F480156

General Info

Members Datasets Scaffolds Average Seq Length
773 377 744 126

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100644567|Ga0068854_1006445672
Length 139
Sequence MTDLAPAPRARRPRPKIVTLTDAAAERVREIMDDSETPVVGVRVGIKDAGCAGQSYTLTYVGAPIPGDDHIVDKGVDVYVEPKATLYLLGTVMDFEEDILKSGFTFRNPNQTGECGCGESVTLKPADLKALAEARAGAH

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
11 2643221629 Devosia sp. Root105 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221662 Devosia sp. Root413D1 Isolate Unclassified
16 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
17 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
18 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
19 2818991435 Caulobacter henricii 536 Isolate Unclassified
20 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
21 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
22 2849560528 Caulobacter zeae 410 Isolate Unclassified
23 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
24 2851153111 Caulobacter radicis 736 Isolate Unclassified
25 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
26 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
27 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
28 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
121 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
232 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
233 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
234 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
235 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
236 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
237 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
238 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
239 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
240 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
241 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
242 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
253 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
266 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
267 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
275 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
282 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
287 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
320 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
321 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
322 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
338 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
339 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
340 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
341 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
342 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
343 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
344 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
345 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
346 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
347 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
348 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
349 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
350 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
351 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
352 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
353 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
354 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
355 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
363 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
377 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.76
Metatranscriptomes 3.49
Isolates 3.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.34
Nodule 0.13
Rhizoplane 2.2
Rhizosphere 74.64
Stem 0
Stem Tuber 0
Unclassified 5.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10010803 3300003215 Bacteria 4096
2 JGI25153J46596_10042779 3300003215 Bacteria 1379
3 Ga0055537_1006822 3300003773 Bacteria 2840
4 Ga0055524_1005226 3300003775 Bacteria 5839
5 Ga0055528_1008119 3300003790 Bacteria 4546
6 Ga0055530_10003549 3300003791 Bacteria 8789
7 Ga0055530_10007123 3300003791 Bacteria 4791
8 Ga0055530_10007274 3300003791 Bacteria 4699
9 Ga0055531_10001331 3300003794 Bacteria 18439
10 Ga0055531_10001678 3300003794 Bacteria 15938
11 Ga0055531_10002494 3300003794 Bacteria 12265
12 Ga0055543_1042023 3300004625 Bacteria 769
13 Ga0058863_11578230 3300004799 Bacteria 905
14 Ga0065165_1000532 3300005262 Bacteria 58082
15 Ga0065165_1000979 3300005262 Bacteria 35374
16 Ga0065165_1013111 3300005262 Bacteria 3319
17 Ga0070658_10009132 3300005327 Bacteria 7970
18 Ga0070658_10131827 3300005327 Bacteria 2083
19 Ga0070658_10194762 3300005327 Bacteria 1709
20 Ga0070658_10197317 3300005327 Bacteria 1697
21 Ga0070683_100605156 3300005329 Bacteria 1049
22 Ga0070683_101412591 3300005329 Bacteria 669
23 Ga0070670_100434510 3300005331 Bacteria 1162
24 Ga0070670_101338743 3300005331 Bacteria 656
25 Ga0068869_100309997 3300005334 Bacteria 1277
26 Ga0070682_100977607 3300005337 Bacteria 701
27 Ga0070660_100034638 3300005339 Bacteria 3816
28 Ga0070660_100083536 3300005339 Bacteria 2509
29 Ga0070661_100022236 3300005344 Bacteria 4539
30 Ga0070661_100073003 3300005344 Bacteria 2526
31 Ga0070661_100129884 3300005344 Bacteria 1891
32 Ga0070661_100762644 3300005344 Bacteria 792
33 Ga0070668_100006163 3300005347 Bacteria 8881
34 Ga0070668_100017835 3300005347 Bacteria 5325
35 Ga0070668_100025816 3300005347 Bacteria 4456
36 Ga0070668_100482370 3300005347 Bacteria 1071
37 Ga0070671_100107910 3300005355 Bacteria 2338
38 Ga0070671_100273360 3300005355 Bacteria 1436
39 Ga0070673_100341036 3300005364 Bacteria 1328
40 Ga0070673_100857530 3300005364 Bacteria 841
41 Ga0070659_100029991 3300005366 Bacteria 4206
42 Ga0070667_100415394 3300005367 Bacteria 1226
43 Ga0070667_100564393 3300005367 Bacteria 1047
44 Ga0070713_100722431 3300005436 Bacteria 952
45 Ga0070694_100284839 3300005444 Bacteria 1261
46 Ga0070708_100664087 3300005445 Bacteria 982
47 Ga0070678_100108961 3300005456 Bacteria 2163
48 Ga0070678_100220898 3300005456 Bacteria 1575
49 Ga0070681_10503913 3300005458 Bacteria 1124
50 Ga0068867_100590040 3300005459 Bacteria 967
51 Ga0070685_10190985 3300005466 Bacteria 1325
52 Ga0070679_100041910 3300005530 Bacteria 4557
53 Ga0070679_100566984 3300005530 Bacteria 1079
54 Ga0070679_101688685 3300005530 Bacteria 581
55 Ga0070684_100158021 3300005535 Bacteria 2056
56 Ga0070684_100928012 3300005535 Bacteria 816
57 Ga0068853_100000349 3300005539 Bacteria 32236
58 Ga0068853_100010907 3300005539 Bacteria 7364
59 Ga0068853_100278472 3300005539 Bacteria 1542
60 Ga0068853_100310939 3300005539 Bacteria 1459
61 Ga0070695_100703847 3300005545 Bacteria 802
62 Ga0070693_100972213 3300005547 Bacteria 641
63 Ga0070665_100017471 3300005548 Bacteria 7203
64 Ga0070665_100469453 3300005548 Bacteria 1269
65 Ga0070665_102076908 3300005548 Bacteria 573
66 Ga0070704_100206559 3300005549 Bacteria 1589
67 Ga0068855_100019409 3300005563 Bacteria 8168
68 Ga0068855_100021728 3300005563 Bacteria 7696
69 Ga0068855_100103516 3300005563 Bacteria 3275
70 Ga0068855_100621957 3300005563 Bacteria 1163
71 Ga0070664_100635099 3300005564 Bacteria 992
72 Ga0070664_101015629 3300005564 Bacteria 780
73 Ga0068857_100817247 3300005577 Bacteria 890
74 Ga0068854_100080564 3300005578 Bacteria 2403
75 Ga0068854_100175192 3300005578 Bacteria 1671
76 Ga0068854_100644567 3300005578 Bacteria 909
77 Ga0068854_102010667 3300005578 Bacteria 533
78 Ga0068856_100032721 3300005614 Bacteria 5092
79 Ga0068856_100347165 3300005614 Bacteria 1502
80 Ga0068856_100406014 3300005614 Bacteria 1382
81 Ga0068856_100572408 3300005614 Bacteria 1151
82 Ga0068852_100010308 3300005616 Bacteria 6977
83 Ga0068852_100056190 3300005616 Bacteria 3400
84 Ga0068852_100078086 3300005616 Bacteria 2928
85 Ga0068852_101637586 3300005616 Bacteria 666
86 Ga0068859_100019102 3300005617 Bacteria 6883
87 Ga0068859_100120881 3300005617 Bacteria 2685
88 Ga0068859_100403489 3300005617 Bacteria 1463
89 Ga0068859_100752223 3300005617 Bacteria 1063
90 Ga0068864_100427496 3300005618 Bacteria 1263
91 Ga0068864_101840214 3300005618 Bacteria 611
92 Ga0068861_100166684 3300005719 Bacteria 1822
93 Ga0068861_100713484 3300005719 Bacteria 933
94 Ga0068851_10174409 3300005834 Bacteria 1188
95 Ga0068863_100063458 3300005841 Bacteria 3494
96 Ga0068863_102249157 3300005841 Bacteria 555
97 Ga0068858_100101300 3300005842 Bacteria 2686
98 Ga0068858_100825971 3300005842 Bacteria 905
99 Ga0068860_100000260 3300005843 Bacteria 77214
100 Ga0068860_100037022 3300005843 Bacteria 4671
101 Ga0068860_100096991 3300005843 Bacteria 2810
102 Ga0068860_100841702 3300005843 Bacteria 932
103 Ga0068862_100012982 3300005844 Bacteria 6890
104 Ga0068862_100016822 3300005844 Bacteria 6089
105 Ga0068862_100051275 3300005844 Bacteria 3529
106 Ga0068862_100260309 3300005844 Bacteria 1583
107 Ga0068862_100506044 3300005844 Bacteria 1147
108 Ga0068862_101682674 3300005844 Bacteria 642
109 Ga0081455_10312237 3300005937 Bacteria 1123
110 Ga0075365_10841960 3300006038 Bacteria 647
111 Ga0075368_10240587 3300006042 Bacteria 772
112 Ga0075363_100021497 3300006048 Bacteria 3251
113 Ga0075364_10069003 3300006051 Bacteria 2325
114 Ga0075364_10124886 3300006051 Bacteria 1724
115 Ga0075362_10055076 3300006177 Bacteria 1789
116 Ga0075362_10179820 3300006177 Bacteria 1025
117 Ga0075367_10505949 3300006178 Bacteria 766
118 Ga0075369_10012967 3300006186 Bacteria 3298
119 Ga0075369_10185433 3300006186 Bacteria 958
120 Ga0075366_10016093 3300006195 Bacteria 4294
121 Ga0075366_10032228 3300006195 Bacteria 3085
122 Ga0075366_10468727 3300006195 Bacteria 778
123 Ga0075366_10609802 3300006195 Bacteria 677
124 Ga0075370_10059177 3300006353 Bacteria 2180
125 Ga0075370_10086622 3300006353 Bacteria 1804
126 Ga0075370_10112636 3300006353 Bacteria 1581
127 Ga0075370_10341506 3300006353 Bacteria 894
128 Ga0075434_100310133 3300006871 Bacteria 1598
129 Ga0068865_100001399 3300006881 Bacteria 14029
130 Ga0097620_100019103 3300006931 Bacteria 6883
131 Ga0097620_100120883 3300006931 Bacteria 2685
132 Ga0097620_100403516 3300006931 Bacteria 1463
133 Ga0097620_100752240 3300006931 Bacteria 1063
134 Ga0079104_1036659 3300006946 Bacteria 1175
135 Ga0105240_10005608 3300009093 Bacteria 18633
136 Ga0105240_10047987 3300009093 Bacteria 5400
137 Ga0105240_10055987 3300009093 Bacteria 4936
138 Ga0105240_10799647 3300009093 Bacteria 1022
139 Ga0105240_11363495 3300009093 Bacteria 746
140 Ga0111539_12908340 3300009094 Bacteria 554
141 Ga0105245_10638442 3300009098 Bacteria 1094
142 Ga0105245_11185930 3300009098 Bacteria 811
143 Ga0105243_11398020 3300009148 Bacteria 720
144 Ga0105241_10021133 3300009174 Bacteria 4811
145 Ga0105241_10421379 3300009174 Bacteria 1175
146 Ga0105241_10581337 3300009174 Bacteria 1009
147 Ga0105242_10302217 3300009176 Bacteria 1461
148 Ga0105242_10304418 3300009176 Bacteria 1456
