F480189

General Info

Members Datasets Scaffolds Average Seq Length
773 376 1547 106

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0254114|Ga0496119_0254114_43_402
Length 114
Sequence MSALLLADLTVFTLALLVGFEVISKVPATLHTPLMSGANAIHGVVLVGAILITGTVSGPVQLTLXXXXINMVGGFVVTDRMLEMFSRPSRARGGEPPEPGAGSPGPSAQRGPGR

Samples

Sample ID Description Type Environment
1 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
109 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
110 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
111 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
112 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
203 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
204 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
205 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
224 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
225 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
229 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
236 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
237 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
254 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
258 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
263 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
264 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
265 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
266 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
280 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
281 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
282 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
285 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
298 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
303 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 2508501039 Frankia saprophytica CN3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.16
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0.13
Rhizoplane 9.31
Rhizosphere 86.42
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496119_0254114 3300048922 Bacteria 885
2 LJNas_1006518 3300000546 Bacteria 1264
3 JGI24739J22299_10087628 3300001989 Bacteria 950
4 JGI24737J22298_10034214 3300001990 Bacteria 1576
5 JGI24743J22301_10017239 3300001991 Bacteria 1354
6 JGI24738J21930_10152362 3300002075 Bacteria 514
7 JGI24744J21845_10020245 3300002077 Bacteria 1313
8 rootH1_10019294 3300003316 Bacteria 3632
9 rootH1_10019294 3300003323 Bacteria 5798
10 rootL2_10004332 3300003322 Bacteria 3772
11 rootH1_10020729 3300003323 Bacteria 3673
12 Ga0070658_10000837 3300005327 Bacteria 26278
13 Ga0070658_10014587 3300005327 Bacteria 6306
14 Ga0070658_10140334 3300005327 Bacteria 2018
15 Ga0070683_100002179 3300005329 Bacteria 15491
16 Ga0070683_100061274 3300005329 Bacteria 3498
17 Ga0070683_100645343 3300005329 Bacteria 1013
18 Ga0070683_100813333 3300005329 Bacteria 896
19 Ga0070683_101189738 3300005329 Bacteria 732
20 Ga0068869_100473397 3300005334 Bacteria 1042
21 Ga0070680_100120271 3300005336 Bacteria 2192
22 Ga0070680_100145734 3300005336 Bacteria 1986
23 Ga0070682_100775231 3300005337 Bacteria 777
24 Ga0068868_100018427 3300005338 Bacteria 5221
25 Ga0068868_100984671 3300005338 Bacteria 771
26 Ga0070660_100000656 3300005339 Bacteria 22861
27 Ga0070660_100206118 3300005339 Bacteria 1596
28 Ga0070689_100113379 3300005340 Bacteria 2159
29 Ga0070689_100782124 3300005340 Bacteria 838
30 Ga0070689_101685507 3300005340 Bacteria 577
31 Ga0070691_10019483 3300005341 Bacteria 3132
32 Ga0070691_10042258 3300005341 Bacteria 2157
33 Ga0070687_100155759 3300005343 Bacteria 1346
34 Ga0070687_100666341 3300005343 Bacteria 723
35 Ga0070661_100003829 3300005344 Bacteria 10359
36 Ga0070661_100007025 3300005344 Bacteria 7767
37 Ga0070661_100082241 3300005344 Bacteria 2378
38 Ga0070661_100084253 3300005344 Bacteria 2349
39 Ga0070692_10048424 3300005345 Bacteria 2202
40 Ga0070692_10110673 3300005345 Bacteria 1518
41 Ga0070692_10111231 3300005345 Bacteria 1515
42 Ga0070692_11253776 3300005345 Bacteria 530
43 Ga0070668_100080661 3300005347 Bacteria 2550
44 Ga0070668_100312571 3300005347 Bacteria 1321
45 Ga0070675_100000058 3300005354 Bacteria 66874
46 Ga0070675_100124017 3300005354 Bacteria 2197
47 Ga0070675_100506181 3300005354 Bacteria 1089
48 Ga0070675_100801056 3300005354 Bacteria 861
49 Ga0070674_100210354 3300005356 Bacteria 1507
50 Ga0070674_100852942 3300005356 Bacteria 790
51 Ga0070673_100276431 3300005364 Bacteria 1471
52 Ga0070673_100529096 3300005364 Bacteria 1069
53 Ga0070688_100031487 3300005365 Bacteria 3191
54 Ga0070659_100145978 3300005366 Bacteria 1927
55 Ga0070659_100150365 3300005366 Bacteria 1899
56 Ga0070667_100695548 3300005367 Bacteria 941
57 Ga0070667_101244401 3300005367 Bacteria 697
58 Ga0070709_10280957 3300005434 Bacteria 1210
59 Ga0070714_100954413 3300005435 Bacteria 834
60 Ga0070714_101624306 3300005435 Bacteria 631
61 Ga0070713_101065364 3300005436 Bacteria 781
62 Ga0070710_10089684 3300005437 Bacteria 1811
63 Ga0070710_10106516 3300005437 Bacteria 1678
64 Ga0070710_10679704 3300005437 Bacteria 724
65 Ga0070710_11114500 3300005437 Bacteria 580
66 Ga0070701_10100527 3300005438 Bacteria 1601
67 Ga0070701_10307818 3300005438 Bacteria 976
68 Ga0070711_100025979 3300005439 Bacteria 3835
69 Ga0070705_100065458 3300005440 Bacteria 2176
70 Ga0070705_100433557 3300005440 Bacteria 982
71 Ga0070700_100006178 3300005441 Bacteria 6382
72 Ga0070694_100171842 3300005444 Bacteria 1597
73 Ga0070708_100716232 3300005445 Bacteria 942
74 Ga0070663_100001885 3300005455 Bacteria 11713
75 Ga0070663_100443017 3300005455 Bacteria 1069
76 Ga0070678_100048315 3300005456 Bacteria 3063
77 Ga0070678_100495089 3300005456 Bacteria 1078
78 Ga0070662_100049513 3300005457 Bacteria 3030
79 Ga0070681_10230800 3300005458 Bacteria 1765
80 Ga0070681_10477120 3300005458 Bacteria 1160
81 Ga0070681_10752767 3300005458 Bacteria 891
82 Ga0068867_100014807 3300005459 Bacteria 5530
83 Ga0068867_101216027 3300005459 Bacteria 693
84 Ga0070685_10000018 3300005466 Bacteria 110132
85 Ga0070685_10210152 3300005466 Bacteria 1270
86 Ga0070685_10500573 3300005466 Bacteria 860
87 Ga0070685_11319912 3300005466 Bacteria 551
88 Ga0070706_101222659 3300005467 Bacteria 690
89 Ga0070707_100099915 3300005468 Bacteria 2811
90 Ga0070707_101203616 3300005468 Bacteria 724
91 Ga0070707_101276351 3300005468 Bacteria 701
92 Ga0070698_100089935 3300005471 Bacteria 3054
93 Ga0070698_100144585 3300005471 Bacteria 2328
94 Ga0070698_100249595 3300005471 Bacteria 1707
95 Ga0070698_100302639 3300005471 Bacteria 1530
96 Ga0070699_100095426 3300005518 Bacteria 2604
97 Ga0070699_100408032 3300005518 Bacteria 1229
98 Ga0070679_100025244 3300005530 Bacteria 5829
99 Ga0070679_100508379 3300005530 Bacteria 1149
100 Ga0070684_100026476 3300005535 Bacteria 4887
101 Ga0070684_100117829 3300005535 Bacteria 2386
102 Ga0070684_100127167 3300005535 Bacteria 2296
103 Ga0070684_100254441 3300005535 Bacteria 1605
104 Ga0070684_100638944 3300005535 Bacteria 990
105 Ga0070684_101172118 3300005535 Bacteria 722
106 Ga0070697_100299975 3300005536 Bacteria 1381
107 Ga0070697_100453822 3300005536 Bacteria 1117
108 Ga0070697_101514224 3300005536 Bacteria 599
109 Ga0068853_100158454 3300005539 Bacteria 2041
110 Ga0068853_100820604 3300005539 Bacteria 891
111 Ga0068853_101103216 3300005539 Bacteria 765
112 Ga0070672_100003065 3300005543 Bacteria 10774
