F480265
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 775 | 552 | 469 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300028577|Ga0265318_10002087|Ga0265318_100020876 |
| Length | 291 |
| Sequence | MYDIPKITRPSKDIIAQLKDIGTATVAGSLAHAGFRQPHMIGPVTQYPGKSIVGTALTLQFLPQRPDLFSEGEYADVEKQLHRHVLYQVEEGDVVVVDARGDMTSGVFGDMMSTYFKGRGGAGIVIDGVMRDRPNVDKLDLALWLRGWTPNYHVQTGIYPSAVNVPIACGGVQVIPGDIIMADDDGVVVLPVSMAAKVIEDSKKHAEWEVFSREKLKQGADLRRYYPLHADAQGEYEAWRKLNPIRNSAYPATSVKCSSNHLPGTMRRLRDSSSVARALASITGTAVSSGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 7 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 8 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 9 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 10 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 11 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 12 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 13 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 14 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 15 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 16 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 17 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 18 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 19 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 20 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 21 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 22 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 23 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 24 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 25 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 26 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 27 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 28 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 29 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 30 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 31 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 32 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 33 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 34 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 35 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 36 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 37 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 38 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 39 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 40 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 41 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 42 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 43 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 44 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 45 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 46 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 47 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 48 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 49 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 50 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 51 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 52 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 53 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 54 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 55 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 56 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 57 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 58 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 59 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 60 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 61 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 62 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 63 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 64 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 65 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 66 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 67 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 68 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 69 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 70 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 71 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 72 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 73 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 74 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 75 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 76 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 77 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 78 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 79 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 80 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 81 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 82 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 83 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 84 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 85 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 86 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 87 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 88 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 89 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 90 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 91 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 92 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 93 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 94 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 95 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 96 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 97 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 98 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 99 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 100 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 101 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 102 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 103 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 104 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 105 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 106 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 107 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 108 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 109 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 110 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 111 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 112 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 113 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 114 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 115 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 116 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 117 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 118 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 119 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 120 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 121 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 122 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 123 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 124 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 125 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 126 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 127 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 128 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 129 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 130 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 131 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 132 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 133 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 134 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 135 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 136 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 137 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 138 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 139 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 140 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 141 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 142 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 143 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 144 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 145 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 146 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 147 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 148 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 149 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 150 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 151 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 152 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 153 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 154 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 155 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 156 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 157 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 158 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 159 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 160 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 161 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 162 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 163 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 164 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 165 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 166 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 167 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 168 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 169 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 170 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 171 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 172 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 173 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 174 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 175 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 176 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 177 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 178 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 179 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 180 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 181 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 182 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 183 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 184 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 185 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 186 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 187 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 188 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 189 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 190 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 191 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 192 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 193 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 194 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 195 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 196 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 197 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 198 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 199 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 200 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 201 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 202 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 203 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 204 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 205 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 206 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 207 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 208 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 209 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 210 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 211 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 212 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 213 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 214 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 215 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 216 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 217 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 218 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 219 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 220 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 221 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 222 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 223 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 224 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 225 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 226 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 227 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 228 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 229 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 230 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 231 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 232 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 233 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 234 