149 Ga0105242_11621230 3300009176 Bacteria 681
150 Ga0105248_10421508 3300009177 Bacteria 1503
151 Ga0105248_10543939 3300009177 Bacteria 1310
152 Ga0105237_10000309 3300009545 Bacteria 67900
153 Ga0105237_10255147 3300009545 Bacteria 1756
154 Ga0105237_10835634 3300009545 Bacteria 928
155 Ga0105238_10081963 3300009551 Bacteria 3216
156 Ga0105238_10217173 3300009551 Bacteria 1888
157 Ga0105238_10402617 3300009551 Bacteria 1362
158 Ga0105238_10495598 3300009551 Bacteria 1222
159 Ga0105238_10688069 3300009551 Bacteria 1034
160 Ga0105238_10843008 3300009551 Bacteria 934
161 Ga0105238_11020589 3300009551 Bacteria 848
162 Ga0105238_11185607 3300009551 Bacteria 788
163 Ga0105238_11969105 3300009551 Bacteria 618
164 Ga0105249_10059537 3300009553 Bacteria 3503
165 Ga0105249_10464385 3300009553 Bacteria 1306
166 Ga0105239_10000575 3300010375 Bacteria 52515
167 Ga0105239_10026037 3300010375 Bacteria 6441
168 Ga0105239_10955857 3300010375 Bacteria 984
169 Ga0105239_11148449 3300010375 Bacteria 895
170 Ga0105239_12219715 3300010375 Bacteria 638
171 Ga0105246_10454803 3300011119 Bacteria 1077
172 Ga0157373_11341198 3300013100 Bacteria 542
173 Ga0157371_10061002 3300013102 Bacteria 2674
174 Ga0157370_10245263 3300013104 Bacteria 1657
175 Ga0157370_11381062 3300013104 Bacteria 634
176 Ga0157370_11694642 3300013104 Bacteria 567
177 Ga0157369_10029152 3300013105 Bacteria 6101
178 Ga0157369_10405210 3300013105 Bacteria 1415
179 Ga0157369_12574549 3300013105 Bacteria 515
180 Ga0157374_10312398 3300013296 Bacteria 1556
181 Ga0157374_10320429 3300013296 Bacteria 1536
182 Ga0157374_10766630 3300013296 Bacteria 980
183 Ga0157374_12687445 3300013296 Bacteria 525
184 Ga0157378_12882229 3300013297 Bacteria 533
185 Ga0163162_10962799 3300013306 Bacteria 964
186 Ga0163162_13271065 3300013306 Bacteria 519
187 Ga0157372_10735492 3300013307 Bacteria 1147
188 Ga0157372_10929886 3300013307 Bacteria 1008
189 Ga0157372_11865941 3300013307 Bacteria 691
190 Ga0157375_11332632 3300013308 Bacteria 844
191 Ga0163163_10454052 3300014325 Bacteria 1342
192 Ga0163163_10470242 3300014325 Bacteria 1318
193 Ga0163163_12292274 3300014325 Bacteria 599
194 Ga0182008_10113850 3300014497 Bacteria 1341
195 Ga0157379_10580490 3300014968 Bacteria 1045
196 Ga0157376_10193623 3300014969 Bacteria 1866
197 Ga0157376_10303706 3300014969 Bacteria 1512
198 Ga0157376_10978742 3300014969 Bacteria 868
199 Ga0157376_11459360 3300014969 Bacteria 716
200 Ga0197907_10040603 3300020069 Bacteria 1183
201 Ga0197907_10058942 3300020069 Bacteria 676
202 Ga0206356_11296514 3300020070 Bacteria 922
203 Ga0206356_11504143 3300020070 Bacteria 791
204 Ga0206349_1124037 3300020075 Bacteria 694
205 Ga0206355_1348711 3300020076 Bacteria 908
206 Ga0206351_10492450 3300020077 Bacteria 1055
207 Ga0206352_11266876 3300020078 Bacteria 978
208 Ga0206350_10872178 3300020080 Bacteria 1124
209 Ga0206354_10464058 3300020081 Bacteria 808
210 Ga0206353_10095337 3300020082 Bacteria 602
211 Ga0206353_11387986 3300020082 Bacteria 532
212 Ga0154015_1147209 3300020610 Bacteria 818
213 Ga0213872_10009986 3300021361 Bacteria 4531
214 Ga0213871_10009389 3300021441 Bacteria 2191
215 Ga0213871_10049334 3300021441 Bacteria 1150
216 Ga0224712_10059741 3300022467 Bacteria 1515
217 Ga0224712_10128235 3300022467 Bacteria 1105
218 Ga0207427_101879 3300025231 Bacteria 6619
219 Ga0209026_1001440 3300025250 Bacteria 10524
220 Ga0209233_1001040 3300025261 Bacteria 11652
221 Ga0209565_1000475 3300025263 Bacteria 29667
222 Ga0209673_1002142 3300025273 Bacteria 14707
223 Ga0209675_1040462 3300025291 Bacteria 1025
224 Ga0209676_1000679 3300025292 Bacteria 48245
225 Ga0209676_1000835 3300025292 Bacteria 39928
226 Ga0209564_1001352 3300025295 Bacteria 25893
227 Ga0209564_1011781 3300025295 Bacteria 3882
228 Ga0209564_1030943 3300025295 Bacteria 1647
229 Ga0209564_1082980 3300025295 Bacteria 619
230 Ga0209758_1000696 3300025297 Bacteria 49847
231 Ga0209758_1002742 3300025297 Bacteria 17301
232 Ga0209758_1002892 3300025297 Bacteria 16578
233 Ga0209050_1000141 3300025298 Bacteria 173116
234 Ga0209050_1000807 3300025298 Bacteria 44122
235 Ga0209050_1001452 3300025298 Bacteria 25445
236 Ga0209256_1001833 3300025299 Bacteria 19808
237 Ga0209256_1007087 3300025299 Bacteria 5663
238 Ga0209256_1010425 3300025299 Bacteria 3895
239 Ga0207426_1074054 3300025302 Bacteria 941
240 Ga0209051_1006308 3300025303 Bacteria 6716
241 Ga0209257_1000609 3300025304 Bacteria 58413
242 Ga0209257_1000636 3300025304 Bacteria 56284
243 Ga0209257_1001481 3300025304 Bacteria 27569
244 Ga0209257_1002443 3300025304 Bacteria 18467
245 Ga0209257_1005103 3300025304 Bacteria 9521
246 Ga0207656_10074112 3300025321 Bacteria 1518
247 Ga0207688_10311583 3300025901 Bacteria 964
248 Ga0207645_10159340 3300025907 Bacteria 1476
249 Ga0207705_10058559 3300025909 Bacteria 2779
250 Ga0207705_10262017 3300025909 Bacteria 1320
251 Ga0207705_10295202 3300025909 Bacteria 1242
252 Ga0207705_10437210 3300025909 Bacteria 1014
253 Ga0207654_10162003 3300025911 Bacteria 1446
254 Ga0207707_11035266 3300025912 Bacteria 672
255 Ga0207695_10035247 3300025913 Bacteria 5430
256 Ga0207695_10131122 3300025913 Bacteria 2464
257 Ga0207695_10211921 3300025913 Bacteria 1848
258 Ga0207695_10255677 3300025913 Bacteria 1650
259 Ga0207695_10766330 3300025913 Bacteria 845
260 Ga0207695_11402538 3300025913 Bacteria 579
261 Ga0207695_11577470 3300025913 Bacteria 537
262 Ga0207671_10000617 3300025914 Bacteria 46905
263 Ga0207671_10177492 3300025914 Bacteria 1656
264 Ga0207671_10633742 3300025914 Bacteria 851
265 Ga0207657_10009762 3300025919 Bacteria 9622
266 Ga0207657_10012082 3300025919 Bacteria 8535
267 Ga0207657_10097737 3300025919 Bacteria 2441
268 Ga0207649_10000527 3300025920 Bacteria 26665
269 Ga0207649_10623496 3300025920 Bacteria 831
270 Ga0207652_10020496 3300025921 Bacteria 5445
271 Ga0207652_11812646 3300025921 Bacteria 515
272 Ga0207694_10112207 3300025924 Bacteria 2169
273 Ga0207694_10274456 3300025924 Bacteria 1383
274 Ga0207694_10467447 3300025924 Bacteria 1054
275 Ga0207694_10645076 3300025924 Bacteria 892
276 Ga0207694_10900726 3300025924 Bacteria 748
277 Ga0207694_10934418 3300025924 Bacteria 734
278 Ga0207690_10161424 3300025932 Bacteria 1671
279 Ga0207690_10424572 3300025932 Bacteria 1064
280 Ga0207690_10941690 3300025932 Bacteria 717
281 Ga0207706_10075551 3300025933 Bacteria 2963
282 Ga0207686_10026441 3300025934 Bacteria 3385
283 Ga0207709_10642613 3300025935 Bacteria 844
284 Ga0207704_10005421 3300025938 Bacteria 5883
285 Ga0207689_10243971 3300025942 Bacteria 1485
286 Ga0207689_10408706 3300025942 Bacteria 1132
287 Ga0207661_10572424 3300025944 Bacteria 1036
288 Ga0207661_10917667 3300025944 Bacteria 807
289 Ga0207679_10838635 3300025945 Bacteria 839
290 Ga0207679_11804904 3300025945 Bacteria 559
291 Ga0207667_10040883 3300025949 Bacteria 4935
292 Ga0207667_10082927 3300025949 Bacteria 3320
293 Ga0207667_10093804 3300025949 Bacteria 3099
294 Ga0207667_10279455 3300025949 Bacteria 1706
295 Ga0207667_10284756 3300025949 Bacteria 1689
296 Ga0207667_10646516 3300025949 Bacteria 1063
297 Ga0207667_11057329 3300025949 Bacteria 797
298 Ga0207651_10765515 3300025960 Bacteria 854
299 Ga0207712_10305947 3300025961 Bacteria 1306
300 Ga0207668_10010026 3300025972 Bacteria 5703
301 Ga0207668_10014536 3300025972 Bacteria 4873
302 Ga0207668_10027478 3300025972 Bacteria 3706
303 Ga0207668_10055694 3300025972 Bacteria 2750
304 Ga0207668_10320715 3300025972 Bacteria 1286
305 Ga0207640_10014606 3300025981 Bacteria 4525
306 Ga0207640_10049846 3300025981 Bacteria 2713
307 Ga0207658_10346156 3300025986 Bacteria 1293
308 Ga0207658_10428023 3300025986 Bacteria 1168
309 Ga0207658_10854422 3300025986 Bacteria 827
310 Ga0207677_10507817 3300026023 Bacteria 1044
311 Ga0207703_10646146 3300026035 Bacteria 1003
312 Ga0207703_10921093 3300026035 Bacteria 837
313 Ga0207639_10007233 3300026041 Bacteria 7563
314 Ga0207639_10011930 3300026041 Bacteria 6045
315 Ga0207639_10041375 3300026041 Bacteria 3447
316 Ga0207639_10258747 3300026041 Bacteria 1521
317 Ga0207639_10465282 3300026041 Bacteria 1150
318 Ga0207639_10761404 3300026041 Bacteria 901
319 Ga0207678_10068601 3300026067 Bacteria 3042
320 Ga0207678_11113957 3300026067 Bacteria 699
321 Ga0207702_10043009 3300026078 Bacteria 3791
322 Ga0207702_10250781 3300026078 Bacteria 1662
323 Ga0207702_10404588 3300026078 Bacteria 1317
324 Ga0207702_10513496 3300026078 Bacteria 1169
325 Ga0207702_10618732 3300026078 Bacteria 1063
326 Ga0207641_10029964 3300026088 Bacteria 4503
327 Ga0207648_10763797 3300026089 Bacteria 898
328 Ga0207676_10380290 3300026095 Bacteria 1314
329 Ga0207676_10399343 3300026095 Bacteria 1284
330 Ga0207674_10057472 3300026116 Bacteria 3943
331 Ga0207675_100179033 3300026118 Bacteria 2030
332 Ga0207683_10157290 3300026121 Bacteria 2053
333 Ga0207683_10558484 3300026121 Bacteria 1059
334 Ga0207698_10026340 3300026142 Bacteria 4112
335 Ga0207698_10083603 3300026142 Bacteria 2584
336 Ga0207698_10220880 3300026142 Bacteria 1712
337 Ga0207698_10834375 3300026142 Bacteria 926
338 Ga0209983_1018319 3300027665 Bacteria 1453
339 Ga0209974_10126650 3300027876 Bacteria 908
340 Ga0209974_10238010 3300027876 Bacteria 682
341 Ga0268266_10000265 3300028379 Bacteria 87871
342 Ga0268266_10040177 3300028379 Bacteria 3987
343 Ga0268266_10444684 3300028379 Bacteria 1231
344 Ga0268266_10945253 3300028379 Bacteria 834
345 Ga0268266_11960414 3300028379 Bacteria 559
346 Ga0268265_10002571 3300028380 Bacteria 13554
347 Ga0268265_10014725 3300028380 Bacteria 5337
348 Ga0268265_10021366 3300028380 Bacteria 4533
349 Ga0268265_10064180 3300028380 Bacteria 2828
350 Ga0268265_10287805 3300028380 Bacteria 1473
351 Ga0268265_10433755 3300028380 Bacteria 1223
352 Ga0268265_10455444 3300028380 Bacteria 1196
353 Ga0268264_10000169 3300028381 Bacteria 144978
354 Ga0268264_10077769 3300028381 Bacteria 2827
355 Ga0268264_10091721 3300028381 Bacteria 2621
356 Ga0268264_10936607 3300028381 Bacteria 871
357 Ga0265334_10096613 3300028573 Bacteria 1073
358 Ga0307515_10025521 3300028794 Bacteria 10218
359 Ga0307515_10191957 3300028794 Bacteria 1949
360 Ga0307515_10646645 3300028794 Bacteria 670
361 Ga0265338_10019208 3300028800 Bacteria 7271
362 Ga0265338_10039703 3300028800 Bacteria 4435
363 Ga0265338_10151121 3300028800 Bacteria 1804
364 Ga0265338_10173021 3300028800 Bacteria 1654
365 Ga0265338_10747010 3300028800 Bacteria 673
366 Ga0307511_10071077 3300030521 Bacteria 2542
367 Ga0265328_10107402 3300031239 Bacteria 1036
368 Ga0265325_10006244 3300031241 Bacteria 7263
369 Ga0265329_10033006 3300031242 Bacteria 1675
370 Ga0265340_10057760 3300031247 Bacteria 1864
371 Ga0265339_10000389 3300031249 Bacteria 34751
372 Ga0265327_10001033 3300031251 Bacteria 39244
373 Ga0307513_10000261 3300031456 Bacteria 76045
374 Ga0307408_100902659 3300031548 Bacteria 809
375 Ga0265313_10000449 3300031595 Bacteria 43511
376 Ga0265314_10047669 3300031711 Bacteria 3013
377 Ga0265314_10048467 3300031711 Bacteria 2982
378 Ga0265314_10104975 3300031711 Bacteria 1808