113 Ga0070686_100045942 3300005544 Bacteria 2753
114 Ga0070686_100219870 3300005544 Bacteria 1372
115 Ga0070686_100374171 3300005544 Bacteria 1076
116 Ga0070686_100439780 3300005544 Bacteria 1000
117 Ga0070686_101429008 3300005544 Bacteria 581
118 Ga0070695_100104326 3300005545 Bacteria 1914
119 Ga0070695_100583553 3300005545 Bacteria 875
120 Ga0070695_101450786 3300005545 Bacteria 570
121 Ga0070696_101070939 3300005546 Bacteria 676
122 Ga0070693_100226572 3300005547 Bacteria 1228
123 Ga0070665_100007985 3300005548 Bacteria 10722
124 Ga0070665_100297870 3300005548 Bacteria 1615
125 Ga0070665_100489489 3300005548 Bacteria 1241
126 Ga0070665_100827462 3300005548 Bacteria 939
127 Ga0070665_101121642 3300005548 Bacteria 798
128 Ga0070704_100513082 3300005549 Bacteria 1042
129 Ga0070704_100631806 3300005549 Bacteria 944
130 Ga0070704_100717330 3300005549 Bacteria 888
131 Ga0068855_100048608 3300005563 Bacteria 5006
132 Ga0068855_100076144 3300005563 Bacteria 3895
133 Ga0068855_100178147 3300005563 Bacteria 2404
134 Ga0068855_100289079 3300005563 Bacteria 1818
135 Ga0068855_100520182 3300005563 Bacteria 1291
136 Ga0068855_101818507 3300005563 Bacteria 619
137 Ga0070664_100063698 3300005564 Bacteria 3143
138 Ga0070664_100183393 3300005564 Bacteria 1861
139 Ga0070664_102210777 3300005564 Bacteria 522
140 Ga0068857_100183686 3300005577 Bacteria 1903
141 Ga0068857_100906205 3300005577 Bacteria 846
142 Ga0068857_101107803 3300005577 Bacteria 765
143 Ga0068854_100002182 3300005578 Bacteria 12036
144 Ga0068854_100142891 3300005578 Bacteria 1838
145 Ga0068856_100111797 3300005614 Bacteria 2729
146 Ga0068856_100708899 3300005614 Bacteria 1027
147 Ga0068856_101043321 3300005614 Bacteria 835
148 Ga0070702_100061555 3300005615 Bacteria 2186
149 Ga0070702_100071245 3300005615 Bacteria 2054
150 Ga0070702_100285925 3300005615 Bacteria 1134
151 Ga0068852_100055949 3300005616 Bacteria 3407
152 Ga0068852_100140032 3300005616 Bacteria 2238
153 Ga0068852_100433753 3300005616 Bacteria 1298
154 Ga0068852_100569733 3300005616 Bacteria 1134
155 Ga0068852_102261541 3300005616 Bacteria 565
156 Ga0068852_102676941 3300005616 Bacteria 518
157 Ga0068859_100480801 3300005617 Bacteria 1337
158 Ga0068859_100740532 3300005617 Bacteria 1072
159 Ga0068864_100195287 3300005618 Bacteria 1857
160 Ga0068864_100889803 3300005618 Bacteria 879
161 Ga0068864_101770933 3300005618 Bacteria 623
162 Ga0068861_100294474 3300005719 Bacteria 1403
163 Ga0068861_100729056 3300005719 Bacteria 924
164 Ga0068851_10030626 3300005834 Bacteria 2669
165 Ga0068851_10289560 3300005834 Bacteria 939
166 Ga0068863_100034635 3300005841 Bacteria 4808
167 Ga0068863_100174686 3300005841 Bacteria 2061
168 Ga0068863_100717007 3300005841 Bacteria 995
169 Ga0068858_100185145 3300005842 Bacteria 1967
170 Ga0068858_100318187 3300005842 Bacteria 1487
171 Ga0068858_100335793 3300005842 Bacteria 1446
172 Ga0068860_100287411 3300005843 Bacteria 1608
173 Ga0068860_100302635 3300005843 Bacteria 1567
174 Ga0068860_100343956 3300005843 Bacteria 1467
175 Ga0068862_100944826 3300005844 Bacteria 850
176 Ga0068862_101748052 3300005844 Bacteria 631
177 Ga0081540_1007014 3300005983 Bacteria 8106
178 Ga0081539_10012514 3300005985 Bacteria 6527
179 Ga0070717_10005511 3300006028 Bacteria 9238
180 Ga0070717_10026482 3300006028 Bacteria 4625
181 Ga0075365_10002695 3300006038 Bacteria 8843
182 Ga0075368_10181916 3300006042 Bacteria 886
183 Ga0075363_100025203 3300006048 Bacteria 3030
184 Ga0075363_100087174 3300006048 Bacteria 1715
185 Ga0075363_100111943 3300006048 Bacteria 1518
186 Ga0070715_10025416 3300006163 Bacteria 2345
187 Ga0070716_100023594 3300006173 Bacteria 3263
188 Ga0070716_100055912 3300006173 Bacteria 2260
189 Ga0070712_100029436 3300006175 Bacteria 3680
190 Ga0070712_100069077 3300006175 Bacteria 2520
191 Ga0070712_100258849 3300006175 Bacteria 1393
192 Ga0075367_10028464 3300006178 Bacteria 3188
193 Ga0075367_10481425 3300006178 Bacteria 787
194 Ga0075367_11015420 3300006178 Bacteria 530
195 Ga0097621_100072163 3300006237 Bacteria 2855
196 Ga0097621_100856565 3300006237 Bacteria 844
197 Ga0097621_101775840 3300006237 Bacteria 588
198 Ga0068871_100070674 3300006358 Bacteria 2869
199 Ga0068871_100497261 3300006358 Bacteria 1099
200 Ga0075433_10083308 3300006852 Bacteria 2822
201 Ga0075434_100275207 3300006871 Bacteria 1703
202 Ga0075434_100613677 3300006871 Bacteria 1107
203 Ga0075434_101107592 3300006871 Bacteria 805
204 Ga0068865_100111966 3300006881 Bacteria 2015
205 Ga0075436_100213637 3300006914 Bacteria 1368
206 Ga0075436_100241157 3300006914 Bacteria 1286
207 Ga0097620_100480800 3300006931 Bacteria 1337
208 Ga0097620_100740568 3300006931 Bacteria 1072
209 Ga0075435_100007003 3300007076 Bacteria 8003
210 Ga0075435_100079835 3300007076 Bacteria 2685
211 Ga0075435_100924283 3300007076 Bacteria 761
212 Ga0105240_10096869 3300009093 Bacteria 3595
213 Ga0105240_10195564 3300009093 Bacteria 2375
214 Ga0105240_10455705 3300009093 Bacteria 1430
215 Ga0111539_10736246 3300009094 Bacteria 1148
216 Ga0111539_11291347 3300009094 Bacteria 847
217 Ga0105245_10031939 3300009098 Bacteria 4661
218 Ga0105245_10051216 3300009098 Bacteria 3702
219 Ga0105245_10054515 3300009098 Bacteria 3591
220 Ga0105245_10444321 3300009098 Bacteria 1304
221 Ga0105245_11809896 3300009098 Bacteria 663
222 Ga0105247_10003405 3300009101 Bacteria 10392
223 Ga0105247_10059034 3300009101 Bacteria 2374
224 Ga0105247_10100913 3300009101 Bacteria 1845
225 Ga0105247_10308479 3300009101 Bacteria 1100
226 Ga0114129_11051038 3300009147 Bacteria 1022
227 Ga0105243_10044738 3300009148 Bacteria 3475
228 Ga0105243_10161107 3300009148 Bacteria 1934
229 Ga0105241_10364673 3300009174 Bacteria 1258
230 Ga0105241_10391464 3300009174 Bacteria 1217
231 Ga0105241_10506688 3300009174 Bacteria 1077
232 Ga0105241_10748638 3300009174 Bacteria 896
233 Ga0105242_11649364 3300009176 Bacteria 676
234 Ga0105248_10416374 3300009177 Bacteria 1513
235 Ga0105248_10642500 3300009177 Bacteria 1197
236 Ga0105237_10102701 3300009545 Bacteria 2851
237 Ga0105237_10334587 3300009545 Bacteria 1518
238 Ga0105237_10351971 3300009545 Bacteria 1477
239 Ga0105238_10417193 3300009551 Bacteria 1336
240 Ga0105238_11493095 3300009551 Bacteria 704
241 Ga0105238_11829484 3300009551 Bacteria 639
242 Ga0105249_11766032 3300009553 Bacteria 691
243 Ga0105239_10017268 3300010375 Bacteria 7979
244 Ga0105239_10076207 3300010375 Bacteria 3688
245 Ga0105239_10099111 3300010375 Bacteria 3221
246 Ga0105246_10067722 3300011119 Bacteria 2502
247 Ga0105246_10169717 3300011119 Bacteria 1670
248 Ga0105246_10197013 3300011119 Bacteria 1563
249 Ga0157340_1016527 3300012473 Bacteria 584
250 Ga0157337_1006060 3300012483 Bacteria 826
251 Ga0157343_1003277 3300012488 Bacteria 940
252 Ga0157345_1008401 3300012498 Bacteria 862
253 Ga0157338_1005742 3300012515 Bacteria 1125
254 Ga0157373_10371284 3300013100 Bacteria 1022
255 Ga0157371_10562405 3300013102 Bacteria 846
256 Ga0157370_10014681 3300013104 Bacteria 8001
257 Ga0157370_10041853 3300013104 Bacteria 4417
258 Ga0157369_10148746 3300013105 Bacteria 2475
259 Ga0157369_10152692 3300013105 Bacteria 2441
260 Ga0157369_10431680 3300013105 Bacteria 1365
261 Ga0157374_10101071 3300013296 Bacteria 2765
262 Ga0157374_10495011 3300013296 Bacteria 1227
263 Ga0157374_10559380 3300013296 Bacteria 1152
264 Ga0157378_10018399 3300013297 Bacteria 6135