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 235 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 236 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 237 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 238 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 239 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 240 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 241 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 242 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 243 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 244 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 245 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 246 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 247 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 248 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 249 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 250 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 251 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 252 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 253 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 254 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 255 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 256 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 257 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 258 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 259 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 260 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 261 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 262 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 263 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 264 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 265 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 266 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 267 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 268 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 269 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 270 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 271 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 272 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 273 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 274 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 275 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 276 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 277 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 278 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 279 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 280 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 281 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 282 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 283 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 284 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 285 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 286 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 287 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 288 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 289 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 290 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 291 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 292 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 293 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 294 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 295 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 296 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 297 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 298 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 299 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 300 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 301 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 302 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 303 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 304 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 305 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 306 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 307 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 308 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 309 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 310 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 311 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 312 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 313 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 314 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 315 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 316 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 317 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 318 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 319 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 320 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 321 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 322 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 323 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 324 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 325 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 326 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 327 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 328 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 329 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 330 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 331 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 332 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 333 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 334 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 335 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 336 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 337 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 338 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 339 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 340 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 341 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 343 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 345 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 346 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 347 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 348 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 349 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 350 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 351 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 352 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 353 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 354 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 355 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 356 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 357 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 358 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 359 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 360 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 361 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 362 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 364 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 365 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 367 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 368 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 370 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 372 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 373 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 374 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 375 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 376 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 377 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 378 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 379 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 417 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 418 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 419 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 420 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 421 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 422 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 423 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 424 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 425 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 426 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 427 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 428 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 429 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 430 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 431 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 432 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 433 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 434 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 435 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 436 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 437 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 438 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 439 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 440 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 441 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 442 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 443 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 444 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 445 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 446 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 447 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 448 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 449 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 450 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 451 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 452 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 453 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 454 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 455 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 456 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 457 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 458 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 459 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 467 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 468 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 469 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 470 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 471 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 472 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 473 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 474 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 475 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 476 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 477 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 478 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 505 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 506 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 507 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 508 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 510 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 511 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 512 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 513 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 514 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 515 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 516 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 517 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 518 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 521 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 522 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 523 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 524 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 525 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 526 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 527 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 528 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 529 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 530 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 531 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 532 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 533 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 534 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 535 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 536 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 537 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 538 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 539 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 540 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 541 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 542 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 543 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 544 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 545 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 546 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 547 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 548 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 549 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 550 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 551 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 552 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 60.52 |