379 Ga0265314_10133553 3300031711 Bacteria 1544
380 Ga0307516_10000004 3300031730 Bacteria 367451
381 Ga0307413_10217370 3300031824 Bacteria 1393
382 Ga0307413_10693012 3300031824 Bacteria 845
383 Ga0307413_11834971 3300031824 Bacteria 543
384 Ga0307410_10611627 3300031852 Bacteria 910
385 Ga0307407_10609780 3300031903 Bacteria 814
386 Ga0307407_10735309 3300031903 Bacteria 746
387 Ga0307409_101070701 3300031995 Bacteria 827
388 Ga0307416_100281241 3300032002 Bacteria 1641
389 Ga0307414_10420079 3300032004 Bacteria 1166
390 Ga0307411_11929502 3300032005 Bacteria 550
391 Ga0373948_0086323 3300034817 Bacteria 723
392 Ga0373934_0255967 3300035086 Bacteria 724
393 Ga0373944_0074975 3300035089 Bacteria 1108
394 Ga0373932_0074617 3300035112 Bacteria 1059
395 Ga0373943_0725635 3300035170 Bacteria 589
396 Ga0373946_0003816 3300035171 Bacteria 5349
397 Ga0373931_0096749 3300035691 Bacteria 1654
398 Ga0373931_0256077 3300035691 Bacteria 1066
399 Ga0373935_0497054 3300035692 Bacteria 885
400 Ga0373927_0000323 3300035695 Bacteria 37618
401 Ga0373937_1504134 3300036401 Bacteria 621
402 Ga0373925_0000061 3300037068 Bacteria 117783
403 Ga0395899_0117329 3300037312 Bacteria 1909
404 Ga0395899_0447533 3300037312 Bacteria 846
405 Ga0395899_0459232 3300037312 Bacteria 832
406 Ga0395899_0768125 3300037312 Bacteria 598
407 Ga0395900_0194693 3300037418 Bacteria 2054
408 Ga0395900_0221214 3300037418 Bacteria 1908
409 Ga0395900_0392615 3300037418 Bacteria 1353
410 Ga0395900_0425217 3300037418 Bacteria 1288
411 Ga0395900_0759534 3300037418 Bacteria 899
412 Ga0395898_0124963 3300037466 Bacteria 2464
413 Ga0395898_0481906 3300037466 Bacteria 1180
414 Ga0395898_0527032 3300037466 Bacteria 1123
415 Ga0395905_0003612 3300037471 Bacteria 16441
416 Ga0395905_0015746 3300037471 Bacteria 7184
417 Ga0395905_0352865 3300037471 Bacteria 1363
418 Ga0395905_0568134 3300037471 Bacteria 1035
419 Ga0395901_0078590 3300038443 Bacteria 3445
420 Ga0395901_0143673 3300038443 Bacteria 2508
421 Ga0395901_0161843 3300038443 Bacteria 2350
422 Ga0395901_0234392 3300038443 Bacteria 1916
423 Ga0395901_0684846 3300038443 Bacteria 1024
424 Ga0395901_0722334 3300038443 Bacteria 992
425 Ga0395901_1079397 3300038443 Bacteria 774
426 Ga0400486_14046 3300038742 Bacteria 5716
427 Ga0436360_0414423 3300039438 Bacteria 2106
428 Ga0436360_0681050 3300039438 Bacteria 547
429 Ga0436360_1144667 3300039438 Bacteria 2804
430 Ga0436361_0100937 3300039447 Bacteria 8249
431 Ga0436361_0125926 3300039447 Bacteria 553
432 Ga0436361_0320334 3300039447 Bacteria 1211
433 Ga0436361_0798110 3300039447 Bacteria 862
434 Ga0436361_1197628 3300039447 Bacteria 1239
435 Ga0439436_0256568 3300041404 Bacteria 508
436 Ga0439461_0119236 3300041410 Bacteria 658
437 Ga0439461_0173001 3300041410 Bacteria 568
438 Ga0439465_0031449 3300041413 Bacteria 1691
439 Ga0451789_0794106 3300041443 Bacteria 634
440 Ga0451790_46757 3300041444 Bacteria 536
441 Ga0451793_1847991 3300041452 Bacteria 894
442 Ga0451797_1338990 3300041453 Bacteria 671
443 Ga0451802_1510085 3300041460 Bacteria 505
444 Ga0451807_0966353 3300041486 Bacteria 597
445 Ga0451807_1668656 3300041486 Bacteria 667
446 Ga0451835_0930043 3300041492 Bacteria 650
447 Ga0451837_1716482 3300041494 Bacteria 1014
448 Ga0451849_1539659 3300041505 Bacteria 522
449 Ga0451843_0825648 3300041509 Bacteria 1036
450 Ga0439445_0064202 3300042004 Bacteria 1008
451 Ga0439446_0014459 3300042156 Bacteria 2179
452 Ga0439434_0044153 3300042435 Bacteria 1373
453 Ga0439434_0351577 3300042435 Bacteria 515
454 Ga0439435_0079858 3300042436 Bacteria 980
455 Ga0439435_0221228 3300042436 Bacteria 630
456 Ga0466965_0337851 3300044683 Bacteria 823
457 Ga0466966_0288732 3300044684 Bacteria 986
458 Ga0466963_0802691 3300044694 Bacteria 664
459 Ga0466963_1120018 3300044694 Bacteria 554
460 Ga0466968_0103806 3300044735 Bacteria 1272
461 Ga0466957_0297169 3300044842 Bacteria 1084
462 Ga0466957_1449880 3300044842 Bacteria 500
463 Ga0466959_0035106 3300045049 Bacteria 3710
464 Ga0466967_0213153 3300045976 Bacteria 1833
465 Ga0495617_089409 3300046452 Bacteria 1006
466 Ga0495627_001535 3300046453 Bacteria 13242
467 Ga0495590_0000637 3300046457 Bacteria 16257
468 Ga0495629_0361733 3300046459 Bacteria 989
469 Ga0495638_0001003 3300046460 Bacteria 28322
470 Ga0495638_0003310 3300046460 Bacteria 12714
471 Ga0495638_0003618 3300046460 Bacteria 12076
472 Ga0495638_0005017 3300046460 Bacteria 9937
473 Ga0495638_0020558 3300046460 Bacteria 4360
474 Ga0495651_0304974 3300046462 Bacteria 1067
475 Ga0495650_0000007 3300046471 Bacteria 718072
476 Ga0495594_0206281 3300046499 Bacteria 1120
477 Ga0495583_0000037 3300046506 Bacteria 244437
478 Ga0495583_0157457 3300046506 Bacteria 939
479 Ga0495606_0020966 3300046507 Bacteria 4797
480 Ga0495606_0161882 3300046507 Bacteria 1305
481 Ga0495608_0560673 3300046511 Bacteria 688
482 Ga0495610_0000205 3300046512 Bacteria 65600
483 Ga0495610_0001610 3300046512 Bacteria 19895
484 Ga0495610_0005214 3300046512 Bacteria 9303
485 Ga0495616_0000159 3300046513 Bacteria 58948
486 Ga0495620_0013393 3300046515 Bacteria 4200
487 Ga0495631_0179595 3300046518 Bacteria 907
488 Ga0495632_0001395 3300046519 Bacteria 20270
489 Ga0495637_0003268 3300046520 Bacteria 8623
490 Ga0495637_0027793 3300046520 Bacteria 2527
491 Ga0495643_0018407 3300046522 Bacteria 4061
492 Ga0495643_0179461 3300046522 Bacteria 1030
493 Ga0495648_0000154 3300046524 Bacteria 81679
494 Ga0495648_0040700 3300046524 Bacteria 2944
495 Ga0495663_0247942 3300046525 Bacteria 632
496 Ga0495642_0064831 3300046528 Bacteria 1520
497 Ga0495654_0000100 3300046530 Bacteria 98615
498 Ga0495621_0092031 3300046539 Bacteria 1144
499 Ga0495597_0015408 3300046542 Bacteria 3621
500 Ga0495597_0026634 3300046542 Bacteria 2655
501 Ga0495668_0000092 3300046616 Bacteria 142835
502 Ga0495668_0006961 3300046616 Bacteria 7315
503 Ga0495668_0011470 3300046616 Bacteria 5304
504 Ga0495668_0026263 3300046616 Bacteria 3305
505 Ga0495668_0042149 3300046616 Bacteria 2542
506 Ga0495668_0185119 3300046616 Bacteria 1141
507 Ga0495668_0212471 3300046616 Bacteria 1059
508 Ga0495625_0000080 3300046660 Bacteria 156895
509 Ga0495625_0003786 3300046660 Bacteria 14684
510 Ga0495625_0006302 3300046660 Bacteria 10609
511 Ga0495625_0030057 3300046660 Bacteria 4056
512 Ga0495625_0035884 3300046660 Bacteria 3649
513 Ga0495669_0019698 3300046684 Bacteria 2914
514 Ga0495613_0000435 3300046689 Bacteria 35741
515 Ga0495670_0302691 3300046691 Bacteria 857
516 Ga0495671_0612659 3300046692 Bacteria 518
517 Ga0495649_0514005 3300046694 Bacteria 595
518 Ga0495649_0647100 3300046694 Bacteria 520
519 Ga0495589_0017924 3300046794 Bacteria 3632
520 Ga0495636_0052056 3300047318 Bacteria 1717
521 Ga0495672_0001481 3300047320 Bacteria 23043
522 Ga0495672_0007251 3300047320 Bacteria 8364
523 Ga0495672_0018839 3300047320 Bacteria 4572
524 Ga0495677_0026683 3300047445 Bacteria 2095
525 Ga0495677_0028117 3300047445 Bacteria 2041
526 Ga0495677_0287973 3300047445 Bacteria 645
527 Ga0495679_002196 3300047446 Bacteria 10189
528 Ga0495673_0000132 3300047469 Bacteria 138001
529 Ga0495673_0000363 3300047469 Bacteria 54803
530 Ga0495673_0012113 3300047469 Bacteria 4592
531 Ga0495681_0008669 3300047470 Bacteria 6349
532 Ga0495686_0003268 3300047472 Bacteria 14187
533 Ga0495686_0010880 3300047472 Bacteria 6442
534 Ga0495686_0029767 3300047472 Bacteria 3550
535 Ga0495686_0038383 3300047472 Bacteria 3063
536 Ga0495686_0078234 3300047472 Bacteria 2024
537 Ga0495686_0082152 3300047472 Bacteria 1967
538 Ga0495686_0219991 3300047472 Bacteria 1081
539 Ga0495686_0232693 3300047472 Bacteria 1043
540 Ga0496101_0071183 3300048904 Bacteria 2549
541 Ga0496107_0000142 3300048910 Bacteria 35781
542 Ga0496107_0178604 3300048910 Bacteria 1576
543 Ga0496108_0521214 3300048911 Bacteria 1038
544 Ga0496108_1329421 3300048911 Bacteria 604
545 Ga0496114_0788179 3300048917 Bacteria 829
546 Ga0496114_0959841 3300048917 Bacteria 737
547 Ga0496115_0149425 3300048918 Bacteria 1928
548 Ga0496115_0282974 3300048918 Bacteria 1361
549 Ga0496115_0835762 3300048918 Bacteria 714
550 Ga0496117_0350852 3300048920 Bacteria 762
551 Ga0496120_0362081 3300048923 Bacteria 649
552 Ga0496121_0005751 3300048924 Bacteria 15746
553 Ga0496121_0075741 3300048924 Bacteria 2687
554 Ga0496121_0296515 3300048924 Bacteria 1099
555 Ga0496122_0277034 3300048925 Bacteria 920
556 Ga0496124_0021831 3300048927 Bacteria 5888
557 Ga0496124_0416722 3300048927 Bacteria 927
558 Ga0496124_0694908 3300048927 Bacteria 646
559 Ga0496124_0784795 3300048927 Bacteria 592
560 Ga0496125_0030771 3300048928 Bacteria 4795
561 Ga0496126_0002357 3300048929 Bacteria 25776
562 Ga0496126_0107854 3300048929 Bacteria 2429
563 Ga0495678_000659 3300049459 Bacteria 31659
564 Ga0501031_0174412 3300049568 Bacteria 1405
565 Ga0501031_0360149 3300049568 Bacteria 941
566 Ga0501031_0407960 3300049568 Bacteria 879
567 Ga0501032_0001563 3300049569 Bacteria 18270
568 Ga0501032_0150796 3300049569 Bacteria 1529
569 Ga0501032_0552039 3300049569 Bacteria 734
570 Ga0501032_0585978 3300049569 Bacteria 710
571 Ga0501032_0626170 3300049569 Bacteria 684
572 Ga0501032_0740714 3300049569 Bacteria 622
573 Ga0501033_0012313 3300049570 Bacteria 6529
574 Ga0501033_0078836 3300049570 Bacteria 2417
575 Ga0501033_0549214 3300049570 Bacteria 796
576 Ga0501034_0039981 3300049571 Bacteria 4749
577 Ga0501034_0040066 3300049571 Bacteria 4744
578 Ga0501034_0105656 3300049571 Bacteria 2808
579 Ga0501034_0208617 3300049571 Bacteria 1909
580 Ga0501034_0254375 3300049571 Bacteria 1700
581 Ga0501034_0262311 3300049571 Bacteria 1670
582 Ga0501034_0305164 3300049571 Bacteria 1527
583 Ga0501034_0398539 3300049571 Bacteria 1299
584 Ga0501034_0399848 3300049571 Bacteria 1296
585 Ga0501034_0639279 3300049571 Bacteria 966
586 Ga0501034_0663761 3300049571 Bacteria 943
587 Ga0501034_0885370 3300049571 Bacteria 781
588 Ga0501036_0014336 3300049572 Bacteria 6597
589 Ga0501036_1566121 3300049572 Bacteria 532
590 Ga0501037_0016941 3300049573 Bacteria 5362
591 Ga0501037_0021548 3300049573 Bacteria 4765
592 Ga0501037_0032652 3300049573 Bacteria 3845
593 Ga0501037_0125192 3300049573 Bacteria 1846
594 Ga0501037_0627561 3300049573 Bacteria 720
595 Ga0501038_0030626 3300049574 Bacteria 4758
596 Ga0501038_0092330 3300049574 Bacteria 2535
597 Ga0501038_0140103 3300049574 Bacteria 1979
598 Ga0501038_0180253 3300049574 Bacteria 1705
599 Ga0501038_1163201 3300049574 Bacteria 561
600 Ga0501039_0495372 3300049575 Bacteria 959
601 Ga0501043_0021252 3300049579 Bacteria 5088
602 Ga0501043_0151366 3300049579 Bacteria 1816
603 Ga0501043_0156023 3300049579 Bacteria 1785
604 Ga0501046_0285659 3300049580 Bacteria 1208
605 Ga0501046_0321322 3300049580 Bacteria 1128
606 Ga0501047_0000223 3300049581 Bacteria 67658
607 Ga0501047_0015714 3300049581 Bacteria 7212
608 Ga0501047_0188058 3300049581 Bacteria 1930
609 Ga0501047_0269902 3300049581 Bacteria 1548
610 Ga0501047_0407991 3300049581 Bacteria 1191
611 Ga0501047_0592684 3300049581 Bacteria 930