265 Ga0157378_10700127 3300013297 Bacteria 1032
266 Ga0157378_10758731 3300013297 Bacteria 993
267 Ga0163162_10258325 3300013306 Bacteria 1874
268 Ga0163162_10787816 3300013306 Bacteria 1069
269 Ga0163162_11041657 3300013306 Bacteria 926
270 Ga0163162_13420677 3300013306 Bacteria 506
271 Ga0157372_10002742 3300013307 Bacteria 19035
272 Ga0157372_10096924 3300013307 Bacteria 3362
273 Ga0157372_10181318 3300013307 Bacteria 2438
274 Ga0157372_10356500 3300013307 Bacteria 1704
275 Ga0157372_10428001 3300013307 Bacteria 1543
276 Ga0157372_10483147 3300013307 Bacteria 1444
277 Ga0157375_10005846 3300013308 Bacteria 10706
278 Ga0157375_10035444 3300013308 Bacteria 4763
279 Ga0157375_10185181 3300013308 Bacteria 2235
280 Ga0163163_10039877 3300014325 Bacteria 4585
281 Ga0163163_10212728 3300014325 Bacteria 1982
282 Ga0157380_10001287 3300014326 Bacteria 16323
283 Ga0157380_10682573 3300014326 Bacteria 1029
284 Ga0157380_11542396 3300014326 Bacteria 718
285 Ga0182008_10140327 3300014497 Bacteria 1208
286 Ga0182008_10362774 3300014497 Bacteria 771
287 Ga0157377_10097549 3300014745 Bacteria 1745
288 Ga0157379_10012172 3300014968 Bacteria 7514
289 Ga0157379_10074934 3300014968 Bacteria 3029
290 Ga0157376_10087491 3300014969 Bacteria 2689
291 Ga0157376_10783793 3300014969 Bacteria 965
292 Ga0163161_11841974 3300017792 Bacteria 538
293 Ga0197907_10741091 3300020069 Bacteria 664
294 Ga0206356_11377664 3300020070 Bacteria 1419
295 Ga0206351_10742472 3300020077 Bacteria 532
296 Ga0206352_11139450 3300020078 Bacteria 2265
297 Ga0206350_11550094 3300020080 Bacteria 1264
298 Ga0206354_10194282 3300020081 Bacteria 904
299 Ga0206353_11982173 3300020082 Bacteria 2668
300 Ga0224712_10004145 3300022467 Bacteria 3876
301 Ga0224712_10050208 3300022467 Bacteria 1619
302 Ga0207656_10218619 3300025321 Bacteria 925
303 Ga0207692_10179473 3300025898 Bacteria 1232
304 Ga0207710_10162647 3300025900 Bacteria 1088
305 Ga0207688_10015276 3300025901 Bacteria 4167
306 Ga0207647_10111347 3300025904 Bacteria 1618
307 Ga0207685_10022996 3300025905 Bacteria 2115
308 Ga0207699_10216754 3300025906 Bacteria 1304
309 Ga0207699_10275254 3300025906 Bacteria 1168
310 Ga0207699_10534254 3300025906 Bacteria 849
311 Ga0207645_10469146 3300025907 Bacteria 851
312 Ga0207705_10009276 3300025909 Bacteria 7156
313 Ga0207705_10028127 3300025909 Bacteria 4008
314 Ga0207705_10049029 3300025909 Bacteria 3039
315 Ga0207684_10610444 3300025910 Bacteria 931
316 Ga0207684_10899035 3300025910 Bacteria 744
317 Ga0207654_10239784 3300025911 Bacteria 1211
318 Ga0207707_10129487 3300025912 Bacteria 2207
319 Ga0207707_10307348 3300025912 Bacteria 1370
320 Ga0207707_10360019 3300025912 Bacteria 1253
321 Ga0207707_10689037 3300025912 Bacteria 859
322 Ga0207695_10101287 3300025913 Bacteria 2875
323 Ga0207695_10563125 3300025913 Bacteria 1021
324 Ga0207695_10659627 3300025913 Bacteria 927
325 Ga0207671_10582300 3300025914 Bacteria 892
326 Ga0207693_10010038 3300025915 Bacteria 7693
327 Ga0207693_10176576 3300025915 Bacteria 1681
328 Ga0207663_10034703 3300025916 Bacteria 3020
329 Ga0207663_10089401 3300025916 Bacteria 2039
330 Ga0207660_10324957 3300025917 Bacteria 1229
331 Ga0207660_10428823 3300025917 Bacteria 1067
332 Ga0207660_10620252 3300025917 Bacteria 881
333 Ga0207662_10180614 3300025918 Bacteria 1358
334 Ga0207662_11025251 3300025918 Bacteria 586
335 Ga0207657_10004970 3300025919 Bacteria 13991
336 Ga0207657_10073205 3300025919 Bacteria 2896
337 Ga0207649_10000640 3300025920 Bacteria 23374
338 Ga0207649_10059266 3300025920 Bacteria 2401
339 Ga0207649_10071992 3300025920 Bacteria 2210
340 Ga0207649_10079758 3300025920 Bacteria 2115
341 Ga0207652_10093202 3300025921 Bacteria 2650
342 Ga0207652_10132737 3300025921 Bacteria 2222
343 Ga0207646_10085683 3300025922 Bacteria 2818
344 Ga0207646_11310495 3300025922 Bacteria 632
345 Ga0207646_11561433 3300025922 Bacteria 570
346 Ga0207681_10230352 3300025923 Bacteria 1438
347 Ga0207694_10088032 3300025924 Bacteria 2447
348 Ga0207694_10419951 3300025924 Bacteria 1114
349 Ga0207650_11287160 3300025925 Bacteria 622
350 Ga0207659_10213475 3300025926 Bacteria 1548
351 Ga0207659_10679715 3300025926 Bacteria 881
352 Ga0207659_11645186 3300025926 Bacteria 547
353 Ga0207687_10031396 3300025927 Bacteria 3589
354 Ga0207687_10281643 3300025927 Bacteria 1333
355 Ga0207687_10304332 3300025927 Bacteria 1285
356 Ga0207687_11234009 3300025927 Bacteria 643
357 Ga0207700_10000834 3300025928 Bacteria 17809
358 Ga0207700_10065094 3300025928 Bacteria 2780
359 Ga0207700_10896213 3300025928 Bacteria 794
360 Ga0207700_11210069 3300025928 Bacteria 674
361 Ga0207664_10033865 3300025929 Bacteria 3930
362 Ga0207664_11257130 3300025929 Bacteria 659
363 Ga0207690_10045743 3300025932 Bacteria 2894
364 Ga0207690_10055387 3300025932 Bacteria 2671
365 Ga0207690_11071434 3300025932 Bacteria 671
366 Ga0207706_10009875 3300025933 Bacteria 8756
367 Ga0207686_11851913 3300025934 Bacteria 500
368 Ga0207709_10123527 3300025935 Bacteria 1752
369 Ga0207709_10631389 3300025935 Bacteria 851
370 Ga0207670_10067535 3300025936 Bacteria 2460
371 Ga0207670_11757930 3300025936 Bacteria 527
372 Ga0207669_10182335 3300025937 Bacteria 1506
373 Ga0207669_10819505 3300025937 Bacteria 773
374 Ga0207704_10048923 3300025938 Bacteria 2539
375 Ga0207665_10004593 3300025939 Bacteria 9169
376 Ga0207665_10009806 3300025939 Bacteria 6288
377 Ga0207665_10185061 3300025939 Bacteria 1510
378 Ga0207691_10006847 3300025940 Bacteria 11000
379 Ga0207711_10151720 3300025941 Bacteria 2091
380 Ga0207689_11095796 3300025942 Bacteria 671
381 Ga0207661_10015634 3300025944 Bacteria 5590
382 Ga0207661_10086922 3300025944 Bacteria 2595
383 Ga0207661_10170287 3300025944 Bacteria 1895
384 Ga0207661_11616945 3300025944 Bacteria 593
385 Ga0207679_10040410 3300025945 Bacteria 3339
386 Ga0207679_10075478 3300025945 Bacteria 2558
387 Ga0207679_11284349 3300025945 Bacteria 672
388 Ga0207667_10168466 3300025949 Bacteria 2251
389 Ga0207667_10183375 3300025949 Bacteria 2149
390 Ga0207667_10531611 3300025949 Bacteria 1190
391 Ga0207667_10556241 3300025949 Bacteria 1160
392 Ga0207651_10206221 3300025960 Bacteria 1579
393 Ga0207668_10043828 3300025972 Bacteria 3039
394 Ga0207640_10008058 3300025981 Bacteria 5827
395 Ga0207658_10935494 3300025986 Bacteria 790
396 Ga0207677_10000046 3300026023 Bacteria 105382
397 Ga0207677_10358931 3300026023 Bacteria 1223
398 Ga0207677_11008436 3300026023 Bacteria 755
399 Ga0207677_11286419 3300026023 Bacteria 671
400 Ga0207703_10144390 3300026035 Bacteria 2068
401 Ga0207703_10163962 3300026035 Bacteria 1948
402 Ga0207703_10194989 3300026035 Bacteria 1796
403 Ga0207703_10780284 3300026035 Bacteria 912
404 Ga0207639_10512408 3300026041 Bacteria 1097
405 Ga0207639_10667729 3300026041 Bacteria 962
406 Ga0207639_11071134 3300026041 Bacteria 756
407 Ga0207678_10000994 3300026067 Bacteria 25831
408 Ga0207708_10002088 3300026075 Bacteria 14696
409 Ga0207708_11417345 3300026075 Bacteria 610
410 Ga0207702_10002965 3300026078 Bacteria 15824
411 Ga0207702_10085598 3300026078 Bacteria 2747
412 Ga0207702_10088146 3300026078 Bacteria 2710
413 Ga0207702_10544230 3300026078 Bacteria 1135
414 Ga0207702_11049868 3300026078 Bacteria 808
415 Ga0207702_11610320 3300026078 Bacteria 643
416 Ga0207641_10024322 3300026088 Bacteria 4992
417 Ga0207641_10371456 3300026088 Bacteria 1367