| Metatranscriptomes | 0 |
| Isolates | 39.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.23 |
| Nodule | 32.39 |
| Rhizoplane | 0.52 |
| Rhizosphere | 39.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1010079 | 3300001915 | Bacteria | 1708 |
| 2 | JGI24739J22299_10018230 | 3300001989 | Bacteria | 2525 |
| 3 | JGI25156J39149_1002223 | 3300002705 | Bacteria | 7181 |
| 4 | JGI25158J39367_1000205 | 3300002739 | Bacteria | 14120 |
| 5 | JGI25157J39369_1000599 | 3300002741 | Bacteria | 21188 |
| 6 | JGI25152J39213_1004650 | 3300002773 | Bacteria | 4254 |
| 7 | JGI25152J39213_1006150 | 3300002773 | Bacteria | 3337 |
| 8 | JGI25152J39213_1009450 | 3300002773 | Bacteria | 2317 |
| 9 | JGI25150J39212_1007385 | 3300002774 | Bacteria | 2212 |
| 10 | JGI25159J45721_1001121 | 3300002987 | Bacteria | 11452 |
| 11 | JGI25151J46595_10000867 | 3300003187 | Bacteria | 23973 |
| 12 | JGI25151J46595_10004550 | 3300003187 | Bacteria | 7312 |
| 13 | JGI25151J46595_10018558 | 3300003187 | Bacteria | 2981 |
| 14 | rootL2_10015096 | 3300003322 | Bacteria | 17553 |
| 15 | rootH1_10100374 | 3300003323 | Bacteria | 7653 |
| 16 | JGI25161J50226_1000050 | 3300003374 | Bacteria | 110628 |
| 17 | JGI25161J50226_1003954 | 3300003374 | Bacteria | 3223 |
| 18 | Ga0055526_1000595 | 3300003771 | Bacteria | 28430 |
| 19 | Ga0055526_1024018 | 3300003771 | Bacteria | 2010 |
| 20 | Ga0055524_1000922 | 3300003775 | Bacteria | 18970 |
| 21 | Ga0055524_1002690 | 3300003775 | Bacteria | 8994 |
| 22 | Ga0055524_1018262 | 3300003775 | Bacteria | 2443 |
| 23 | Ga0055536_1052975 | 3300003781 | Bacteria | 880 |
| 24 | Ga0055528_1000096 | 3300003790 | Bacteria | 70375 |
| 25 | Ga0055528_1000716 | 3300003790 | Bacteria | 23431 |
| 26 | Ga0055528_1014786 | 3300003790 | Bacteria | 2863 |
| 27 | Ga0055528_1018681 | 3300003790 | Bacteria | 2339 |
| 28 | Ga0055528_1030026 | 3300003790 | Bacteria | 1454 |
| 29 | Ga0055540_1000399 | 3300003792 | Bacteria | 35498 |
| 30 | Ga0055540_1031822 | 3300003792 | Bacteria | 1209 |
| 31 | Ga0055540_1049953 | 3300003792 | Bacteria | 866 |
| 32 | Ga0055543_1000489 | 3300004625 | Bacteria | 22914 |
| 33 | Ga0065165_1005024 | 3300005262 | Bacteria | 7736 |
| 34 | Ga0065165_1007074 | 3300005262 | Bacteria | 5637 |
| 35 | Ga0065165_1016267 | 3300005262 | Bacteria | 2793 |
| 36 | Ga0065707_10120174 | 3300005295 | Bacteria | 2141 |
| 37 | Ga0070658_10019519 | 3300005327 | Bacteria | 5428 |
| 38 | Ga0070683_100108132 | 3300005329 | Bacteria | 2622 |
| 39 | Ga0070683_100605748 | 3300005329 | Bacteria | 1048 |
| 40 | Ga0070682_100068256 | 3300005337 | Bacteria | 2267 |
| 41 | Ga0068868_100138538 | 3300005338 | Bacteria | 1996 |
| 42 | Ga0070660_100030363 | 3300005339 | Bacteria | 4055 |
| 43 | Ga0070660_100133813 | 3300005339 | Bacteria | 1986 |
| 44 | Ga0070660_100145156 | 3300005339 | Bacteria | 1905 |
| 45 | Ga0070660_100180793 | 3300005339 | Bacteria | 1706 |
| 46 | Ga0070687_100332424 | 3300005343 | Bacteria | 975 |
| 47 | Ga0070661_100005094 | 3300005344 | Bacteria | 9066 |
| 48 | Ga0070661_100018671 | 3300005344 | Bacteria | 4934 |
| 49 | Ga0070661_100042747 | 3300005344 | Bacteria | 3308 |
| 50 | Ga0070661_100074458 | 3300005344 | Bacteria | 2501 |
| 51 | Ga0070661_100079929 | 3300005344 | Bacteria | 2413 |
| 52 | Ga0070668_100011517 | 3300005347 | Bacteria | 6586 |
| 53 | Ga0070668_100176104 | 3300005347 | Bacteria | 1744 |
| 54 | Ga0070669_100016868 | 3300005353 | Bacteria | 5213 |
| 55 | Ga0070669_100086993 | 3300005353 | Bacteria | 2336 |
| 56 | Ga0070669_100217606 | 3300005353 | Bacteria | 1509 |
| 57 | Ga0070674_100016108 | 3300005356 | Bacteria | 4683 |
| 58 | Ga0070674_100049340 | 3300005356 | Bacteria | 2893 |
| 59 | Ga0070674_100433145 | 3300005356 | Bacteria | 1082 |
| 60 | Ga0070673_100217950 | 3300005364 | Bacteria | 1651 |
| 61 | Ga0070659_100017270 | 3300005366 | Bacteria | 5425 |
| 62 | Ga0070659_100161964 | 3300005366 | Bacteria | 1830 |
| 63 | Ga0070659_100378991 | 3300005366 | Bacteria | 1191 |
| 64 | Ga0070710_10000809 | 3300005437 | Bacteria | 15018 |
| 65 | Ga0070708_100222091 | 3300005445 | Bacteria | 1772 |
| 66 | Ga0070663_100008664 | 3300005455 | Bacteria | 6271 |
| 67 | Ga0070663_100028440 | 3300005455 | Bacteria | 3806 |
| 68 | Ga0070662_100030424 | 3300005457 | Bacteria | 3777 |
| 69 | Ga0068867_100338039 | 3300005459 | Bacteria | 1253 |
| 70 | Ga0070707_100140234 | 3300005468 | Bacteria | 2353 |
| 71 | Ga0070699_100422994 | 3300005518 | Bacteria | 1206 |
| 72 | Ga0070679_100131508 | 3300005530 | Bacteria | 2483 |
| 73 | Ga0070684_100328127 | 3300005535 | Bacteria | 1406 |
| 74 | Ga0070684_100625806 | 3300005535 | Bacteria | 1001 |
| 75 | Ga0070684_100914887 | 3300005535 | Bacteria | 822 |
| 76 | Ga0068853_100001347 | 3300005539 | Bacteria | 17688 |
| 77 | Ga0068853_100012183 | 3300005539 | Bacteria | 6993 |
| 78 | Ga0068853_100022202 | 3300005539 | Bacteria | 5298 |
| 79 | Ga0070686_100035123 | 3300005544 | Bacteria | 3094 |
| 80 | Ga0070665_100008163 | 3300005548 | Bacteria | 10598 |
| 81 | Ga0070665_100058286 | 3300005548 | Bacteria | 3872 |
| 82 | Ga0070665_100336422 | 3300005548 | Bacteria | 1514 |
| 83 | Ga0068855_100040893 | 3300005563 | Bacteria | 5498 |
| 84 | Ga0068855_100353259 | 3300005563 | Bacteria | 1619 |
| 85 | Ga0068857_100021902 | 3300005577 | Bacteria | 5624 |
| 86 | Ga0068857_100074871 | 3300005577 | Bacteria | 3018 |
| 87 | Ga0068857_100166175 | 3300005577 | Bacteria | 2004 |
| 88 | Ga0068854_100001486 | 3300005578 | Bacteria | 14198 |
| 89 | Ga0068854_100041169 | 3300005578 | Bacteria | 3264 |
| 90 | Ga0068854_100044855 | 3300005578 | Bacteria | 3141 |
| 91 | Ga0068856_100012342 | 3300005614 | Bacteria | 8274 |
| 92 | Ga0068856_100154879 | 3300005614 | Bacteria | 2301 |
| 93 | Ga0068856_100281122 | 3300005614 | Bacteria | 1681 |
| 94 | Ga0068856_100322254 | 3300005614 | Bacteria | 1563 |
| 95 | Ga0068856_100454630 | 3300005614 | Bacteria | 1301 |
| 96 | Ga0068852_100017669 | 3300005616 | Bacteria | 5601 |
| 97 | Ga0068852_100034234 | 3300005616 | Bacteria | 4224 |
| 98 | Ga0068852_100050523 | 3300005616 | Bacteria | 3563 |
| 99 | Ga0068852_100119104 | 3300005616 | Bacteria | 2413 |
| 100 | Ga0068852_100375473 | 3300005616 | Bacteria | 1394 |
| 101 | Ga0068852_100885067 | 3300005616 | Bacteria | 910 |
| 102 | Ga0068851_10005070 | 3300005834 | Bacteria | 5974 |
| 103 | Ga0068862_100003242 | 3300005844 | Bacteria | 14082 |
| 104 | Ga0068862_100047167 | 3300005844 | Bacteria | 3676 |
| 105 | Ga0068862_100547084 | 3300005844 | Bacteria | 1105 |
| 106 | Ga0081540_1019814 | 3300005983 | Bacteria | 4072 |
| 107 | Ga0081539_10000316 | 3300005985 | Bacteria | 107841 |
| 108 | Ga0070717_10104762 | 3300006028 | Bacteria | 2407 |
| 109 | Ga0075365_10020389 | 3300006038 | Bacteria | 4109 |
| 110 | Ga0075365_10023833 | 3300006038 | Bacteria | 3853 |
| 111 | Ga0075365_10036309 | 3300006038 | Bacteria | 3192 |
| 112 | Ga0075365_10186122 | 3300006038 | Bacteria | 1452 |
| 113 | Ga0075365_10228251 | 3300006038 | Bacteria | 1307 |
| 114 | Ga0075368_10035242 | 3300006042 | Bacteria | 1952 |
| 115 | Ga0075363_100072523 | 3300006048 | Bacteria | 1872 |
| 116 | Ga0075363_100213452 | 3300006048 | Bacteria | 1105 |
| 117 | Ga0075364_10222336 | 3300006051 | Bacteria | 1282 |
| 118 | Ga0075364_10443482 | 3300006051 | Bacteria | 887 |
| 119 | Ga0075362_10003549 | 3300006177 | Bacteria | 5474 |
| 120 | Ga0075362_10128528 | 3300006177 | Bacteria | 1203 |
| 121 | Ga0075367_10012197 | 3300006178 | Bacteria | 4572 |
| 122 | Ga0075367_10016873 | 3300006178 | Bacteria | 3996 |
| 123 | Ga0075367_10189720 | 3300006178 | Bacteria | 1282 |
| 124 | Ga0075367_10310440 | 3300006178 | Bacteria | 993 |
| 125 | Ga0075369_10030199 | 3300006186 | Bacteria | 2281 |
| 126 | Ga0075369_10044691 | 3300006186 | Bacteria | 1903 |
| 127 | Ga0075369_10105746 | 3300006186 | Bacteria | 1265 |
| 128 | Ga0075366_10001329 | 3300006195 | Bacteria | 12354 |
| 129 | Ga0075366_10200289 | 3300006195 | Bacteria | 1214 |
| 130 | Ga0075370_10034041 | 3300006353 | Bacteria | 2855 |
| 131 | Ga0075370_10076482 | 3300006353 | Bacteria | 1920 |
| 132 | Ga0075370_10121047 | 3300006353 | Bacteria | 1523 |
| 133 | Ga0075370_10332111 | 3300006353 | Bacteria | 906 |
| 134 | Ga0068871_100533514 | 3300006358 | Bacteria | 1061 |
| 135 | Ga0075431_100615695 | 3300006847 | Bacteria | 1069 |
| 136 | Ga0075429_100564614 | 3300006880 | Bacteria | 997 |
| 137 | Ga0068865_100108227 | 3300006881 | Bacteria | 2046 |
| 138 | Ga0105244_10089445 | 3300009036 | Bacteria | 1516 |
| 139 | Ga0105240_10000336 | 3300009093 | Bacteria | 87900 |
| 140 | Ga0105240_10057132 | 3300009093 | Bacteria | 4878 |
| 141 | Ga0111539_10698752 | 3300009094 | Bacteria | 1180 |
| 142 | Ga0105245_10391104 | 3300009098 | Bacteria | 1387 |
| 143 | Ga0114129_10080578 | 3300009147 | Bacteria | 4525 |
| 144 | Ga0114129_10316295 | 3300009147 | Bacteria | 2076 |
| 145 | Ga0114129_10384072 | 3300009147 | Bacteria | 1854 |
| 146 | Ga0105241_10087477 | 3300009174 | Bacteria | 2453 |
| 147 | Ga0105241_10105300 | 3300009174 | Bacteria | 2249 |
| 148 | Ga0105241_10183428 | 3300009174 | Bacteria | 1737 |
| 149 | Ga0105241_10350362 | 3300009174 | Bacteria | 1282 |
| 150 | Ga0105237_10000690 | 3300009545 | Bacteria | 46704 |
| 151 | Ga0105237_10167494 | 3300009545 | Bacteria | 2196 |
| 152 | Ga0105237_10330040 | 3300009545 | Bacteria | 1530 |
| 153 | Ga0105238_10013090 | 3300009551 | Bacteria | 8369 |
| 154 | Ga0105238_10014048 | 3300009551 | Bacteria | 8097 |
| 155 | Ga0105238_10034505 | 3300009551 | Bacteria | 5147 |
| 156 | Ga0123341_1004539 | 3300009765 | Bacteria | 12198 |
| 157 | Ga0123342_1017768 | 3300009766 | Bacteria | 5840 |
| 158 | Ga0105032_103260 | 3300009979 | Bacteria | 1414 |
| 159 | Ga0105239_10013586 | 3300010375 | Bacteria | 9038 |
| 160 | Ga0105239_10183511 | 3300010375 | Bacteria | 2341 |
| 161 | Ga0105239_10194870 | 3300010375 | Bacteria | 2269 |
| 162 | Ga0105239_10281176 | 3300010375 | Bacteria | 1873 |
| 163 | Ga0105239_10531845 | 3300010375 | Bacteria | 1338 |
| 164 | Ga0157322_1004080 | 3300012490 | Bacteria | 934 |
| 165 | Ga0157371_10028500 | 3300013102 | Bacteria | 4043 |
| 166 | Ga0157370_10026622 | 3300013104 | Bacteria | 5707 |
| 167 | Ga0157370_10658944 | 3300013104 | Bacteria | 956 |
| 168 | Ga0157369_10113277 | 3300013105 | Bacteria | 2881 |
| 169 | Ga0157374_10119111 | 3300013296 | Bacteria | 2546 |
| 170 | Ga0157378_10082289 | 3300013297 | Bacteria | 2911 |
| 171 | Ga0157378_10417244 | 3300013297 | Bacteria | 1326 |
| 172 | Ga0157372_10128256 | 3300013307 | Bacteria | 2917 |
| 173 | Ga0157372_10152488 | 3300013307 | Bacteria | 2668 |
| 174 | Ga0157375_10149482 | 3300013308 | Unclassified | 2470 |
| 175 | Ga0182008_10225101 | 3300014497 | Bacteria | 961 |
| 176 | Ga0157379_10729142 | 3300014968 | Bacteria | 932 |
| 177 | Ga0213876_10002694 | 3300021384 | Bacteria | 10371 |
| 178 | Ga0209436_100031 | 3300025208 | Bacteria | 82827 |
| 179 | Ga0209436_114778 | 3300025208 | Bacteria | 1231 |
| 180 | Ga0207425_1002640 | 3300025245 | Bacteria | 6188 |
| 181 | Ga0207425_1006193 | 3300025245 | Bacteria | 3302 |
| 182 | Ga0207425_1017953 | 3300025245 | Bacteria | 1543 |
| 183 | Ga0209026_1000029 | 3300025250 | Bacteria | 337109 |
| 184 | Ga0209677_103335 | 3300025253 | Bacteria | 5282 |
| 185 | Ga0209759_1000040 | 3300025256 | Bacteria | 254501 |
| 186 | Ga0209129_1000016 | 3300025258 | Bacteria | 485491 |
| 187 | Ga0209129_1000669 | 3300025258 | Bacteria | 22694 |
| 188 | Ga0209129_1001340 | 3300025258 | Bacteria | 13927 |
| 189 | Ga0209129_1002531 | 3300025258 | Bacteria | 8879 |
| 190 | Ga0209233_1000097 | 3300025261 | Bacteria | 295452 |
| 191 | Ga0209673_1000063 | 3300025273 | Bacteria | 256709 |
| 192 | Ga0209673_1000252 | 3300025273 | Bacteria | 101552 |
| 193 | Ga0209673_1000291 | 3300025273 | Bacteria | 93803 |
| 194 | Ga0209673_1001400 | 3300025273 | Bacteria | 23490 |
| 195 | Ga0209673_1002105 | 3300025273 | Bacteria | 14931 |
| 196 | Ga0209673_1002242 | 3300025273 | Bacteria | 13961 |
| 197 | Ga0209130_1000031 | 3300025284 | Bacteria | 322932 |
| 198 | Ga0209130_1000048 | 3300025284 | Bacteria | 233357 |
| 199 | Ga0209130_1005302 | 3300025284 | Bacteria | 4524 |
| 200 | Ga0209025_1000338 | 3300025294 | Bacteria | 103479 |
| 201 | Ga0209025_1000430 | 3300025294 | Bacteria | 83230 |
| 202 | Ga0209025_1005207 | 3300025294 | Bacteria | 10728 |
| 203 | Ga0209564_1000586 | 3300025295 | Bacteria | 57490 |
| 204 | Ga0209564_1000664 | 3300025295 | Bacteria | 50898 |
| 205 | Ga0209564_1000876 | 3300025295 | Bacteria | 40029 |
| 206 | Ga0209564_1006096 | 3300025295 | Bacteria | 6625 |
| 207 | Ga0209564_1013624 | 3300025295 | Bacteria | 3434 |
| 208 | Ga0209758_1000490 | 3300025297 | Bacteria | 64714 |
| 209 | Ga0209758_1001257 | 3300025297 | Bacteria | 31390 |
| 210 | Ga0209758_1001647 | 3300025297 | Bacteria | 25345 |
| 211 | Ga0209758_1002831 | 3300025297 | Bacteria | 16855 |
| 212 | Ga0209758_1004719 | 3300025297 | Bacteria | 11117 |
| 213 | Ga0209758_1013935 | 3300025297 | Bacteria | 4327 |
| 214 | Ga0209758_1034009 | 3300025297 | Bacteria | 2036 |
| 215 | Ga0209050_1003257 | 3300025298 | Bacteria | 12215 |
| 216 | Ga0209256_1000463 | 3300025299 | Bacteria | 61298 |
| 217 | Ga0209256_1001515 | 3300025299 | Bacteria | 23483 |
| 218 | Ga0209256_1002067 | 3300025299 | Bacteria | 17689 |
| 219 | Ga0209256_1004108 | 3300025299 | Bacteria | 9426 |
| 220 | Ga0207426_1000042 | 3300025302 | Bacteria | 433289 |