612 Ga0501047_0990948 3300049581 Bacteria 654
613 Ga0501048_0158776 3300049582 Bacteria 1600
614 Ga0501048_0582161 3300049582 Bacteria 803
615 Ga0501067_0000091 3300049583 Bacteria 52819
616 Ga0501067_0074271 3300049583 Bacteria 1884
617 Ga0501067_0789561 3300049583 Bacteria 535
618 Ga0501068_0002658 3300049584 Bacteria 9471
619 Ga0501070_0012163 3300049586 Bacteria 7262
620 Ga0501070_0102572 3300049586 Bacteria 2366
621 Ga0501070_0178841 3300049586 Bacteria 1746
622 Ga0501070_0601258 3300049586 Bacteria 877
623 Ga0501070_0611868 3300049586 Bacteria 868
624 Ga0501073_0000011 3300049589 Bacteria 161823
625 Ga0501073_0062276 3300049589 Bacteria 2602
626 Ga0501073_0320939 3300049589 Bacteria 1069
627 Ga0501073_0542413 3300049589 Bacteria 804
628 Ga0501073_0881951 3300049589 Bacteria 616
629 Ga0501074_0150663 3300049590 Bacteria 1663
630 Ga0501074_0366185 3300049590 Bacteria 1023
631 Ga0501077_0000011 3300049593 Bacteria 96805
632 Ga0501238_037965 3300049671 Bacteria 705
633 Ga0501080_0001484 3300049742 Bacteria 19783
634 Ga0501080_0021953 3300049742 Bacteria 5912
635 Ga0501080_0339269 3300049742 Bacteria 1358
636 Ga0501080_0354537 3300049742 Bacteria 1324
637 Ga0501080_0645772 3300049742 Bacteria 937
638 Ga0501080_0716149 3300049742 Bacteria 882
639 Ga0501081_1176308 3300049743 Bacteria 581
640 Ga0501083_0002308 3300049744 Bacteria 13036
641 Ga0501083_0031649 3300049744 Bacteria 3630
642 Ga0501083_0678165 3300049744 Bacteria 670
643 Ga0501035_0005658 3300049822 Bacteria 11796
644 Ga0501035_0026323 3300049822 Bacteria 5322
645 Ga0501035_0310512 3300049822 Bacteria 1327
646 Ga0501035_0900908 3300049822 Bacteria 700
647 Ga0501044_0007155 3300049823 Bacteria 12274
648 Ga0501044_0010058 3300049823 Bacteria 10280
649 Ga0501044_0094473 3300049823 Bacteria 3015
650 Ga0501044_0181606 3300049823 Bacteria 2070
651 Ga0501044_0424206 3300049823 Bacteria 1240
652 Ga0501044_0837244 3300049823 Bacteria 797
653 Ga0501044_1489519 3300049823 Bacteria 542
654 nmdc:mga03683_13444_c1 3300050489 Bacteria 3013
655 nmdc:mga03683_359060_c1 3300050489 Bacteria 691
656 nmdc:mga03683_372953_c1 3300050489 Bacteria 678
657 nmdc:mga03683_49616_c1 3300050489 Bacteria 1748
658 nmdc:mga03683_554337_c1 3300050489 Bacteria 560
659 nmdc:mga03683_638409_c1 3300050489 Bacteria 523
660 nmdc:mga03n38_89912_c1 3300050490 Bacteria 1459
661 nmdc:mga00v17_754084_c1 3300050491 Bacteria 622
662 nmdc:mga00v17_7564_c2 3300050491 Bacteria 2264
663 nmdc:mga0yw44_836127_c1 3300050492 Bacteria 625
664 nmdc:mga0k408_172711_c1 3300050493 Bacteria 1289
665 nmdc:mga0k408_29963_c1 3300050493 Bacteria 3101
666 nmdc:mga0k408_523308_c1 3300050493 Bacteria 702
667 nmdc:mga0k408_97809_c1 3300050493 Bacteria 1141
668 nmdc:mga06z11_336129_c1 3300050494 Bacteria 902
669 nmdc:mga06z11_341998_c1 3300050494 Bacteria 895
670 nmdc:mga04h51_116010_c1 3300050495 Bacteria 992
671 nmdc:mga04h51_295750_c1 3300050495 Bacteria 659
672 nmdc:mga07m45_37354_c1 3300050496 Bacteria 2709
673 nmdc:mga07m45_91276_c1 3300050496 Bacteria 1745
674 nmdc:mga0qj67_405942_c1 3300050509 Bacteria 1099
675 nmdc:mga0sz30_14935_c1 3300050516 Bacteria 3063
676 nmdc:mga0sz30_64032_c2 3300050516 Bacteria 975
677 Ga0495612_0100537 3300053078 Bacteria 1231
678 Ga0500578_0000092 3300053086 Bacteria 102206
679 Ga0500578_0269871 3300053086 Bacteria 1018
680 Ga0500643_005170 3300053087 Bacteria 5692
681 Ga0500643_018434 3300053087 Bacteria 2316
682 Ga0500643_107571 3300053087 Bacteria 754
683 Ga0500644_0000121 3300053088 Bacteria 48128
684 Ga0500644_0021802 3300053088 Bacteria 1924
685 Ga0500646_0037398 3300053090 Bacteria 1356
686 Ga0500646_0126818 3300053090 Bacteria 826
687 Ga0500651_0326731 3300053093 Bacteria 875
688 Ga0500641_0007547 3300053096 Bacteria 3878
689 Ga0500650_0257325 3300053098 Bacteria 781
690 Ga0500554_000951 3300053102 Bacteria 5624
691 Ga0500555_015527 3300053103 Bacteria 2197
692 Ga0500555_016079 3300053103 Bacteria 2156
693 Ga0500556_0000273 3300053104 Bacteria 40555
694 Ga0500556_0002733 3300053104 Bacteria 5447
695 Ga0500556_0218323 3300053104 Bacteria 752
696 Ga0500562_000772 3300053108 Bacteria 7796
697 Ga0500562_000990 3300053108 Bacteria 6929
698 Ga0500562_044278 3300053108 Bacteria 1185
699 Ga0500594_0000192 3300053118 Bacteria 15305
700 Ga0500594_0056821 3300053118 Bacteria 1117
701 Ga0500595_005390 3300053119 Bacteria 5593
702 Ga0500595_011491 3300053119 Bacteria 3465
703 Ga0500618_000034 3300053125 Bacteria 120560
704 Ga0500658_0003408 3300053134 Bacteria 6014
705 Ga0500559_0000005 3300053136 Bacteria 230231
706 Ga0500559_0002051 3300053136 Bacteria 10788
707 Ga0500559_0007255 3300053136 Bacteria 4924
708 Ga0500559_0206161 3300053136 Bacteria 927
709 Ga0500559_0588090 3300053136 Bacteria 505
710 Ga0500564_000085 3300053138 Bacteria 24497
711 Ga0500568_0093111 3300053139 Bacteria 1135
712 Ga0500568_0193994 3300053139 Bacteria 745
713 Ga0500588_0247233 3300053146 Bacteria 669
714 Ga0500616_0012756 3300053153 Bacteria 4906
715 Ga0500616_0078177 3300053153 Bacteria 1669
716 Ga0500622_0001197 3300053156 Bacteria 21349
717 Ga0500622_0006251 3300053156 Bacteria 6960
718 Ga0500622_0030614 3300053156 Bacteria 2825
719 Ga0500622_0032748 3300053156 Bacteria 2725
720 Ga0500627_0309980 3300053158 Bacteria 687
721 Ga0500636_0030803 3300053177 Bacteria 3175
722 Ga0500570_221636 3300053724 Bacteria 541
723 Ga0500611_001832 3300053727 Bacteria 2433
724 Ga0500645_000494 3300053730 Bacteria 26541
725 Ga0500645_001063 3300053730 Bacteria 15218
726 Ga0500645_006402 3300053730 Bacteria 4206
727 Ga0500645_093280 3300053730 Bacteria 853
728 Ga0500645_160663 3300053730 Bacteria 616
729 Ga0500645_162920 3300053730 Bacteria 611
730 Ga0501084_0303056 3300054114 Bacteria 1350
731 Ga0501084_0326962 3300054114 Bacteria 1295
732 Ga0587077_024025 3300059493 Bacteria 1106
733 Ga0587080_109882 3300059503 Bacteria 600
734 Ga0587082_060825 3300059504 Bacteria 744
735 Ga0587101_004973 3300059623 Bacteria 1451
736 Ga0587062_006810 3300059639 Bacteria 1311
737 Ga0587069_158590 3300059642 Bacteria 507
738 Ga0587076_117399 3300059645 Bacteria 613
739 Ga0587100_034046 3300059648 Bacteria 552
740 Ga0587107_138814 3300059652 Bacteria 518
741 Ga0587111_0061480 3300060346 Bacteria 855
742 Ga0501082_0019195 3300060353 Bacteria 5891
743 Ga0501082_0392628 3300060353 Bacteria 1211
744 Ga0501082_0905311 3300060353 Bacteria 772

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0352865 Ga0395905_0352865_516_914 106
2 3300005436 Ga0070713_100722431 Ga0070713_1007224311 107
3 3300005262 Ga0065165_1013111 Ga0065165_10131113 108
4 3300009176 Ga0105242_10302217 Ga0105242_103022172 108
5 3300025945 Ga0207679_11804904 Ga0207679_118049042 108
6 3300009093 Ga0105240_10047987 Ga0105240_100479876 109
7 3300025901 Ga0207688_10311583 Ga0207688_103115832 109
8 3300025913 Ga0207695_10035247 Ga0207695_100352473 109
9 3300005844 Ga0068862_101682674 Ga0068862_1016826742 110
10 3300006871 Ga0075434_100310133 Ga0075434_1003101333 110
11 3300009553 Ga0105249_10059537 Ga0105249_100595373 110
12 3300020082 Ga0206353_10095337 Ga0206353_100953372 110
13 3300028380 Ga0268265_10021366 Ga0268265_100213663 110
14 3300028380 Ga0268265_10455444 Ga0268265_104554441 110
15 3300041494 Ga0451837_1716482 Ga0451837_1716482_256_591 110
16 3300044842 Ga0466957_1449880 Ga0466957_1449880_57_452 110
17 3300049569 Ga0501032_0001563 Ga0501032_0001563_15202_15537 110
18 3300049569 Ga0501032_0585978 Ga0501032_0585978_249_599 110
19 3300049573 Ga0501037_0021548 Ga0501037_0021548_33_368 110
20 3300049579 Ga0501043_0156023 Ga0501043_0156023_182_517 110
21 3300049583 Ga0501067_0000091 Ga0501067_0000091_5047_5382 110
22 3300049584 Ga0501068_0002658 Ga0501068_0002658_4156_4491 110
23 3300049589 Ga0501073_0000011 Ga0501073_0000011_78872_79207 110
24 3300049593 Ga0501077_0000011 Ga0501077_0000011_82486_82821 110
25 3300049742 Ga0501080_0001484 Ga0501080_0001484_19028_19363 110
26 3300049823 Ga0501044_0007155 Ga0501044_0007155_11277_11612 110
27 3300054114 Ga0501084_0326962 Ga0501084_0326962_538_873 110
28 3300060353 Ga0501082_0905311 Ga0501082_0905311_116_451 110
29 3300014969 Ga0157376_10978742 Ga0157376_109787421 111
30 3300028573 Ga0265334_10096613 Ga0265334_100966132 111
31 3300028800 Ga0265338_10039703 Ga0265338_100397035 111
32 3300031239 Ga0265328_10107402 Ga0265328_101074022 111
33 3300031241 Ga0265325_10006244 Ga0265325_100062445 111
34 3300031242 Ga0265329_10033006 Ga0265329_100330062 111
35 3300031249 Ga0265339_10000389 Ga0265339_100003897 111
36 3300031595 Ga0265313_10000449 Ga0265313_1000044931 111
37 3300031711 Ga0265314_10047669 Ga0265314_100476692 111
38 3300041444 Ga0451790_46757 Ga0451790_46757_71_418 111
39 3300005262 Ga0065165_1000979 Ga0065165_100097936 112
40 3300009098 Ga0105245_10638442 Ga0105245_106384422 112
41 3300009545 Ga0105237_10000309 Ga0105237_1000030913 112
42 3300009551 Ga0105238_10402617 Ga0105238_104026173 112
43 3300010375 Ga0105239_10000575 Ga0105239_100005755 112
44 3300025295 Ga0209564_1001352 Ga0209564_100135217 112
45 3300025299 Ga0209256_1001833 Ga0209256_100183321 112
46 3300041413 Ga0439465_0031449 Ga0439465_0031449_866_1231 112
47 3300041486 Ga0451807_0966353 Ga0451807_0966353_34_399 112
48 3300041509 Ga0451843_0825648 Ga0451843_0825648_205_543 112
49 3300042436 Ga0439435_0221228 Ga0439435_0221228_178_543 112
50 3300046460 Ga0495638_0003618 Ga0495638_0003618_2784_3191 112
51 3300048918 Ga0496115_0282974 Ga0496115_0282974_981_1325 112
52 3300050493 nmdc:mga0k408_172711_c1 nmdc:mga0k408_172711_c1_39_389 112
53 3300053136 Ga0500559_0588090 Ga0500559_0588090_17_355 112
54 iso_pu_bacteria 8045864390 8045865266 112
55 3300005327 Ga0070658_10131827 Ga0070658_101318272 113
56 3300009093 Ga0105240_11363495 Ga0105240_113634952 113
57 3300013100 Ga0157373_11341198 Ga0157373_113411981 113
58 3300013102 Ga0157371_10061002 Ga0157371_100610023 113
59 3300013104 Ga0157370_10245263 Ga0157370_102452633 113
60 3300013307 Ga0157372_10735492 Ga0157372_107354922 113
61 3300037312 Ga0395899_0459232 Ga0395899_0459232_438_806 113
62 3300037466 Ga0395898_0527032 Ga0395898_0527032_123_491 113
63 3300038443 Ga0395901_0161843 Ga0395901_0161843_1032_1400 113
64 3300039438 Ga0436360_0414423 Ga0436360_0414423_695_1036 113
65 3300044842 Ga0466957_0297169 Ga0466957_0297169_34_405 113
66 3300047472 Ga0495686_0010880 Ga0495686_0010880_245_640 113
67 3300048911 Ga0496108_1329421 Ga0496108_1329421_196_537 113
68 3300048927 Ga0496124_0694908 Ga0496124_0694908_118_498 113
69 3300049571 Ga0501034_0305164 Ga0501034_0305164_848_1219 113
70 3300050489 nmdc:mga03683_554337_c1 nmdc:mga03683_554337_c1_129_470 113
71 3300050495 nmdc:mga04h51_116010_c1 nmdc:mga04h51_116010_c1_146_517 113
72 iso_pu_bacteria 2643221629 2644167644 113
73 iso_pu_bacteria 2643221662 2644349104 113
74 3300005347 Ga0070668_100017835 Ga0070668_1000178356 114
75 3300005548 Ga0070665_100469453 Ga0070665_1004694532 114
76 3300005844 Ga0068862_100012982 Ga0068862_1000129823 114
77 3300013104 Ga0157370_11381062 Ga0157370_113810622 114
78 3300014969 Ga0157376_11459360 Ga0157376_114593602 114
79 3300025972 Ga0207668_10010026 Ga0207668_100100266 114
80 3300025972 Ga0207668_10320715 Ga0207668_103207152 114
81 3300028379 Ga0268266_10040177 Ga0268266_100401775 114
82 3300028380 Ga0268265_10014725 Ga0268265_100147255 114
83 3300031247 Ga0265340_10057760 Ga0265340_100577602 114
84 3300031711 Ga0265314_10048467 Ga0265314_100484674 114
85 3300032002 Ga0307416_100281241 Ga0307416_1002812413 114
86 3300037312 Ga0395899_0447533 Ga0395899_0447533_211_606 114
87 3300037466 Ga0395898_0124963 Ga0395898_0124963_725_1120 114
88 3300041452 Ga0451793_1847991 Ga0451793_1847991_318_695 114
89 3300048920 Ga0496117_0350852 Ga0496117_0350852_45_422 114
90 3300048923 Ga0496120_0362081 Ga0496120_0362081_149_532 114
91 3300048924 Ga0496121_0296515 Ga0496121_0296515_589_972 114
92 3300005327 Ga0070658_10194762 Ga0070658_101947623 115
93 3300005337 Ga0070682_100977607 Ga0070682_1009776072 115
94 3300005539 Ga0068853_100010907 Ga0068853_1000109075 115
95 3300005548 Ga0070665_100017471 Ga0070665_1000174714 115
96 3300005563 Ga0068855_100021728 Ga0068855_1000217287 115
97 3300005564 Ga0070664_101015629 Ga0070664_1010156292 115
98 3300005719 Ga0068861_100713484 Ga0068861_1007134842 115
99 3300006038 Ga0075365_10841960 Ga0075365_108419602 115
100 3300006042 Ga0075368_10240587 Ga0075368_102405872 115
101 3300006048 Ga0075363_100021497 Ga0075363_1000214972 115
102 3300006051 Ga0075364_10069003 Ga0075364_100690032 115
103 3300006051 Ga0075364_10124886 Ga0075364_101248863 115
104 3300006177 Ga0075362_10055076 Ga0075362_100550762 115
105 3300006177 Ga0075362_10179820 Ga0075362_101798202 115
106 3300006178 Ga0075367_10505949 Ga0075367_105059491 115
107 3300006186 Ga0075369_10185433 Ga0075369_101854331 115
108 3300006195 Ga0075366_10468727 Ga0075366_104687272 115
109 3300006195 Ga0075366_10609802 Ga0075366_106098021 115
110 3300006353 Ga0075370_10059177 Ga0075370_100591772 115
111 3300009093 Ga0105240_10055987 Ga0105240_100559875 115
112 3300009551 Ga0105238_11969105 Ga0105238_119691051 115
113 3300013296 Ga0157374_12687445 Ga0157374_126874451 115
114 3300013307 Ga0157372_11865941 Ga0157372_118659412 115
115 3300014969 Ga0157376_10193623 Ga0157376_101936231 115
116 3300020069 Ga0197907_10040603 Ga0197907_100406033 115
117 3300022467 Ga0224712_10059741 Ga0224712_100597412 115
118 3300022467 Ga0224712_10128235 Ga0224712_101282352 115
119 3300025231 Ga0207427_101879 Ga0207427_1018793 115
120 3300025261 Ga0209233_1001040 Ga0209233_100104010 115
121 3300025909 Ga0207705_10058559 Ga0207705_100585592 115
122 3300025913 Ga0207695_10131122 Ga0207695_101311224 115
123 3300025914 Ga0207671_10000617 Ga0207671_100006172 115
124 3300025919 Ga0207657_10009762 Ga0207657_100097629 115
125 3300025924 Ga0207694_10934418 Ga0207694_109344181 115
126 3300025932 Ga0207690_10161424 Ga0207690_101614243 115
127 3300025945 Ga0207679_10838635 Ga0207679_108386352 115
128 3300025949 Ga0207667_10040883 Ga0207667_100408837 115
129 3300025949 Ga0207667_10284756 Ga0207667_102847562 115
130 3300026041 Ga0207639_10007233 Ga0207639_100072334 115
131 3300026041 Ga0207639_10761404 Ga0207639_107614042 115
132 3300027665 Ga0209983_1018319 Ga0209983_10183193 115
133 3300027876 Ga0209974_10126650 Ga0209974_101266502 115
134 3300027876 Ga0209974_10238010 Ga0209974_102380102 115
135 3300028379 Ga0268266_10000265 Ga0268266_1000026542 115
136 3300031548 Ga0307408_100902659 Ga0307408_1009026592 115
137 3300031824 Ga0307413_10217370 Ga0307413_102173703 115
138 3300031824 Ga0307413_11834971 Ga0307413_118349712 115
139 3300031903 Ga0307407_10609780 Ga0307407_106097801 115
140 3300032005 Ga0307411_11929502 Ga0307411_119295021 115
141 3300038443 Ga0395901_0722334 Ga0395901_0722334_308_688 115
142 3300038443 Ga0395901_1079397 Ga0395901_1079397_358_738 115
143 3300041404 Ga0439436_0256568 Ga0439436_0256568_33_413 115
144 3300041460 Ga0451802_1510085 Ga0451802_1510085_61_441 115
145 3300041492 Ga0451835_0930043 Ga0451835_0930043_209_589 115
146 3300042004 Ga0439445_0064202 Ga0439445_0064202_328_708 115
147 3300042435 Ga0439434_0044153 Ga0439434_0044153_11_391 115
148 3300042435 Ga0439434_0351577 Ga0439434_0351577_61_441 115
149 3300044683 Ga0466965_0337851 Ga0466965_0337851_49_429 115
150 3300047472 Ga0495686_0078234 Ga0495686_0078234_408_788 115
151 3300047472 Ga0495686_0232693 Ga0495686_0232693_53_433 115
152 3300048917 Ga0496114_0788179 Ga0496114_0788179_28_408 115
153 3300048929 Ga0496126_0107854 Ga0496126_0107854_1177_1557 115
154 3300049568 Ga0501031_0407960 Ga0501031_0407960_207_587 115
155 3300049569 Ga0501032_0740714 Ga0501032_0740714_13_393 115
156 3300049570 Ga0501033_0012313 Ga0501033_0012313_3711_4091 115
157 3300049571 Ga0501034_0040066 Ga0501034_0040066_4326_4706 115
158 3300049571 Ga0501034_0254375 Ga0501034_0254375_348_728 115
159 3300049571 Ga0501034_0262311 Ga0501034_0262311_861_1241 115
160 3300049571 Ga0501034_0398539 Ga0501034_0398539_197_577 115
161 3300049571 Ga0501034_0885370 Ga0501034_0885370_213_593 115
162 3300049573 Ga0501037_0125192 Ga0501037_0125192_1234_1614 115
163 3300049573 Ga0501037_0627561 Ga0501037_0627561_173_553 115
164 3300049574 Ga0501038_0180253 Ga0501038_0180253_771_1151 115
165 3300049580 Ga0501046_0285659 Ga0501046_0285659_481_861 115
166 3300049581 Ga0501047_0015714 Ga0501047_0015714_3582_3962 115
167 3300049581 Ga0501047_0990948 Ga0501047_0990948_91_471 115
168 3300049586 Ga0501070_0012163 Ga0501070_0012163_6335_6715 115
169 3300049590 Ga0501074_0366185 Ga0501074_0366185_477_857 115
170 3300049742 Ga0501080_0645772 Ga0501080_0645772_275_655 115
171 3300049822 Ga0501035_0026323 Ga0501035_0026323_4107_4487 115
172 3300049823 Ga0501044_1489519 Ga0501044_1489519_64_444 115
173 3300050489 nmdc:mga03683_13444_c1 nmdc:mga03683_13444_c1_759_1139 115
174 3300050489 nmdc:mga03683_359060_c1 nmdc:mga03683_359060_c1_133_513 115
175 3300050489 nmdc:mga03683_49616_c1 nmdc:mga03683_49616_c1_480_860 115
176 3300050490 nmdc:mga03n38_89912_c1 nmdc:mga03n38_89912_c1_492_872 115
177 3300050491 nmdc:mga00v17_754084_c1 nmdc:mga00v17_754084_c1_167_547 115
178 3300050491 nmdc:mga00v17_7564_c2 nmdc:mga00v17_7564_c2_1635_2015 115
179 3300050493 nmdc:mga0k408_523308_c1 nmdc:mga0k408_523308_c1_272_652 115
180 3300050493 nmdc:mga0k408_97809_c1 nmdc:mga0k408_97809_c1_740_1120 115
181 3300050494 nmdc:mga06z11_341998_c1 nmdc:mga06z11_341998_c1_302_682 115
182 3300050495 nmdc:mga04h51_295750_c1 nmdc:mga04h51_295750_c1_34_414 115
183 3300050496 nmdc:mga07m45_91276_c1 nmdc:mga07m45_91276_c1_546_926 115
184 3300050516 nmdc:mga0sz30_64032_c2 nmdc:mga0sz30_64032_c2_100_480 115
185 3300053108 Ga0500562_044278 Ga0500562_044278_306_686 115
186 3300053139 Ga0500568_0093111 Ga0500568_0093111_644_1024 115
187 3300053153 Ga0500616_0012756 Ga0500616_0012756_3043_3423 115
188 3300053730 Ga0500645_093280 Ga0500645_093280_43_423 115
189 3300059504 Ga0587082_060825 Ga0587082_060825_325_705 115
190 3300059623 Ga0587101_004973 Ga0587101_004973_662_1042 115
191 3300059639 Ga0587062_006810 Ga0587062_006810_314_694 115
192 3300059645 Ga0587076_117399 Ga0587076_117399_197_577 115
193 3300059648 Ga0587100_034046 Ga0587100_034046_83_463 115
194 3300060346 Ga0587111_0061480 Ga0587111_0061480_194_574 115
195 3300004799 Ga0058863_11578230 Ga0058863_115782302 116
196 3300005327 Ga0070658_10197317 Ga0070658_101973173 116
197 3300005329 Ga0070683_100605156 Ga0070683_1006051562 116
198 3300005329 Ga0070683_101412591 Ga0070683_1014125911 116
199 3300005331 Ga0070670_101338743 Ga0070670_1013387431 116
200 3300005339 Ga0070660_100083536 Ga0070660_1000835363 116
201 3300005344 Ga0070661_100022236 Ga0070661_1000222366 116
202 3300005344 Ga0070661_100073003 Ga0070661_1000730032 116
203 3300005344 Ga0070661_100129884 Ga0070661_1001298843 116
204 3300005344 Ga0070661_100762644 Ga0070661_1007626441 116
205 3300005355 Ga0070671_100273360 Ga0070671_1002733603 116
206 3300005364 Ga0070673_100341036 Ga0070673_1003410362 116
207 3300005364 Ga0070673_100857530 Ga0070673_1008575302 116
208 3300005366 Ga0070659_100029991 Ga0070659_1000299911 116
209 3300005456 Ga0070678_100108961 Ga0070678_1001089613 116
210 3300005456 Ga0070678_100220898 Ga0070678_1002208983 116
211 3300005459 Ga0068867_100590040 Ga0068867_1005900402 116
212 3300005530 Ga0070679_100566984 Ga0070679_1005669842 116
213 3300005530 Ga0070679_101688685 Ga0070679_1016886851 116
214 3300005535 Ga0070684_100928012 Ga0070684_1009280122 116
215 3300005539 Ga0068853_100000349 Ga0068853_10000034931 116
216 3300005539 Ga0068853_100310939 Ga0068853_1003109392 116
217 3300005563 Ga0068855_100019409 Ga0068855_1000194097 116
218 3300005563 Ga0068855_100103516 Ga0068855_1001035163 116
219 3300005563 Ga0068855_100621957 Ga0068855_1006219572 116
220 3300005564 Ga0070664_100635099 Ga0070664_1006350992 116
221 3300005577 Ga0068857_100817247 Ga0068857_1008172472 116
222 3300005578 Ga0068854_100080564 Ga0068854_1000805642 116
223 3300005578 Ga0068854_100175192 Ga0068854_1001751922 116
224 3300005614 Ga0068856_100032721 Ga0068856_1000327212 116
225 3300005614 Ga0068856_100347165 Ga0068856_1003471652 116
226 3300005614 Ga0068856_100406014 Ga0068856_1004060142 116
227 3300005614 Ga0068856_100572408 Ga0068856_1005724081 116
228 3300005616 Ga0068852_100010308 Ga0068852_1000103083 116
229 3300005616 Ga0068852_100056190 Ga0068852_1000561904 116
230 3300005616 Ga0068852_100078086 Ga0068852_1000780863 116
231 3300005616 Ga0068852_101637586 Ga0068852_1016375861 116
232 3300005834 Ga0068851_10174409 Ga0068851_101744092 116
233 3300005841 Ga0068863_102249157 Ga0068863_1022491571 116
234 3300009098 Ga0105245_11185930 Ga0105245_111859302 116
235 3300009148 Ga0105243_11398020 Ga0105243_113980202 116
236 3300009174 Ga0105241_10021133 Ga0105241_100211335 116
237 3300009174 Ga0105241_10421379 Ga0105241_104213793 116
238 3300009176 Ga0105242_11621230 Ga0105242_116212301 116
239 3300009545 Ga0105237_10255147 Ga0105237_102551473 116
240 3300009545 Ga0105237_10835634 Ga0105237_108356342 116
241 3300009551 Ga0105238_10081963 Ga0105238_100819633 116
242 3300009551 Ga0105238_10217173 Ga0105238_102171733 116
243 3300009551 Ga0105238_10688069 Ga0105238_106880691 116
244 3300010375 Ga0105239_10026037 Ga0105239_100260372 116
245 3300010375 Ga0105239_10955857 Ga0105239_109558572 116
246 3300010375 Ga0105239_11148449 Ga0105239_111484492 116
247 3300010375 Ga0105239_12219715 Ga0105239_122197152 116
248 3300011119 Ga0105246_10454803 Ga0105246_104548032 116
249 3300013104 Ga0157370_11694642 Ga0157370_116946422 116
250 3300013105 Ga0157369_10029152 Ga0157369_100291524 116
251 3300013296 Ga0157374_10320429 Ga0157374_103204292 116
252 3300013296 Ga0157374_10766630 Ga0157374_107666302 116
253 3300013308 Ga0157375_11332632 Ga0157375_113326321 116
254 3300014325 Ga0163163_10454052 Ga0163163_104540522 116
255 3300014325 Ga0163163_10470242 Ga0163163_104702423 116
256 3300014325 Ga0163163_12292274 Ga0163163_122922742 116
257 3300014497 Ga0182008_10113850 Ga0182008_101138503 116
258 3300020069 Ga0197907_10058942 Ga0197907_100589421 116
259 3300020070 Ga0206356_11296514 Ga0206356_112965142 116
260 3300020070 Ga0206356_11504143 Ga0206356_115041432 116
261 3300020075 Ga0206349_1124037 Ga0206349_11240371 116
262 3300020076 Ga0206355_1348711 Ga0206355_13487111 116
263 3300020077 Ga0206351_10492450 Ga0206351_104924502 116
264 3300020078 Ga0206352_11266876 Ga0206352_112668762 116
265 3300020080 Ga0206350_10872178 Ga0206350_108721782 116
266 3300020081 Ga0206354_10464058 Ga0206354_104640581 116
267 3300020082 Ga0206353_11387986 Ga0206353_113879861 116
268 3300020610 Ga0154015_1147209 Ga0154015_11472092 116
269 3300025321 Ga0207656_10074112 Ga0207656_100741122 116
270 3300025907 Ga0207645_10159340 Ga0207645_101593402 116
271 3300025909 Ga0207705_10262017 Ga0207705_102620172 116
272 3300025909 Ga0207705_10295202 Ga0207705_102952023 116
273 3300025909 Ga0207705_10437210 Ga0207705_104372102 116
274 3300025911 Ga0207654_10162003 Ga0207654_101620032 116
275 3300025912 Ga0207707_11035266 Ga0207707_110352661 116
276 3300025913 Ga0207695_10255677 Ga0207695_102556773 116
277 3300025913 Ga0207695_10766330 Ga0207695_107663302 116
278 3300025913 Ga0207695_11577470 Ga0207695_115774701 116
279 3300025914 Ga0207671_10177492 Ga0207671_101774922 116
280 3300025919 Ga0207657_10012082 Ga0207657_100120825 116
281 3300025919 Ga0207657_10097737 Ga0207657_100977373 116
282 3300025920 Ga0207649_10000527 Ga0207649_1000052720 116
283 3300025920 Ga0207649_10623496 Ga0207649_106234961 116
284 3300025921 Ga0207652_11812646 Ga0207652_118126461 116
285 3300025924 Ga0207694_10112207 Ga0207694_101122073 116
286 3300025924 Ga0207694_10274456 Ga0207694_102744563 116
287 3300025924 Ga0207694_10467447 Ga0207694_104674472 116
288 3300025932 Ga0207690_10424572 Ga0207690_104245722 116
289 3300025932 Ga0207690_10941690 Ga0207690_109416902 116
290 3300025933 Ga0207706_10075551 Ga0207706_100755513 116
291 3300025944 Ga0207661_10572424 Ga0207661_105724242 116
292 3300025944 Ga0207661_10917667 Ga0207661_109176672 116
293 3300025949 Ga0207667_10082927 Ga0207667_100829274 116
294 3300025949 Ga0207667_10093804 Ga0207667_100938043 116
295 3300025949 Ga0207667_10279455 Ga0207667_102794553 116
296 3300025949 Ga0207667_10646516 Ga0207667_106465163 116
297 3300025960 Ga0207651_10765515 Ga0207651_107655152 116
298 3300025981 Ga0207640_10014606 Ga0207640_100146062 116
299 3300025981 Ga0207640_10049846 Ga0207640_100498462 116
300 3300026041 Ga0207639_10011930 Ga0207639_100119304 116
301 3300026041 Ga0207639_10258747 Ga0207639_102587473 116
302 3300026041 Ga0207639_10465282 Ga0207639_104652822 116
303 3300026067 Ga0207678_10068601 Ga0207678_100686012 116
304 3300026078 Ga0207702_10043009 Ga0207702_100430093 116
305 3300026078 Ga0207702_10250781 Ga0207702_102507812 116
306 3300026078 Ga0207702_10513496 Ga0207702_105134962 116
307 3300026078 Ga0207702_10618732 Ga0207702_106187322 116
308 3300026116 Ga0207674_10057472 Ga0207674_100574723 116
309 3300026121 Ga0207683_10157290 Ga0207683_101572903 116
310 3300026121 Ga0207683_10558484 Ga0207683_105584842 116
311 3300026142 Ga0207698_10026340 Ga0207698_100263404 116
312 3300026142 Ga0207698_10083603 Ga0207698_100836032 116
313 3300026142 Ga0207698_10220880 Ga0207698_102208802 116
314 3300026142 Ga0207698_10834375 Ga0207698_108343751 116
315 3300028379 Ga0268266_10945253 Ga0268266_109452531 116
316 3300031995 Ga0307409_101070701 Ga0307409_1010707012 116
317 3300032004 Ga0307414_10420079 Ga0307414_104200792 116
318 3300034817 Ga0373948_0086323 Ga0373948_0086323_65_451 116
319 3300035691 Ga0373931_0096749 Ga0373931_0096749_418_804 116
320 3300037418 Ga0395900_0425217 Ga0395900_0425217_749_1132 116
321 3300041453 Ga0451797_1338990 Ga0451797_1338990_79_456 116
322 3300045976 Ga0466967_0213153 Ga0466967_0213153_1184_1567 116
323 3300048911 Ga0496108_0521214 Ga0496108_0521214_123_509 116
324 3300048927 Ga0496124_0416722 Ga0496124_0416722_204_590 116
325 3300049568 Ga0501031_0174412 Ga0501031_0174412_590_973 116
326 3300049568 Ga0501031_0360149 Ga0501031_0360149_236_622 116
327 3300049569 Ga0501032_0552039 Ga0501032_0552039_192_578 116
328 3300049569 Ga0501032_0626170 Ga0501032_0626170_48_431 116
329 3300049570 Ga0501033_0078836 Ga0501033_0078836_641_1027 116
330 3300049571 Ga0501034_0105656 Ga0501034_0105656_1841_2230 116
331 3300049571 Ga0501034_0399848 Ga0501034_0399848_806_1192 116
332 3300049571 Ga0501034_0639279 Ga0501034_0639279_309_692 116
333 3300049571 Ga0501034_0663761 Ga0501034_0663761_503_886 116
334 3300049572 Ga0501036_0014336 Ga0501036_0014336_1520_1906 116
335 3300049573 Ga0501037_0016941 Ga0501037_0016941_4692_5078 116
336 3300049574 Ga0501038_0092330 Ga0501038_0092330_1604_1987 116
337 3300049574 Ga0501038_0140103 Ga0501038_0140103_876_1262 116
338 3300049579 Ga0501043_0151366 Ga0501043_0151366_149_532 116
339 3300049581 Ga0501047_0592684 Ga0501047_0592684_39_425 116
340 3300049586 Ga0501070_0102572 Ga0501070_0102572_43_426 116
341 3300049586 Ga0501070_0178841 Ga0501070_0178841_405_791 116
342 3300049589 Ga0501073_0320939 Ga0501073_0320939_640_1026 116
343 3300049742 Ga0501080_0339269 Ga0501080_0339269_291_677 116
344 3300049742 Ga0501080_0716149 Ga0501080_0716149_105_488 116
345 3300049743 Ga0501081_1176308 Ga0501081_1176308_140_496 116
346 3300049822 Ga0501035_0005658 Ga0501035_0005658_7903_8286 116
347 3300049823 Ga0501044_0010058 Ga0501044_0010058_9466_9849 116
348 3300049823 Ga0501044_0181606 Ga0501044_0181606_164_550 116
349 3300049823 Ga0501044_0424206 Ga0501044_0424206_228_608 116
350 3300050489 nmdc:mga03683_638409_c1 nmdc:mga03683_638409_c1_17_403 116
351 3300050494 nmdc:mga06z11_336129_c1 nmdc:mga06z11_336129_c1_391_777 116
352 3300053158 Ga0500627_0309980 Ga0500627_0309980_72_458 116
353 3300053730 Ga0500645_006402 Ga0500645_006402_2178_2573 116
354 3300054114 Ga0501084_0303056 Ga0501084_0303056_882_1265 116
355 3300059493 Ga0587077_024025 Ga0587077_024025_681_1067 116
356 3300059503 Ga0587080_109882 Ga0587080_109882_24_407 116
357 3300059642 Ga0587069_158590 Ga0587069_158590_109_492 116
358 3300059652 Ga0587107_138814 Ga0587107_138814_92_478 116
359 3300005458 Ga0070681_10503913 Ga0070681_105039131 117
360 3300005530 Ga0070679_100041910 Ga0070679_1000419102 117
361 3300025921 Ga0207652_10020496 Ga0207652_100204963 117
362 3300028379 Ga0268266_10444684 Ga0268266_104446842 117
363 3300041410 Ga0439461_0119236 Ga0439461_0119236_155_562 117
364 3300053102 Ga0500554_000951 Ga0500554_000951_1981_2400 117
365 3300005327 Ga0070658_10009132 Ga0070658_100091323 118
366 3300005339 Ga0070660_100034638 Ga0070660_1000346384 118
367 3300005578 Ga0068854_102010667 Ga0068854_1020106672 118
368 3300006353 Ga0075370_10112636 Ga0075370_101126364 118
369 3300009551 Ga0105238_10843008 Ga0105238_108430081 118
370 3300013105 Ga0157369_10405210 Ga0157369_104052102 118
371 3300025304 Ga0209257_1001481 Ga0209257_100148117 118
372 3300030521 Ga0307511_10071077 Ga0307511_100710774 118
373 3300035112 Ga0373932_0074617 Ga0373932_0074617_246_605 118
374 3300035691 Ga0373931_0256077 Ga0373931_0256077_469_828 118
375 3300037312 Ga0395899_0117329 Ga0395899_0117329_824_1225 118
376 3300037418 Ga0395900_0194693 Ga0395900_0194693_125_526 118
377 3300038443 Ga0395901_0684846 Ga0395901_0684846_281_682 118
378 3300049569 Ga0501032_0150796 Ga0501032_0150796_385_780 118
379 3300049570 Ga0501033_0549214 Ga0501033_0549214_276_671 118
380 3300049572 Ga0501036_1566121 Ga0501036_1566121_155_514 118
381 3300049573 Ga0501037_0032652 Ga0501037_0032652_250_609 118
382 3300049574 Ga0501038_0030626 Ga0501038_0030626_1581_1940 118
383 3300049574 Ga0501038_1163201 Ga0501038_1163201_59_418 118
384 3300049575 Ga0501039_0495372 Ga0501039_0495372_379_738 118
385 3300049579 Ga0501043_0021252 Ga0501043_0021252_1405_1764 118
386 3300049580 Ga0501046_0321322 Ga0501046_0321322_623_982 118
387 3300049581 Ga0501047_0188058 Ga0501047_0188058_1207_1602 118
388 3300049581 Ga0501047_0269902 Ga0501047_0269902_1036_1431 118
389 3300049581 Ga0501047_0407991 Ga0501047_0407991_409_768 118
390 3300049582 Ga0501048_0158776 Ga0501048_0158776_1112_1471 118
391 3300049582 Ga0501048_0582161 Ga0501048_0582161_131_490 118
392 3300049583 Ga0501067_0074271 Ga0501067_0074271_328_687 118
393 3300049586 Ga0501070_0601258 Ga0501070_0601258_369_728 118
394 3300049589 Ga0501073_0062276 Ga0501073_0062276_1452_1811 118
395 3300049589 Ga0501073_0542413 Ga0501073_0542413_329_688 118
396 3300049590 Ga0501074_0150663 Ga0501074_0150663_339_698 118
397 3300049742 Ga0501080_0021953 Ga0501080_0021953_1384_1743 118
398 3300049744 Ga0501083_0002308 Ga0501083_0002308_9722_10081 118
399 3300049744 Ga0501083_0678165 Ga0501083_0678165_118_477 118
400 3300049822 Ga0501035_0310512 Ga0501035_0310512_211_570 118
401 3300049822 Ga0501035_0900908 Ga0501035_0900908_54_449 118
402 3300049823 Ga0501044_0094473 Ga0501044_0094473_517_876 118
403 3300049823 Ga0501044_0837244 Ga0501044_0837244_101_496 118
404 3300053118 Ga0500594_0056821 Ga0500594_0056821_525_887 118
405 3300053119 Ga0500595_011491 Ga0500595_011491_2940_3338 118
406 3300053146 Ga0500588_0247233 Ga0500588_0247233_170_532 118
407 3300005444 Ga0070694_100284839 Ga0070694_1002848391 119
408 3300005466 Ga0070685_10190985 Ga0070685_101909852 119
409 3300005545 Ga0070695_100703847 Ga0070695_1007038472 119
410 3300005547 Ga0070693_100972213 Ga0070693_1009722132 119
411 3300005549 Ga0070704_100206559 Ga0070704_1002065593 119
412 3300005617 Ga0068859_100120881 Ga0068859_1001208814 119
413 3300005617 Ga0068859_100752223 Ga0068859_1007522233 119
414 3300005618 Ga0068864_100427496 Ga0068864_1004274962 119
415 3300005842 Ga0068858_100825971 Ga0068858_1008259712 119
416 3300005843 Ga0068860_100037022 Ga0068860_1000370223 119
417 3300005937 Ga0081455_10312237 Ga0081455_103122372 119
418 3300006931 Ga0097620_100120883 Ga0097620_1001208832 119
419 3300006931 Ga0097620_100752240 Ga0097620_1007522401 119
420 3300009176 Ga0105242_10304418 Ga0105242_103044182 119
421 3300009177 Ga0105248_10543939 Ga0105248_105439392 119
422 3300013306 Ga0163162_10962799 Ga0163162_109627993 119
423 3300014968 Ga0157379_10580490 Ga0157379_105804901 119
424 3300025934 Ga0207686_10026441 Ga0207686_100264413 119
425 3300025935 Ga0207709_10642613 Ga0207709_106426132 119
426 3300026035 Ga0207703_10646146 Ga0207703_106461462 119
427 3300026067 Ga0207678_11113957 Ga0207678_111139572 119
428 3300026089 Ga0207648_10763797 Ga0207648_107637972 119
429 3300026095 Ga0207676_10399343 Ga0207676_103993433 119
430 3300028381 Ga0268264_10091721 Ga0268264_100917213 119
431 3300028381 Ga0268264_10936607 Ga0268264_109366072 119
432 3300031824 Ga0307413_10693012 Ga0307413_106930122 119
433 3300031852 Ga0307410_10611627 Ga0307410_106116273 119
434 3300031903 Ga0307407_10735309 Ga0307407_107353092 119
435 3300046616 Ga0495668_0185119 Ga0495668_0185119_187_546 119
436 3300047320 Ga0495672_0007251 Ga0495672_0007251_6378_6740 119
437 3300047320 Ga0495672_0018839 Ga0495672_0018839_645_1007 119
438 3300047472 Ga0495686_0219991 Ga0495686_0219991_77_472 119
439 3300049571 Ga0501034_0039981 Ga0501034_0039981_3154_3516 119
440 3300049571 Ga0501034_0208617 Ga0501034_0208617_1235_1597 119
441 3300049581 Ga0501047_0000223 Ga0501047_0000223_29835_30197 119
442 3300049583 Ga0501067_0789561 Ga0501067_0789561_85_447 119
443 3300049589 Ga0501073_0881951 Ga0501073_0881951_138_500 119
444 3300049742 Ga0501080_0354537 Ga0501080_0354537_356_718 119
445 3300049744 Ga0501083_0031649 Ga0501083_0031649_250_612 119
446 3300050509 nmdc:mga0qj67_405942_c1 nmdc:mga0qj67_405942_c1_190_552 119
447 3300060353 Ga0501082_0019195 Ga0501082_0019195_2709_3071 119
448 3300060353 Ga0501082_0392628 Ga0501082_0392628_665_1027 119
449 3300005844 Ga0068862_100506044 Ga0068862_1005060443 120
450 3300028380 Ga0268265_10433755 Ga0268265_104337553 120
451 3300046452 Ga0495617_089409 Ga0495617_089409_407_778 120
452 3300046694 Ga0495649_0647100 Ga0495649_0647100_30_395 120
453 3300009094 Ga0111539_12908340 Ga0111539_129083401 121
454 3300037312 Ga0395899_0768125 Ga0395899_0768125_189_584 121
455 3300037418 Ga0395900_0392615 Ga0395900_0392615_734_1129 121
456 3300037471 Ga0395905_0568134 Ga0395905_0568134_237_632 121
457 3300038443 Ga0395901_0234392 Ga0395901_0234392_1465_1860 121
458 iso_pu_bacteria 2582581279 2585148691 121
459 3300025942 Ga0207689_10408706 Ga0207689_104087062 122
460 3300039447 Ga0436361_0320334 Ga0436361_0320334_800_1189 122
461 3300053139 Ga0500568_0193994 Ga0500568_0193994_42_437 122
462 3300009093 Ga0105240_10799647 Ga0105240_107996471 123
463 3300021441 Ga0213871_10009389 Ga0213871_100093892 123
464 3300025913 Ga0207695_11402538 Ga0207695_114025381 123
465 3300031251 Ga0265327_10001033 Ga0265327_1000103337 123
466 3300031711 Ga0265314_10133553 Ga0265314_101335532 123
467 3300038742 Ga0400486_14046 Ga0400486_14046_692_1078 123
468 3300039438 Ga0436360_1144667 Ga0436360_1144667_2283_2666 123
469 3300005535 Ga0070684_100158021 Ga0070684_1001580212 124
470 3300005539 Ga0068853_100278472 Ga0068853_1002784722 124
471 3300021361 Ga0213872_10009986 Ga0213872_100099866 124
472 3300026041 Ga0207639_10041375 Ga0207639_100413753 124
473 3300028800 Ga0265338_10151121 Ga0265338_101511212 124
474 3300031456 Ga0307513_10000261 Ga0307513_1000026152 124
475 3300037418 Ga0395900_0759534 Ga0395900_0759534_155_541 124
476 3300039447 Ga0436361_0100937 Ga0436361_0100937_4084_4476 124
477 3300039447 Ga0436361_0125926 Ga0436361_0125926_102_494 124
478 3300039447 Ga0436361_0798110 Ga0436361_0798110_430_822 124
479 3300039447 Ga0436361_1197628 Ga0436361_1197628_57_449 124
480 3300046539 Ga0495621_0092031 Ga0495621_0092031_426_812 124
481 3300053104 Ga0500556_0002733 Ga0500556_0002733_95_481 124
482 3300053177 Ga0500636_0030803 Ga0500636_0030803_452_850 124
483 3300053730 Ga0500645_001063 Ga0500645_001063_4807_5193 124
484 3300053730 Ga0500645_160663 Ga0500645_160663_215_601 124
485 3300005331 Ga0070670_100434510 Ga0070670_1004345103 125
486 3300005548 Ga0070665_102076908 Ga0070665_1020769081 125
487 3300005578 Ga0068854_100644567 Ga0068854_1006445672 125
488 3300009551 Ga0105238_11020589 Ga0105238_110205892 125
489 3300009551 Ga0105238_11185607 Ga0105238_111856071 125
490 3300013105 Ga0157369_12574549 Ga0157369_125745492 125
491 3300013296 Ga0157374_10312398 Ga0157374_103123981 125
492 3300013297 Ga0157378_12882229 Ga0157378_128822291 125
493 3300013306 Ga0163162_13271065 Ga0163162_132710651 125
494 3300025924 Ga0207694_10645076 Ga0207694_106450762 125
495 3300025924 Ga0207694_10900726 Ga0207694_109007262 125
496 3300026078 Ga0207702_10404588 Ga0207702_104045881 125
497 3300028379 Ga0268266_11960414 Ga0268266_119604142 125
498 3300028794 Ga0307515_10025521 Ga0307515_100255212 125
499 3300028800 Ga0265338_10019208 Ga0265338_100192083 125
500 3300028800 Ga0265338_10747010 Ga0265338_107470101 125
501 3300036401 Ga0373937_1504134 Ga0373937_1504134_117_503 125
502 3300037418 Ga0395900_0221214 Ga0395900_0221214_188_580 125
503 3300037466 Ga0395898_0481906 Ga0395898_0481906_645_1037 125
504 3300037471 Ga0395905_0015746 Ga0395905_0015746_103_495 125
505 3300038443 Ga0395901_0143673 Ga0395901_0143673_967_1359 125
506 3300044684 Ga0466966_0288732 Ga0466966_0288732_503_904 125
507 3300045049 Ga0466959_0035106 Ga0466959_0035106_887_1288 125
508 3300046457 Ga0495590_0000637 Ga0495590_0000637_15088_15480 125
509 3300046616 Ga0495668_0026263 Ga0495668_0026263_837_1229 125
510 3300046689 Ga0495613_0000435 Ga0495613_0000435_4689_5084 125
511 3300047472 Ga0495686_0003268 Ga0495686_0003268_9748_10140 125
512 3300048910 Ga0496107_0178604 Ga0496107_0178604_320_712 125
513 3300053087 Ga0500643_005170 Ga0500643_005170_27_419 125
514 3300053088 Ga0500644_0021802 Ga0500644_0021802_344_736 125
515 3300053108 Ga0500562_000990 Ga0500562_000990_699_1091 125
516 3300053119 Ga0500595_005390 Ga0500595_005390_1235_1627 125
517 3300053136 Ga0500559_0206161 Ga0500559_0206161_389_787 125
518 3300053156 Ga0500622_0001197 Ga0500622_0001197_11563_11955 125
519 3300005347 Ga0070668_100006163 Ga0070668_1000061638 126
520 3300005347 Ga0070668_100025816 Ga0070668_1000258163 126
521 3300005355 Ga0070671_100107910 Ga0070671_1001079103 126
522 3300005367 Ga0070667_100415394 Ga0070667_1004153942 126
523 3300005367 Ga0070667_100564393 Ga0070667_1005643933 126
524 3300005617 Ga0068859_100019102 Ga0068859_1000191023 126
525 3300005617 Ga0068859_100403489 Ga0068859_1004034892 126
526 3300005719 Ga0068861_100166684 Ga0068861_1001666843 126
527 3300005841 Ga0068863_100063458 Ga0068863_1000634583 126
528 3300005842 Ga0068858_100101300 Ga0068858_1001013004 126
529 3300005843 Ga0068860_100000260 Ga0068860_10000026073 126
530 3300005843 Ga0068860_100096991 Ga0068860_1000969912 126
531 3300005843 Ga0068860_100841702 Ga0068860_1008417022 126
532 3300005844 Ga0068862_100016822 Ga0068862_1000168226 126
533 3300005844 Ga0068862_100051275 Ga0068862_1000512753 126
534 3300005844 Ga0068862_100260309 Ga0068862_1002603092 126
535 3300006931 Ga0097620_100019103 Ga0097620_1000191033 126
536 3300006931 Ga0097620_100403516 Ga0097620_1004035162 126
537 3300009553 Ga0105249_10464385 Ga0105249_104643852 126
538 3300013307 Ga0157372_10929886 Ga0157372_109298862 126
539 3300025961 Ga0207712_10305947 Ga0207712_103059472 126
540 3300025972 Ga0207668_10014536 Ga0207668_100145365 126
541 3300025972 Ga0207668_10027478 Ga0207668_100274785 126
542 3300025972 Ga0207668_10055694 Ga0207668_100556942 126
543 3300025986 Ga0207658_10346156 Ga0207658_103461562 126
544 3300025986 Ga0207658_10428023 Ga0207658_104280233 126
545 3300025986 Ga0207658_10854422 Ga0207658_108544222 126
546 3300026035 Ga0207703_10921093 Ga0207703_109210932 126
547 3300026088 Ga0207641_10029964 Ga0207641_100299645 126
548 3300026095 Ga0207676_10380290 Ga0207676_103802901 126
549 3300026118 Ga0207675_100179033 Ga0207675_1001790332 126
550 3300028380 Ga0268265_10002571 Ga0268265_100025716 126
551 3300028380 Ga0268265_10064180 Ga0268265_100641803 126
552 3300028380 Ga0268265_10287805 Ga0268265_102878052 126
553 3300028381 Ga0268264_10000169 Ga0268264_1000016912 126
554 3300028381 Ga0268264_10077769 Ga0268264_100777694 126
555 3300028794 Ga0307515_10646645 Ga0307515_106466452 126
556 3300031730 Ga0307516_10000004 Ga0307516_10000004107 126
557 3300041443 Ga0451789_0794106 Ga0451789_0794106_168_557 126
558 3300053153 Ga0500616_0078177 Ga0500616_0078177_540_947 126
559 3300053730 Ga0500645_162920 Ga0500645_162920_116_514 126
560 iso_pu_bacteria 2582581280 2585153871 126
561 iso_pu_bacteria 2582581293 2585198083 126
562 iso_pu_bacteria 2585428106 2587916640 126
563 iso_pu_bacteria 2643221545 2643747807 126
564 iso_pu_bacteria 2643221583 2643924932 126
565 iso_pu_bacteria 2643221614 2644084900 126
566 iso_pu_bacteria 2643221640 2644225829 126
567 iso_pu_bacteria 2643221642 2644235318 126
568 iso_pu_bacteria 2643221661 2644342452 126
569 iso_pu_bacteria 2643221666 2644365752 126
570 iso_pu_bacteria 2643221691 2644511421 126
571 iso_pu_bacteria 2791355048 2792459551 126
572 iso_pu_bacteria 2818991435 2819537946 126
573 iso_pu_bacteria 2818991454 2819648493 126
574 iso_pu_bacteria 2843744320 2843747940 126
575 iso_pu_bacteria 2849560528 2849564902 126
576 iso_pu_bacteria 2849573788 2849574755 126
577 iso_pu_bacteria 2851153111 2851153143 126
578 iso_pu_bacteria 2857504554 2857506281 126
579 iso_pu_bacteria 2884960567 2884965032 126
580 iso_pu_bacteria 2898329390 2898329963 126
581 iso_pu_bacteria 2928531327 2928535305 126
582 3300009093 Ga0105240_10005608 Ga0105240_100056082 127
583 3300009174 Ga0105241_10581337 Ga0105241_105813372 127
584 3300009551 Ga0105238_10495598 Ga0105238_104955983 127
585 3300025913 Ga0207695_10211921 Ga0207695_102119213 127
586 3300041486 Ga0451807_1668656 Ga0451807_1668656_215_604 127
587 3300044694 Ga0466963_0802691 Ga0466963_0802691_243_629 127
588 3300046511 Ga0495608_0560673 Ga0495608_0560673_81_467 127
589 3300053078 Ga0495612_0100537 Ga0495612_0100537_823_1209 127
590 3300003791 Ga0055530_10003549 Ga0055530_1000354910 128
591 3300003794 Ga0055531_10001331 Ga0055531_1000133115 128
592 3300004625 Ga0055543_1042023 Ga0055543_10420232 128
593 3300005262 Ga0065165_1000532 Ga0065165_100053243 128
594 3300005347 Ga0070668_100482370 Ga0070668_1004823702 128
595 3300005445 Ga0070708_100664087 Ga0070708_1006640872 128
596 3300005618 Ga0068864_101840214 Ga0068864_1018402141 128
597 3300006881 Ga0068865_100001399 Ga0068865_10000139910 128
598 3300006946 Ga0079104_1036659 Ga0079104_10366592 128
599 3300009177 Ga0105248_10421508 Ga0105248_104215082 128
600 3300014969 Ga0157376_10303706 Ga0157376_103037062 128
601 3300021441 Ga0213871_10049334 Ga0213871_100493342 128
602 3300025250 Ga0209026_1001440 Ga0209026_10014403 128
603 3300025297 Ga0209758_1000696 Ga0209758_100069616 128
604 3300025298 Ga0209050_1000141 Ga0209050_100014136 128
605 3300025304 Ga0209257_1000636 Ga0209257_100063625 128
606 3300025914 Ga0207671_10633742 Ga0207671_106337422 128
607 3300025938 Ga0207704_10005421 Ga0207704_100054213 128
608 3300025949 Ga0207667_11057329 Ga0207667_110573292 128
609 3300026023 Ga0207677_10507817 Ga0207677_105078172 128
610 3300035086 Ga0373934_0255967 Ga0373934_0255967_93_491 128
611 3300035089 Ga0373944_0074975 Ga0373944_0074975_17_415 128
612 3300035170 Ga0373943_0725635 Ga0373943_0725635_92_490 128
613 3300035171 Ga0373946_0003816 Ga0373946_0003816_634_1032 128
614 3300035692 Ga0373935_0497054 Ga0373935_0497054_250_648 128
615 3300035695 Ga0373927_0000323 Ga0373927_0000323_3125_3523 128
616 3300037068 Ga0373925_0000061 Ga0373925_0000061_93272_93670 128
617 3300037471 Ga0395905_0003612 Ga0395905_0003612_13587_13979 128
618 3300038443 Ga0395901_0078590 Ga0395901_0078590_366_761 128
619 3300039438 Ga0436360_0681050 Ga0436360_0681050_78_479 128
620 3300044694 Ga0466963_1120018 Ga0466963_1120018_150_539 128
621 3300044735 Ga0466968_0103806 Ga0466968_0103806_148_543 128
622 3300046459 Ga0495629_0361733 Ga0495629_0361733_198_593 128
623 3300046462 Ga0495651_0304974 Ga0495651_0304974_360_755 128
624 3300046499 Ga0495594_0206281 Ga0495594_0206281_37_432 128
625 3300046528 Ga0495642_0064831 Ga0495642_0064831_835_1230 128
626 3300046616 Ga0495668_0042149 Ga0495668_0042149_288_683 128
627 3300046684 Ga0495669_0019698 Ga0495669_0019698_678_1073 128
628 3300046694 Ga0495649_0514005 Ga0495649_0514005_31_429 128
629 3300047318 Ga0495636_0052056 Ga0495636_0052056_416_811 128
630 3300047445 Ga0495677_0026683 Ga0495677_0026683_1096_1491 128
631 3300047445 Ga0495677_0028117 Ga0495677_0028117_1384_1782 128
632 3300047445 Ga0495677_0287973 Ga0495677_0287973_187_573 128
633 3300049586 Ga0501070_0611868 Ga0501070_0611868_71_466 128
634 3300053090 Ga0500646_0037398 Ga0500646_0037398_207_602 128
635 3300053093 Ga0500651_0326731 Ga0500651_0326731_77_469 128
636 3300053098 Ga0500650_0257325 Ga0500650_0257325_191_589 128
637 3300053103 Ga0500555_016079 Ga0500555_016079_1743_2138 128
638 3300053108 Ga0500562_000772 Ga0500562_000772_1927_2337 128
639 3300005334 Ga0068869_100309997 Ga0068869_1003099972 129
640 3300025942 Ga0207689_10243971 Ga0207689_102439712 129
641 3300028794 Ga0307515_10191957 Ga0307515_101919571 129
642 3300046460 Ga0495638_0001003 Ga0495638_0001003_26860_27264 129
643 3300046512 Ga0495610_0001610 Ga0495610_0001610_4159_4563 129
644 3300046524 Ga0495648_0000154 Ga0495648_0000154_26847_27251 129
645 3300046542 Ga0495597_0015408 Ga0495597_0015408_2841_3242 129
646 3300046616 Ga0495668_0212471 Ga0495668_0212471_542_943 129
647 3300047469 Ga0495673_0000363 Ga0495673_0000363_38970_39374 129
648 3300049459 Ga0495678_000659 Ga0495678_000659_26884_27288 129
649 3300050492 nmdc:mga0yw44_836127_c1 nmdc:mga0yw44_836127_c1_211_612 129
650 3300053086 Ga0500578_0000092 Ga0500578_0000092_25382_25786 129
651 3300053087 Ga0500643_018434 Ga0500643_018434_275_670 129
652 3300053088 Ga0500644_0000121 Ga0500644_0000121_20592_20996 129
653 3300053096 Ga0500641_0007547 Ga0500641_0007547_831_1226 129
654 3300053103 Ga0500555_015527 Ga0500555_015527_837_1241 129
655 3300053104 Ga0500556_0218323 Ga0500556_0218323_311_715 129
656 3300053118 Ga0500594_0000192 Ga0500594_0000192_6956_7360 129
657 3300053138 Ga0500564_000085 Ga0500564_000085_8351_8755 129
658 3300003215 JGI25153J46596_10042779 JGI25153J46596_100427793 130
659 3300003773 Ga0055537_1006822 Ga0055537_10068225 130
660 3300003775 Ga0055524_1005226 Ga0055524_10052262 130
661 3300003790 Ga0055528_1008119 Ga0055528_10081193 130
662 3300003791 Ga0055530_10007123 Ga0055530_100071234 130
663 3300003791 Ga0055530_10007274 Ga0055530_100072743 130
664 3300003794 Ga0055531_10001678 Ga0055531_1000167813 130
665 3300003794 Ga0055531_10002494 Ga0055531_100024944 130
666 3300006186 Ga0075369_10012967 Ga0075369_100129674 130
667 3300006195 Ga0075366_10016093 Ga0075366_100160935 130
668 3300006195 Ga0075366_10032228 Ga0075366_100322285 130
669 3300006353 Ga0075370_10086622 Ga0075370_100866223 130
670 3300006353 Ga0075370_10341506 Ga0075370_103415062 130
671 3300025263 Ga0209565_1000475 Ga0209565_10004755 130
672 3300025273 Ga0209673_1002142 Ga0209673_10021423 130
673 3300025291 Ga0209675_1040462 Ga0209675_10404623 130
674 3300025292 Ga0209676_1000679 Ga0209676_100067929 130
675 3300025292 Ga0209676_1000835 Ga0209676_100083522 130
676 3300025295 Ga0209564_1030943 Ga0209564_10309432 130
677 3300025297 Ga0209758_1002742 Ga0209758_100274215 130
678 3300025298 Ga0209050_1000807 Ga0209050_100080725 130
679 3300025298 Ga0209050_1001452 Ga0209050_10014528 130
680 3300025299 Ga0209256_1007087 Ga0209256_100708710 130
681 3300025299 Ga0209256_1010425 Ga0209256_10104257 130
682 3300025302 Ga0207426_1074054 Ga0207426_10740542 130
683 3300025303 Ga0209051_1006308 Ga0209051_10063085 130
684 3300025304 Ga0209257_1000609 Ga0209257_100060952 130
685 3300025304 Ga0209257_1002443 Ga0209257_100244312 130
686 3300025304 Ga0209257_1005103 Ga0209257_100510311 130
687 3300028800 Ga0265338_10173021 Ga0265338_101730212 130
688 3300031711 Ga0265314_10104975 Ga0265314_101049753 130
689 3300041410 Ga0439461_0173001 Ga0439461_0173001_114_506 130
690 3300041505 Ga0451849_1539659 Ga0451849_1539659_13_405 130
691 3300042436 Ga0439435_0079858 Ga0439435_0079858_129_521 130
692 3300046453 Ga0495627_001535 Ga0495627_001535_9942_10334 130
693 3300046460 Ga0495638_0020558 Ga0495638_0020558_1746_2138 130
694 3300046471 Ga0495650_0000007 Ga0495650_0000007_156986_157378 130
695 3300046506 Ga0495583_0000037 Ga0495583_0000037_62401_62805 130
696 3300046506 Ga0495583_0157457 Ga0495583_0157457_375_767 130
697 3300046507 Ga0495606_0020966 Ga0495606_0020966_1295_1687 130
698 3300046507 Ga0495606_0161882 Ga0495606_0161882_695_1099 130
699 3300046512 Ga0495610_0005214 Ga0495610_0005214_5084_5476 130
700 3300046515 Ga0495620_0013393 Ga0495620_0013393_2069_2461 130
701 3300046520 Ga0495637_0003268 Ga0495637_0003268_5290_5682 130
702 3300046520 Ga0495637_0027793 Ga0495637_0027793_228_620 130
703 3300046522 Ga0495643_0018407 Ga0495643_0018407_120_512 130
704 3300046522 Ga0495643_0179461 Ga0495643_0179461_229_621 130
705 3300046524 Ga0495648_0040700 Ga0495648_0040700_2091_2483 130
706 3300046525 Ga0495663_0247942 Ga0495663_0247942_112_516 130
707 3300046530 Ga0495654_0000100 Ga0495654_0000100_67868_68260 130
708 3300046542 Ga0495597_0026634 Ga0495597_0026634_977_1381 130
709 3300046616 Ga0495668_0000092 Ga0495668_0000092_27298_27690 130
710 3300046616 Ga0495668_0006961 Ga0495668_0006961_1282_1686 130
711 3300046616 Ga0495668_0011470 Ga0495668_0011470_1832_2224 130
712 3300046660 Ga0495625_0000080 Ga0495625_0000080_29430_29822 130
713 3300046660 Ga0495625_0003786 Ga0495625_0003786_3057_3449 130
714 3300046660 Ga0495625_0006302 Ga0495625_0006302_6787_7179 130
715 3300046660 Ga0495625_0030057 Ga0495625_0030057_1624_2016 130
716 3300046660 Ga0495625_0035884 Ga0495625_0035884_1593_1997 130
717 3300046691 Ga0495670_0302691 Ga0495670_0302691_283_675 130
718 3300046692 Ga0495671_0612659 Ga0495671_0612659_55_447 130
719 3300046794 Ga0495589_0017924 Ga0495589_0017924_2610_3002 130
720 3300047320 Ga0495672_0001481 Ga0495672_0001481_151_543 130
721 3300047446 Ga0495679_002196 Ga0495679_002196_1528_1920 130
722 3300047469 Ga0495673_0000132 Ga0495673_0000132_39640_40032 130
723 3300047469 Ga0495673_0012113 Ga0495673_0012113_1579_1971 130
724 3300047470 Ga0495681_0008669 Ga0495681_0008669_1369_1761 130
725 3300047472 Ga0495686_0029767 Ga0495686_0029767_2390_2782 130
726 3300047472 Ga0495686_0038383 Ga0495686_0038383_962_1354 130
727 3300048904 Ga0496101_0071183 Ga0496101_0071183_646_1050 130
728 3300048910 Ga0496107_0000142 Ga0496107_0000142_4337_4741 130
729 3300048917 Ga0496114_0959841 Ga0496114_0959841_12_419 130
730 3300048918 Ga0496115_0149425 Ga0496115_0149425_1452_1856 130
731 3300048918 Ga0496115_0835762 Ga0496115_0835762_246_638 130
732 3300048924 Ga0496121_0005751 Ga0496121_0005751_5967_6371 130
733 3300048924 Ga0496121_0075741 Ga0496121_0075741_2141_2542 130
734 3300048925 Ga0496122_0277034 Ga0496122_0277034_320_712 130
735 3300048927 Ga0496124_0021831 Ga0496124_0021831_2371_2763 130
736 3300048927 Ga0496124_0784795 Ga0496124_0784795_111_503 130
737 3300048928 Ga0496125_0030771 Ga0496125_0030771_1755_2162 130
738 3300048929 Ga0496126_0002357 Ga0496126_0002357_4556_4963 130
739 3300049671 Ga0501238_037965 Ga0501238_037965_289_681 130
740 3300050489 nmdc:mga03683_372953_c1 nmdc:mga03683_372953_c1_144_548 130
741 3300050493 nmdc:mga0k408_29963_c1 nmdc:mga0k408_29963_c1_687_1079 130
742 3300050496 nmdc:mga07m45_37354_c1 nmdc:mga07m45_37354_c1_1737_2129 130
743 3300050516 nmdc:mga0sz30_14935_c1 nmdc:mga0sz30_14935_c1_151_543 130
744 3300053086 Ga0500578_0269871 Ga0500578_0269871_449_841 130
745 3300053087 Ga0500643_107571 Ga0500643_107571_281_673 130
746 3300053090 Ga0500646_0126818 Ga0500646_0126818_135_527 130
747 3300053104 Ga0500556_0000273 Ga0500556_0000273_30430_30822 130
748 3300053125 Ga0500618_000034 Ga0500618_000034_117255_117647 130
749 3300053136 Ga0500559_0000005 Ga0500559_0000005_9412_9804 130
750 3300053136 Ga0500559_0002051 Ga0500559_0002051_1985_2377 130
751 3300053136 Ga0500559_0007255 Ga0500559_0007255_4014_4406 130
752 3300053156 Ga0500622_0006251 Ga0500622_0006251_2547_2939 130
753 3300053156 Ga0500622_0030614 Ga0500622_0030614_293_685 130
754 3300053156 Ga0500622_0032748 Ga0500622_0032748_1768_2160 130
755 3300053727 Ga0500611_001832 Ga0500611_001832_1345_1737 130
756 3300053730 Ga0500645_000494 Ga0500645_000494_14430_14822 130
757 iso_pu_bacteria 2643221584 2643931320 130
758 iso_pu_bacteria 2510917020 2511122776 131
759 3300003215 JGI25153J46596_10010803 JGI25153J46596_100108037 135
760 3300025295 Ga0209564_1011781 Ga0209564_10117817 135
761 3300025295 Ga0209564_1082980 Ga0209564_10829801 135
762 3300025297 Ga0209758_1002892 Ga0209758_100289216 135
763 3300042156 Ga0439446_0014459 Ga0439446_0014459_1248_1655 135
764 3300046460 Ga0495638_0003310 Ga0495638_0003310_9611_10018 135
765 3300046460 Ga0495638_0005017 Ga0495638_0005017_184_591 135
766 3300046512 Ga0495610_0000205 Ga0495610_0000205_40723_41130 135
767 3300046513 Ga0495616_0000159 Ga0495616_0000159_39401_39808 135
768 3300046518 Ga0495631_0179595 Ga0495631_0179595_267_674 135
769 3300046519 Ga0495632_0001395 Ga0495632_0001395_8296_8703 135
770 3300047472 Ga0495686_0082152 Ga0495686_0082152_990_1397 135
771 3300053134 Ga0500658_0003408 Ga0500658_0003408_357_764 135
772 3300053724 Ga0500570_221636 Ga0500570_221636_86_493 135
773 iso_pu_bacteria 2643221552 2643778525 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

16

119

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.8692 15 115
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8614 15 117
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8534 15 117
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8251 17 118
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8103 17 118
ID Description Score Start End Superfamily
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8851 17 105 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8712 17 115 2.60.300.12
af_P9WMN5_14_118_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8652 18 125 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8537 17 115 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8463 17 105 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A068VLL9-F1-model_v4 DH200=94 genomic scaffold, scaffold_4615 0.9327 13 116 GO:0005739
GO:0016226
GO:0051537
GO:0097428
AF-A0A1G1M7N8-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.9304 17 118 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A1U7XV07-F1-model_v4 Iron-sulfur assembly protein IscA-like 1, mitochondrial isoform X3 0.9243 13 110 GO:0005739
GO:0016226
GO:0051537
GO:0097428
AF-A0A1J5J855-F1-model_v4 Fe-S cluster assembly protein HesB 0.9179 16 113 GO:0005737
GO:0016226
GO:0051537
GO:0097428
AF-A0A1G1M7N8-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.9123 17 118 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035

Feature Viewer

pLDDT pTM Quality
82.7 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map