418 Ga0207648_10022910 3300026089 Bacteria 5602
419 Ga0207648_10520220 3300026089 Bacteria 1090
420 Ga0207676_10072422 3300026095 Bacteria 2770
421 Ga0207676_10809468 3300026095 Bacteria 914
422 Ga0207676_11918266 3300026095 Bacteria 591
423 Ga0207676_12275667 3300026095 Bacteria 540
424 Ga0207674_10037977 3300026116 Bacteria 5003
425 Ga0207674_10045370 3300026116 Bacteria 4521
426 Ga0207674_10184966 3300026116 Bacteria 2034
427 Ga0207674_10303678 3300026116 Bacteria 1545
428 Ga0207674_10599285 3300026116 Bacteria 1064
429 Ga0207674_11786403 3300026116 Bacteria 582
430 Ga0207675_100015728 3300026118 Bacteria 7055
431 Ga0207675_100520636 3300026118 Bacteria 1185
432 Ga0207675_100733562 3300026118 Bacteria 998
433 Ga0207698_10045232 3300026142 Bacteria 3315
434 Ga0207698_10132283 3300026142 Bacteria 2134
435 Ga0207698_10715957 3300026142 Bacteria 997
436 Ga0207698_11940666 3300026142 Bacteria 603
437 Ga0268266_10000553 3300028379 Bacteria 52199
438 Ga0268266_10298906 3300028379 Bacteria 1501
439 Ga0268266_10802255 3300028379 Bacteria 909
440 Ga0268265_10093436 3300028380 Bacteria 2410
441 Ga0268265_10628590 3300028380 Bacteria 1030
442 Ga0268265_12054508 3300028380 Bacteria 579
443 Ga0268264_10080508 3300028381 Bacteria 2781
444 Ga0268264_10301837 3300028381 Bacteria 1508
445 Ga0268264_10343081 3300028381 Bacteria 1419
446 Ga0268264_10394381 3300028381 Bacteria 1329
447 Ga0265337_1068111 3300028556 Bacteria 980
448 Ga0265326_10004541 3300028558 Bacteria 4439
449 Ga0265319_1002478 3300028563 Bacteria 10058
450 Ga0265319_1154415 3300028563 Unclassified 710
451 Ga0265334_10007110 3300028573 Bacteria 4801
452 Ga0265334_10018224 3300028573 Bacteria 2896
453 Ga0265334_10024182 3300028573 Bacteria 2466
454 Ga0265318_10016790 3300028577 Bacteria 3016
455 Ga0265323_10018987 3300028653 Bacteria 2656
456 Ga0265323_10065434 3300028653 Bacteria 1254
457 Ga0265322_10022955 3300028654 Bacteria 1785
458 Ga0265322_10025058 3300028654 Bacteria 1706
459 Ga0265336_10029207 3300028666 Bacteria 1721
460 Ga0265336_10072306 3300028666 Bacteria 1031
461 Ga0265338_10044169 3300028800 Bacteria 4119
462 Ga0265338_10073792 3300028800 Bacteria 2906
463 Ga0265338_10777518 3300028800 Bacteria 657
464 Ga0265324_10005854 3300029957 Bacteria 5230
465 Ga0265324_10215987 3300029957 Bacteria 651
466 Ga0307511_10327865 3300030521 Bacteria 672
467 Ga0265330_10055404 3300031235 Bacteria 1732
468 Ga0265330_10061982 3300031235 Bacteria 1627
469 Ga0265330_10411926 3300031235 Bacteria 572
470 Ga0265332_10076382 3300031238 Bacteria 1423
471 Ga0265320_10019311 3300031240 Bacteria 3728
472 Ga0265320_10063595 3300031240 Bacteria 1755
473 Ga0265320_10256365 3300031240 Unclassified 775
474 Ga0265325_10023928 3300031241 Bacteria 3327
475 Ga0265325_10024057 3300031241 Bacteria 3316
476 Ga0265325_10081921 3300031241 Bacteria 1602
477 Ga0265329_10047998 3300031242 Bacteria 1362
478 Ga0265340_10017744 3300031247 Bacteria 3681
479 Ga0265339_10034458 3300031249 Bacteria 2844
480 Ga0265339_10245490 3300031249 Bacteria 868
481 Ga0265331_10057161 3300031250 Bacteria 1851
482 Ga0265331_10096514 3300031250 Bacteria 1363
483 Ga0265316_10003201 3300031344 Bacteria 16639
484 Ga0265316_10042233 3300031344 Bacteria 3645
485 Ga0265316_10074613 3300031344 Bacteria 2610
486 Ga0265316_10150916 3300031344 Bacteria 1741
487 Ga0265316_10230985 3300031344 Bacteria 1362
488 Ga0307509_10015370 3300031507 Bacteria 8931
489 Ga0307408_100750489 3300031548 Bacteria 881
490 Ga0265313_10037334 3300031595 Bacteria 2431
491 Ga0265313_10104710 3300031595 Bacteria 1251
492 Ga0307508_10659648 3300031616 Bacteria 652
493 Ga0307514_10338512 3300031649 Bacteria 812
494 Ga0316575_10136477 3300031665 Bacteria 1008
495 Ga0316575_10147646 3300031665 Bacteria 969
496 Ga0316579_10050647 3300031691 Bacteria 1942
497 Ga0265314_10051035 3300031711 Bacteria 2883
498 Ga0265314_10239729 3300031711 Bacteria 1047
499 Ga0265342_10023479 3300031712 Bacteria 3903
500 Ga0265342_10096101 3300031712 Bacteria 1693
501 Ga0316576_10136676 3300031727 Bacteria 1845
502 Ga0316576_10258278 3300031727 Bacteria 1307
503 Ga0316577_10000301 3300031733 Bacteria 17934
504 Ga0307413_10050524 3300031824 Bacteria 2499
505 Ga0307410_10315822 3300031852 Bacteria 1238
506 Ga0307407_11482701 3300031903 Bacteria 536
507 Ga0307416_103131102 3300032002 Bacteria 553
508 Ga0307411_11132800 3300032005 Bacteria 707
509 Ga0316583_10028297 3300032133 Bacteria 1999
510 Ga0307510_10078897 3300033180 Bacteria 3215
511 Ga0373948_0089895 3300034817 Bacteria 711
512 Ga0373926_0161112 3300035083 Bacteria 856
513 Ga0373944_0041682 3300035089 Bacteria 1421
514 Ga0373936_0072994 3300035113 Bacteria 1417
515 Ga0373939_0441778 3300035114 Bacteria 546
516 Ga0373957_0021239 3300035120 Bacteria 2302
517 Ga0373960_0061821 3300035121 Bacteria 1138
518 Ga0373960_0072754 3300035121 Bacteria 1067
519 Ga0373943_0029188 3300035170 Bacteria 2605
520 Ga0373946_0031147 3300035171 Bacteria 2134
521 Ga0373946_0070506 3300035171 Bacteria 1508
522 Ga0373962_0074101 3300035242 Bacteria 1023
523 Ga0316574_0051044 3300035398 Bacteria 2577
524 Ga0316574_0156371 3300035398 Bacteria 1469
525 Ga0316574_0273510 3300035398 Bacteria 1077
526 Ga0316574_0979439 3300035398 Bacteria 509
527 Ga0373931_0188208 3300035691 Bacteria 1226
528 Ga0373931_1302781 3300035691 Bacteria 500
529 Ga0373935_0227045 3300035692 Bacteria 1299
530 Ga0373927_0344113 3300035695 Bacteria 982
531 Ga0373947_0105320 3300035725 Bacteria 1777
532 Ga0373937_1877009 3300036401 Bacteria 545
533 Ga0316582_0023098 3300036647 Bacteria 3702
534 Ga0316582_0043735 3300036647 Bacteria 2812
535 Ga0316582_0587356 3300036647 Bacteria 767
536 Ga0316584_0011154 3300036712 Bacteria 6309
537 Ga0316584_0215526 3300036712 Bacteria 1412
538 Ga0373925_0673566 3300037068 Bacteria 853
539 Ga0373925_1083146 3300037068 Bacteria 659
540 Ga0395898_0273217 3300037466 Bacteria 1612
541 Ga0395898_1159733 3300037466 Bacteria 705
542 Ga0395905_0174439 3300037471 Bacteria 2019
543 Ga0316581_0042578 3300037588 Bacteria 1385
544 Ga0395901_0200109 3300038443 Bacteria 2094
545 Ga0395901_0380877 3300038443 Bacteria 1452
546 Ga0395901_0602388 3300038443 Bacteria 1108
547 Ga0242420_092171 3300038996 Bacteria 637
548 Ga0436365_1839893 3300039437 Bacteria 588
549 Ga0451791_0075505 3300041451 Bacteria 568
550 Ga0451793_0425389 3300041452 Bacteria 965
551 Ga0451833_1338646 3300041491 Bacteria 1733
552 Ga0451835_0783680 3300041492 Bacteria 800
553 Ga0451839_0778726 3300041496 Bacteria 795
554 Ga0451853_3914549 3300041512 Bacteria 673
555 Ga0451577_0105335 3300042876 Bacteria 2521
556 Ga0451577_1933077 3300042876 Bacteria 516
557 Ga0466966_0103590 3300044684 Bacteria 1759
558 Ga0466961_0421020 3300044693 Bacteria 809
559 Ga0453684_0189070 3300044712 Bacteria 2410
560 Ga0466957_1348101 3300044842 Bacteria 518
561 Ga0466958_0085882 3300045836 Bacteria 1941
562 Ga0466967_0617371 3300045976 Bacteria 1071
563 Ga0466967_0905023 3300045976 Bacteria 877
564 Ga0495592_0271245 3300046454 Bacteria 1113
565 Ga0495641_0142667 3300046461 Bacteria 1070
566 Ga0495641_0153502 3300046461 Bacteria 1029
567 Ga0495651_0556437 3300046462 Bacteria 728
568 Ga0495653_0283514 3300046463 Bacteria 1086
569 Ga0495580_0176425 3300046472 Bacteria 1476
570 Ga0495580_0893645 3300046472 Bacteria 571
571 Ga0495605_0247180 3300046474 Bacteria 764
572 Ga0495639_0282392 3300046475 Bacteria 825
573 Ga0495584_0182364 3300046491 Bacteria 1067