| 221 | Ga0207426_1000075 | 3300025302 | Bacteria | 321337 |
| 222 | Ga0207426_1000136 | 3300025302 | Bacteria | 201401 |
| 223 | Ga0209051_1000671 | 3300025303 | Bacteria | 38414 |
| 224 | Ga0209051_1016239 | 3300025303 | Bacteria | 3382 |
| 225 | Ga0209051_1025534 | 3300025303 | Bacteria | 2401 |
| 226 | Ga0209257_1000504 | 3300025304 | Bacteria | 68999 |
| 227 | Ga0209257_1065337 | 3300025304 | Bacteria | 975 |
| 228 | Ga0207656_10003814 | 3300025321 | Bacteria | 5222 |
| 229 | Ga0207692_10001415 | 3300025898 | Bacteria | 8982 |
| 230 | Ga0207680_10179295 | 3300025903 | Bacteria | 1431 |
| 231 | Ga0207647_10008504 | 3300025904 | Bacteria | 7354 |
| 232 | Ga0207647_10107942 | 3300025904 | Bacteria | 1647 |
| 233 | Ga0207645_10014079 | 3300025907 | Bacteria | 5360 |
| 234 | Ga0207643_10338636 | 3300025908 | Bacteria | 942 |
| 235 | Ga0207705_10184788 | 3300025909 | Bacteria | 1574 |
| 236 | Ga0207705_10247464 | 3300025909 | Bacteria | 1359 |
| 237 | Ga0207654_10035337 | 3300025911 | Bacteria | 2783 |
| 238 | Ga0207654_10118616 | 3300025911 | Bacteria | 1658 |
| 239 | Ga0207695_10000458 | 3300025913 | Bacteria | 88734 |
| 240 | Ga0207695_10265603 | 3300025913 | Bacteria | 1613 |
| 241 | Ga0207671_10000577 | 3300025914 | Bacteria | 49208 |
| 242 | Ga0207671_10016228 | 3300025914 | Bacteria | 5797 |
| 243 | Ga0207671_10373874 | 3300025914 | Bacteria | 1132 |
| 244 | Ga0207657_10009115 | 3300025919 | Bacteria | 10011 |
| 245 | Ga0207657_10011473 | 3300025919 | Bacteria | 8796 |
| 246 | Ga0207657_10012411 | 3300025919 | Bacteria | 8419 |
| 247 | Ga0207657_10020971 | 3300025919 | Bacteria | 6163 |
| 248 | Ga0207649_10008971 | 3300025920 | Bacteria | 5464 |
| 249 | Ga0207649_10011064 | 3300025920 | Bacteria | 4966 |
| 250 | Ga0207649_10308811 | 3300025920 | Bacteria | 1158 |
| 251 | Ga0207681_10092411 | 3300025923 | Bacteria | 2163 |
| 252 | Ga0207694_10014161 | 3300025924 | Bacteria | 6013 |
| 253 | Ga0207694_10033622 | 3300025924 | Bacteria | 3928 |
| 254 | Ga0207694_10256710 | 3300025924 | Bacteria | 1431 |
| 255 | Ga0207650_10318883 | 3300025925 | Bacteria | 1273 |
| 256 | Ga0207687_10269151 | 3300025927 | Bacteria | 1361 |
| 257 | Ga0207687_10364131 | 3300025927 | Bacteria | 1181 |
| 258 | Ga0207664_10028791 | 3300025929 | Bacteria | 4225 |
| 259 | Ga0207664_10398737 | 3300025929 | Bacteria | 1223 |
| 260 | Ga0207690_10331894 | 3300025932 | Bacteria | 1198 |
| 261 | Ga0207706_10511363 | 3300025933 | Bacteria | 1036 |
| 262 | Ga0207669_10004321 | 3300025937 | Bacteria | 6244 |
| 263 | Ga0207669_10025236 | 3300025937 | Bacteria | 3208 |
| 264 | Ga0207669_10048578 | 3300025937 | Bacteria | 2522 |
| 265 | Ga0207704_10232228 | 3300025938 | Bacteria | 1373 |
| 266 | Ga0207691_10048476 | 3300025940 | Bacteria | 3895 |
| 267 | Ga0207691_10466494 | 3300025940 | Bacteria | 1074 |
| 268 | Ga0207679_10428795 | 3300025945 | Bacteria | 1168 |
| 269 | Ga0207667_10004954 | 3300025949 | Bacteria | 16268 |
| 270 | Ga0207667_10102920 | 3300025949 | Bacteria | 2945 |
| 271 | Ga0207667_10201250 | 3300025949 | Bacteria | 2043 |
| 272 | Ga0207651_10194905 | 3300025960 | Bacteria | 1619 |
| 273 | Ga0207668_10009534 | 3300025972 | Bacteria | 5824 |
| 274 | Ga0207668_10719554 | 3300025972 | Bacteria | 879 |
| 275 | Ga0207640_10011282 | 3300025981 | Bacteria | 5055 |
| 276 | Ga0207640_10011939 | 3300025981 | Bacteria | 4933 |
| 277 | Ga0207677_10065799 | 3300026023 | Bacteria | 2531 |
| 278 | Ga0207639_10042470 | 3300026041 | Bacteria | 3408 |
| 279 | Ga0207639_10293587 | 3300026041 | Bacteria | 1434 |
| 280 | Ga0207639_10895807 | 3300026041 | Bacteria | 829 |
| 281 | Ga0207678_10012764 | 3300026067 | Bacteria | 7379 |
| 282 | Ga0207678_10018975 | 3300026067 | Bacteria | 6041 |
| 283 | Ga0207702_10132709 | 3300026078 | Bacteria | 2243 |
| 284 | Ga0207702_10150220 | 3300026078 | Bacteria | 2118 |
| 285 | Ga0207702_10373360 | 3300026078 | Bacteria | 1370 |
| 286 | Ga0207702_10417985 | 3300026078 | Bacteria | 1296 |
| 287 | Ga0207702_10571203 | 3300026078 | Bacteria | 1108 |
| 288 | Ga0207648_10096669 | 3300026089 | Bacteria | 2584 |
| 289 | Ga0207674_10004581 | 3300026116 | Bacteria | 16594 |
| 290 | Ga0207674_10095351 | 3300026116 | Bacteria | 2961 |
| 291 | Ga0207674_10159834 | 3300026116 | Bacteria | 2208 |
| 292 | Ga0207674_10176501 | 3300026116 | Bacteria | 2089 |
| 293 | Ga0207683_10046943 | 3300026121 | Bacteria | 3781 |
| 294 | Ga0207698_10055985 | 3300026142 | Bacteria | 3043 |
| 295 | Ga0207698_10073770 | 3300026142 | Bacteria | 2718 |
| 296 | Ga0207698_10082567 | 3300026142 | Bacteria | 2598 |
| 297 | Ga0207698_10247042 | 3300026142 | Bacteria | 1630 |
| 298 | Ga0207698_10381936 | 3300026142 | Bacteria | 1340 |
| 299 | Ga0268266_10003641 | 3300028379 | Bacteria | 15245 |
| 300 | Ga0268266_10083243 | 3300028379 | Bacteria | 2793 |
| 301 | Ga0268266_10236163 | 3300028379 | Bacteria | 1685 |
| 302 | Ga0268265_10005163 | 3300028380 | Bacteria | 8944 |
| 303 | Ga0268265_10028795 | 3300028380 | Bacteria | 3981 |
| 304 | Ga0265318_10002087 | 3300028577 | Bacteria | 10931 |
| 305 | Ga0307517_10225947 | 3300028786 | Bacteria | 1131 |
| 306 | Ga0307515_10299599 | 3300028794 | Bacteria | 1294 |
| 307 | Ga0307512_10009090 | 3300030522 | Bacteria | 9610 |
| 308 | Ga0316177_1021166 | 3300030731 | Bacteria | 3048 |
| 309 | Ga0316176_1184345 | 3300030732 | Bacteria | 1549 |
| 310 | Ga0316180_1172947 | 3300030736 | Bacteria | 3542 |
| 311 | Ga0265332_10039082 | 3300031238 | Bacteria | 2055 |
| 312 | Ga0307513_10007748 | 3300031456 | Bacteria | 13861 |
| 313 | Ga0307513_10204001 | 3300031456 | Bacteria | 1815 |
| 314 | Ga0307513_10275582 | 3300031456 | Bacteria | 1463 |
| 315 | Ga0307408_100079573 | 3300031548 | Bacteria | 2446 |
| 316 | Ga0265314_10034609 | 3300031711 | Bacteria | 3689 |
| 317 | Ga0265342_10252510 | 3300031712 | Bacteria | 941 |
| 318 | Ga0316576_10378557 | 3300031727 | Bacteria | 1051 |
| 319 | Ga0307516_10117405 | 3300031730 | Bacteria | 2455 |
| 320 | Ga0307413_10320543 | 3300031824 | Bacteria | 1184 |
| 321 | Ga0307407_10283933 | 3300031903 | Bacteria | 1148 |
| 322 | Ga0307412_10096675 | 3300031911 | Bacteria | 2079 |
| 323 | Ga0307414_10083504 | 3300032004 | Bacteria | 2346 |
| 324 | Ga0307414_10254581 | 3300032004 | Bacteria | 1461 |
| 325 | Ga0307414_10275573 | 3300032004 | Bacteria | 1411 |
| 326 | Ga0307411_10243830 | 3300032005 | Bacteria | 1409 |
| 327 | Ga0373939_0104884 | 3300035114 | Bacteria | 976 |
| 328 | Ga0373942_0047873 | 3300035207 | Bacteria | 1189 |
| 329 | Ga0316574_0124785 | 3300035398 | Unclassified | 1654 |
| 330 | Ga0373931_0013840 | 3300035691 | Bacteria | 3935 |
| 331 | Ga0373947_0300628 | 3300035725 | Bacteria | 1070 |
| 332 | Ga0316584_0390262 | 3300036712 | Bacteria | 993 |
| 333 | Ga0395899_0036782 | 3300037312 | Bacteria | 3670 |
| 334 | Ga0395905_0000791 | 3300037471 | Bacteria | 41576 |
| 335 | Ga0395905_0005397 | 3300037471 | Bacteria | 13065 |
| 336 | Ga0395905_0046646 | 3300037471 | Bacteria | 4063 |
| 337 | Ga0395905_0229782 | 3300037471 | Bacteria | 1735 |
| 338 | Ga0436364_0393289 | 3300037853 | Bacteria | 14105 |
| 339 | Ga0436364_0469241 | 3300037853 | Bacteria | 9261 |
| 340 | Ga0436364_0579643 | 3300037853 | Bacteria | 34127 |
| 341 | Ga0395901_0092105 | 3300038443 | Bacteria | 3173 |
| 342 | Ga0436365_0257230 | 3300039437 | Bacteria | 39667 |
| 343 | Ga0436360_0835435 | 3300039438 | Bacteria | 1712 |
| 344 | Ga0436363_1085806 | 3300039450 | Bacteria | 1694 |
| 345 | Ga0439465_0014043 | 3300041413 | Bacteria | 2494 |
| 346 | Ga0439465_0109519 | 3300041413 | Bacteria | 960 |
| 347 | Ga0451839_1234649 | 3300041496 | Bacteria | 957 |
| 348 | Ga0451845_0296105 | 3300041501 | Bacteria | 1446 |
| 349 | Ga0451847_0268177 | 3300041503 | Bacteria | 1132 |
| 350 | Ga0451849_1289643 | 3300041505 | Bacteria | 1320 |
| 351 | Ga0451851_0444680 | 3300041507 | Bacteria | 1033 |
| 352 | Ga0439448_0083916 | 3300042005 | Bacteria | 1072 |
| 353 | Ga0466972_0022762 | 3300044658 | Bacteria | 3119 |
| 354 | Ga0466971_0194570 | 3300044719 | Bacteria | 956 |
| 355 | Ga0466957_0137622 | 3300044842 | Bacteria | 1571 |
| 356 | Ga0466960_0117731 | 3300044901 | Bacteria | 1388 |
| 357 | Ga0495638_0062685 | 3300046460 | Bacteria | 2294 |
| 358 | Ga0495606_0112874 | 3300046507 | Bacteria | 1637 |
| 359 | Ga0495610_0004552 | 3300046512 | Bacteria | 10196 |
| 360 | Ga0495620_0141236 | 3300046515 | Bacteria | 942 |
| 361 | Ga0495632_0073066 | 3300046519 | Bacteria | 1645 |
| 362 | Ga0495668_0115828 | 3300046616 | Bacteria | 1466 |
| 363 | Ga0495625_0254448 | 3300046660 | Bacteria | 1139 |
| 364 | Ga0496106_0008218 | 3300048909 | Bacteria | 7715 |
| 365 | Ga0496106_0243119 | 3300048909 | Bacteria | 1438 |
| 366 | Ga0496109_0198173 | 3300048912 | Bacteria | 1888 |
| 367 | Ga0496116_0003206 | 3300048919 | Bacteria | 16345 |
| 368 | Ga0496116_0093227 | 3300048919 | Bacteria | 1824 |
| 369 | Ga0496116_0117283 | 3300048919 | Bacteria | 1549 |
| 370 | Ga0496117_0010959 | 3300048920 | Bacteria | 8171 |
| 371 | Ga0496117_0059067 | 3300048920 | Bacteria | 2652 |
| 372 | Ga0496118_0024130 | 3300048921 | Bacteria | 5259 |
| 373 | Ga0496118_0090434 | 3300048921 | Bacteria | 2109 |
| 374 | Ga0496118_0139409 | 3300048921 | Bacteria | 1541 |
| 375 | Ga0496119_0000750 | 3300048922 | Bacteria | 43609 |
| 376 | Ga0496119_0042991 | 3300048922 | Bacteria | 2860 |
| 377 | Ga0496121_0003823 | 3300048924 | Bacteria | 20961 |
| 378 | Ga0496121_0009961 | 3300048924 | Bacteria | 10816 |
| 379 | Ga0496121_0150370 | 3300048924 | Bacteria | 1714 |
| 380 | Ga0496121_0407874 | 3300048924 | Bacteria | 888 |
| 381 | Ga0496122_0033522 | 3300048925 | Bacteria | 4222 |
| 382 | Ga0496122_0081372 | 3300048925 | Bacteria | 2254 |
| 383 | Ga0496123_0002938 | 3300048926 | Bacteria | 19929 |
| 384 | Ga0496123_0020166 | 3300048926 | Bacteria | 5224 |
| 385 | Ga0496123_0030754 | 3300048926 | Bacteria | 3923 |
| 386 | Ga0496124_0001914 | 3300048927 | Bacteria | 28559 |
| 387 | Ga0496124_0030119 | 3300048927 | Bacteria | 4822 |
| 388 | Ga0496124_0140144 | 3300048927 | Bacteria | 1909 |
| 389 | Ga0496124_0204706 | 3300048927 | Bacteria | 1498 |
| 390 | Ga0496125_0125650 | 3300048928 | Bacteria | 1818 |
| 391 | Ga0496126_0008697 | 3300048929 | Bacteria | 10902 |
| 392 | Ga0496126_0017755 | 3300048929 | Bacteria | 7082 |
| 393 | Ga0496126_0097560 | 3300048929 | Bacteria | 2575 |
| 394 | Ga0496126_0100364 | 3300048929 | Bacteria | 2533 |
| 395 | Ga0495678_050663 | 3300049459 | Bacteria | 1608 |
| 396 | Ga0501031_0001559 | 3300049568 | Bacteria | 14268 |
| 397 | Ga0501031_0089125 | 3300049568 | Bacteria | 2011 |
| 398 | Ga0501032_0001034 | 3300049569 | Bacteria | 22327 |
| 399 | Ga0501033_0003222 | 3300049570 | Bacteria | 13496 |
| 400 | Ga0501033_0137820 | 3300049570 | Bacteria | 1765 |
| 401 | Ga0501034_0000222 | 3300049571 | Bacteria | 108857 |
| 402 | Ga0501034_0002860 | 3300049571 | Bacteria | 20110 |
| 403 | Ga0501034_0009509 | 3300049571 | Bacteria | 10176 |
| 404 | Ga0501034_0012347 | 3300049571 | Bacteria | 8826 |
| 405 | Ga0501034_0073930 | 3300049571 | Bacteria | 3417 |
| 406 | Ga0501034_0141388 | 3300049571 | Bacteria | 2386 |
| 407 | Ga0501034_0152259 | 3300049571 | Bacteria | 2288 |
| 408 | Ga0501034_0266055 | 3300049571 | Bacteria | 1656 |
| 409 | Ga0501036_0066386 | 3300049572 | Bacteria | 3052 |
| 410 | Ga0501036_0277558 | 3300049572 | Bacteria | 1402 |
| 411 | Ga0501037_0000514 | 3300049573 | Bacteria | 31087 |
| 412 | Ga0501038_0015873 | 3300049574 | Bacteria | 6842 |
| 413 | Ga0501038_0038552 | 3300049574 | Bacteria | 4184 |
| 414 | Ga0501038_0069097 | 3300049574 | Bacteria | 3001 |
| 415 | Ga0501039_0000432 | 3300049575 | Bacteria | 30229 |
| 416 | Ga0501039_0012347 | 3300049575 | Bacteria | 6517 |
| 417 | Ga0501043_0035006 | 3300049579 | Bacteria | 3949 |
| 418 | Ga0501046_0001262 | 3300049580 | Bacteria | 24516 |
| 419 | Ga0501047_0006274 | 3300049581 | Bacteria | 11175 |
| 420 | Ga0501047_0030949 | 3300049581 | Bacteria | 5159 |
| 421 | Ga0501048_0003846 | 3300049582 | Bacteria | 11447 |
| 422 | Ga0501067_0011888 | 3300049583 | Bacteria | 4825 |
| 423 | Ga0501067_0019049 | 3300049583 | Bacteria | 3798 |
| 424 | Ga0501068_0016396 | 3300049584 | Bacteria | 4271 |
| 425 | Ga0501068_0099705 | 3300049584 | Bacteria | 1799 |
| 426 | Ga0501068_0162193 | 3300049584 | Bacteria | 1409 |
| 427 | Ga0501069_0001119 | 3300049585 | Bacteria | 12944 |
| 428 | Ga0501070_0006527 | 3300049586 | Bacteria | 9924 |
| 429 | Ga0501070_0017904 | 3300049586 | Bacteria | 5948 |
| 430 | Ga0501071_0366574 | 3300049587 | Bacteria | 1097 |
| 431 | Ga0501072_0039944 | 3300049588 | Bacteria | 3684 |
| 432 | Ga0501073_0000534 | 3300049589 | Bacteria | 26731 |
| 433 | Ga0501073_0028100 | 3300049589 | Bacteria | 4018 |
| 434 | Ga0501073_0091242 | 3300049589 | Bacteria | 2117 |
| 435 | Ga0501074_0035429 | 3300049590 | Bacteria | 3616 |
| 436 | Ga0501074_0219144 | 3300049590 | Bacteria | 1355 |
| 437 | Ga0501080_0003677 | 3300049742 | Bacteria | 13522 |
| 438 | Ga0501080_0010159 | 3300049742 | Bacteria | 8608 |
| 439 | Ga0501083_0018962 | 3300049744 | Bacteria | 4789 |
| 440 | Ga0501083_0041672 | 3300049744 | Bacteria | 3113 |
| 441 | Ga0501035_0030566 | 3300049822 | Bacteria | 4908 |
| 442 | Ga0501035_0096494 | 3300049822 | Bacteria | 2597 |
| 443 | Ga0501044_0004665 | 3300049823 | Bacteria | 15333 |
| 444 | Ga0501044_0011230 | 3300049823 | Bacteria | 9709 |
| 445 | Ga0501044_0552394 | 3300049823 | Bacteria | 1048 |
| 446 | Ga0501045_0363619 | 3300049824 | Bacteria | 1077 |
| 447 | nmdc:mga0yw44_457015_c1 | 3300050492 | Bacteria | 865 |
| 448 | nmdc:mga0k408_124785_c1 | 3300050493 | Bacteria | 1526 |
| 449 | nmdc:mga06z11_31466_c1 | 3300050494 | Bacteria | 2578 |
