ga0207643_10338636 Ga0207643_103386362 246
606 3300025911 Ga0207654_10035337 Ga0207654_100353371 246
607 3300025913 Ga0207695_10000458 Ga0207695_1000045862 246
608 3300025914 Ga0207671_10000577 Ga0207671_1000057725 246
609 3300025914 Ga0207671_10016228 Ga0207671_100162282 246
610 3300025919 Ga0207657_10012411 Ga0207657_100124119 246
611 3300025920 Ga0207649_10008971 Ga0207649_100089713 246
612 3300025924 Ga0207694_10014161 Ga0207694_100141612 246
613 3300025924 Ga0207694_10033622 Ga0207694_100336222 246
614 3300025925 Ga0207650_10318883 Ga0207650_103188832 246
615 3300025929 Ga0207664_10028791 Ga0207664_100287912 246
616 3300025929 Ga0207664_10398737 Ga0207664_103987372 246
617 3300025937 Ga0207669_10025236 Ga0207669_100252362 246
618 3300025937 Ga0207669_10048578 Ga0207669_100485782 246
619 3300025949 Ga0207667_10201250 Ga0207667_102012503 246
620 3300025972 Ga0207668_10009534 Ga0207668_100095342 246
621 3300025972 Ga0207668_10719554 Ga0207668_107195541 246
622 3300025981 Ga0207640_10011282 Ga0207640_100112825 246
623 3300026041 Ga0207639_10042470 Ga0207639_100424703 246
624 3300026067 Ga0207678_10012764 Ga0207678_100127644 246
625 3300026067 Ga0207678_10018975 Ga0207678_100189755 246
626 3300026078 Ga0207702_10373360 Ga0207702_103733602 246
627 3300026116 Ga0207674_10095351 Ga0207674_100953512 246
628 3300026142 Ga0207698_10082567 Ga0207698_100825673 246
629 3300028380 Ga0268265_10005163 Ga0268265_100051636 246
630 3300028380 Ga0268265_10028795 Ga0268265_100287952 246
631 3300028786 Ga0307517_10225947 Ga0307517_102259471 246
632 3300028794 Ga0307515_10299599 Ga0307515_102995992 246
633 3300030522 Ga0307512_10009090 Ga0307512_100090907 246
634 3300030731 Ga0316177_1021166 Ga0316177_10211663 246
635 3300030736 Ga0316180_1172947 Ga0316180_11729473 246
636 3300031238 Ga0265332_10039082 Ga0265332_100390823 246
637 3300031456 Ga0307513_10204001 Ga0307513_102040012 246
638 3300031456 Ga0307513_10275582 Ga0307513_102755822 246
639 3300031711 Ga0265314_10034609 Ga0265314_100346091 246
640 3300031712 Ga0265342_10252510 Ga0265342_102525102 246
641 3300031911 Ga0307412_10096675 Ga0307412_100966751 246
642 3300032004 Ga0307414_10083504 Ga0307414_100835042 246
643 3300032004 Ga0307414_10275573 Ga0307414_102755732 246
644 3300035725 Ga0373947_0300628 Ga0373947_0300628_261_1001 246
645 3300037471 Ga0395905_0000791 Ga0395905_0000791_31329_32078 246
646 3300037853 Ga0436364_0393289 Ga0436364_0393289_4514_5260 246
647 3300041496 Ga0451839_1234649 Ga0451839_1234649_89_838 246
648 3300041501 Ga0451845_0296105 Ga0451845_0296105_24_770 246
649 3300041503 Ga0451847_0268177 Ga0451847_0268177_370_1119 246
650 3300041505 Ga0451849_1289643 Ga0451849_1289643_208_957 246
651 3300041507 Ga0451851_0444680 Ga0451851_0444680_31_780 246
652 3300042005 Ga0439448_0083916 Ga0439448_0083916_111_998 246
653 3300044719 Ga0466971_0194570 Ga0466971_0194570_11_754 246
654 3300046507 Ga0495606_0112874 Ga0495606_0112874_702_1442 246
655 3300046512 Ga0495610_0004552 Ga0495610_0004552_5984_6724 246
656 3300046515 Ga0495620_0141236 Ga0495620_0141236_180_923 246
657 3300046519 Ga0495632_0073066 Ga0495632_0073066_150_890 246
658 3300046616 Ga0495668_0115828 Ga0495668_0115828_24_767 246
659 3300046660 Ga0495625_0254448 Ga0495625_0254448_19_759 246
660 3300048919 Ga0496116_0003206 Ga0496116_0003206_2246_2992 246
661 3300048919 Ga0496116_0093227 Ga0496116_0093227_242_982 246
662 3300048919 Ga0496116_0117283 Ga0496116_0117283_299_1045 246
663 3300048920 Ga0496117_0010959 Ga0496117_0010959_461_1207 246
664 3300048920 Ga0496117_0059067 Ga0496117_0059067_1557_2303 246
665 3300048921 Ga0496118_0024130 Ga0496118_0024130_255_1001 246
666 3300048921 Ga0496118_0090434 Ga0496118_0090434_1188_1934 246
667 3300048921 Ga0496118_0139409 Ga0496118_0139409_107_865 246
668 3300048922 Ga0496119_0042991 Ga0496119_0042991_1367_2113 246
669 3300048924 Ga0496121_0009961 Ga0496121_0009961_6323_7069 246
670 3300048924 Ga0496121_0407874 Ga0496121_0407874_71_811 246
671 3300048925 Ga0496122_0033522 Ga0496122_0033522_47_793 246
672 3300048925 Ga0496122_0081372 Ga0496122_0081372_548_1294 246
673 3300048926 Ga0496123_0020166 Ga0496123_0020166_3748_4494 246
674 3300048926 Ga0496123_0030754 Ga0496123_0030754_1040_1786 246
675 3300048927 Ga0496124_0001914 Ga0496124_0001914_25568_26314 246
676 3300048927 Ga0496124_0140144 Ga0496124_0140144_390_1136 246
677 3300048927 Ga0496124_0204706 Ga0496124_0204706_65_907 246
678 3300048928 Ga0496125_0125650 Ga0496125_0125650_505_1251 246
679 3300048929 Ga0496126_0008697 Ga0496126_0008697_7391_8158 246
680 3300048929 Ga0496126_0100364 Ga0496126_0100364_1540_2298 246
681 3300049459 Ga0495678_050663 Ga0495678_050663_472_1212 246
682 3300049568 Ga0501031_0001559 Ga0501031_0001559_12484_13251 246
683 3300049568 Ga0501031_0089125 Ga0501031_0089125_945_1709 246
684 3300049569 Ga0501032_0001034 Ga0501032_0001034_1295_2062 246
685 3300049570 Ga0501033_0003222 Ga0501033_0003222_5216_5983 246
686 3300049570 Ga0501033_0137820 Ga0501033_0137820_877_1641 246
687 3300049571 Ga0501034_0002860 Ga0501034_0002860_18278_19045 246
688 3300049571 Ga0501034_0152259 Ga0501034_0152259_1282_2028 246
689 3300049572 Ga0501036_0066386 Ga0501036_0066386_1075_1842 246
690 3300049572 Ga0501036_0277558 Ga0501036_0277558_173_937 246
691 3300049573 Ga0501037_0000514 Ga0501037_0000514_3129_3896 246
692 3300049574 Ga0501038_0015873 Ga0501038_0015873_948_1715 246
693 3300049574 Ga0501038_0038552 Ga0501038_0038552_2118_2858 246
694 3300049574 Ga0501038_0069097 Ga0501038_0069097_1931_2695 246
695 3300049575 Ga0501039_0000432 Ga0501039_0000432_1658_2425 246
696 3300049575 Ga0501039_0012347 Ga0501039_0012347_1579_2343 246
697 3300049579 Ga0501043_0035006 Ga0501043_0035006_1212_1979 246
698 3300049580 Ga0501046_0001262 Ga0501046_0001262_18409_19176 246
699 3300049581 Ga0501047_0006274 Ga0501047_0006274_6298_7065 246
700 3300049581 Ga0501047_0030949 Ga0501047_0030949_1362_2102 246
701 3300049582 Ga0501048_0003846 Ga0501048_0003846_3340_4107 246
702 3300049583 Ga0501067_0011888 Ga0501067_0011888_3586_4326 246
703 3300049583 Ga0501067_0019049 Ga0501067_0019049_785_1552 246
704 3300049584 Ga0501068_0016396 Ga0501068_0016396_2922_3689 246
705 3300049584 Ga0501068_0099705 Ga0501068_0099705_261_1001 246
706 3300049584 Ga0501068_0162193 Ga0501068_0162193_520_1284 246
707 3300049585 Ga0501069_0001119 Ga0501069_0001119_10608_11375 246
708 3300049586 Ga0501070_0006527 Ga0501070_0006527_1736_2503 246
709 3300049586 Ga0501070_0017904 Ga0501070_0017904_71_835 246
710 3300049587 Ga0501071_0366574 Ga0501071_0366574_239_1006 246
711 3300049588 Ga0501072_0039944 Ga0501072_0039944_1897_2664 246
712 3300049589 Ga0501073_0000534 Ga0501073_0000534_6424_7191 246
713 3300049589 Ga0501073_0028100 Ga0501073_0028100_1178_1918 246
714 3300049589 Ga0501073_0091242 Ga0501073_0091242_385_1131 246
715 3300049590 Ga0501074_0035429 Ga0501074_0035429_1161_1928 246
716 3300049590 Ga0501074_0219144 Ga0501074_0219144_429_1193 246
717 3300049742 Ga0501080_0003677 Ga0501080_0003677_9524_10291 246
718 3300049742 Ga0501080_0010159 Ga0501080_0010159_1577_2317 246
719 3300049744 Ga0501083_0018962 Ga0501083_0018962_1053_1820 246
720 3300049744 Ga0501083_0041672 Ga0501083_0041672_942_1682 246
721 3300049822 Ga0501035_0030566 Ga0501035_0030566_1562_2329 246
722 3300049822 Ga0501035_0096494 Ga0501035_0096494_1092_1856 246
723 3300049823 Ga0501044_0004665 Ga0501044_0004665_14462_15202 246
724 3300049823 Ga0501044_0011230 Ga0501044_0011230_6031_6798 246
725 3300049823 Ga0501044_0552394 Ga0501044_0552394_271_1035 246
726 3300049824 Ga0501045_0363619 Ga0501045_0363619_253_1017 246
727 3300050507 nmdc:mga05p37_357443_c1 nmdc:mga05p37_357443_c1_580_1320 246
728 3300050507 nmdc:mga05p37_503593_c1 nmdc:mga05p37_503593_c1_103_843 246
729 3300053093 Ga0500651_0068385 Ga0500651_0068385_593_1333 246
730 3300053130 Ga0500642_0001239 Ga0500642_0001239_411_1151 246
731 3300053139 Ga0500568_0000361 Ga0500568_0000361_33231_33971 246
732 3300053151 Ga0500604_0008235 Ga0500604_0008235_429_1169 246
733 3300053151 Ga0500604_0043014 Ga0500604_0043014_279_1019 246
734 3300053153 Ga0500616_0000686 Ga0500616_0000686_30886_31626 246
735 3300053157 Ga0500624_022879 Ga0500624_022879_164_919 246
736 3300054114 Ga0501084_0000193 Ga0501084_0000193_27617_28384 246
737 3300054114 Ga0501084_0015147 Ga0501084_0015147_3496_4236 246
738 3300060353 Ga0501082_0003570 Ga0501082_0003570_6404_7144 246
739 3300061719 Ga0466962_0094782 Ga0466962_0094782_271_1029 246
740 3300006177 Ga0075362_10128528 Ga0075362_101285282 247
741 3300006178 Ga0075367_10016873 Ga0075367_100168733 247
742 3300006186 Ga0075369_10105746 Ga0075369_101057462 247
743 3300006195 Ga0075366_10200289 Ga0075366_102002892 247
744 3300006353 Ga0075370_10121047 Ga0075370_101210472 247
745 3300031824 Ga0307413_10320543 Ga0307413_103205432 247
746 3300041413 Ga0439465_0109519 Ga0439465_0109519_121_891 247
747 3300048909 Ga0496106_0243119 Ga0496106_0243119_214_981 247
748 3300048924 Ga0496121_0150370 Ga0496121_0150370_493_1263 247
749 3300049571 Ga0501034_0012347 Ga0501034_0012347_6761_7528 247
750 3300049571 Ga0501034_0073930 Ga0501034_0073930_421_1179 247
751 3300049571 Ga0501034_0141388 Ga0501034_0141388_129_890 247
752 3300049571 Ga0501034_0266055 Ga0501034_0266055_273_1040 247
753 3300050494 nmdc:mga06z11_69250_c1 nmdc:mga06z11_69250_c1_891_1652 247
754 3300053139 Ga0500568_0035779 Ga0500568_0035779_1050_1820 247
755 iso_pu_bacteria 2643221629 2644164349 247
756 iso_pu_bacteria 2643221662 2644346380 247
757 3300001915 JGI24741J21665_1010079 JGI24741J21665_10100792 248
758 3300005262 Ga0065165_1005024 Ga0065165_10050241 248
759 3300005343 Ga0070687_100332424 Ga0070687_1003324241 248
760 3300005353 Ga0070669_100086993 Ga0070669_1000869932 248
761 3300005548 Ga0070665_100336422 Ga0070665_1003364222 248
762 3300006178 Ga0075367_10310440 Ga0075367_103104401 248
763 3300006353 Ga0075370_10076482 Ga0075370_100764822 248
764 3300013308 Ga0157375_10149482 Ga0157375_101494821 248
765 3300025923 Ga0207681_10092411 Ga0207681_100924112 248
766 3300025927 Ga0207687_10364131 Ga0207687_103641312 248
767 3300028379 Ga0268266_10236163 Ga0268266_102361632 248
768 3300028577 Ga0265318_10002087 Ga0265318_100020876 248
769 3300048909 Ga0496106_0008218 Ga0496106_0008218_3834_4580 248
770 3300048912 Ga0496109_0198173 Ga0496109_0198173_905_1717 248
771 3300048924 Ga0496121_0003823 Ga0496121_0003823_2686_3432 248
772 3300048926 Ga0496123_0002938 Ga0496123_0002938_2579_3325 248
773 3300048927 Ga0496124_0030119 Ga0496124_0030119_1412_2158 248
774 3300048929 Ga0496126_0097560 Ga0496126_0097560_1284_2030 248
775 3300050496 nmdc:mga07m45_15904_c2 nmdc:mga07m45_15904_c2_1969_2715 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

20

189

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x15-assembly1.cif.gz_C-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.9763 8 214
5x15-assembly1.cif.gz_A-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.9677 9 215
5x15-assembly1.cif.gz_A-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.9581 9 215
5x15-assembly1.cif.gz_C-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.957 8 214
3k4i-assembly1.cif.gz_B crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.8937 8 226
ID Description Score Start End Superfamily
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9022 11 191 3.50.30.40
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8913 11 191 3.50.30.40
5ir2A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8689 3 210 3.50.30.40
2pcnA00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8648 37 191 3.50.30.40
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8499 27 190 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A527ZK34-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) 0.9851 1 189 GO:0046872
AF-A0A6B0XG78-F1-model_v4 Regulator of ribonuclease activity homolog 0.9824 1 242 GO:0046872
AF-A0A381VDY7-F1-model_v4 Uncharacterized protein 0.9814 1 191
AF-A0A527ZK34-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) 0.9799 1 189 GO:0046872
AF-A0A381VDY7-F1-model_v4 Uncharacterized protein 0.9763 1 191

Feature Viewer

pLDDT pTM Quality
91.95 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map