574 Ga0495584_0697020 3300046491 Bacteria 518
575 Ga0495594_0710537 3300046499 Bacteria 568
576 Ga0495596_0452494 3300046500 Bacteria 501
577 Ga0495606_0000211 3300046507 Bacteria 103386
578 Ga0495610_0032849 3300046512 Bacteria 2690
579 Ga0495618_0025161 3300046514 Bacteria 3693
580 Ga0495618_0566145 3300046514 Bacteria 679
581 Ga0495620_0267416 3300046515 Bacteria 651
582 Ga0495628_0091581 3300046516 Bacteria 2353
583 Ga0495628_0886318 3300046516 Bacteria 620
584 Ga0495630_0295489 3300046517 Bacteria 1238
585 Ga0495644_0230495 3300046523 Bacteria 717
586 Ga0495666_0205935 3300046526 Bacteria 903
587 Ga0495665_0081252 3300046531 Bacteria 1704
588 Ga0495640_0253819 3300046533 Bacteria 1100
589 Ga0495640_0574508 3300046533 Bacteria 682
590 Ga0495586_0203563 3300046535 Bacteria 1122
591 Ga0495645_0551985 3300046543 Bacteria 714
592 Ga0495667_0272454 3300046559 Bacteria 1075
593 Ga0495656_0000581 3300046615 Bacteria 11854
594 Ga0495656_0084570 3300046615 Bacteria 1439
595 Ga0495656_0276140 3300046615 Bacteria 855
596 Ga0495656_0617262 3300046615 Bacteria 581
597 Ga0495634_0393469 3300046642 Bacteria 824
598 Ga0495634_0646599 3300046642 Bacteria 611
599 Ga0495625_0300020 3300046660 Bacteria 1028
600 Ga0495635_0151138 3300046663 Bacteria 1581
601 Ga0495635_0682523 3300046663 Bacteria 667
602 Ga0495657_0410446 3300046675 Bacteria 796
603 Ga0495599_0585904 3300046678 Bacteria 650
604 Ga0495646_0323281 3300046680 Bacteria 812
605 Ga0495647_0011848 3300046681 Bacteria 2992
606 Ga0495647_0128746 3300046681 Bacteria 1071
607 Ga0495613_0689959 3300046689 Bacteria 673
608 Ga0495581_0153978 3300047315 Bacteria 1343
609 Ga0495676_0002788 3300047321 Bacteria 15720
610 Ga0495676_0351422 3300047321 Bacteria 985
611 Ga0495676_0433590 3300047321 Bacteria 868
612 Ga0495680_0205919 3300047322 Bacteria 1410
613 Ga0495675_0016987 3300047444 Bacteria 4606
614 Ga0495684_0302908 3300047471 Bacteria 1147
615 Ga0495602_0346636 3300048088 Bacteria 1073
616 Ga0496100_0297074 3300048903 Bacteria 1208
617 Ga0496100_0732796 3300048903 Bacteria 772
618 Ga0496100_0754068 3300048903 Bacteria 761
619 Ga0496100_1567220 3300048903 Bacteria 520
620 Ga0496101_0038929 3300048904 Bacteria 3379
621 Ga0496101_0144589 3300048904 Bacteria 1815
622 Ga0496101_0440363 3300048904 Bacteria 1028
623 Ga0496101_1278364 3300048904 Bacteria 574
624 Ga0496102_0013571 3300048905 Bacteria 7062
625 Ga0496102_0187458 3300048905 Bacteria 1950
626 Ga0496102_0245971 3300048905 Bacteria 1686
627 Ga0496102_0360694 3300048905 Bacteria 1368
628 Ga0496103_0301062 3300048906 Bacteria 1032
629 Ga0496104_0036816 3300048907 Bacteria 4575
630 Ga0496104_0120892 3300048907 Bacteria 2515
631 Ga0496104_0198369 3300048907 Bacteria 1919
632 Ga0496104_0666412 3300048907 Bacteria 949
633 Ga0496104_1495396 3300048907 Bacteria 578
634 Ga0496105_0026982 3300048908 Bacteria 4688
635 Ga0496105_0335966 3300048908 Bacteria 1209
636 Ga0496105_0587532 3300048908 Bacteria 866
637 Ga0496105_0895624 3300048908 Bacteria 669
638 Ga0496106_0002210 3300048909 Bacteria 14512
639 Ga0496106_0006426 3300048909 Bacteria 8704
640 Ga0496106_0024191 3300048909 Bacteria 4514
641 Ga0496106_0086614 3300048909 Bacteria 2413
642 Ga0496106_0488124 3300048909 Bacteria 990
643 Ga0496107_0045320 3300048910 Bacteria 3163
644 Ga0496107_0101745 3300048910 Bacteria 2107
645 Ga0496107_0105614 3300048910 Bacteria 2068
646 Ga0496107_0179913 3300048910 Bacteria 1570
647 Ga0496107_0463126 3300048910 Bacteria 941
648 Ga0496108_0015361 3300048911 Bacteria 6245
649 Ga0496108_0098636 3300048911 Bacteria 2489
650 Ga0496108_0161207 3300048911 Bacteria 1938
651 Ga0496109_0021702 3300048912 Bacteria 5682
652 Ga0496109_0049378 3300048912 Bacteria 3830
653 Ga0496109_0089209 3300048912 Bacteria 2850
654 Ga0496109_0119001 3300048912 Bacteria 2459
655 Ga0496109_1555075 3300048912 Bacteria 596
656 Ga0496109_1671592 3300048912 Bacteria 571
657 Ga0496110_0034617 3300048913 Bacteria 4377
658 Ga0496110_0148481 3300048913 Bacteria 2121
659 Ga0496110_1291264 3300048913 Bacteria 639
660 Ga0496111_0046212 3300048914 Bacteria 3134
661 Ga0496111_0095340 3300048914 Bacteria 2183
662 Ga0496111_1354823 3300048914 Bacteria 500
663 Ga0496112_0104047 3300048915 Bacteria 2809
664 Ga0496112_0107970 3300048915 Bacteria 2753
665 Ga0496112_0109113 3300048915 Bacteria 2738
666 Ga0496112_0178988 3300048915 Bacteria 2084
667 Ga0496112_0248996 3300048915 Bacteria 1728
668 Ga0496113_0006121 3300048916 Bacteria 7595
669 Ga0496113_0063931 3300048916 Bacteria 2782
670 Ga0496113_0088342 3300048916 Bacteria 2384
671 Ga0496113_0145595 3300048916 Bacteria 1866
672 Ga0496113_0206704 3300048916 Bacteria 1562
673 Ga0496113_0279184 3300048916 Bacteria 1335
674 Ga0496113_0835744 3300048916 Bacteria 730
675 Ga0496114_0074500 3300048917 Bacteria 2858
676 Ga0496114_0127584 3300048917 Bacteria 2194
677 Ga0496114_0149490 3300048917 Bacteria 2026
678 Ga0496114_0283429 3300048917 Bacteria 1461
679 Ga0496114_0582969 3300048917 Bacteria 987
680 Ga0496115_0019661 3300048918 Bacteria 5199
681 Ga0496115_0045048 3300048918 Bacteria 3521
682 Ga0496115_0100377 3300048918 Bacteria 2372
683 Ga0496115_0116084 3300048918 Bacteria 2201
684 Ga0496115_0225800 3300048918 Bacteria 1545
685 Ga0496115_0265301 3300048918 Bacteria 1412
686 Ga0496126_0122317 3300048929 Bacteria 2256
687 Ga0501031_0041975 3300049568 Bacteria 2987
688 Ga0501031_0152274 3300049568 Bacteria 1511
689 Ga0501033_0363817 3300049570 Bacteria 1012
690 Ga0501034_0100423 3300049571 Bacteria 2888
691 Ga0501034_1363321 3300049571 Bacteria 585
692 Ga0501036_0044477 3300049572 Bacteria 3762
693 Ga0501036_0051632 3300049572 Bacteria 3482
694 Ga0501036_0628087 3300049572 Bacteria 890
695 Ga0501037_0559200 3300049573 Bacteria 771
696 Ga0501038_0091529 3300049574 Bacteria 2548
697 Ga0501038_0975191 3300049574 Bacteria 623
698 Ga0501038_1182140 3300049574 Bacteria 556
699 Ga0501039_0091703 3300049575 Bacteria 2368
700 Ga0501039_0202875 3300049575 Bacteria 1559
701 Ga0501039_0209940 3300049575 Bacteria 1531
702 Ga0501040_0027520 3300049576 Bacteria 3829
703 Ga0501040_0187464 3300049576 Bacteria 1467
704 Ga0501040_1303147 3300049576 Bacteria 527
705 Ga0501041_0138800 3300049577 Bacteria 1515
706 Ga0501041_0364665 3300049577 Bacteria 913
707 Ga0501042_0088515 3300049578 Bacteria 2221
708 Ga0501042_0098693 3300049578 Bacteria 2100
709 Ga0501042_0680854 3300049578 Bacteria 748
710 Ga0501043_0764220 3300049579 Bacteria 701
711 Ga0501046_0020051 3300049580 Bacteria 5536
712 Ga0501046_0453029 3300049580 Bacteria 922
713 Ga0501047_0035628 3300049581 Bacteria 4807
714 Ga0501048_0224932 3300049582 Bacteria 1331
715 Ga0501067_0385471 3300049583 Bacteria 781
716 Ga0501069_0183080 3300049585 Bacteria 1211
717 Ga0501069_0897687 3300049585 Bacteria 539
718 Ga0501070_1364310 3300049586 Bacteria 540
719 Ga0501071_0006530 3300049587 Bacteria 7573
720 Ga0501071_0696167 3300049587 Bacteria 782
721 Ga0501071_1148132 3300049587 Bacteria 600
722 Ga0501071_1344054 3300049587 Bacteria 552
723 Ga0501072_0143032 3300049588 Bacteria 1907
724 Ga0501072_0563877 3300049588 Bacteria 899
725 Ga0501072_0807875 3300049588 Bacteria 734
726 Ga0501073_0050113 3300049589 Bacteria 2927
727 Ga0501074_0099264 3300049590 Bacteria 2084
728 Ga0501074_0157444 3300049590 Bacteria 1622
729 Ga0501074_0201267 3300049590 Bacteria 1419
730 Ga0501075_0072024 3300049591 Bacteria 2612