| 450 | nmdc:mga06z11_69250_c1 | 3300050494 | Bacteria | 1862 |
| 451 | nmdc:mga07m45_15904_c2 | 3300050496 | Bacteria | 3356 |
| 452 | nmdc:mga05p37_347060_c1 | 3300050507 | Bacteria | 1748 |
| 453 | nmdc:mga05p37_357443_c1 | 3300050507 | Bacteria | 1718 |
| 454 | nmdc:mga05p37_503593_c1 | 3300050507 | Bacteria | 1389 |
| 455 | Ga0500651_0068385 | 3300053093 | Bacteria | 2212 |
| 456 | Ga0500572_002091 | 3300053111 | Bacteria | 4954 |
| 457 | Ga0500642_0001239 | 3300053130 | Bacteria | 7296 |
| 458 | Ga0500658_0001646 | 3300053134 | Bacteria | 8888 |
| 459 | Ga0500568_0000361 | 3300053139 | Bacteria | 35246 |
| 460 | Ga0500568_0035779 | 3300053139 | Bacteria | 2024 |
| 461 | Ga0500604_0008235 | 3300053151 | Bacteria | 2763 |
| 462 | Ga0500604_0043014 | 3300053151 | Bacteria | 1371 |
| 463 | Ga0500616_0000686 | 3300053153 | Bacteria | 39652 |
| 464 | Ga0500620_002500 | 3300053155 | Bacteria | 3722 |
| 465 | Ga0500624_022879 | 3300053157 | Bacteria | 1020 |
| 466 | Ga0501084_0000193 | 3300054114 | Bacteria | 47522 |
| 467 | Ga0501084_0015147 | 3300054114 | Bacteria | 6394 |
| 468 | Ga0501082_0003570 | 3300060353 | Bacteria | 13580 |
| 469 | Ga0466962_0094782 | 3300061719 | Bacteria | 1431 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044901 | Ga0466960_0117731 | Ga0466960_0117731_361_1065 | 226 |
| 2 | 3300053155 | Ga0500620_002500 | Ga0500620_002500_257_1000 | 229 |
| 3 | 3300037471 | Ga0395905_0046646 | Ga0395905_0046646_1147_1899 | 230 |
| 4 | 3300031730 | Ga0307516_10117405 | Ga0307516_101174053 | 231 |
| 5 | 3300002705 | JGI25156J39149_1002223 | JGI25156J39149_10022235 | 232 |
| 6 | 3300002741 | JGI25157J39369_1000599 | JGI25157J39369_100059914 | 232 |
| 7 | 3300006038 | Ga0075365_10186122 | Ga0075365_101861222 | 232 |
| 8 | 3300025250 | Ga0209026_1000029 | Ga0209026_1000029285 | 232 |
| 9 | 3300025256 | Ga0209759_1000040 | Ga0209759_1000040140 | 232 |
| 10 | 3300032005 | Ga0307411_10243830 | Ga0307411_102438301 | 234 |
| 11 | 3300005339 | Ga0070660_100180793 | Ga0070660_1001807932 | 235 |
| 12 | 3300006038 | Ga0075365_10020389 | Ga0075365_100203892 | 235 |
| 13 | 3300006051 | Ga0075364_10443482 | Ga0075364_104434821 | 235 |
| 14 | 3300009979 | Ga0105032_103260 | Ga0105032_1032602 | 235 |
| 15 | 3300025919 | Ga0207657_10020971 | Ga0207657_100209715 | 235 |
| 16 | 3300026142 | Ga0207698_10073770 | Ga0207698_100737702 | 235 |
| 17 | 3300037471 | Ga0395905_0005397 | Ga0395905_0005397_11069_11812 | 235 |
| 18 | 3300046460 | Ga0495638_0062685 | Ga0495638_0062685_214_963 | 235 |
| 19 | 3300050494 | nmdc:mga06z11_31466_c1 | nmdc:mga06z11_31466_c1_1502_2251 | 235 |
| 20 | 3300005353 | Ga0070669_100217606 | Ga0070669_1002176062 | 236 |
| 21 | 3300044658 | Ga0466972_0022762 | Ga0466972_0022762_2024_2758 | 237 |
| 22 | 3300048922 | Ga0496119_0000750 | Ga0496119_0000750_7567_8307 | 238 |
| 23 | 3300014968 | Ga0157379_10729142 | Ga0157379_107291422 | 239 |
| 24 | 3300044842 | Ga0466957_0137622 | Ga0466957_0137622_419_1159 | 239 |
| 25 | 3300053134 | Ga0500658_0001646 | Ga0500658_0001646_182_922 | 239 |
| 26 | iso_pu_bacteria | 2508501114 | 2509079424 | 239 |
| 27 | 3300009174 | Ga0105241_10087477 | Ga0105241_100874772 | 240 |
| 28 | 3300009545 | Ga0105237_10167494 | Ga0105237_101674942 | 240 |
| 29 | 3300009551 | Ga0105238_10013090 | Ga0105238_100130902 | 240 |
| 30 | 3300010375 | Ga0105239_10013586 | Ga0105239_100135863 | 240 |
| 31 | 3300013104 | Ga0157370_10658944 | Ga0157370_106589441 | 240 |
| 32 | 3300031548 | Ga0307408_100079573 | Ga0307408_1000795734 | 240 |
| 33 | iso_pu_bacteria | 2510065019 | 2510131579 | 240 |
| 34 | iso_pu_bacteria | 2513237305 | 2514423374 | 240 |
| 35 | iso_pu_bacteria | 2693429783 | 2694629063 | 240 |
| 36 | iso_pu_bacteria | 2693429784 | 2694637022 | 240 |
| 37 | iso_pu_bacteria | 2721755686 | 2723575031 | 240 |
| 38 | iso_pu_bacteria | 2738541293 | 2738802859 | 240 |
| 39 | iso_pu_bacteria | 2856349417 | 2856353204 | 240 |
| 40 | iso_pu_bacteria | 2856356410 | 2856356695 | 240 |
| 41 | iso_pu_bacteria | 2856364286 | 2856367107 | 240 |
| 42 | iso_pu_bacteria | 2857349434 | 2857354562 | 240 |
| 43 | iso_pu_bacteria | 2869285874 | 2869287357 | 240 |
| 44 | iso_pu_bacteria | 2871429161 | 2871430448 | 240 |
| 45 | iso_pu_bacteria | 2871488783 | 2871492394 | 240 |
| 46 | iso_pu_bacteria | 2871495908 | 2871501927 | 240 |
| 47 | iso_pu_bacteria | 2874146452 | 2874148936 | 240 |
| 48 | iso_pu_bacteria | 2874155637 | 2874155940 | 240 |
| 49 | iso_pu_bacteria | 2876369609 | 2876372923 | 240 |
| 50 | iso_pu_bacteria | 2876377896 | 2876381763 | 240 |
| 51 | iso_pu_bacteria | 2876392853 | 2876397883 | 240 |
| 52 | iso_pu_bacteria | 2876413966 | 2876415507 | 240 |
| 53 | iso_pu_bacteria | 2878745973 | 2878746881 | 240 |
| 54 | iso_pu_bacteria | 2878753008 | 2878758275 | 240 |
| 55 | iso_pu_bacteria | 2878760144 | 2878765836 | 240 |
| 56 | iso_pu_bacteria | 2878767105 | 2878772510 | 240 |
| 57 | iso_pu_bacteria | 2881155292 | 2881158089 | 240 |
| 58 | iso_pu_bacteria | 2881161766 | 2881166644 | 240 |
| 59 | iso_pu_bacteria | 2881845957 | 2881847663 | 240 |
| 60 | iso_pu_bacteria | 2881861095 | 2881864427 | 240 |
| 61 | iso_pu_bacteria | 2882912400 | 2882914840 | 240 |
| 62 | iso_pu_bacteria | 2885318864 | 2885320952 | 240 |
| 63 | iso_pu_bacteria | 2885342637 | 2885347300 | 240 |
| 64 | iso_pu_bacteria | 2885350715 | 2885353406 | 240 |
| 65 | iso_pu_bacteria | 2888350351 | 2888351297 | 240 |
| 66 | iso_pu_bacteria | 2889010040 | 2889013683 | 240 |
| 67 | iso_pu_bacteria | 2889016732 | 2889021600 | 240 |
| 68 | iso_pu_bacteria | 2903492973 | 2903496875 | 240 |
| 69 | iso_pu_bacteria | 2903492973 | 2903503323 | 240 |
| 70 | iso_pu_bacteria | 2903540706 | 2903546782 | 240 |
| 71 | iso_pu_bacteria | 2904659560 | 2904664534 | 240 |
| 72 | iso_pu_bacteria | 2906308376 | 2906309899 | 240 |
| 73 | iso_pu_bacteria | 2906321335 | 2906322329 | 240 |
| 74 | iso_pu_bacteria | 2906354277 | 2906357308 | 240 |
| 75 | iso_pu_bacteria | 2922130491 | 2922133428 | 240 |
| 76 | iso_pu_bacteria | 2922185730 | 2922190769 | 240 |
| 77 | iso_pu_bacteria | 2924762789 | 2924769021 | 240 |
| 78 | iso_pu_bacteria | 2924784321 | 2924784371 | 240 |
| 79 | iso_pu_bacteria | 2937813078 | 2937815096 | 240 |
| 80 | iso_pu_bacteria | 2937994558 | 2938000641 | 240 |
| 81 | iso_pu_bacteria | 2938014810 | 2938017458 | 240 |
| 82 | iso_pu_bacteria | 2958041894 | 2958042783 | 240 |
| 83 | iso_pu_bacteria | 2958100919 | 2958105591 | 240 |
| 84 | iso_pu_bacteria | 2958130278 | 2958131642 | 240 |
| 85 | iso_pu_bacteria | 2958165035 | 2958171012 | 240 |
| 86 | iso_pu_bacteria | 2958172287 | 2958177358 | 240 |
| 87 | iso_pu_bacteria | 2958179912 | 2958180714 | 240 |
| 88 | iso_pu_bacteria | 2961077736 | 2961078551 | 240 |
| 89 | iso_pu_bacteria | 2961114664 | 2961119533 | 240 |
| 90 | iso_pu_bacteria | 2961127735 | 2961132729 | 240 |
| 91 | iso_pu_bacteria | 2961163497 | 2961169456 | 240 |
| 92 | iso_pu_bacteria | 2961170736 | 2961173533 | 240 |
| 93 | iso_pu_bacteria | 2965018300 | 2965023708 | 240 |
| 94 | iso_pu_bacteria | 2965119406 | 2965125188 | 240 |
| 95 | iso_pu_bacteria | 2968003550 | 2968005872 | 240 |
| 96 | iso_pu_bacteria | 2968110612 | 2968115788 | 240 |
| 97 | iso_pu_bacteria | 2968117919 | 2968118866 | 240 |
| 98 | iso_pu_bacteria | 2968171901 | 2968177846 | 240 |
| 99 | iso_pu_bacteria | 2970503327 | 2970506125 | 240 |
| 100 | iso_pu_bacteria | 2970554993 | 2970560692 | 240 |
| 101 | iso_pu_bacteria | 2977821940 | 2977826807 | 240 |
| 102 | iso_pu_bacteria | 2977828996 | 2977835892 | 240 |
| 103 | iso_pu_bacteria | 2977843712 | 2977845759 | 240 |
| 104 | iso_pu_bacteria | 2977942078 | 2977946342 | 240 |
| 105 | iso_pu_bacteria | 2977971508 | 2977971895 | 240 |
| 106 | iso_pu_bacteria | 2979710463 | 2979716242 | 240 |
| 107 | iso_pu_bacteria | 2979742915 | 2979746924 | 240 |
| 108 | iso_pu_bacteria | 2979808191 | 2979810847 | 240 |
| 109 | iso_pu_bacteria | 2987636660 | 2987643164 | 240 |
| 110 | iso_pu_bacteria | 2987652177 | 2987658678 | 240 |
| 111 | iso_pu_bacteria | 2987659509 | 2987665566 | 240 |
| 112 | iso_pu_bacteria | 2987666974 | 2987672875 | 240 |
| 113 | iso_pu_bacteria | 3004188549 | 3004194644 | 240 |
| 114 | iso_pu_bacteria | 3004203850 | 3004206712 | 240 |
| 115 | iso_pu_bacteria | 8004374579 | 8004379789 | 240 |
| 116 | iso_pu_bacteria | 8004387939 | 8004389338 | 240 |
| 117 | iso_pu_bacteria | 8004640170 | 8004645013 | 240 |
| 118 | iso_pu_bacteria | 8004714634 | 8004716045 | 240 |
| 119 | 3300005577 | Ga0068857_100166175 | Ga0068857_1001661752 | 241 |
| 120 | 3300026116 | Ga0207674_10176501 | Ga0207674_101765012 | 241 |
| 121 | iso_pu_bacteria | 2718217997 | 2719667965 | 241 |
| 122 | iso_pu_bacteria | 2718218199 | 2720494728 | 241 |
| 123 | iso_pu_bacteria | 2842264693 | 2842267927 | 241 |
| 124 | iso_pu_bacteria | 2842311132 | 2842311869 | 241 |
| 125 | iso_pu_bacteria | 2842428310 | 2842432090 | 241 |
| 126 | iso_pu_bacteria | 2842434925 | 2842438202 | 241 |
| 127 | iso_pu_bacteria | 2842441272 | 2842443898 | 241 |
| 128 | iso_pu_bacteria | 2842447887 | 2842449840 | 241 |
| 129 | iso_pu_bacteria | 2842462802 | 2842466188 | 241 |
| 130 | iso_pu_bacteria | 2842469257 | 2842472828 | 241 |
| 131 | iso_pu_bacteria | 8005497431 | 8005502986 | 241 |
| 132 | iso_pu_bacteria | 8005668836 | 8005674904 | 241 |
| 133 | 3300002773 | JGI25152J39213_1004650 | JGI25152J39213_10046504 | 242 |
| 134 | 3300003187 | JGI25151J46595_10004550 | JGI25151J46595_100045504 | 242 |
| 135 | 3300005262 | Ga0065165_1007074 | Ga0065165_10070742 | 242 |
| 136 | 3300025258 | Ga0209129_1000016 | Ga0209129_1000016118 | 242 |
| 137 | 3300025284 | Ga0209130_1005302 | Ga0209130_10053023 | 242 |
| 138 | 3300025294 | Ga0209025_1000338 | Ga0209025_100033869 | 242 |
| 139 | iso_pu_bacteria | 2503198000 | 2503200613 | 242 |
| 140 | iso_pu_bacteria | 2508501123 | 2509118057 | 242 |
| 141 | iso_pu_bacteria | 2508501127 | 2509139777 | 242 |
| 142 | iso_pu_bacteria | 2509276021 | 2509389503 | 242 |
| 143 | iso_pu_bacteria | 2509276022 | 2509398449 | 242 |
| 144 | iso_pu_bacteria | 2509276033 | 2509446085 | 242 |
| 145 | iso_pu_bacteria | 2510461076 | 2510892217 | 242 |
| 146 | iso_pu_bacteria | 2512875016 | 2512932049 | 242 |
| 147 | iso_pu_bacteria | 2513237084 | 2513567371 | 242 |
| 148 | iso_pu_bacteria | 2513237085 | 2513579480 | 242 |
| 149 | iso_pu_bacteria | 2513237088 | 2513597063 | 242 |
| 150 | iso_pu_bacteria | 2513237090 | 2513611487 | 242 |
| 151 | iso_pu_bacteria | 2513237093 | 2513632155 | 242 |
| 152 | iso_pu_bacteria | 2513237103 | 2513712370 | 242 |
| 153 | iso_pu_bacteria | 2513237138 | 2513868674 | 242 |
| 154 | iso_pu_bacteria | 2513237144 | 2513909272 | 242 |
| 155 | iso_pu_bacteria | 2513237146 | 2513924751 | 242 |
| 156 | iso_pu_bacteria | 2513237162 | 2514023306 | 242 |
| 157 | iso_pu_bacteria | 2513237164 | 2514039254 | 242 |
| 158 | iso_pu_bacteria | 2515075009 | 2515113692 | 242 |
| 159 | iso_pu_bacteria | 2515154113 | 2515632142 | 242 |
| 160 | iso_pu_bacteria | 2515154114 | 2515644556 | 242 |
| 161 | iso_pu_bacteria | 2515154116 | 2515660003 | 242 |
| 162 | iso_pu_bacteria | 2515154134 | 2515738488 | 242 |
| 163 | iso_pu_bacteria | 2516653077 | 2517037308 | 242 |
| 164 | iso_pu_bacteria | 2516653085 | 2517080526 | 242 |
| 165 | iso_pu_bacteria | 2517093000 | 2517097873 | 242 |
| 166 | iso_pu_bacteria | 2517287029 | 2517409989 | 242 |
| 167 | iso_pu_bacteria | 2534681796 | 2535517502 | 242 |
| 168 | iso_pu_bacteria | 2582581308 | 2585277758 | 242 |
| 169 | iso_pu_bacteria | 2585427526 | 2585526849 | 242 |
| 170 | iso_pu_bacteria | 2585427527 | 2585533375 | 242 |
| 171 | iso_pu_bacteria | 2585427528 | 2585542391 | 242 |
| 172 | iso_pu_bacteria | 2585427530 | 2585557880 | 242 |
| 173 | iso_pu_bacteria | 2585427593 | 2585841863 | 242 |
| 174 | iso_pu_bacteria | 2585427633 | 2585996988 | 242 |
| 175 | iso_pu_bacteria | 2585427634 | 2586001577 | 242 |
| 176 | iso_pu_bacteria | 2588253730 | 2588517950 | 242 |
| 177 | iso_pu_bacteria | 2597489875 | 2597815921 | 242 |
| 178 | iso_pu_bacteria | 2599185170 | 2599416311 | 242 |
| 179 | iso_pu_bacteria | 2599185301 | 2599936922 | 242 |
| 180 | iso_pu_bacteria | 2615840624 | 2616295130 | 242 |
| 181 | iso_pu_bacteria | 2615840626 | 2616310565 | 242 |
| 182 | iso_pu_bacteria | 2643221580 | 2643911101 | 242 |
| 183 | iso_pu_bacteria | 2643221580 | 2643912164 | 242 |
| 184 | iso_pu_bacteria | 2643221591 | 2643966869 | 242 |
| 185 | iso_pu_bacteria | 2643221595 | 2643986503 | 242 |
| 186 | iso_pu_bacteria | 2643221627 | 2644152734 | 242 |
| 187 | iso_pu_bacteria | 2643221643 | 2644239084 | 242 |
| 188 | iso_pu_bacteria | 2643221674 | 2644413195 | 242 |
| 189 | iso_pu_bacteria | 2718217882 | 2719183614 | 242 |
| 190 | iso_pu_bacteria | 2718218009 | 2719728055 | 242 |
| 191 | iso_pu_bacteria | 2718218363 | 2721144916 | 242 |
| 192 | iso_pu_bacteria | 2718218365 | 2721155655 | 242 |
| 193 | iso_pu_bacteria | 2718218366 | 2721167003 | 242 |
| 194 | iso_pu_bacteria | 2721755514 | 2722837981 | 242 |
| 195 | iso_pu_bacteria | 2721755810 | 2724042249 | 242 |
| 196 | iso_pu_bacteria | 2724679232 | 2725949359 | 242 |
| 197 | iso_pu_bacteria | 2728369365 | 2730161754 | 242 |
| 198 | iso_pu_bacteria | 2728369397 | 2730300762 | 242 |
| 199 | iso_pu_bacteria | 2738541333 | 2739038475 | 242 |
| 200 | iso_pu_bacteria | 2756170246 | 2756676848 | 242 |
| 201 | iso_pu_bacteria | 2765235942 | 2766066962 | 242 |
| 202 | iso_pu_bacteria | 2775506901 | 2776265017 | 242 |
| 203 | iso_pu_bacteria | 2791355123 | 2792749628 | 242 |
| 204 | iso_pu_bacteria | 2791355259 | 2793313485 | 242 |
| 205 | iso_pu_bacteria | 2791355260 | 2793321614 | 242 |