731 Ga0501076_0032839 3300049592 Bacteria 4053
732 Ga0501076_0079209 3300049592 Bacteria 2637
733 Ga0501077_0082273 3300049593 Bacteria 2040
734 Ga0501079_0043201 3300049741 Bacteria 3479
735 Ga0501079_0383077 3300049741 Bacteria 1103
736 Ga0501080_0286797 3300049742 Bacteria 1496
737 Ga0501080_0350415 3300049742 Bacteria 1333
738 Ga0501081_0005806 3300049743 Bacteria 7993
739 Ga0501035_0567635 3300049822 Bacteria 928
740 Ga0501044_0323661 3300049823 Bacteria 1465
741 Ga0501045_0027461 3300049824 Bacteria 4102
742 Ga0501045_0304972 3300049824 Bacteria 1185
743 Ga0501045_0379893 3300049824 Bacteria 1052
744 nmdc:mga03n38_16781_c1 3300050490 Bacteria 2856
745 nmdc:mga03n38_93831_c1 3300050490 Bacteria 1434
746 nmdc:mga00v17_1061121_c1 3300050491 Bacteria 508
747 nmdc:mga00v17_30140_c1 3300050491 Bacteria 3190
748 nmdc:mga0yw44_6426_c1 3300050492 Bacteria 5679
749 nmdc:mga0yw44_651346_c1 3300050492 Bacteria 716
750 nmdc:mga06z11_1036190_c1 3300050494 Bacteria 500
751 nmdc:mga06z11_181693_c1 3300050494 Bacteria 1213
752 nmdc:mga06z11_416276_c1 3300050494 Bacteria 810
753 nmdc:mga05p37_1893240_c1 3300050507 Bacteria 570
754 nmdc:mga05p37_351841_c1 3300050507 Bacteria 1734
755 nmdc:mga0qj67_134113_c1 3300050509 Bacteria 2006
756 nmdc:mga06r32_141139_c1 3300050510 Bacteria 2385
757 nmdc:mga08y16_130857_c1 3300050511 Bacteria 2609
758 nmdc:mga08y16_463227_c1 3300050511 Bacteria 1291
759 nmdc:mga0n895_613121_c1 3300050512 Bacteria 1090
760 nmdc:mga0rr50_890231_c1 3300050513 Bacteria 759
761 nmdc:mga0rr50_98874_c1 3300050513 Bacteria 2288
762 nmdc:mga08x19_268912_c1 3300050514 Bacteria 1179
763 nmdc:mga0a205_1052873_c1 3300050515 Bacteria 661
764 nmdc:mga0a205_394520_c1 3300050515 Bacteria 1248
765 Ga0495601_0146533 3300053077 Bacteria 1541
766 Ga0495601_0427560 3300053077 Bacteria 857
767 Ga0495612_0000228 3300053078 Bacteria 23756
768 Ga0495612_0017029 3300053078 Bacteria 2911
769 Ga0495612_0253406 3300053078 Bacteria 783
770 Ga0495619_0008589 3300053085 Bacteria 6464
771 Ga0501082_0170864 3300060353 Bacteria 1890
772 Ga0501082_0367825 3300060353 Bacteria 1254
773 Ga0501082_0402496 3300060353 Bacteria 1195
774 2508675543 2508501039 Bacteria 9978592
775 Ga0496119_0254114
776 LJNas_1006518
777 JGI24739J22299_10087628
778 JGI24737J22298_10034214
779 JGI24743J22301_10017239
780 JGI24738J21930_10152362
781 JGI24744J21845_10020245
782 rootH1_10019294
783 rootL2_10004332
784 rootH1_10020729
785 Ga0070658_10000837
786 Ga0070658_10014587
787 Ga0070658_10140334
788 Ga0070683_100002179
789 Ga0070683_100061274
790 Ga0070683_100645343
791 Ga0070683_100813333
792 Ga0070683_101189738
793 Ga0068869_100473397
794 Ga0070680_100120271
795 Ga0070680_100145734
796 Ga0070682_100775231
797 Ga0068868_100018427
798 Ga0068868_100984671
799 Ga0070660_100000656
800 Ga0070660_100206118
801 Ga0070689_100113379
802 Ga0070689_100782124
803 Ga0070689_101685507
804 Ga0070691_10019483
805 Ga0070691_10042258
806 Ga0070687_100155759
807 Ga0070687_100666341
808 Ga0070661_100003829
809 Ga0070661_100007025
810 Ga0070661_100082241
811 Ga0070661_100084253
812 Ga0070692_10048424
813 Ga0070692_10110673
814 Ga0070692_10111231
815 Ga0070692_11253776
816 Ga0070668_100080661
817 Ga0070668_100312571
818 Ga0070675_100000058
819 Ga0070675_100124017
820 Ga0070675_100506181
821 Ga0070675_100801056
822 Ga0070674_100210354
823 Ga0070674_100852942
824 Ga0070673_100276431
825 Ga0070673_100529096
826 Ga0070688_100031487
827 Ga0070659_100145978
828 Ga0070659_100150365
829 Ga0070667_100695548
830 Ga0070667_101244401
831 Ga0070709_10280957
832 Ga0070714_100954413
833 Ga0070714_101624306
834 Ga0070713_101065364
835 Ga0070710_10089684
836 Ga0070710_10106516
837 Ga0070710_10679704
838 Ga0070710_11114500
839 Ga0070701_10100527
840 Ga0070701_10307818
841 Ga0070711_100025979
842 Ga0070705_100065458
843 Ga0070705_100433557
844 Ga0070700_100006178
845 Ga0070694_100171842
846 Ga0070708_100716232
847 Ga0070663_100001885
848 Ga0070663_100443017
849 Ga0070678_100048315
850 Ga0070678_100495089
851 Ga0070662_100049513
852 Ga0070681_10230800
853 Ga0070681_10477120
854 Ga0070681_10752767
855 Ga0068867_100014807
856 Ga0068867_101216027
857 Ga0070685_10000018
858 Ga0070685_10210152
859 Ga0070685_10500573
860 Ga0070685_11319912
861 Ga0070706_101222659
862 Ga0070707_100099915
863 Ga0070707_101203616
864 Ga0070707_101276351
865 Ga0070698_100089935
866 Ga0070698_100144585
867 Ga0070698_100249595
868 Ga0070698_100302639
869 Ga0070699_100095426
870 Ga0070699_100408032
871 Ga0070679_100025244
872 Ga0070679_100508379
873 Ga0070684_100026476
874 Ga0070684_100117829
875 Ga0070684_100127167
876 Ga0070684_100254441
877 Ga0070684_100638944
878 Ga0070684_101172118
879 Ga0070697_100299975
880 Ga0070697_100453822
881 Ga0070697_101514224
882 Ga0068853_100158454
883 Ga0068853_100820604
884 Ga0068853_101103216
885 Ga0070672_100003065
886 Ga0070686_100045942
887 Ga0070686_100219870
888 Ga0070686_100374171
889 Ga0070686_100439780
890 Ga0070686_101429008
891 Ga0070695_100104326
892 Ga0070695_100583553
893 Ga0070695_101450786
894 Ga0070696_101070939
895 Ga0070693_100226572
896 Ga0070665_100007985
897 Ga0070665_100297870
898 Ga0070665_100489489
899 Ga0070665_100827462
900 Ga0070665_101121642
901 Ga0070704_100513082
902 Ga0070704_100631806
903 Ga0070704_100717330
904 Ga0068855_100048608
905 Ga0068855_100076144
906 Ga0068855_100178147
907 Ga0068855_100289079
908 Ga0068855_100520182
909 Ga0068855_101818507
910 Ga0070664_100063698
911 Ga0070664_100183393
912 Ga0070664_102210777
913 Ga0068857_100183686
914 Ga0068857_100906205
915 Ga0068857_101107803
916 Ga0068854_100002182
917 Ga0068854_100142891
918 Ga0068856_100111797
919 Ga0068856_100708899
920 Ga0068856_101043321
921 Ga0070702_100061555
922 Ga0070702_100071245
923 Ga0070702_100285925
924 Ga0068852_100055949
925 Ga0068852_100140032
926 Ga0068852_100433753
927 Ga0068852_100569733
928 Ga0068852_102261541
929 Ga0068852_102676941
930 Ga0068859_100480801
931 Ga0068859_100740532
932 Ga0068864_100195287
933 Ga0068864_100889803
934 Ga0068864_101770933
935 Ga0068861_100294474
936 Ga0068861_100729056
937 Ga0068851_10030626
938 Ga0068851_10289560
939 Ga0068863_100034635
940 Ga0068863_100174686
941 Ga0068863_100717007
942 Ga0068858_100185145
943 Ga0068858_100318187
944 Ga0068858_100335793
945 Ga0068860_100287411
946 Ga0068860_100302635
947 Ga0068860_100343956
948 Ga0068862_100944826
949 Ga0068862_101748052
950 Ga0081540_1007014
951 Ga0081539_10012514
952 Ga0070717_10005511
953 Ga0070717_10026482
954 Ga0075365_10002695
955 Ga0075368_10181916
956 Ga0075363_100025203
957 Ga0075363_100087174
958 Ga0075363_100111943
959 Ga0070715_10025416
960 Ga0070716_100023594
961 Ga0070716_100055912
962 Ga0070712_100029436
963 Ga0070712_100069077
964 Ga0070712_100258849
965 Ga0075367_10028464
966 Ga0075367_10481425
967 Ga0075367_11015420
968 Ga0097621_100072163
969 Ga0097621_100856565
970 Ga0097621_101775840
971 Ga0068871_100070674
972 Ga0068871_100497261
973 Ga0075433_10083308
974 Ga0075434_100275207
975 Ga0075434_100613677
976 Ga0075434_101107592
977 Ga0068865_100111966
978 Ga0075436_100213637
979 Ga0075436_100241157
980 Ga0097620_100480800
981 Ga0097620_100740568
982 Ga0075435_100007003
983 Ga0075435_100079835
984 Ga0075435_100924283
985 Ga0105240_10096869
986 Ga0105240_10195564
987 Ga0105240_10455705
988 Ga0111539_10736246
989 Ga0111539_11291347
990 Ga0105245_10031939
991 Ga0105245_10051216
992 Ga0105245_10054515
993 Ga0105245_10444321
994 Ga0105245_11809896
995 Ga0105247_10003405
996 Ga0105247_10059034
997 Ga0105247_10100913
998 Ga0105247_10308479
999 Ga0114129_11051038
1000 Ga0105243_10044738
1001 Ga0105243_10161107
1002 Ga0105241_10364673
1003 Ga0105241_10391464
1004 Ga0105241_10506688
1005 Ga0105241_10748638
1006 Ga0105242_11649364
1007 Ga0105248_10416374
1008 Ga0105248_10642500
1009 Ga0105237_10102701
1010 Ga0105237_10334587
1011 Ga0105237_10351971
1012 Ga0105238_10417193
1013 Ga0105238_11493095
1014 Ga0105238_11829484
1015 Ga0105249_11766032
1016 Ga0105239_10017268
1017 Ga0105239_10076207
1018 Ga0105239_10099111
1019 Ga0105246_10067722
1020 Ga0105246_10169717
1021 Ga0105246_10197013
1022 Ga0157340_1016527
1023 Ga0157337_1006060
1024 Ga0157343_1003277
1025 Ga0157345_1008401
1026 Ga0157338_1005742
1027 Ga0157373_10371284
1028 Ga0157371_10562405
1029 Ga0157370_10014681
1030 Ga0157370_10041853
1031 Ga0157369_10148746
1032 Ga0157369_10152692
1033 Ga0157369_10431680
1034 Ga0157374_10101071
1035 Ga0157374_10495011
1036 Ga0157374_10559380
1037 Ga0157378_10018399
1038 Ga0157378_10700127
1039 Ga0157378_10758731
1040 Ga0163162_10258325
1041 Ga0163162_10787816
1042 Ga0163162_11041657
1043 Ga0163162_13420677
1044 Ga0157372_10002742
1045 Ga0157372_10096924
1046 Ga0157372_10181318
1047 Ga0157372_10356500
1048 Ga0157372_10428001
1049 Ga0157372_10483147
1050 Ga0157375_10005846
1051 Ga0157375_10035444
1052 Ga0157375_10185181
1053 Ga0163163_10039877
1054 Ga0163163_10212728
1055 Ga0157380_10001287
1056 Ga0157380_10682573
1057 Ga0157380_11542396
1058 Ga0182008_10140327
1059 Ga0182008_10362774
1060 Ga0157377_10097549
1061 Ga0157379_10012172
1062 Ga0157379_10074934
1063 Ga0157376_10087491
1064 Ga0157376_10783793
1065 Ga0163161_11841974
1066 Ga0197907_10741091
1067 Ga0206356_11377664
1068 Ga0206351_10742472
1069 Ga0206352_11139450
1070 Ga0206350_11550094
1071 Ga0206354_10194282
1072 Ga0206353_11982173
1073 Ga0224712_10004145
1074 Ga0224712_10050208
1075 Ga0207656_10218619
1076 Ga0207692_10179473
1077 Ga0207710_10162647
1078 Ga0207688_10015276
1079 Ga0207647_10111347
1080 Ga0207685_10022996
1081 Ga0207699_10216754
1082 Ga0207699_10275254
1083 Ga0207699_10534254
1084 Ga0207645_10469146
1085 Ga0207705_10009276
1086 Ga0207705_10028127
1087 Ga0207705_10049029
1088 Ga0207684_10610444
1089 Ga0207684_10899035
1090 Ga0207654_10239784
1091 Ga0207707_10129487
1092 Ga0207707_10307348
1093 Ga0207707_10360019
1094 Ga0207707_10689037
1095 Ga0207695_10101287
1096 Ga0207695_10563125
1097 Ga0207695_10659627
1098 Ga0207671_10582300
1099 Ga0207693_10010038
1100 Ga0207693_10176576
1101 Ga0207663_10034703
1102 Ga0207663_10089401
1103 Ga0207660_10324957
1104 Ga0207660_10428823
1105 Ga0207660_10620252
1106 Ga0207662_10180614
1107 Ga0207662_11025251
1108 Ga0207657_10004970
1109 Ga0207657_10073205
1110 Ga0207649_10000640
1111 Ga0207649_10059266
1112 Ga0207649_10071992
1113 Ga0207649_10079758
1114 Ga0207652_10093202
1115 Ga0207652_10132737
1116 Ga0207646_10085683
1117 Ga0207646_11310495
1118 Ga0207646_11561433
1119 Ga0207681_10230352
1120 Ga0207694_10088032
1121 Ga0207694_10419951
1122 Ga0207650_11287160
1123 Ga0207659_10213475
1124 Ga0207659_10679715
1125 Ga0207659_11645186
1126 Ga0207687_10031396
1127 Ga0207687_10281643
1128 Ga0207687_10304332
1129 Ga0207687_11234009
1130 Ga0207700_10000834
1131 Ga0207700_10065094
1132 Ga0207700_10896213
1133 Ga0207700_11210069
1134 Ga0207664_10033865
1135 Ga0207664_11257130
1136 Ga0207690_10045743
1137 Ga0207690_10055387
1138 Ga0207690_11071434
1139 Ga0207706_10009875
1140 Ga0207686_11851913
1141 Ga0207709_10123527
1142 Ga0207709_10631389
1143 Ga0207670_10067535
1144 Ga0207670_11757930
1145 Ga0207669_10182335
1146 Ga0207669_10819505
1147 Ga0207704_10048923
1148 Ga0207665_10004593
1149 Ga0207665_10009806
1150 Ga0207665_10185061
1151 Ga0207691_10006847
1152 Ga0207711_10151720
1153 Ga0207689_11095796
1154 Ga0207661_10015634
1155 Ga0207661_10086922
1156 Ga0207661_10170287
1157 Ga0207661_11616945
1158 Ga0207679_10040410
1159 Ga0207679_10075478
1160 Ga0207679_11284349
1161 Ga0207667_10168466
1162 Ga0207667_10183375
1163 Ga0207667_10531611
1164 Ga0207667_10556241
1165 Ga0207651_10206221
1166 Ga0207668_10043828
1167 Ga0207640_10008058
1168 Ga0207658_10935494
1169 Ga0207677_10000046
1170 Ga0207677_10358931
1171 Ga0207677_11008436
1172 Ga0207677_11286419
1173 Ga0207703_10144390
1174 Ga0207703_10163962
1175 Ga0207703_10194989
1176 Ga0207703_10780284
1177 Ga0207639_10512408
1178 Ga0207639_10667729
1179 Ga0207639_11071134
1180 Ga0207678_10000994
1181 Ga0207708_10002088
1182 Ga0207708_11417345
1183 Ga0207702_10002965
1184 Ga0207702_10085598
1185 Ga0207702_10088146
1186 Ga0207702_10544230
1187 Ga0207702_11049868
1188 Ga0207702_11610320
1189 Ga0207641_10024322
1190 Ga0207641_10371456
1191 Ga0207648_10022910
1192 Ga0207648_10520220
1193 Ga0207676_10072422
1194 Ga0207676_10809468
1195 Ga0207676_11918266
1196 Ga0207676_12275667
1197 Ga0207674_10037977
1198 Ga0207674_10045370
1199 Ga0207674_10184966
1200 Ga0207674_10303678
1201 Ga0207674_10599285
1202 Ga0207674_11786403
1203 Ga0207675_100015728
1204 Ga0207675_100520636
1205 Ga0207675_100733562
1206 Ga0207698_10045232
1207 Ga0207698_10132283
1208 Ga0207698_10715957
1209 Ga0207698_11940666
1210 Ga0268266_10000553
1211 Ga0268266_10298906
1212 Ga0268266_10802255
1213 Ga0268265_10093436
1214 Ga0268265_10628590
1215 Ga0268265_12054508
1216 Ga0268264_10080508
1217 Ga0268264_10301837
1218 Ga0268264_10343081
1219 Ga0268264_10394381
1220 Ga0265337_1068111
1221 Ga0265326_10004541
1222 Ga0265319_1002478
1223 Ga0265319_1154415
1224 Ga0265334_10007110
1225 Ga0265334_10018224
1226 Ga0265334_10024182
1227 Ga0265318_10016790
1228 Ga0265323_10018987
1229 Ga0265323_10065434
1230 Ga0265322_10022955
1231 Ga0265322_10025058
1232 Ga0265336_10029207
1233 Ga0265336_10072306
1234 Ga0265338_10044169
1235 Ga0265338_10073792
1236 Ga0265338_10777518
1237 Ga0265324_10005854
1238 Ga0265324_10215987
1239 Ga0307511_10327865
1240 Ga0265330_10055404
1241 Ga0265330_10061982
1242 Ga0265330_10411926
1243 Ga0265332_10076382
1244 Ga0265320_10019311
1245 Ga0265320_10063595
1246 Ga0265320_10256365
1247 Ga0265325_10023928
1248 Ga0265325_10024057
1249 Ga0265325_10081921
1250 Ga0265329_10047998
1251 Ga0265340_10017744
1252 Ga0265339_10034458
1253 Ga0265339_10245490
1254 Ga0265331_10057161
1255 Ga0265331_10096514
1256 Ga0265316_10003201
1257 Ga0265316_10042233
1258 Ga0265316_10074613
1259 Ga0265316_10150916
1260 Ga0265316_10230985
1261 Ga0307509_10015370
1262 Ga0307408_100750489
1263 Ga0265313_10037334
1264 Ga0265313_10104710
1265 Ga0307508_10659648
1266 Ga0307514_10338512
1267 Ga0316575_10136477
1268 Ga0316575_10147646
1269 Ga0316579_10050647
1270 Ga0265314_10051035
1271 Ga0265314_10239729
1272 Ga0265342_10023479
1273 Ga0265342_10096101
1274 Ga0316576_10136676
1275 Ga0316576_10258278
1276 Ga0316577_10000301
1277 Ga0307413_10050524
1278 Ga0307410_10315822
1279 Ga0307407_11482701
1280 Ga0307416_103131102
1281 Ga0307411_11132800
1282 Ga0316583_10028297
1283 Ga0307510_10078897
1284 Ga0373948_0089895
1285 Ga0373926_0161112
1286 Ga0373944_0041682
1287 Ga0373936_0072994
1288 Ga0373939_0441778
1289 Ga0373957_0021239
1290 Ga0373960_0061821
1291 Ga0373960_0072754
1292 Ga0373943_0029188
1293 Ga0373946_0031147
1294 Ga0373946_0070506
1295 Ga0373962_0074101
1296 Ga0316574_0051044
1297 Ga0316574_0156371
1298 Ga0316574_0273510
1299 Ga0316574_0979439
1300 Ga0373931_0188208
1301 Ga0373931_1302781
1302 Ga0373935_0227045
1303 Ga0373927_0344113
1304 Ga0373947_0105320
1305 Ga0373937_1877009
1306 Ga0316582_0023098
1307 Ga0316582_0043735
1308 Ga0316582_0587356
1309 Ga0316584_0011154
1310 Ga0316584_0215526
1311 Ga0373925_0673566
1312 Ga0373925_1083146
1313 Ga0395898_0273217
1314 Ga0395898_1159733
1315 Ga0395905_0174439
1316 Ga0316581_0042578
1317 Ga0395901_0200109
1318 Ga0395901_0380877
1319 Ga0395901_0602388
1320 Ga0242420_092171
1321 Ga0436365_1839893
1322 Ga0451791_0075505
1323 Ga0451793_0425389
1324 Ga0451833_1338646
1325 Ga0451835_0783680
1326 Ga0451839_0778726
1327 Ga0451853_3914549
1328 Ga0451577_0105335
1329 Ga0451577_1933077
1330 Ga0466966_0103590
1331 Ga0466961_0421020
1332 Ga0453684_0189070
1333 Ga0466957_1348101
1334 Ga0466958_0085882
1335 Ga0466967_0617371
1336 Ga0466967_0905023
1337 Ga0495592_0271245
1338 Ga0495641_0142667
1339 Ga0495641_0153502
1340 Ga0495651_0556437
1341 Ga0495653_0283514
1342 Ga0495580_0176425
1343 Ga0495580_0893645
1344 Ga0495605_0247180
1345 Ga0495639_0282392
1346 Ga0495584_0182364
1347 Ga0495584_0697020
1348 Ga0495594_0710537
1349 Ga0495596_0452494
1350 Ga0495606_0000211
1351 Ga0495610_0032849
1352 Ga0495618_0025161
1353 Ga0495618_0566145
1354 Ga0495620_0267416
1355 Ga0495628_0091581
1356 Ga0495628_0886318
1357 Ga0495630_0295489
1358 Ga0495644_0230495
1359 Ga0495666_0205935
1360 Ga0495665_0081252
1361 Ga0495640_0253819
1362 Ga0495640_0574508
1363 Ga0495586_0203563
1364 Ga0495645_0551985
1365 Ga0495667_0272454
1366 Ga0495656_0000581
1367 Ga0495656_0084570
1368 Ga0495656_0276140
1369 Ga0495656_0617262
1370 Ga0495634_0393469
1371 Ga0495634_0646599
1372 Ga0495625_0300020
1373 Ga0495635_0151138
1374 Ga0495635_0682523
1375 Ga0495657_0410446
1376 Ga0495599_0585904
1377 Ga0495646_0323281
1378 Ga0495647_0011848
1379 Ga0495647_0128746
1380 Ga0495613_0689959
1381 Ga0495581_0153978
1382 Ga0495676_0002788
1383 Ga0495676_0351422
1384 Ga0495676_0433590
1385 Ga0495680_0205919
1386 Ga0495675_0016987
1387 Ga0495684_0302908
1388 Ga0495602_0346636
1389 Ga0496100_0297074
1390 Ga0496100_0732796
1391 Ga0496100_0754068
1392 Ga0496100_1567220
1393 Ga0496101_0038929
1394 Ga0496101_0144589
1395 Ga0496101_0440363
1396 Ga0496101_1278364
1397 Ga0496102_0013571
1398 Ga0496102_0187458
1399 Ga0496102_0245971
1400 Ga0496102_0360694
1401 Ga0496103_0301062
1402 Ga0496104_0036816
1403 Ga0496104_0120892
1404 Ga0496104_0198369
1405 Ga0496104_0666412
1406 Ga0496104_1495396
1407 Ga0496105_0026982
1408 Ga0496105_0335966
1409 Ga0496105_0587532
1410 Ga0496105_0895624
1411 Ga0496106_0002210
1412 Ga0496106_0006426
1413 Ga0496106_0024191
1414 Ga0496106_0086614
1415 Ga0496106_0488124
1416 Ga0496107_0045320
1417 Ga0496107_0101745
1418 Ga0496107_0105614
1419 Ga0496107_0179913
1420 Ga0496107_0463126
1421 Ga0496108_0015361
1422 Ga0496108_0098636
1423 Ga0496108_0161207
1424 Ga0496109_0021702
1425 Ga0496109_0049378
1426 Ga0496109_0089209
1427 Ga0496109_0119001
1428 Ga0496109_1555075
1429 Ga0496109_1671592
1430 Ga0496110_0034617
1431 Ga0496110_0148481
1432 Ga0496110_1291264
1433 Ga0496111_0046212
1434 Ga0496111_0095340
1435 Ga0496111_1354823
1436 Ga0496112_0104047
1437 Ga0496112_0107970
1438 Ga0496112_0109113
1439 Ga0496112_0178988
1440 Ga0496112_0248996
1441 Ga0496113_0006121
1442 Ga0496113_0063931
1443 Ga0496113_0088342
1444 Ga0496113_0145595
1445 Ga0496113_0206704
1446 Ga0496113_0279184
1447 Ga0496113_0835744
1448 Ga0496114_0074500
1449 Ga0496114_0127584
1450 Ga0496114_0149490
1451 Ga0496114_0283429
1452 Ga0496114_0582969
1453 Ga0496115_0019661
1454 Ga0496115_0045048
1455 Ga0496115_0100377
1456 Ga0496115_0116084
1457 Ga0496115_0225800
1458 Ga0496115_0265301
1459 Ga0496126_0122317
1460 Ga0501031_0041975
1461 Ga0501031_0152274
1462 Ga0501033_0363817
1463 Ga0501034_0100423
1464 Ga0501034_1363321
1465 Ga0501036_0044477
1466 Ga0501036_0051632
1467 Ga0501036_0628087
1468 Ga0501037_0559200
1469 Ga0501038_0091529
1470 Ga0501038_0975191
1471 Ga0501038_1182140
1472 Ga0501039_0091703
1473 Ga0501039_0202875
1474 Ga0501039_0209940
1475 Ga0501040_0027520
1476 Ga0501040_0187464
1477 Ga0501040_1303147
1478 Ga0501041_0138800
1479 Ga0501041_0364665
1480 Ga0501042_0088515
1481 Ga0501042_0098693
1482 Ga0501042_0680854
1483 Ga0501043_0764220
1484 Ga0501046_0020051
1485 Ga0501046_0453029
1486 Ga0501047_0035628
1487 Ga0501048_0224932
1488 Ga0501067_0385471
1489 Ga0501069_0183080
1490 Ga0501069_0897687
1491 Ga0501070_1364310
1492 Ga0501071_0006530
1493 Ga0501071_0696167
1494 Ga0501071_1148132
1495 Ga0501071_1344054
1496 Ga0501072_0143032
1497 Ga0501072_0563877
1498 Ga0501072_0807875
1499 Ga0501073_0050113
1500 Ga0501074_0099264
1501 Ga0501074_0157444
1502 Ga0501074_0201267
1503 Ga0501075_0072024
1504 Ga0501076_0032839
1505 Ga0501076_0079209
1506 Ga0501077_0082273
1507 Ga0501079_0043201
1508 Ga0501079_0383077
1509 Ga0501080_0286797
1510 Ga0501080_0350415
1511 Ga0501081_0005806
1512 Ga0501035_0567635
1513 Ga0501044_0323661
1514 Ga0501045_0027461
1515 Ga0501045_0304972
1516 Ga0501045_0379893
1517 nmdc:mga03n38_16781_c1
1518 nmdc:mga03n38_93831_c1
1519 nmdc:mga00v17_1061121_c1
1520 nmdc:mga00v17_30140_c1
1521 nmdc:mga0yw44_6426_c1
1522 nmdc:mga0yw44_651346_c1
1523 nmdc:mga06z11_1036190_c1
1524 nmdc:mga06z11_181693_c1
1525 nmdc:mga06z11_416276_c1
1526 nmdc:mga05p37_1893240_c1
1527 nmdc:mga05p37_351841_c1
1528 nmdc:mga0qj67_134113_c1
1529 nmdc:mga06r32_141139_c1
1530 nmdc:mga08y16_130857_c1
1531 nmdc:mga08y16_463227_c1
1532 nmdc:mga0n895_613121_c1
1533 nmdc:mga0rr50_890231_c1
1534 nmdc:mga0rr50_98874_c1
1535 nmdc:mga08x19_268912_c1
1536 nmdc:mga0a205_1052873_c1
1537 nmdc:mga0a205_394520_c1
1538 Ga0495601_0146533
1539 Ga0495601_0427560
1540 Ga0495612_0000228
1541 Ga0495612_0017029
1542 Ga0495612_0253406
1543 Ga0495619_0008589
1544 Ga0501082_0170864
1545 Ga0501082_0367825
1546 Ga0501082_0402496
1547 2508675543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12769

PNTB_4TM

4TM region of pyridine nucleotide transhydrogenase, mitoch

8

87

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f5d-assembly1.cif.gz_H trypanosoma brucei f1-atpase 0.8697 37 76
5jbr-assembly1.cif.gz_B crystal structure of uncharacterized protein bcav_2135 from beutenbergia cavernae 0.861 30 81
3na7-assembly1.cif.gz_A 2.2 angstrom structure of the hp0958 protein from helicobacter pylori ccug 17874 0.8372 27 87
5fvk-assembly2.cif.gz_B crystal structure of vps4-vfa1 complex from s.cerevisiae at 1.66 a resolution. 0.829 27 89
6z03-assembly1.cif.gz_B dna topoisomerase 0.812 35 85
ID Description Score Start End Superfamily
af_Q4DX76_44_180_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9048 37 75 2.60.15.10
af_Q4CYB4_1172_1308_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.885 35 82 1.20.58.1120
af_Q5U3S1_1_78_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.882 37 88 1.20.58.80
5fvkA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8554 27 89 1.20.58.80
af_A0A2R8QMD9_132_235_1.20.81.10 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain 0.8488 29 87 1.20.81.10
ID Description Score Start End GO Terms
AF-A0A1G3UTD3-F1-model_v4 Uncharacterized protein 0.8221 29 97 GO:0016020
AF-A0A2P6UYB6-F1-model_v4 deleted 0.7939 1 104
AF-A0A2P6UYB6-F1-model_v4 deleted 0.7877 1 104
AF-A0A6A4JHN8-F1-model_v4 deleted 0.7867 30 99
AF-A0A6I7QLE4-F1-model_v4 Uncharacterized protein 0.7865 30 104

Map