| 206 | iso_pu_bacteria | 2791355264 | 2793346093 | 242 |
| 207 | iso_pu_bacteria | 2791355265 | 2793353955 | 242 |
| 208 | iso_pu_bacteria | 2791355267 | 2793365810 | 242 |
| 209 | iso_pu_bacteria | 2802429605 | 2805927182 | 242 |
| 210 | iso_pu_bacteria | 2802429606 | 2805934393 | 242 |
| 211 | iso_pu_bacteria | 2802429633 | 2806048819 | 242 |
| 212 | iso_pu_bacteria | 2802429634 | 2806056021 | 242 |
| 213 | iso_pu_bacteria | 2802429635 | 2806062832 | 242 |
| 214 | iso_pu_bacteria | 2802429636 | 2806070272 | 242 |
| 215 | iso_pu_bacteria | 2802429637 | 2806077258 | 242 |
| 216 | iso_pu_bacteria | 2818991453 | 2819643132 | 242 |
| 217 | iso_pu_bacteria | 2838035591 | 2838036429 | 242 |
| 218 | iso_pu_bacteria | 2838661181 | 2838668637 | 242 |
| 219 | iso_pu_bacteria | 2838668709 | 2838669513 | 242 |
| 220 | iso_pu_bacteria | 2838686498 | 2838690463 | 242 |
| 221 | iso_pu_bacteria | 2838701080 | 2838701885 | 242 |
| 222 | iso_pu_bacteria | 2838729681 | 2838733180 | 242 |
| 223 | iso_pu_bacteria | 2838742623 | 2838747231 | 242 |
| 224 | iso_pu_bacteria | 2841734538 | 2841734938 | 242 |
| 225 | iso_pu_bacteria | 2841851746 | 2841855384 | 242 |
| 226 | iso_pu_bacteria | 2841864319 | 2841867853 | 242 |
| 227 | iso_pu_bacteria | 2842110456 | 2842111551 | 242 |
| 228 | iso_pu_bacteria | 2842156927 | 2842160909 | 242 |
| 229 | iso_pu_bacteria | 2842163707 | 2842164438 | 242 |
| 230 | iso_pu_bacteria | 2842180545 | 2842184525 | 242 |
| 231 | iso_pu_bacteria | 2842192696 | 2842196158 | 242 |
| 232 | iso_pu_bacteria | 2842205361 | 2842207324 | 242 |
| 233 | iso_pu_bacteria | 2842217011 | 2842218521 | 242 |
| 234 | iso_pu_bacteria | 2842229732 | 2842232108 | 242 |
| 235 | iso_pu_bacteria | 2842243621 | 2842248490 | 242 |
| 236 | iso_pu_bacteria | 2842250916 | 2842251692 | 242 |
| 237 | iso_pu_bacteria | 2842257432 | 2842262702 | 242 |
| 238 | iso_pu_bacteria | 2842271015 | 2842275223 | 242 |
| 239 | iso_pu_bacteria | 2842278818 | 2842280965 | 242 |
| 240 | iso_pu_bacteria | 2842285085 | 2842288419 | 242 |
| 241 | iso_pu_bacteria | 2842304105 | 2842307341 | 242 |
| 242 | iso_pu_bacteria | 2842317721 | 2842323323 | 242 |
| 243 | iso_pu_bacteria | 2842341865 | 2842346676 | 242 |
| 244 | iso_pu_bacteria | 2842402390 | 2842406235 | 242 |
| 245 | iso_pu_bacteria | 2842409023 | 2842412820 | 242 |
| 246 | iso_pu_bacteria | 2842415677 | 2842419301 | 242 |
| 247 | iso_pu_bacteria | 2842489311 | 2842489668 | 242 |
| 248 | iso_pu_bacteria | 2842495871 | 2842500499 | 242 |
| 249 | iso_pu_bacteria | 2844002411 | 2844006594 | 242 |
| 250 | iso_pu_bacteria | 2844454524 | 2844460119 | 242 |
| 251 | iso_pu_bacteria | 2854916844 | 2854917320 | 242 |
| 252 | iso_pu_bacteria | 2856320880 | 2856326191 | 242 |
| 253 | iso_pu_bacteria | 2856342000 | 2856344125 | 242 |
| 254 | iso_pu_bacteria | 2857516855 | 2857518359 | 242 |
| 255 | iso_pu_bacteria | 2869162929 | 2869164682 | 242 |
| 256 | iso_pu_bacteria | 2869278585 | 2869284188 | 242 |
| 257 | iso_pu_bacteria | 2871466892 | 2871467041 | 242 |
| 258 | iso_pu_bacteria | 2871474448 | 2871476685 | 242 |
| 259 | iso_pu_bacteria | 2874123672 | 2874124542 | 242 |
| 260 | iso_pu_bacteria | 2874139085 | 2874144813 | 242 |
| 261 | iso_pu_bacteria | 2874168670 | 2874169120 | 242 |
| 262 | iso_pu_bacteria | 2876363079 | 2876365749 | 242 |
| 263 | iso_pu_bacteria | 2878738818 | 2878743818 | 242 |
| 264 | iso_pu_bacteria | 2878788777 | 2878790834 | 242 |
| 265 | iso_pu_bacteria | 2881147464 | 2881150092 | 242 |
| 266 | iso_pu_bacteria | 2882632389 | 2882639034 | 242 |
| 267 | iso_pu_bacteria | 2885305155 | 2885308938 | 242 |
| 268 | iso_pu_bacteria | 2885312484 | 2885318677 | 242 |
| 269 | iso_pu_bacteria | 2885326080 | 2885326835 | 242 |
| 270 | iso_pu_bacteria | 2885334103 | 2885337595 | 242 |
| 271 | iso_pu_bacteria | 2888337043 | 2888342221 | 242 |
| 272 | iso_pu_bacteria | 2888343758 | 2888348965 | 242 |
| 273 | iso_pu_bacteria | 2903448605 | 2903450736 | 242 |
| 274 | iso_pu_bacteria | 2903521522 | 2903521561 | 242 |
| 275 | iso_pu_bacteria | 2903528002 | 2903529892 | 242 |
| 276 | iso_pu_bacteria | 2906378014 | 2906379080 | 242 |
| 277 | iso_pu_bacteria | 2919100787 | 2919102404 | 242 |
| 278 | iso_pu_bacteria | 2923556063 | 2923561203 | 242 |
| 279 | iso_pu_bacteria | 2924718760 | 2924726097 | 242 |
| 280 | iso_pu_bacteria | 2924754689 | 2924761494 | 242 |
| 281 | iso_pu_bacteria | 2924776078 | 2924781735 | 242 |
| 282 | iso_pu_bacteria | 2933570622 | 2933574003 | 242 |
| 283 | iso_pu_bacteria | 2933586486 | 2933588105 | 242 |
| 284 | iso_pu_bacteria | 2935901341 | 2935906101 | 242 |
| 285 | iso_pu_bacteria | 2936367885 | 2936369476 | 242 |
| 286 | iso_pu_bacteria | 2936375103 | 2936380168 | 242 |
| 287 | iso_pu_bacteria | 2937822353 | 2937824250 | 242 |
| 288 | iso_pu_bacteria | 2937836603 | 2937838545 | 242 |
| 289 | iso_pu_bacteria | 2937848649 | 2937848690 | 242 |
| 290 | iso_pu_bacteria | 2937877337 | 2937878919 | 242 |
| 291 | iso_pu_bacteria | 2937972304 | 2937978210 | 242 |
| 292 | iso_pu_bacteria | 2958034702 | 2958040577 | 242 |
| 293 | iso_pu_bacteria | 2958041894 | 2958055425 | 242 |
| 294 | iso_pu_bacteria | 2958064165 | 2958065063 | 242 |
| 295 | iso_pu_bacteria | 2958071322 | 2958074627 | 242 |
| 296 | iso_pu_bacteria | 2958084443 | 2958087379 | 242 |
| 297 | iso_pu_bacteria | 2958092219 | 2958098931 | 242 |
| 298 | iso_pu_bacteria | 2958144490 | 2958144794 | 242 |
| 299 | iso_pu_bacteria | 2963644680 | 2963647156 | 242 |
| 300 | iso_pu_bacteria | 2968016561 | 2968021796 | 242 |
| 301 | iso_pu_bacteria | 2968083720 | 2968088009 | 242 |
| 302 | iso_pu_bacteria | 2970469710 | 2970474386 | 242 |
| 303 | iso_pu_bacteria | 2970524798 | 2970530287 | 242 |
| 304 | iso_pu_bacteria | 2970540015 | 2970545837 | 242 |
| 305 | iso_pu_bacteria | 2970593180 | 2970598800 | 242 |
| 306 | iso_pu_bacteria | 2977864932 | 2977871502 | 242 |
| 307 | iso_pu_bacteria | 2977922695 | 2977928272 | 242 |
| 308 | iso_pu_bacteria | 2977986579 | 2977990258 | 242 |
| 309 | iso_pu_bacteria | 2996348954 | 2996353798 | 242 |
| 310 | iso_pu_bacteria | 3000135777 | 3000136611 | 242 |
| 311 | iso_pu_bacteria | 3004211236 | 3004215724 | 242 |
| 312 | iso_pu_bacteria | 3004218560 | 3004224501 | 242 |
| 313 | iso_pu_bacteria | 3004275668 | 3004280466 | 242 |
| 314 | iso_pu_bacteria | 3005409236 | 3005414139 | 242 |
| 315 | iso_pu_bacteria | 3005445848 | 3005451175 | 242 |
| 316 | iso_pu_bacteria | 637000159 | 637075145 | 242 |
| 317 | iso_pu_bacteria | 639633055 | 639649731 | 242 |
| 318 | iso_pu_bacteria | 8004395343 | 8004398267 | 242 |
| 319 | iso_pu_bacteria | 8004633249 | 8004634596 | 242 |
| 320 | iso_pu_bacteria | 8005289223 | 8005294992 | 242 |
| 321 | iso_pu_bacteria | 8005301065 | 8005305133 | 242 |
| 322 | iso_pu_bacteria | 8005307578 | 8005308309 | 242 |
| 323 | iso_pu_bacteria | 8005376324 | 8005377984 | 242 |
| 324 | iso_pu_bacteria | 8005460587 | 8005464380 | 242 |
| 325 | iso_pu_bacteria | 8005542996 | 8005546328 | 242 |
| 326 | iso_pu_bacteria | 8005556819 | 8005561787 | 242 |
| 327 | iso_pu_bacteria | 8005563573 | 8005568566 | 242 |
| 328 | iso_pu_bacteria | 8005570704 | 8005571141 | 242 |
| 329 | iso_pu_bacteria | 8005688590 | 8005689154 | 242 |
| 330 | iso_pu_bacteria | 8018127388 | 8018127676 | 242 |
| 331 | iso_pu_bacteria | 8018163183 | 8018163192 | 242 |
| 332 | iso_pu_bacteria | 8023680758 | 8023681440 | 242 |
| 333 | iso_pu_bacteria | 8024479707 | 8024479743 | 242 |
| 334 | iso_pu_bacteria | 8024501048 | 8024507210 | 242 |
| 335 | iso_pu_bacteria | 8046767195 | 8046770617 | 242 |
| 336 | iso_pu_bacteria | 8047710418 | 8047712317 | 242 |
| 337 | iso_pu_bacteria | 8055617313 | 8055619066 | 242 |
| 338 | iso_pu_bacteria | 8056375014 | 8056380319 | 242 |
| 339 | iso_pu_bacteria | 8056382006 | 8056383891 | 242 |
| 340 | iso_pu_bacteria | 8057575449 | 8057578812 | 242 |
| 341 | iso_pu_bacteria | 8057874678 | 8057878874 | 242 |
| 342 | 3300005327 | Ga0070658_10019519 | Ga0070658_100195192 | 243 |
| 343 | 3300005339 | Ga0070660_100030363 | Ga0070660_1000303633 | 243 |
| 344 | 3300005344 | Ga0070661_100042747 | Ga0070661_1000427472 | 243 |
| 345 | 3300005366 | Ga0070659_100017270 | Ga0070659_1000172701 | 243 |
| 346 | 3300005535 | Ga0070684_100625806 | Ga0070684_1006258061 | 243 |
| 347 | 3300005539 | Ga0068853_100012183 | Ga0068853_1000121833 | 243 |
| 348 | 3300005614 | Ga0068856_100454630 | Ga0068856_1004546302 | 243 |
| 349 | 3300005616 | Ga0068852_100017669 | Ga0068852_1000176693 | 243 |
| 350 | 3300025909 | Ga0207705_10184788 | Ga0207705_101847882 | 243 |
| 351 | 3300025913 | Ga0207695_10265603 | Ga0207695_102656032 | 243 |
| 352 | 3300025919 | Ga0207657_10011473 | Ga0207657_100114738 | 243 |
| 353 | 3300025924 | Ga0207694_10256710 | Ga0207694_102567102 | 243 |
| 354 | 3300025932 | Ga0207690_10331894 | Ga0207690_103318942 | 243 |
| 355 | 3300025949 | Ga0207667_10004954 | Ga0207667_1000495414 | 243 |
| 356 | 3300026078 | Ga0207702_10417985 | Ga0207702_104179852 | 243 |
| 357 | 3300026142 | Ga0207698_10381936 | Ga0207698_103819361 | 243 |
| 358 | 3300031727 | Ga0316576_10378557 | Ga0316576_103785571 | 243 |
| 359 | 3300035398 | Ga0316574_0124785 | Ga0316574_0124785_824_1555 | 243 |
| 360 | 3300036712 | Ga0316584_0390262 | Ga0316584_0390262_186_917 | 243 |
| 361 | 3300041413 | Ga0439465_0014043 | Ga0439465_0014043_543_1283 | 243 |
| 362 | iso_pu_bacteria | 2643221634 | 2644195080 | 243 |
| 363 | 3300006038 | Ga0075365_10036309 | Ga0075365_100363093 | 244 |
| 364 | 3300006178 | Ga0075367_10189720 | Ga0075367_101897202 | 244 |
| 365 | 3300032004 | Ga0307414_10254581 | Ga0307414_102545811 | 244 |
| 366 | 3300037471 | Ga0395905_0229782 | Ga0395905_0229782_284_1018 | 244 |
| 367 | 3300038443 | Ga0395901_0092105 | Ga0395901_0092105_288_1022 | 244 |
| 368 | 3300049571 | Ga0501034_0000222 | Ga0501034_0000222_29105_29845 | 244 |
| 369 | iso_pu_bacteria | 2816332139 | 2816510364 | 244 |
| 370 | 3300001989 | JGI24739J22299_10018230 | JGI24739J22299_100182302 | 245 |
| 371 | 3300005329 | Ga0070683_100108132 | Ga0070683_1001081323 | 245 |
| 372 | 3300005338 | Ga0068868_100138538 | Ga0068868_1001385382 | 245 |
| 373 | 3300005339 | Ga0070660_100133813 | Ga0070660_1001338132 | 245 |
| 374 | 3300005339 | Ga0070660_100145156 | Ga0070660_1001451561 | 245 |
| 375 | 3300005344 | Ga0070661_100018671 | Ga0070661_1000186714 | 245 |
| 376 | 3300005344 | Ga0070661_100074458 | Ga0070661_1000744582 | 245 |
| 377 | 3300005344 | Ga0070661_100079929 | Ga0070661_1000799292 | 245 |
| 378 | 3300005347 | Ga0070668_100176104 | Ga0070668_1001761041 | 245 |
| 379 | 3300005356 | Ga0070674_100049340 | Ga0070674_1000493402 | 245 |
| 380 | 3300005364 | Ga0070673_100217950 | Ga0070673_1002179501 | 245 |
| 381 | 3300005366 | Ga0070659_100161964 | Ga0070659_1001619641 | 245 |
| 382 | 3300005457 | Ga0070662_100030424 | Ga0070662_1000304241 | 245 |
| 383 | 3300005459 | Ga0068867_100338039 | Ga0068867_1003380392 | 245 |
| 384 | 3300005535 | Ga0070684_100328127 | Ga0070684_1003281272 | 245 |
| 385 | 3300005548 | Ga0070665_100008163 | Ga0070665_1000081636 | 245 |
| 386 | 3300005548 | Ga0070665_100058286 | Ga0070665_1000582863 | 245 |
| 387 | 3300005563 | Ga0068855_100040893 | Ga0068855_1000408931 | 245 |
| 388 | 3300005563 | Ga0068855_100353259 | Ga0068855_1003532593 | 245 |
| 389 | 3300005578 | Ga0068854_100041169 | Ga0068854_1000411693 | 245 |
| 390 | 3300005578 | Ga0068854_100044855 | Ga0068854_1000448554 | 245 |
| 391 | 3300005614 | Ga0068856_100012342 | Ga0068856_1000123426 | 245 |
| 392 | 3300005614 | Ga0068856_100281122 | Ga0068856_1002811222 | 245 |
| 393 | 3300005614 | Ga0068856_100322254 | Ga0068856_1003222542 | 245 |
| 394 | 3300005616 | Ga0068852_100050523 | Ga0068852_1000505232 | 245 |
| 395 | 3300005616 | Ga0068852_100119104 | Ga0068852_1001191043 | 245 |
| 396 | 3300005616 | Ga0068852_100375473 | Ga0068852_1003754732 | 245 |
| 397 | 3300005983 | Ga0081540_1019814 | Ga0081540_10198142 | 245 |
| 398 | 3300006358 | Ga0068871_100533514 | Ga0068871_1005335141 | 245 |
| 399 | 3300006881 | Ga0068865_100108227 | Ga0068865_1001082271 | 245 |
| 400 | 3300009094 | Ga0111539_10698752 | Ga0111539_106987522 | 245 |
| 401 | 3300009098 | Ga0105245_10391104 | Ga0105245_103911042 | 245 |
| 402 | 3300009147 | Ga0114129_10316295 | Ga0114129_103162952 | 245 |
| 403 | 3300009174 | Ga0105241_10183428 | Ga0105241_101834282 | 245 |
| 404 | 3300009174 | Ga0105241_10350362 | Ga0105241_103503622 | 245 |
| 405 | 3300009545 | Ga0105237_10330040 | Ga0105237_103300402 | 245 |
| 406 | 3300009551 | Ga0105238_10034505 | Ga0105238_100345053 | 245 |
| 407 | 3300010375 | Ga0105239_10183511 | Ga0105239_101835112 | 245 |
| 408 | 3300010375 | Ga0105239_10194870 | Ga0105239_101948703 | 245 |
| 409 | 3300010375 | Ga0105239_10531845 | Ga0105239_105318452 | 245 |
| 410 | 3300013102 | Ga0157371_10028500 | Ga0157371_100285004 | 245 |
| 411 | 3300013296 | Ga0157374_10119111 | Ga0157374_101191111 | 245 |
| 412 | 3300013297 | Ga0157378_10082289 | Ga0157378_100822892 | 245 |
| 413 | 3300013307 | Ga0157372_10128256 | Ga0157372_101282562 | 245 |
| 414 | 3300013307 | Ga0157372_10152488 | Ga0157372_101524884 | 245 |
| 415 | 3300021384 | Ga0213876_10002694 | Ga0213876_100026948 | 245 |
| 416 | 3300025297 | Ga0209758_1013935 | Ga0209758_10139353 | 245 |
| 417 | 3300025904 | Ga0207647_10008504 | Ga0207647_100085042 | 245 |
| 418 | 3300025904 | Ga0207647_10107942 | Ga0207647_101079421 | 245 |
| 419 | 3300025907 | Ga0207645_10014079 | Ga0207645_100140792 | 245 |
| 420 | 3300025909 | Ga0207705_10247464 | Ga0207705_102474642 | 245 |
| 421 | 3300025911 | Ga0207654_10118616 | Ga0207654_101186162 | 245 |
| 422 | 3300025914 | Ga0207671_10373874 | Ga0207671_103738741 | 245 |
| 423 | 3300025919 | Ga0207657_10009115 | Ga0207657_100091153 | 245 |
| 424 | 3300025920 | Ga0207649_10011064 | Ga0207649_100110643 | 245 |
| 425 | 3300025920 | Ga0207649_10308811 | Ga0207649_103088112 | 245 |
| 426 | 3300025927 | Ga0207687_10269151 | Ga0207687_102691512 | 245 |
| 427 | 3300025933 | Ga0207706_10511363 | Ga0207706_105113631 | 245 |
| 428 | 3300025937 | Ga0207669_10004321 | Ga0207669_100043212 | 245 |
| 429 | 3300025938 | Ga0207704_10232228 | Ga0207704_102322282 | 245 |
| 430 | 3300025940 | Ga0207691_10048476 | Ga0207691_100484763 | 245 |
| 431 | 3300025940 | Ga0207691_10466494 | Ga0207691_104664941 | 245 |
| 432 | 3300025945 | Ga0207679_10428795 | Ga0207679_104287952 | 245 |
| 433 | 3300025949 | Ga0207667_10102920 | Ga0207667_101029202 | 245 |
| 434 | 3300025960 | Ga0207651_10194905 | Ga0207651_101949052 | 245 |
| 435 | 3300025981 | Ga0207640_10011939 | Ga0207640_100119393 | 245 |
| 436 | 3300026023 | Ga0207677_10065799 | Ga0207677_100657993 | 245 |
| 437 | 3300026041 | Ga0207639_10293587 | Ga0207639_102935872 | 245 |
| 438 | 3300026041 | Ga0207639_10895807 | Ga0207639_108958071 | 245 |
| 439 | 3300026078 | Ga0207702_10132709 | Ga0207702_101327091 | 245 |
| 440 | 3300026078 | Ga0207702_10150220 | Ga0207702_101502201 | 245 |
| 441 | 3300026078 | Ga0207702_10571203 | Ga0207702_105712032 | 245 |
| 442 | 3300026089 | Ga0207648_10096669 | Ga0207648_100966691 | 245 |
| 443 | 3300026116 | Ga0207674_10004581 | Ga0207674_1000458112 | 245 |
| 444 | 3300026116 | Ga0207674_10159834 | Ga0207674_101598342 | 245 |
| 445 | 3300026121 | Ga0207683_10046943 | Ga0207683_100469433 | 245 |
| 446 | 3300026142 | Ga0207698_10055985 | Ga0207698_100559853 | 245 |
| 447 | 3300026142 | Ga0207698_10247042 | Ga0207698_102470421 | 245 |
| 448 | 3300028379 | Ga0268266_10003641 | Ga0268266_100036417 | 245 |
| 449 | 3300028379 | Ga0268266_10083243 | Ga0268266_100832433 | 245 |
| 450 | 3300030732 | Ga0316176_1184345 | Ga0316176_11843451 | 245 |
| 451 | 3300031456 | Ga0307513_10007748 | Ga0307513_100077484 | 245 |
| 452 | 3300031903 | Ga0307407_10283933 | Ga0307407_102839331 | 245 |
| 453 | 3300035114 | Ga0373939_0104884 | Ga0373939_0104884_21_761 | 245 |
| 454 | 3300035207 | Ga0373942_0047873 | Ga0373942_0047873_433_1173 | 245 |
| 455 | 3300035691 | Ga0373931_0013840 | Ga0373931_0013840_1750_2490 | 245 |
| 456 | 3300037312 | Ga0395899_0036782 | Ga0395899_0036782_2458_3195 | 245 |
| 457 | 3300037853 | Ga0436364_0469241 | Ga0436364_0469241_1534_2283 | 245 |
| 458 | 3300037853 | Ga0436364_0579643 | Ga0436364_0579643_24901_25665 | 245 |
| 459 | 3300039437 | Ga0436365_0257230 | Ga0436365_0257230_27365_28129 | 245 |
| 460 | 3300039438 | Ga0436360_0835435 | Ga0436360_0835435_850_1590 | 245 |
| 461 | 3300039450 | Ga0436363_1085806 | Ga0436363_1085806_723_1487 | 245 |
| 462 | 3300048929 | Ga0496126_0017755 | Ga0496126_0017755_5509_6264 | 245 |
| 463 | 3300049571 | Ga0501034_0009509 | Ga0501034_0009509_2317_3054 | 245 |
| 464 | 3300050492 | nmdc:mga0yw44_457015_c1 | nmdc:mga0yw44_457015_c1_88_828 | 245 |
| 465 | 3300050493 | nmdc:mga0k408_124785_c1 | nmdc:mga0k408_124785_c1_16_759 | 245 |
| 466 | 3300050507 | nmdc:mga05p37_347060_c1 | nmdc:mga05p37_347060_c1_78_872 | 245 |
| 467 | 3300053111 | Ga0500572_002091 | Ga0500572_002091_1862_2605 | 245 |
| 468 | 3300002739 | JGI25158J39367_1000205 | JGI25158J39367_10002054 | 246 |
| 469 | 3300002773 | JGI25152J39213_1006150 | JGI25152J39213_10061501 | 246 |
| 470 | 3300002773 | JGI25152J39213_1009450 | JGI25152J39213_10094502 | 246 |
| 471 | 3300002774 | JGI25150J39212_1007385 | JGI25150J39212_10073852 | 246 |
| 472 | 3300002987 | JGI25159J45721_1001121 | JGI25159J45721_10011217 | 246 |
| 473 | 3300003187 | JGI25151J46595_10000867 | JGI25151J46595_100008675 | 246 |
| 474 | 3300003187 | JGI25151J46595_10018558 | JGI25151J46595_100185582 | 246 |
| 475 | 3300003322 | rootL2_10015096 | rootL2_1001509619 | 246 |
| 476 | 3300003323 | rootH1_10100374 | rootH1_1010037410 | 246 |
| 477 | 3300003374 | JGI25161J50226_1000050 | JGI25161J50226_100005091 | 246 |
| 478 | 3300003374 | JGI25161J50226_1003954 | JGI25161J50226_10039543 | 246 |
| 479 | 3300003771 | Ga0055526_1000595 | Ga0055526_100059515 | 246 |
| 480 | 3300003771 | Ga0055526_1024018 | Ga0055526_10240182 | 246 |
| 481 | 3300003775 | Ga0055524_1000922 | Ga0055524_100092218 | 246 |
| 482 | 3300003775 | Ga0055524_1002690 | Ga0055524_10026903 | 246 |
| 483 | 3300003775 | Ga0055524_1018262 | Ga0055524_10182621 | 246 |
| 484 | 3300003781 | Ga0055536_1052975 | Ga0055536_10529751 | 246 |
| 485 | 3300003790 | Ga0055528_1000096 | Ga0055528_100009617 | 246 |
| 486 | 3300003790 | Ga0055528_1000716 | Ga0055528_100071639 | 246 |
| 487 | 3300003790 | Ga0055528_1014786 | Ga0055528_10147863 | 246 |
| 488 | 3300003790 | Ga0055528_1018681 | Ga0055528_10186811 | 246 |
| 489 | 3300003790 | Ga0055528_1030026 | Ga0055528_10300262 | 246 |
| 490 | 3300003792 | Ga0055540_1000399 | Ga0055540_100039915 | 246 |
| 491 | 3300003792 | Ga0055540_1031822 | Ga0055540_10318222 | 246 |
| 492 | 3300003792 | Ga0055540_1049953 | Ga0055540_10499531 | 246 |
| 493 | 3300004625 | Ga0055543_1000489 | Ga0055543_100048912 | 246 |
| 494 | 3300005262 | Ga0065165_1016267 | Ga0065165_10162672 | 246 |
| 495 | 3300005295 | Ga0065707_10120174 | Ga0065707_101201741 | 246 |
| 496 | 3300005329 | Ga0070683_100605748 | Ga0070683_1006057482 | 246 |
| 497 | 3300005337 | Ga0070682_100068256 | Ga0070682_1000682563 | 246 |
| 498 | 3300005344 | Ga0070661_100005094 | Ga0070661_1000050946 | 246 |
| 499 | 3300005347 | Ga0070668_100011517 | Ga0070668_1000115173 | 246 |
| 500 | 3300005353 | Ga0070669_100016868 | Ga0070669_1000168683 | 246 |
| 501 | 3300005356 | Ga0070674_100016108 | Ga0070674_1000161083 | 246 |
| 502 | 3300005356 | Ga0070674_100433145 | Ga0070674_1004331452 | 246 |
| 503 | 3300005366 | Ga0070659_100378991 | Ga0070659_1003789911 | 246 |
| 504 | 3300005437 | Ga0070710_10000809 | Ga0070710_100008096 | 246 |
| 505 | 3300005445 | Ga0070708_100222091 | Ga0070708_1002220911 | 246 |
| 506 | 3300005455 | Ga0070663_100008664 | Ga0070663_1000086644 | 246 |
| 507 | 3300005455 | Ga0070663_100028440 | Ga0070663_1000284405 | 246 |
| 508 | 3300005468 | Ga0070707_100140234 | Ga0070707_1001402341 | 246 |
| 509 | 3300005518 | Ga0070699_100422994 | Ga0070699_1004229942 | 246 |
| 510 | 3300005530 | Ga0070679_100131508 | Ga0070679_1001315084 | 246 |
| 511 | 3300005535 | Ga0070684_100914887 | Ga0070684_1009148871 | 246 |
| 512 | 3300005539 | Ga0068853_100001347 | Ga0068853_1000013479 | 246 |
| 513 | 3300005539 | Ga0068853_100022202 | Ga0068853_1000222021 | 246 |
| 514 | 3300005544 | Ga0070686_100035123 | Ga0070686_1000351232 | 246 |
| 515 | 3300005577 | Ga0068857_100021902 | Ga0068857_1000219023 | 246 |
| 516 | 3300005577 | Ga0068857_100074871 | Ga0068857_1000748713 | 246 |
| 517 | 3300005578 | Ga0068854_100001486 | Ga0068854_1000014866 | 246 |
| 518 | 3300005614 | Ga0068856_100154879 | Ga0068856_1001548793 | 246 |
| 519 | 3300005616 | Ga0068852_100034234 | Ga0068852_1000342342 | 246 |
| 520 | 3300005616 | Ga0068852_100885067 | Ga0068852_1008850671 | 246 |
| 521 | 3300005834 | Ga0068851_10005070 | Ga0068851_100050705 | 246 |
| 522 | 3300005844 | Ga0068862_100003242 | Ga0068862_1000032426 | 246 |
| 523 | 3300005844 | Ga0068862_100047167 | Ga0068862_1000471674 | 246 |
| 524 | 3300005844 | Ga0068862_100547084 | Ga0068862_1005470841 | 246 |
| 525 | 3300005985 | Ga0081539_10000316 | Ga0081539_1000031633 | 246 |
| 526 | 3300006028 | Ga0070717_10104762 | Ga0070717_101047621 | 246 |
| 527 | 3300006038 | Ga0075365_10023833 | Ga0075365_100238334 | 246 |
| 528 | 3300006038 | Ga0075365_10228251 | Ga0075365_102282512 | 246 |
| 529 | 3300006042 | Ga0075368_10035242 | Ga0075368_100352422 | 246 |
| 530 | 3300006048 | Ga0075363_100072523 | Ga0075363_1000725232 | 246 |
| 531 | 3300006048 | Ga0075363_100213452 | Ga0075363_1002134522 | 246 |
| 532 | 3300006051 | Ga0075364_10222336 | Ga0075364_102223361 | 246 |
| 533 | 3300006177 | Ga0075362_10003549 | Ga0075362_100035492 | 246 |
| 534 | 3300006178 | Ga0075367_10012197 | Ga0075367_100121972 | 246 |
| 535 | 3300006186 | Ga0075369_10030199 | Ga0075369_100301992 | 246 |
| 536 | 3300006186 | Ga0075369_10044691 | Ga0075369_100446912 | 246 |
| 537 | 3300006195 | Ga0075366_10001329 | Ga0075366_100013291 | 246 |
| 538 | 3300006353 | Ga0075370_10034041 | Ga0075370_100340412 | 246 |
| 539 | 3300006353 | Ga0075370_10332111 | Ga0075370_103321111 | 246 |
| 540 | 3300006847 | Ga0075431_100615695 | Ga0075431_1006156952 | 246 |
| 541 | 3300006880 | Ga0075429_100564614 | Ga0075429_1005646142 | 246 |
| 542 | 3300009036 | Ga0105244_10089445 | Ga0105244_100894452 | 246 |
| 543 | 3300009093 | Ga0105240_10000336 | Ga0105240_1000033628 | 246 |
| 544 | 3300009093 | Ga0105240_10057132 | Ga0105240_100571322 | 246 |
| 545 | 3300009147 | Ga0114129_10080578 | Ga0114129_100805783 | 246 |
| 546 | 3300009147 | Ga0114129_10384072 | Ga0114129_103840722 | 246 |
| 547 | 3300009174 | Ga0105241_10105300 | Ga0105241_101053002 | 246 |
| 548 | 3300009545 | Ga0105237_10000690 | Ga0105237_1000069033 | 246 |
| 549 | 3300009551 | Ga0105238_10014048 | Ga0105238_100140482 | 246 |
| 550 | 3300009765 | Ga0123341_1004539 | Ga0123341_10045399 | 246 |
| 551 | 3300009766 | Ga0123342_1017768 | Ga0123342_10177684 | 246 |
| 552 | 3300010375 | Ga0105239_10281176 | Ga0105239_102811761 | 246 |
| 553 | 3300012490 | Ga0157322_1004080 | Ga0157322_10040802 | 246 |
| 554 | 3300013104 | Ga0157370_10026622 | Ga0157370_100266224 | 246 |
| 555 | 3300013105 | Ga0157369_10113277 | Ga0157369_101132772 | 246 |
| 556 | 3300013297 | Ga0157378_10417244 | Ga0157378_104172442 | 246 |
| 557 | 3300014497 | Ga0182008_10225101 | Ga0182008_102251011 | 246 |
| 558 | 3300025208 | Ga0209436_100031 | Ga0209436_10003162 | 246 |
| 559 | 3300025208 | Ga0209436_114778 | Ga0209436_1147781 | 246 |
| 560 | 3300025245 | Ga0207425_1002640 | Ga0207425_10026406 | 246 |
| 561 | 3300025245 | Ga0207425_1006193 | Ga0207425_10061932 | 246 |
| 562 | 3300025245 | Ga0207425_1017953 | Ga0207425_10179531 | 246 |
| 563 | 3300025253 | Ga0209677_103335 | Ga0209677_1033355 | 246 |
| 564 | 3300025258 | Ga0209129_1000669 | Ga0209129_100066920 | 246 |
| 565 | 3300025258 | Ga0209129_1001340 | Ga0209129_100134010 | 246 |
| 566 | 3300025258 | Ga0209129_1002531 | Ga0209129_10025312 | 246 |
| 567 | 3300025261 | Ga0209233_1000097 | Ga0209233_1000097277 | 246 |
| 568 | 3300025273 | Ga0209673_1000063 | Ga0209673_1000063233 | 246 |
| 569 | 3300025273 | Ga0209673_1000252 | Ga0209673_100025247 | 246 |
| 570 | 3300025273 | Ga0209673_1000291 | Ga0209673_100029151 | 246 |
| 571 | 3300025273 | Ga0209673_1001400 | Ga0209673_100140038 | 246 |
| 572 | 3300025273 | Ga0209673_1002105 | Ga0209673_100210511 | 246 |
| 573 | 3300025273 | Ga0209673_1002242 | Ga0209673_100224211 | 246 |
| 574 | 3300025284 | Ga0209130_1000031 | Ga0209130_100003111 | 246 |
| 575 | 3300025284 | Ga0209130_1000048 | Ga0209130_1000048197 | 246 |
| 576 | 3300025294 | Ga0209025_1000430 | Ga0209025_100043027 | 246 |
| 577 | 3300025294 | Ga0209025_1005207 | Ga0209025_10052075 | 246 |
| 578 | 3300025295 | Ga0209564_1000586 | Ga0209564_100058641 | 246 |
| 579 | 3300025295 | Ga0209564_1000664 | Ga0209564_100066435 | 246 |
| 580 | 3300025295 | Ga0209564_1000876 | Ga0209564_100087614 | 246 |
| 581 | 3300025295 | Ga0209564_1006096 | Ga0209564_10060962 | 246 |
| 582 | 3300025295 | Ga0209564_1013624 | Ga0209564_10136241 | 246 |
| 583 | 3300025297 | Ga0209758_1000490 | Ga0209758_100049010 | 246 |
| 584 | 3300025297 | Ga0209758_1001257 | Ga0209758_100125722 | 246 |
| 585 | 3300025297 | Ga0209758_1001647 | Ga0209758_10016472 | 246 |
| 586 | 3300025297 | Ga0209758_1002831 | Ga0209758_100283110 | 246 |
| 587 | 3300025297 | Ga0209758_1004719 | Ga0209758_10047195 | 246 |
| 588 | 3300025297 | Ga0209758_1034009 | Ga0209758_10340093 | 246 |
| 589 | 3300025298 | Ga0209050_1003257 | Ga0209050_10032572 | 246 |
| 590 | 3300025299 | Ga0209256_1000463 | Ga0209256_100046354 | 246 |
| 591 | 3300025299 | Ga0209256_1001515 | Ga0209256_100151538 | 246 |
| 592 | 3300025299 | Ga0209256_1002067 | Ga0209256_10020673 | 246 |
| 593 | 3300025299 | Ga0209256_1004108 | Ga0209256_10041083 | 246 |
| 594 | 3300025302 | Ga0207426_1000042 | Ga0207426_1000042399 | 246 |
| 595 | 3300025302 | Ga0207426_1000075 | Ga0207426_1000075244 | 246 |
| 596 | 3300025302 | Ga0207426_1000136 | Ga0207426_1000136197 | 246 |
| 597 | 3300025303 | Ga0209051_1000671 | Ga0209051_100067116 | 246 |
| 598 | 3300025303 | Ga0209051_1016239 | Ga0209051_10162393 | 246 |
| 599 | 3300025303 | Ga0209051_1025534 | Ga0209051_10255343 | 246 |
| 600 | 3300025304 | Ga0209257_1000504 | Ga0209257_100050439 | 246 |
| 601 | 3300025304 | Ga0209257_1065337 | Ga0209257_10653372 | 246 |
| 602 | 3300025321 | Ga0207656_10003814 | Ga0207656_100038142 | 246 |
| 603 | 3300025898 | Ga0207692_10001415 | Ga0207692_100014155 | 246 |
| 604 | 3300025903 | Ga0207680_10179295 | Ga0207680_101792951 | 246 |
| 605 | 3300025908 | Ga0207643_10338636 | Ga0207643_103386362 | 246 |
| 606 | 3300025911 | Ga0207654_10035337 | Ga0207654_100353371 | 246 |
| 607 | 3300025913 | Ga0207695_10000458 | Ga0207695_1000045862 | 246 |
| 608 | 3300025914 | Ga0207671_10000577 | Ga0207671_1000057725 | 246 |
| 609 | 3300025914 | Ga0207671_10016228 | Ga0207671_100162282 | 246 |
| 610 | 3300025919 | Ga0207657_10012411 | Ga0207657_100124119 | 246 |
| 611 | 3300025920 | Ga0207649_10008971 | Ga0207649_100089713 | 246 |
| 612 | 3300025924 | Ga0207694_10014161 | Ga0207694_100141612 | 246 |
| 613 | 3300025924 | Ga0207694_10033622 | Ga0207694_100336222 | 246 |
| 614 | 3300025925 | Ga0207650_10318883 | Ga0207650_103188832 | 246 |
| 615 | 3300025929 | Ga0207664_10028791 | Ga0207664_100287912 | 246 |
| 616 | 3300025929 | Ga0207664_10398737 | Ga0207664_103987372 | 246 |
| 617 | 3300025937 | Ga0207669_10025236 | Ga0207669_100252362 | 246 |
| 618 | 3300025937 | Ga0207669_10048578 | Ga0207669_100485782 | 246 |
| 619 | 3300025949 | Ga0207667_10201250 | Ga0207667_102012503 | 246 |
| 620 | 3300025972 | Ga0207668_10009534 | Ga0207668_100095342 | 246 |
| 621 | 3300025972 | Ga0207668_10719554 | Ga0207668_107195541 | 246 |
| 622 | 3300025981 | Ga0207640_10011282 | Ga0207640_100112825 | 246 |
| 623 | 3300026041 | Ga0207639_10042470 | Ga0207639_100424703 | 246 |
| 624 | 3300026067 | Ga0207678_10012764 | Ga0207678_100127644 | 246 |
| 625 | 3300026067 | Ga0207678_10018975 | Ga0207678_100189755 | 246 |
| 626 | 3300026078 | Ga0207702_10373360 | Ga0207702_103733602 | 246 |
| 627 | 3300026116 | Ga0207674_10095351 | Ga0207674_100953512 | 246 |
| 628 | 3300026142 | Ga0207698_10082567 | Ga0207698_100825673 | 246 |
| 629 | 3300028380 | Ga0268265_10005163 | Ga0268265_100051636 | 246 |
| 630 | 3300028380 | Ga0268265_10028795 | Ga0268265_100287952 | 246 |
| 631 | 3300028786 | Ga0307517_10225947 | Ga0307517_102259471 | 246 |
| 632 | 3300028794 | Ga0307515_10299599 | Ga0307515_102995992 | 246 |
| 633 | 3300030522 | Ga0307512_10009090 | Ga0307512_100090907 | 246 |
| 634 | 3300030731 | Ga0316177_1021166 | Ga0316177_10211663 | 246 |
| 635 | 3300030736 | Ga0316180_1172947 | Ga0316180_11729473 | 246 |
| 636 | 3300031238 | Ga0265332_10039082 | Ga0265332_100390823 | 246 |
| 637 | 3300031456 | Ga0307513_10204001 | Ga0307513_102040012 | 246 |
| 638 | 3300031456 | Ga0307513_10275582 | Ga0307513_102755822 | 246 |
| 639 | 3300031711 | Ga0265314_10034609 | Ga0265314_100346091 | 246 |
| 640 | 3300031712 | Ga0265342_10252510 | Ga0265342_102525102 | 246 |
| 641 | 3300031911 | Ga0307412_10096675 | Ga0307412_100966751 | 246 |
| 642 | 3300032004 | Ga0307414_10083504 | Ga0307414_100835042 | 246 |
| 643 | 3300032004 | Ga0307414_10275573 | Ga0307414_102755732 | 246 |
| 644 | 3300035725 | Ga0373947_0300628 | Ga0373947_0300628_261_1001 | 246 |
| 645 | 3300037471 | Ga0395905_0000791 | Ga0395905_0000791_31329_32078 | 246 |
| 646 | 3300037853 | Ga0436364_0393289 | Ga0436364_0393289_4514_5260 | 246 |
| 647 | 3300041496 | Ga0451839_1234649 | Ga0451839_1234649_89_838 | 246 |
| 648 | 3300041501 | Ga0451845_0296105 | Ga0451845_0296105_24_770 | 246 |
| 649 | 3300041503 | Ga0451847_0268177 | Ga0451847_0268177_370_1119 | 246 |
| 650 | 3300041505 | Ga0451849_1289643 | Ga0451849_1289643_208_957 | 246 |
| 651 | 3300041507 | Ga0451851_0444680 | Ga0451851_0444680_31_780 | 246 |
| 652 | 3300042005 | Ga0439448_0083916 | Ga0439448_0083916_111_998 | 246 |
| 653 | 3300044719 | Ga0466971_0194570 | Ga0466971_0194570_11_754 | 246 |
| 654 | 3300046507 | Ga0495606_0112874 | Ga0495606_0112874_702_1442 | 246 |
| 655 | 3300046512 | Ga0495610_0004552 | Ga0495610_0004552_5984_6724 | 246 |
| 656 | 3300046515 | Ga0495620_0141236 | Ga0495620_0141236_180_923 | 246 |
| 657 | 3300046519 | Ga0495632_0073066 | Ga0495632_0073066_150_890 | 246 |
| 658 | 3300046616 | Ga0495668_0115828 | Ga0495668_0115828_24_767 | 246 |
| 659 | 3300046660 | Ga0495625_0254448 | Ga0495625_0254448_19_759 | 246 |
| 660 | 3300048919 | Ga0496116_0003206 | Ga0496116_0003206_2246_2992 | 246 |
| 661 | 3300048919 | Ga0496116_0093227 | Ga0496116_0093227_242_982 | 246 |
| 662 | 3300048919 | Ga0496116_0117283 | Ga0496116_0117283_299_1045 | 246 |
| 663 | 3300048920 | Ga0496117_0010959 | Ga0496117_0010959_461_1207 | 246 |
| 664 | 3300048920 | Ga0496117_0059067 | Ga0496117_0059067_1557_2303 | 246 |
| 665 | 3300048921 | Ga0496118_0024130 | Ga0496118_0024130_255_1001 | 246 |
| 666 | 3300048921 | Ga0496118_0090434 | Ga0496118_0090434_1188_1934 | 246 |
| 667 | 3300048921 | Ga0496118_0139409 | Ga0496118_0139409_107_865 | 246 |
| 668 | 3300048922 | Ga0496119_0042991 | Ga0496119_0042991_1367_2113 | 246 |
| 669 | 3300048924 | Ga0496121_0009961 | Ga0496121_0009961_6323_7069 | 246 |
| 670 | 3300048924 | Ga0496121_0407874 | Ga0496121_0407874_71_811 | 246 |
| 671 | 3300048925 | Ga0496122_0033522 | Ga0496122_0033522_47_793 | 246 |
| 672 | 3300048925 | Ga0496122_0081372 | Ga0496122_0081372_548_1294 | 246 |
| 673 | 3300048926 | Ga0496123_0020166 | Ga0496123_0020166_3748_4494 | 246 |
| 674 | 3300048926 | Ga0496123_0030754 | Ga0496123_0030754_1040_1786 | 246 |
| 675 | 3300048927 | Ga0496124_0001914 | Ga0496124_0001914_25568_26314 | 246 |
| 676 | 3300048927 | Ga0496124_0140144 | Ga0496124_0140144_390_1136 | 246 |
| 677 | 3300048927 | Ga0496124_0204706 | Ga0496124_0204706_65_907 | 246 |
| 678 | 3300048928 | Ga0496125_0125650 | Ga0496125_0125650_505_1251 | 246 |
| 679 | 3300048929 | Ga0496126_0008697 | Ga0496126_0008697_7391_8158 | 246 |
| 680 | 3300048929 | Ga0496126_0100364 | Ga0496126_0100364_1540_2298 | 246 |
| 681 | 3300049459 | Ga0495678_050663 | Ga0495678_050663_472_1212 | 246 |
| 682 | 3300049568 | Ga0501031_0001559 | Ga0501031_0001559_12484_13251 | 246 |
| 683 | 3300049568 | Ga0501031_0089125 | Ga0501031_0089125_945_1709 | 246 |
| 684 | 3300049569 | Ga0501032_0001034 | Ga0501032_0001034_1295_2062 | 246 |
| 685 | 3300049570 | Ga0501033_0003222 | Ga0501033_0003222_5216_5983 | 246 |
| 686 | 3300049570 | Ga0501033_0137820 | Ga0501033_0137820_877_1641 | 246 |
| 687 | 3300049571 | Ga0501034_0002860 | Ga0501034_0002860_18278_19045 | 246 |
| 688 | 3300049571 | Ga0501034_0152259 | Ga0501034_0152259_1282_2028 | 246 |
| 689 | 3300049572 | Ga0501036_0066386 | Ga0501036_0066386_1075_1842 | 246 |
| 690 | 3300049572 | Ga0501036_0277558 | Ga0501036_0277558_173_937 | 246 |
| 691 | 3300049573 | Ga0501037_0000514 | Ga0501037_0000514_3129_3896 | 246 |
| 692 | 3300049574 | Ga0501038_0015873 | Ga0501038_0015873_948_1715 | 246 |
| 693 | 3300049574 | Ga0501038_0038552 | Ga0501038_0038552_2118_2858 | 246 |
| 694 | 3300049574 | Ga0501038_0069097 | Ga0501038_0069097_1931_2695 | 246 |
| 695 | 3300049575 | Ga0501039_0000432 | Ga0501039_0000432_1658_2425 | 246 |
| 696 | 3300049575 | Ga0501039_0012347 | Ga0501039_0012347_1579_2343 | 246 |
| 697 | 3300049579 | Ga0501043_0035006 | Ga0501043_0035006_1212_1979 | 246 |
| 698 | 3300049580 | Ga0501046_0001262 | Ga0501046_0001262_18409_19176 | 246 |
| 699 | 3300049581 | Ga0501047_0006274 | Ga0501047_0006274_6298_7065 | 246 |
| 700 | 3300049581 | Ga0501047_0030949 | Ga0501047_0030949_1362_2102 | 246 |
| 701 | 3300049582 | Ga0501048_0003846 | Ga0501048_0003846_3340_4107 | 246 |
| 702 | 3300049583 | Ga0501067_0011888 | Ga0501067_0011888_3586_4326 | 246 |
| 703 | 3300049583 | Ga0501067_0019049 | Ga0501067_0019049_785_1552 | 246 |
| 704 | 3300049584 | Ga0501068_0016396 | Ga0501068_0016396_2922_3689 | 246 |
| 705 | 3300049584 | Ga0501068_0099705 | Ga0501068_0099705_261_1001 | 246 |
| 706 | 3300049584 | Ga0501068_0162193 | Ga0501068_0162193_520_1284 | 246 |
| 707 | 3300049585 | Ga0501069_0001119 | Ga0501069_0001119_10608_11375 | 246 |
| 708 | 3300049586 | Ga0501070_0006527 | Ga0501070_0006527_1736_2503 | 246 |
| 709 | 3300049586 | Ga0501070_0017904 | Ga0501070_0017904_71_835 | 246 |
| 710 | 3300049587 | Ga0501071_0366574 | Ga0501071_0366574_239_1006 | 246 |
| 711 | 3300049588 | Ga0501072_0039944 | Ga0501072_0039944_1897_2664 | 246 |
| 712 | 3300049589 | Ga0501073_0000534 | Ga0501073_0000534_6424_7191 | 246 |
| 713 | 3300049589 | Ga0501073_0028100 | Ga0501073_0028100_1178_1918 | 246 |
| 714 | 3300049589 | Ga0501073_0091242 | Ga0501073_0091242_385_1131 | 246 |
| 715 | 3300049590 | Ga0501074_0035429 | Ga0501074_0035429_1161_1928 | 246 |
| 716 | 3300049590 | Ga0501074_0219144 | Ga0501074_0219144_429_1193 | 246 |
| 717 | 3300049742 | Ga0501080_0003677 | Ga0501080_0003677_9524_10291 | 246 |
| 718 | 3300049742 | Ga0501080_0010159 | Ga0501080_0010159_1577_2317 | 246 |
| 719 | 3300049744 | Ga0501083_0018962 | Ga0501083_0018962_1053_1820 | 246 |
| 720 | 3300049744 | Ga0501083_0041672 | Ga0501083_0041672_942_1682 | 246 |
| 721 | 3300049822 | Ga0501035_0030566 | Ga0501035_0030566_1562_2329 | 246 |
| 722 | 3300049822 | Ga0501035_0096494 | Ga0501035_0096494_1092_1856 | 246 |
| 723 | 3300049823 | Ga0501044_0004665 | Ga0501044_0004665_14462_15202 | 246 |
| 724 | 3300049823 | Ga0501044_0011230 | Ga0501044_0011230_6031_6798 | 246 |
| 725 | 3300049823 | Ga0501044_0552394 | Ga0501044_0552394_271_1035 | 246 |
| 726 | 3300049824 | Ga0501045_0363619 | Ga0501045_0363619_253_1017 | 246 |
| 727 | 3300050507 | nmdc:mga05p37_357443_c1 | nmdc:mga05p37_357443_c1_580_1320 | 246 |
| 728 | 3300050507 | nmdc:mga05p37_503593_c1 | nmdc:mga05p37_503593_c1_103_843 | 246 |
| 729 | 3300053093 | Ga0500651_0068385 | Ga0500651_0068385_593_1333 | 246 |
| 730 | 3300053130 | Ga0500642_0001239 | Ga0500642_0001239_411_1151 | 246 |
| 731 | 3300053139 | Ga0500568_0000361 | Ga0500568_0000361_33231_33971 | 246 |
| 732 | 3300053151 | Ga0500604_0008235 | Ga0500604_0008235_429_1169 | 246 |
| 733 | 3300053151 | Ga0500604_0043014 | Ga0500604_0043014_279_1019 | 246 |
| 734 | 3300053153 | Ga0500616_0000686 | Ga0500616_0000686_30886_31626 | 246 |
| 735 | 3300053157 | Ga0500624_022879 | Ga0500624_022879_164_919 | 246 |
| 736 | 3300054114 | Ga0501084_0000193 | Ga0501084_0000193_27617_28384 | 246 |
| 737 | 3300054114 | Ga0501084_0015147 | Ga0501084_0015147_3496_4236 | 246 |
| 738 | 3300060353 | Ga0501082_0003570 | Ga0501082_0003570_6404_7144 | 246 |
| 739 | 3300061719 | Ga0466962_0094782 | Ga0466962_0094782_271_1029 | 246 |
| 740 | 3300006177 | Ga0075362_10128528 | Ga0075362_101285282 | 247 |
| 741 | 3300006178 | Ga0075367_10016873 | Ga0075367_100168733 | 247 |
| 742 | 3300006186 | Ga0075369_10105746 | Ga0075369_101057462 | 247 |
| 743 | 3300006195 | Ga0075366_10200289 | Ga0075366_102002892 | 247 |
| 744 | 3300006353 | Ga0075370_10121047 | Ga0075370_101210472 | 247 |
| 745 | 3300031824 | Ga0307413_10320543 | Ga0307413_103205432 | 247 |
| 746 | 3300041413 | Ga0439465_0109519 | Ga0439465_0109519_121_891 | 247 |
| 747 | 3300048909 | Ga0496106_0243119 | Ga0496106_0243119_214_981 | 247 |
| 748 | 3300048924 | Ga0496121_0150370 | Ga0496121_0150370_493_1263 | 247 |
| 749 | 3300049571 | Ga0501034_0012347 | Ga0501034_0012347_6761_7528 | 247 |
| 750 | 3300049571 | Ga0501034_0073930 | Ga0501034_0073930_421_1179 | 247 |
| 751 | 3300049571 | Ga0501034_0141388 | Ga0501034_0141388_129_890 | 247 |
| 752 | 3300049571 | Ga0501034_0266055 | Ga0501034_0266055_273_1040 | 247 |
| 753 | 3300050494 | nmdc:mga06z11_69250_c1 | nmdc:mga06z11_69250_c1_891_1652 | 247 |
| 754 | 3300053139 | Ga0500568_0035779 | Ga0500568_0035779_1050_1820 | 247 |
| 755 | iso_pu_bacteria | 2643221629 | 2644164349 | 247 |
| 756 | iso_pu_bacteria | 2643221662 | 2644346380 | 247 |
| 757 | 3300001915 | JGI24741J21665_1010079 | JGI24741J21665_10100792 | 248 |
| 758 | 3300005262 | Ga0065165_1005024 | Ga0065165_10050241 | 248 |
| 759 | 3300005343 | Ga0070687_100332424 | Ga0070687_1003324241 | 248 |
| 760 | 3300005353 | Ga0070669_100086993 | Ga0070669_1000869932 | 248 |
| 761 | 3300005548 | Ga0070665_100336422 | Ga0070665_1003364222 | 248 |
| 762 | 3300006178 | Ga0075367_10310440 | Ga0075367_103104401 | 248 |
| 763 | 3300006353 | Ga0075370_10076482 | Ga0075370_100764822 | 248 |
| 764 | 3300013308 | Ga0157375_10149482 | Ga0157375_101494821 | 248 |
| 765 | 3300025923 | Ga0207681_10092411 | Ga0207681_100924112 | 248 |
| 766 | 3300025927 | Ga0207687_10364131 | Ga0207687_103641312 | 248 |
| 767 | 3300028379 | Ga0268266_10236163 | Ga0268266_102361632 | 248 |
| 768 | 3300028577 | Ga0265318_10002087 | Ga0265318_100020876 | 248 |
| 769 | 3300048909 | Ga0496106_0008218 | Ga0496106_0008218_3834_4580 | 248 |
| 770 | 3300048912 | Ga0496109_0198173 | Ga0496109_0198173_905_1717 | 248 |
| 771 | 3300048924 | Ga0496121_0003823 | Ga0496121_0003823_2686_3432 | 248 |
| 772 | 3300048926 | Ga0496123_0002938 | Ga0496123_0002938_2579_3325 | 248 |
| 773 | 3300048927 | Ga0496124_0030119 | Ga0496124_0030119_1412_2158 | 248 |
| 774 | 3300048929 | Ga0496126_0097560 | Ga0496126_0097560_1284_2030 | 248 |
| 775 | 3300050496 | nmdc:mga07m45_15904_c2 | nmdc:mga07m45_15904_c2_1969_2715 | 248 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5x15-assembly1.cif.gz_C-2 | crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family | 0.9763 | 8 | 214 |
| 5x15-assembly1.cif.gz_A-2 | crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family | 0.9677 | 9 | 215 |
| 5x15-assembly1.cif.gz_A-2 | crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family | 0.9581 | 9 | 215 |
| 5x15-assembly1.cif.gz_C-2 | crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family | 0.957 | 8 | 214 |
| 3k4i-assembly1.cif.gz_B | crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 | 0.8937 | 8 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3k4iB01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9022 | 11 | 191 | 3.50.30.40 |
| 3k4iB01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.8913 | 11 | 191 | 3.50.30.40 |
| 5ir2A00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.8689 | 3 | 210 | 3.50.30.40 |
| 2pcnA00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.8648 | 37 | 191 | 3.50.30.40 |
| 3nojA01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.8499 | 27 | 190 | 3.50.30.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527ZK34-F1-model_v4 | Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) | 0.9851 | 1 | 189 |
GO:0046872
|
| AF-A0A6B0XG78-F1-model_v4 | Regulator of ribonuclease activity homolog | 0.9824 | 1 | 242 |
GO:0046872
|
| AF-A0A381VDY7-F1-model_v4 | Uncharacterized protein | 0.9814 | 1 | 191 |
|
| AF-A0A527ZK34-F1-model_v4 | Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) | 0.9799 | 1 | 189 |
GO:0046872
|
| AF-A0A381VDY7-F1-model_v4 | Uncharacterized protein | 0.9763 | 1 | 191 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar