F480156
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 773 | 377 | 744 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_100644567|Ga0068854_1006445672 |
| Length | 139 |
| Sequence | MTDLAPAPRARRPRPKIVTLTDAAAERVREIMDDSETPVVGVRVGIKDAGCAGQSYTLTYVGAPIPGDDHIVDKGVDVYVEPKATLYLLGTVMDFEEDILKSGFTFRNPNQTGECGCGESVTLKPADLKALAEARAGAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 9 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 10 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 11 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 12 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 13 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 14 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 15 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 16 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 17 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 18 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 19 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 20 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 21 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 22 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 23 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 24 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 25 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 26 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 27 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 28 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 29 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 30 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 121 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 193 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 229 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 233 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 238 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 239 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 240 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 241 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 242 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 243 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 244 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 245 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 300 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 301 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 330 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 335 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 338 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 340 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 343 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 344 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 345 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 346 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 347 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 349 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 350 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 351 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 355 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 363 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 364 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.76 |
| Metatranscriptomes | 3.49 |
| Isolates | 3.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.34 |
| Nodule | 0.13 |
| Rhizoplane | 2.2 |
| Rhizosphere | 74.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10010803 | 3300003215 | Bacteria | 4096 |
| 2 | JGI25153J46596_10042779 | 3300003215 | Bacteria | 1379 |
| 3 | Ga0055537_1006822 | 3300003773 | Bacteria | 2840 |
| 4 | Ga0055524_1005226 | 3300003775 | Bacteria | 5839 |
| 5 | Ga0055528_1008119 | 3300003790 | Bacteria | 4546 |
| 6 | Ga0055530_10003549 | 3300003791 | Bacteria | 8789 |
| 7 | Ga0055530_10007123 | 3300003791 | Bacteria | 4791 |
| 8 | Ga0055530_10007274 | 3300003791 | Bacteria | 4699 |
| 9 | Ga0055531_10001331 | 3300003794 | Bacteria | 18439 |
| 10 | Ga0055531_10001678 | 3300003794 | Bacteria | 15938 |
| 11 | Ga0055531_10002494 | 3300003794 | Bacteria | 12265 |
| 12 | Ga0055543_1042023 | 3300004625 | Bacteria | 769 |
| 13 | Ga0058863_11578230 | 3300004799 | Bacteria | 905 |
| 14 | Ga0065165_1000532 | 3300005262 | Bacteria | 58082 |
| 15 | Ga0065165_1000979 | 3300005262 | Bacteria | 35374 |
| 16 | Ga0065165_1013111 | 3300005262 | Bacteria | 3319 |
| 17 | Ga0070658_10009132 | 3300005327 | Bacteria | 7970 |
| 18 | Ga0070658_10131827 | 3300005327 | Bacteria | 2083 |
| 19 | Ga0070658_10194762 | 3300005327 | Bacteria | 1709 |
| 20 | Ga0070658_10197317 | 3300005327 | Bacteria | 1697 |
| 21 | Ga0070683_100605156 | 3300005329 | Bacteria | 1049 |
| 22 | Ga0070683_101412591 | 3300005329 | Bacteria | 669 |
| 23 | Ga0070670_100434510 | 3300005331 | Bacteria | 1162 |
| 24 | Ga0070670_101338743 | 3300005331 | Bacteria | 656 |
| 25 | Ga0068869_100309997 | 3300005334 | Bacteria | 1277 |
| 26 | Ga0070682_100977607 | 3300005337 | Bacteria | 701 |
| 27 | Ga0070660_100034638 | 3300005339 | Bacteria | 3816 |
| 28 | Ga0070660_100083536 | 3300005339 | Bacteria | 2509 |
| 29 | Ga0070661_100022236 | 3300005344 | Bacteria | 4539 |
| 30 | Ga0070661_100073003 | 3300005344 | Bacteria | 2526 |
| 31 | Ga0070661_100129884 | 3300005344 | Bacteria | 1891 |
| 32 | Ga0070661_100762644 | 3300005344 | Bacteria | 792 |
| 33 | Ga0070668_100006163 | 3300005347 | Bacteria | 8881 |
| 34 | Ga0070668_100017835 | 3300005347 | Bacteria | 5325 |
| 35 | Ga0070668_100025816 | 3300005347 | Bacteria | 4456 |
| 36 | Ga0070668_100482370 | 3300005347 | Bacteria | 1071 |
| 37 | Ga0070671_100107910 | 3300005355 | Bacteria | 2338 |
| 38 | Ga0070671_100273360 | 3300005355 | Bacteria | 1436 |
| 39 | Ga0070673_100341036 | 3300005364 | Bacteria | 1328 |
| 40 | Ga0070673_100857530 | 3300005364 | Bacteria | 841 |
| 41 | Ga0070659_100029991 | 3300005366 | Bacteria | 4206 |
| 42 | Ga0070667_100415394 | 3300005367 | Bacteria | 1226 |
| 43 | Ga0070667_100564393 | 3300005367 | Bacteria | 1047 |
| 44 | Ga0070713_100722431 | 3300005436 | Bacteria | 952 |
| 45 | Ga0070694_100284839 | 3300005444 | Bacteria | 1261 |
| 46 | Ga0070708_100664087 | 3300005445 | Bacteria | 982 |
| 47 | Ga0070678_100108961 | 3300005456 | Bacteria | 2163 |
| 48 | Ga0070678_100220898 | 3300005456 | Bacteria | 1575 |
| 49 | Ga0070681_10503913 | 3300005458 | Bacteria | 1124 |
| 50 | Ga0068867_100590040 | 3300005459 | Bacteria | 967 |
| 51 | Ga0070685_10190985 | 3300005466 | Bacteria | 1325 |
| 52 | Ga0070679_100041910 | 3300005530 | Bacteria | 4557 |
| 53 | Ga0070679_100566984 | 3300005530 | Bacteria | 1079 |
| 54 | Ga0070679_101688685 | 3300005530 | Bacteria | 581 |
| 55 | Ga0070684_100158021 | 3300005535 | Bacteria | 2056 |
| 56 | Ga0070684_100928012 | 3300005535 | Bacteria | 816 |
| 57 | Ga0068853_100000349 | 3300005539 | Bacteria | 32236 |
| 58 | Ga0068853_100010907 | 3300005539 | Bacteria | 7364 |
| 59 | Ga0068853_100278472 | 3300005539 | Bacteria | 1542 |
| 60 | Ga0068853_100310939 | 3300005539 | Bacteria | 1459 |
| 61 | Ga0070695_100703847 | 3300005545 | Bacteria | 802 |
| 62 | Ga0070693_100972213 | 3300005547 | Bacteria | 641 |
| 63 | Ga0070665_100017471 | 3300005548 | Bacteria | 7203 |
| 64 | Ga0070665_100469453 | 3300005548 | Bacteria | 1269 |
| 65 | Ga0070665_102076908 | 3300005548 | Bacteria | 573 |
| 66 | Ga0070704_100206559 | 3300005549 | Bacteria | 1589 |
| 67 | Ga0068855_100019409 | 3300005563 | Bacteria | 8168 |
| 68 | Ga0068855_100021728 | 3300005563 | Bacteria | 7696 |
| 69 | Ga0068855_100103516 | 3300005563 | Bacteria | 3275 |
| 70 | Ga0068855_100621957 | 3300005563 | Bacteria | 1163 |
| 71 | Ga0070664_100635099 | 3300005564 | Bacteria | 992 |
| 72 | Ga0070664_101015629 | 3300005564 | Bacteria | 780 |
| 73 | Ga0068857_100817247 | 3300005577 | Bacteria | 890 |
| 74 | Ga0068854_100080564 | 3300005578 | Bacteria | 2403 |
| 75 | Ga0068854_100175192 | 3300005578 | Bacteria | 1671 |
| 76 | Ga0068854_100644567 | 3300005578 | Bacteria | 909 |
| 77 | Ga0068854_102010667 | 3300005578 | Bacteria | 533 |
| 78 | Ga0068856_100032721 | 3300005614 | Bacteria | 5092 |
| 79 | Ga0068856_100347165 | 3300005614 | Bacteria | 1502 |
| 80 | Ga0068856_100406014 | 3300005614 | Bacteria | 1382 |
| 81 | Ga0068856_100572408 | 3300005614 | Bacteria | 1151 |
| 82 | Ga0068852_100010308 | 3300005616 | Bacteria | 6977 |
| 83 | Ga0068852_100056190 | 3300005616 | Bacteria | 3400 |
| 84 | Ga0068852_100078086 | 3300005616 | Bacteria | 2928 |
| 85 | Ga0068852_101637586 | 3300005616 | Bacteria | 666 |
| 86 | Ga0068859_100019102 | 3300005617 | Bacteria | 6883 |
| 87 | Ga0068859_100120881 | 3300005617 | Bacteria | 2685 |
| 88 | Ga0068859_100403489 | 3300005617 | Bacteria | 1463 |
| 89 | Ga0068859_100752223 | 3300005617 | Bacteria | 1063 |
| 90 | Ga0068864_100427496 | 3300005618 | Bacteria | 1263 |
| 91 | Ga0068864_101840214 | 3300005618 | Bacteria | 611 |
| 92 | Ga0068861_100166684 | 3300005719 | Bacteria | 1822 |
| 93 | Ga0068861_100713484 | 3300005719 | Bacteria | 933 |
| 94 | Ga0068851_10174409 | 3300005834 | Bacteria | 1188 |
| 95 | Ga0068863_100063458 | 3300005841 | Bacteria | 3494 |
| 96 | Ga0068863_102249157 | 3300005841 | Bacteria | 555 |
| 97 | Ga0068858_100101300 | 3300005842 | Bacteria | 2686 |
| 98 | Ga0068858_100825971 | 3300005842 | Bacteria | 905 |
| 99 | Ga0068860_100000260 | 3300005843 | Bacteria | 77214 |
| 100 | Ga0068860_100037022 | 3300005843 | Bacteria | 4671 |
| 101 | Ga0068860_100096991 | 3300005843 | Bacteria | 2810 |
| 102 | Ga0068860_100841702 | 3300005843 | Bacteria | 932 |
| 103 | Ga0068862_100012982 | 3300005844 | Bacteria | 6890 |
| 104 | Ga0068862_100016822 | 3300005844 | Bacteria | 6089 |
| 105 | Ga0068862_100051275 | 3300005844 | Bacteria | 3529 |
| 106 | Ga0068862_100260309 | 3300005844 | Bacteria | 1583 |
| 107 | Ga0068862_100506044 | 3300005844 | Bacteria | 1147 |
| 108 | Ga0068862_101682674 | 3300005844 | Bacteria | 642 |
| 109 | Ga0081455_10312237 | 3300005937 | Bacteria | 1123 |
| 110 | Ga0075365_10841960 | 3300006038 | Bacteria | 647 |
| 111 | Ga0075368_10240587 | 3300006042 | Bacteria | 772 |
| 112 | Ga0075363_100021497 | 3300006048 | Bacteria | 3251 |
| 113 | Ga0075364_10069003 | 3300006051 | Bacteria | 2325 |
| 114 | Ga0075364_10124886 | 3300006051 | Bacteria | 1724 |
| 115 | Ga0075362_10055076 | 3300006177 | Bacteria | 1789 |
| 116 | Ga0075362_10179820 | 3300006177 | Bacteria | 1025 |
| 117 | Ga0075367_10505949 | 3300006178 | Bacteria | 766 |
| 118 | Ga0075369_10012967 | 3300006186 | Bacteria | 3298 |
| 119 | Ga0075369_10185433 | 3300006186 | Bacteria | 958 |
| 120 | Ga0075366_10016093 | 3300006195 | Bacteria | 4294 |
| 121 | Ga0075366_10032228 | 3300006195 | Bacteria | 3085 |
| 122 | Ga0075366_10468727 | 3300006195 | Bacteria | 778 |
| 123 | Ga0075366_10609802 | 3300006195 | Bacteria | 677 |
| 124 | Ga0075370_10059177 | 3300006353 | Bacteria | 2180 |
| 125 | Ga0075370_10086622 | 3300006353 | Bacteria | 1804 |
| 126 | Ga0075370_10112636 | 3300006353 | Bacteria | 1581 |
| 127 | Ga0075370_10341506 | 3300006353 | Bacteria | 894 |
| 128 | Ga0075434_100310133 | 3300006871 | Bacteria | 1598 |
| 129 | Ga0068865_100001399 | 3300006881 | Bacteria | 14029 |
| 130 | Ga0097620_100019103 | 3300006931 | Bacteria | 6883 |
| 131 | Ga0097620_100120883 | 3300006931 | Bacteria | 2685 |
| 132 | Ga0097620_100403516 | 3300006931 | Bacteria | 1463 |
| 133 | Ga0097620_100752240 | 3300006931 | Bacteria | 1063 |
| 134 | Ga0079104_1036659 | 3300006946 | Bacteria | 1175 |
| 135 | Ga0105240_10005608 | 3300009093 | Bacteria | 18633 |
| 136 | Ga0105240_10047987 | 3300009093 | Bacteria | 5400 |
| 137 | Ga0105240_10055987 | 3300009093 | Bacteria | 4936 |
| 138 | Ga0105240_10799647 | 3300009093 | Bacteria | 1022 |
| 139 | Ga0105240_11363495 | 3300009093 | Bacteria | 746 |
| 140 | Ga0111539_12908340 | 3300009094 | Bacteria | 554 |
| 141 | Ga0105245_10638442 | 3300009098 | Bacteria | 1094 |
| 142 | Ga0105245_11185930 | 3300009098 | Bacteria | 811 |
| 143 | Ga0105243_11398020 | 3300009148 | Bacteria | 720 |
| 144 | Ga0105241_10021133 | 3300009174 | Bacteria | 4811 |
| 145 | Ga0105241_10421379 | 3300009174 | Bacteria | 1175 |
| 146 | Ga0105241_10581337 | 3300009174 | Bacteria | 1009 |
| 147 | Ga0105242_10302217 | 3300009176 | Bacteria | 1461 |
| 148 | Ga0105242_10304418 | 3300009176 | Bacteria | 1456 |
| 149 | Ga0105242_11621230 | 3300009176 | Bacteria | 681 |
| 150 | Ga0105248_10421508 | 3300009177 | Bacteria | 1503 |
| 151 | Ga0105248_10543939 | 3300009177 | Bacteria | 1310 |
| 152 | Ga0105237_10000309 | 3300009545 | Bacteria | 67900 |
| 153 | Ga0105237_10255147 | 3300009545 | Bacteria | 1756 |
| 154 | Ga0105237_10835634 | 3300009545 | Bacteria | 928 |
| 155 | Ga0105238_10081963 | 3300009551 | Bacteria | 3216 |
| 156 | Ga0105238_10217173 | 3300009551 | Bacteria | 1888 |
| 157 | Ga0105238_10402617 | 3300009551 | Bacteria | 1362 |
| 158 | Ga0105238_10495598 | 3300009551 | Bacteria | 1222 |
| 159 | Ga0105238_10688069 | 3300009551 | Bacteria | 1034 |
| 160 | Ga0105238_10843008 | 3300009551 | Bacteria | 934 |
| 161 | Ga0105238_11020589 | 3300009551 | Bacteria | 848 |
| 162 | Ga0105238_11185607 | 3300009551 | Bacteria | 788 |
| 163 | Ga0105238_11969105 | 3300009551 | Bacteria | 618 |
| 164 | Ga0105249_10059537 | 3300009553 | Bacteria | 3503 |
| 165 | Ga0105249_10464385 | 3300009553 | Bacteria | 1306 |
| 166 | Ga0105239_10000575 | 3300010375 | Bacteria | 52515 |
| 167 | Ga0105239_10026037 | 3300010375 | Bacteria | 6441 |
| 168 | Ga0105239_10955857 | 3300010375 | Bacteria | 984 |
| 169 | Ga0105239_11148449 | 3300010375 | Bacteria | 895 |
| 170 | Ga0105239_12219715 | 3300010375 | Bacteria | 638 |
| 171 | Ga0105246_10454803 | 3300011119 | Bacteria | 1077 |
| 172 | Ga0157373_11341198 | 3300013100 | Bacteria | 542 |
| 173 | Ga0157371_10061002 | 3300013102 | Bacteria | 2674 |
| 174 | Ga0157370_10245263 | 3300013104 | Bacteria | 1657 |
| 175 | Ga0157370_11381062 | 3300013104 | Bacteria | 634 |
| 176 | Ga0157370_11694642 | 3300013104 | Bacteria | 567 |
| 177 | Ga0157369_10029152 | 3300013105 | Bacteria | 6101 |
| 178 | Ga0157369_10405210 | 3300013105 | Bacteria | 1415 |
| 179 | Ga0157369_12574549 | 3300013105 | Bacteria | 515 |
| 180 | Ga0157374_10312398 | 3300013296 | Bacteria | 1556 |
| 181 | Ga0157374_10320429 | 3300013296 | Bacteria | 1536 |
| 182 | Ga0157374_10766630 | 3300013296 | Bacteria | 980 |
| 183 | Ga0157374_12687445 | 3300013296 | Bacteria | 525 |
| 184 | Ga0157378_12882229 | 3300013297 | Bacteria | 533 |
| 185 | Ga0163162_10962799 | 3300013306 | Bacteria | 964 |
| 186 | Ga0163162_13271065 | 3300013306 | Bacteria | 519 |
| 187 | Ga0157372_10735492 | 3300013307 | Bacteria | 1147 |
| 188 | Ga0157372_10929886 | 3300013307 | Bacteria | 1008 |
| 189 | Ga0157372_11865941 | 3300013307 | Bacteria | 691 |
| 190 | Ga0157375_11332632 | 3300013308 | Bacteria | 844 |
| 191 | Ga0163163_10454052 | 3300014325 | Bacteria | 1342 |
| 192 | Ga0163163_10470242 | 3300014325 | Bacteria | 1318 |
| 193 | Ga0163163_12292274 | 3300014325 | Bacteria | 599 |
| 194 | Ga0182008_10113850 | 3300014497 | Bacteria | 1341 |
| 195 | Ga0157379_10580490 | 3300014968 | Bacteria | 1045 |
| 196 | Ga0157376_10193623 | 3300014969 | Bacteria | 1866 |
| 197 | Ga0157376_10303706 | 3300014969 | Bacteria | 1512 |
| 198 | Ga0157376_10978742 | 3300014969 | Bacteria | 868 |
| 199 | Ga0157376_11459360 | 3300014969 | Bacteria | 716 |
| 200 | Ga0197907_10040603 | 3300020069 | Bacteria | 1183 |
| 201 | Ga0197907_10058942 | 3300020069 | Bacteria | 676 |
| 202 | Ga0206356_11296514 | 3300020070 | Bacteria | 922 |
| 203 | Ga0206356_11504143 | 3300020070 | Bacteria | 791 |
| 204 | Ga0206349_1124037 | 3300020075 | Bacteria | 694 |
| 205 | Ga0206355_1348711 | 3300020076 | Bacteria | 908 |
| 206 | Ga0206351_10492450 | 3300020077 | Bacteria | 1055 |
| 207 | Ga0206352_11266876 | 3300020078 | Bacteria | 978 |
| 208 | Ga0206350_10872178 | 3300020080 | Bacteria | 1124 |
| 209 | Ga0206354_10464058 | 3300020081 | Bacteria | 808 |
| 210 | Ga0206353_10095337 | 3300020082 | Bacteria | 602 |
| 211 | Ga0206353_11387986 | 3300020082 | Bacteria | 532 |
| 212 | Ga0154015_1147209 | 3300020610 | Bacteria | 818 |
| 213 | Ga0213872_10009986 | 3300021361 | Bacteria | 4531 |
| 214 | Ga0213871_10009389 | 3300021441 | Bacteria | 2191 |
| 215 | Ga0213871_10049334 | 3300021441 | Bacteria | 1150 |
| 216 | Ga0224712_10059741 | 3300022467 | Bacteria | 1515 |
| 217 | Ga0224712_10128235 | 3300022467 | Bacteria | 1105 |
| 218 | Ga0207427_101879 | 3300025231 | Bacteria | 6619 |
| 219 | Ga0209026_1001440 | 3300025250 | Bacteria | 10524 |
| 220 | Ga0209233_1001040 | 3300025261 | Bacteria | 11652 |
| 221 | Ga0209565_1000475 | 3300025263 | Bacteria | 29667 |
| 222 | Ga0209673_1002142 | 3300025273 | Bacteria | 14707 |
| 223 | Ga0209675_1040462 | 3300025291 | Bacteria | 1025 |
| 224 | Ga0209676_1000679 | 3300025292 | Bacteria | 48245 |
| 225 | Ga0209676_1000835 | 3300025292 | Bacteria | 39928 |
| 226 | Ga0209564_1001352 | 3300025295 | Bacteria | 25893 |
| 227 | Ga0209564_1011781 | 3300025295 | Bacteria | 3882 |
| 228 | Ga0209564_1030943 | 3300025295 | Bacteria | 1647 |
| 229 | Ga0209564_1082980 | 3300025295 | Bacteria | 619 |
| 230 | Ga0209758_1000696 | 3300025297 | Bacteria | 49847 |
| 231 | Ga0209758_1002742 | 3300025297 | Bacteria | 17301 |
| 232 | Ga0209758_1002892 | 3300025297 | Bacteria | 16578 |
| 233 | Ga0209050_1000141 | 3300025298 | Bacteria | 173116 |
| 234 | Ga0209050_1000807 | 3300025298 | Bacteria | 44122 |
| 235 | Ga0209050_1001452 | 3300025298 | Bacteria | 25445 |
| 236 | Ga0209256_1001833 | 3300025299 | Bacteria | 19808 |
| 237 | Ga0209256_1007087 | 3300025299 | Bacteria | 5663 |
| 238 | Ga0209256_1010425 | 3300025299 | Bacteria | 3895 |
| 239 | Ga0207426_1074054 | 3300025302 | Bacteria | 941 |
| 240 | Ga0209051_1006308 | 3300025303 | Bacteria | 6716 |
| 241 | Ga0209257_1000609 | 3300025304 | Bacteria | 58413 |
| 242 | Ga0209257_1000636 | 3300025304 | Bacteria | 56284 |
| 243 | Ga0209257_1001481 | 3300025304 | Bacteria | 27569 |
| 244 | Ga0209257_1002443 | 3300025304 | Bacteria | 18467 |
| 245 | Ga0209257_1005103 | 3300025304 | Bacteria | 9521 |
| 246 | Ga0207656_10074112 | 3300025321 | Bacteria | 1518 |
| 247 | Ga0207688_10311583 | 3300025901 | Bacteria | 964 |
| 248 | Ga0207645_10159340 | 3300025907 | Bacteria | 1476 |
| 249 | Ga0207705_10058559 | 3300025909 | Bacteria | 2779 |
| 250 | Ga0207705_10262017 | 3300025909 | Bacteria | 1320 |
| 251 | Ga0207705_10295202 | 3300025909 | Bacteria | 1242 |
| 252 | Ga0207705_10437210 | 3300025909 | Bacteria | 1014 |
| 253 | Ga0207654_10162003 | 3300025911 | Bacteria | 1446 |
| 254 | Ga0207707_11035266 | 3300025912 | Bacteria | 672 |
| 255 | Ga0207695_10035247 | 3300025913 | Bacteria | 5430 |
| 256 | Ga0207695_10131122 | 3300025913 | Bacteria | 2464 |
| 257 | Ga0207695_10211921 | 3300025913 | Bacteria | 1848 |
| 258 | Ga0207695_10255677 | 3300025913 | Bacteria | 1650 |
| 259 | Ga0207695_10766330 | 3300025913 | Bacteria | 845 |
| 260 | Ga0207695_11402538 | 3300025913 | Bacteria | 579 |
| 261 | Ga0207695_11577470 | 3300025913 | Bacteria | 537 |
| 262 | Ga0207671_10000617 | 3300025914 | Bacteria | 46905 |
| 263 | Ga0207671_10177492 | 3300025914 | Bacteria | 1656 |
| 264 | Ga0207671_10633742 | 3300025914 | Bacteria | 851 |
| 265 | Ga0207657_10009762 | 3300025919 | Bacteria | 9622 |
| 266 | Ga0207657_10012082 | 3300025919 | Bacteria | 8535 |
| 267 | Ga0207657_10097737 | 3300025919 | Bacteria | 2441 |
| 268 | Ga0207649_10000527 | 3300025920 | Bacteria | 26665 |
| 269 | Ga0207649_10623496 | 3300025920 | Bacteria | 831 |
| 270 | Ga0207652_10020496 | 3300025921 | Bacteria | 5445 |
| 271 | Ga0207652_11812646 | 3300025921 | Bacteria | 515 |
| 272 | Ga0207694_10112207 | 3300025924 | Bacteria | 2169 |
| 273 | Ga0207694_10274456 | 3300025924 | Bacteria | 1383 |
| 274 | Ga0207694_10467447 | 3300025924 | Bacteria | 1054 |
| 275 | Ga0207694_10645076 | 3300025924 | Bacteria | 892 |
| 276 | Ga0207694_10900726 | 3300025924 | Bacteria | 748 |
| 277 | Ga0207694_10934418 | 3300025924 | Bacteria | 734 |
| 278 | Ga0207690_10161424 | 3300025932 | Bacteria | 1671 |
| 279 | Ga0207690_10424572 | 3300025932 | Bacteria | 1064 |
| 280 | Ga0207690_10941690 | 3300025932 | Bacteria | 717 |
| 281 | Ga0207706_10075551 | 3300025933 | Bacteria | 2963 |
| 282 | Ga0207686_10026441 | 3300025934 | Bacteria | 3385 |
| 283 | Ga0207709_10642613 | 3300025935 | Bacteria | 844 |
| 284 | Ga0207704_10005421 | 3300025938 | Bacteria | 5883 |
| 285 | Ga0207689_10243971 | 3300025942 | Bacteria | 1485 |
| 286 | Ga0207689_10408706 | 3300025942 | Bacteria | 1132 |
| 287 | Ga0207661_10572424 | 3300025944 | Bacteria | 1036 |
| 288 | Ga0207661_10917667 | 3300025944 | Bacteria | 807 |
| 289 | Ga0207679_10838635 | 3300025945 | Bacteria | 839 |
| 290 | Ga0207679_11804904 | 3300025945 | Bacteria | 559 |
| 291 | Ga0207667_10040883 | 3300025949 | Bacteria | 4935 |
| 292 | Ga0207667_10082927 | 3300025949 | Bacteria | 3320 |
| 293 | Ga0207667_10093804 | 3300025949 | Bacteria | 3099 |
| 294 | Ga0207667_10279455 | 3300025949 | Bacteria | 1706 |
| 295 | Ga0207667_10284756 | 3300025949 | Bacteria | 1689 |
| 296 | Ga0207667_10646516 | 3300025949 | Bacteria | 1063 |
| 297 | Ga0207667_11057329 | 3300025949 | Bacteria | 797 |
| 298 | Ga0207651_10765515 | 3300025960 | Bacteria | 854 |
| 299 | Ga0207712_10305947 | 3300025961 | Bacteria | 1306 |
| 300 | Ga0207668_10010026 | 3300025972 | Bacteria | 5703 |
| 301 | Ga0207668_10014536 | 3300025972 | Bacteria | 4873 |
| 302 | Ga0207668_10027478 | 3300025972 | Bacteria | 3706 |
| 303 | Ga0207668_10055694 | 3300025972 | Bacteria | 2750 |
| 304 | Ga0207668_10320715 | 3300025972 | Bacteria | 1286 |
| 305 | Ga0207640_10014606 | 3300025981 | Bacteria | 4525 |
| 306 | Ga0207640_10049846 | 3300025981 | Bacteria | 2713 |
| 307 | Ga0207658_10346156 | 3300025986 | Bacteria | 1293 |
| 308 | Ga0207658_10428023 | 3300025986 | Bacteria | 1168 |
| 309 | Ga0207658_10854422 | 3300025986 | Bacteria | 827 |
| 310 | Ga0207677_10507817 | 3300026023 | Bacteria | 1044 |
| 311 | Ga0207703_10646146 | 3300026035 | Bacteria | 1003 |
| 312 | Ga0207703_10921093 | 3300026035 | Bacteria | 837 |
| 313 | Ga0207639_10007233 | 3300026041 | Bacteria | 7563 |
| 314 | Ga0207639_10011930 | 3300026041 | Bacteria | 6045 |
| 315 | Ga0207639_10041375 | 3300026041 | Bacteria | 3447 |
| 316 | Ga0207639_10258747 | 3300026041 | Bacteria | 1521 |
| 317 | Ga0207639_10465282 | 3300026041 | Bacteria | 1150 |
| 318 | Ga0207639_10761404 | 3300026041 | Bacteria | 901 |
| 319 | Ga0207678_10068601 | 3300026067 | Bacteria | 3042 |
| 320 | Ga0207678_11113957 | 3300026067 | Bacteria | 699 |
| 321 | Ga0207702_10043009 | 3300026078 | Bacteria | 3791 |
| 322 | Ga0207702_10250781 | 3300026078 | Bacteria | 1662 |
| 323 | Ga0207702_10404588 | 3300026078 | Bacteria | 1317 |
| 324 | Ga0207702_10513496 | 3300026078 | Bacteria | 1169 |
| 325 | Ga0207702_10618732 | 3300026078 | Bacteria | 1063 |
| 326 | Ga0207641_10029964 | 3300026088 | Bacteria | 4503 |
| 327 | Ga0207648_10763797 | 3300026089 | Bacteria | 898 |
| 328 | Ga0207676_10380290 | 3300026095 | Bacteria | 1314 |
| 329 | Ga0207676_10399343 | 3300026095 | Bacteria | 1284 |
| 330 | Ga0207674_10057472 | 3300026116 | Bacteria | 3943 |
| 331 | Ga0207675_100179033 | 3300026118 | Bacteria | 2030 |
| 332 | Ga0207683_10157290 | 3300026121 | Bacteria | 2053 |
| 333 | Ga0207683_10558484 | 3300026121 | Bacteria | 1059 |
| 334 | Ga0207698_10026340 | 3300026142 | Bacteria | 4112 |
| 335 | Ga0207698_10083603 | 3300026142 | Bacteria | 2584 |
| 336 | Ga0207698_10220880 | 3300026142 | Bacteria | 1712 |
| 337 | Ga0207698_10834375 | 3300026142 | Bacteria | 926 |
| 338 | Ga0209983_1018319 | 3300027665 | Bacteria | 1453 |
| 339 | Ga0209974_10126650 | 3300027876 | Bacteria | 908 |
| 340 | Ga0209974_10238010 | 3300027876 | Bacteria | 682 |
| 341 | Ga0268266_10000265 | 3300028379 | Bacteria | 87871 |
| 342 | Ga0268266_10040177 | 3300028379 | Bacteria | 3987 |
| 343 | Ga0268266_10444684 | 3300028379 | Bacteria | 1231 |
| 344 | Ga0268266_10945253 | 3300028379 | Bacteria | 834 |
| 345 | Ga0268266_11960414 | 3300028379 | Bacteria | 559 |
| 346 | Ga0268265_10002571 | 3300028380 | Bacteria | 13554 |
| 347 | Ga0268265_10014725 | 3300028380 | Bacteria | 5337 |
| 348 | Ga0268265_10021366 | 3300028380 | Bacteria | 4533 |
| 349 | Ga0268265_10064180 | 3300028380 | Bacteria | 2828 |
| 350 | Ga0268265_10287805 | 3300028380 | Bacteria | 1473 |
| 351 | Ga0268265_10433755 | 3300028380 | Bacteria | 1223 |
| 352 | Ga0268265_10455444 | 3300028380 | Bacteria | 1196 |
| 353 | Ga0268264_10000169 | 3300028381 | Bacteria | 144978 |
| 354 | Ga0268264_10077769 | 3300028381 | Bacteria | 2827 |
| 355 | Ga0268264_10091721 | 3300028381 | Bacteria | 2621 |
| 356 | Ga0268264_10936607 | 3300028381 | Bacteria | 871 |
| 357 | Ga0265334_10096613 | 3300028573 | Bacteria | 1073 |
| 358 | Ga0307515_10025521 | 3300028794 | Bacteria | 10218 |
| 359 | Ga0307515_10191957 | 3300028794 | Bacteria | 1949 |
| 360 | Ga0307515_10646645 | 3300028794 | Bacteria | 670 |
| 361 | Ga0265338_10019208 | 3300028800 | Bacteria | 7271 |
| 362 | Ga0265338_10039703 | 3300028800 | Bacteria | 4435 |
| 363 | Ga0265338_10151121 | 3300028800 | Bacteria | 1804 |
| 364 | Ga0265338_10173021 | 3300028800 | Bacteria | 1654 |
| 365 | Ga0265338_10747010 | 3300028800 | Bacteria | 673 |
| 366 | Ga0307511_10071077 | 3300030521 | Bacteria | 2542 |
| 367 | Ga0265328_10107402 | 3300031239 | Bacteria | 1036 |
| 368 | Ga0265325_10006244 | 3300031241 | Bacteria | 7263 |
| 369 | Ga0265329_10033006 | 3300031242 | Bacteria | 1675 |
| 370 | Ga0265340_10057760 | 3300031247 | Bacteria | 1864 |
| 371 | Ga0265339_10000389 | 3300031249 | Bacteria | 34751 |
| 372 | Ga0265327_10001033 | 3300031251 | Bacteria | 39244 |
| 373 | Ga0307513_10000261 | 3300031456 | Bacteria | 76045 |
| 374 | Ga0307408_100902659 | 3300031548 | Bacteria | 809 |
| 375 | Ga0265313_10000449 | 3300031595 | Bacteria | 43511 |
| 376 | Ga0265314_10047669 | 3300031711 | Bacteria | 3013 |
| 377 | Ga0265314_10048467 | 3300031711 | Bacteria | 2982 |
| 378 | Ga0265314_10104975 | 3300031711 | Bacteria | 1808 |
| 379 | Ga0265314_10133553 | 3300031711 | Bacteria | 1544 |
| 380 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 381 | Ga0307413_10217370 | 3300031824 | Bacteria | 1393 |
| 382 | Ga0307413_10693012 | 3300031824 | Bacteria | 845 |
| 383 | Ga0307413_11834971 | 3300031824 | Bacteria | 543 |
| 384 | Ga0307410_10611627 | 3300031852 | Bacteria | 910 |
| 385 | Ga0307407_10609780 | 3300031903 | Bacteria | 814 |
| 386 | Ga0307407_10735309 | 3300031903 | Bacteria | 746 |
| 387 | Ga0307409_101070701 | 3300031995 | Bacteria | 827 |
| 388 | Ga0307416_100281241 | 3300032002 | Bacteria | 1641 |
| 389 | Ga0307414_10420079 | 3300032004 | Bacteria | 1166 |
| 390 | Ga0307411_11929502 | 3300032005 | Bacteria | 550 |
| 391 | Ga0373948_0086323 | 3300034817 | Bacteria | 723 |
| 392 | Ga0373934_0255967 | 3300035086 | Bacteria | 724 |
| 393 | Ga0373944_0074975 | 3300035089 | Bacteria | 1108 |
| 394 | Ga0373932_0074617 | 3300035112 | Bacteria | 1059 |
| 395 | Ga0373943_0725635 | 3300035170 | Bacteria | 589 |
| 396 | Ga0373946_0003816 | 3300035171 | Bacteria | 5349 |
| 397 | Ga0373931_0096749 | 3300035691 | Bacteria | 1654 |
| 398 | Ga0373931_0256077 | 3300035691 | Bacteria | 1066 |
| 399 | Ga0373935_0497054 | 3300035692 | Bacteria | 885 |
| 400 | Ga0373927_0000323 | 3300035695 | Bacteria | 37618 |
| 401 | Ga0373937_1504134 | 3300036401 | Bacteria | 621 |
| 402 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 403 | Ga0395899_0117329 | 3300037312 | Bacteria | 1909 |
| 404 | Ga0395899_0447533 | 3300037312 | Bacteria | 846 |
| 405 | Ga0395899_0459232 | 3300037312 | Bacteria | 832 |
| 406 | Ga0395899_0768125 | 3300037312 | Bacteria | 598 |
| 407 | Ga0395900_0194693 | 3300037418 | Bacteria | 2054 |
| 408 | Ga0395900_0221214 | 3300037418 | Bacteria | 1908 |
| 409 | Ga0395900_0392615 | 3300037418 | Bacteria | 1353 |
| 410 | Ga0395900_0425217 | 3300037418 | Bacteria | 1288 |
| 411 | Ga0395900_0759534 | 3300037418 | Bacteria | 899 |
| 412 | Ga0395898_0124963 | 3300037466 | Bacteria | 2464 |
| 413 | Ga0395898_0481906 | 3300037466 | Bacteria | 1180 |
| 414 | Ga0395898_0527032 | 3300037466 | Bacteria | 1123 |
| 415 | Ga0395905_0003612 | 3300037471 | Bacteria | 16441 |
| 416 | Ga0395905_0015746 | 3300037471 | Bacteria | 7184 |
| 417 | Ga0395905_0352865 | 3300037471 | Bacteria | 1363 |
| 418 | Ga0395905_0568134 | 3300037471 | Bacteria | 1035 |
| 419 | Ga0395901_0078590 | 3300038443 | Bacteria | 3445 |
| 420 | Ga0395901_0143673 | 3300038443 | Bacteria | 2508 |
| 421 | Ga0395901_0161843 | 3300038443 | Bacteria | 2350 |
| 422 | Ga0395901_0234392 | 3300038443 | Bacteria | 1916 |
| 423 | Ga0395901_0684846 | 3300038443 | Bacteria | 1024 |
| 424 | Ga0395901_0722334 | 3300038443 | Bacteria | 992 |
| 425 | Ga0395901_1079397 | 3300038443 | Bacteria | 774 |
| 426 | Ga0400486_14046 | 3300038742 | Bacteria | 5716 |
| 427 | Ga0436360_0414423 | 3300039438 | Bacteria | 2106 |
| 428 | Ga0436360_0681050 | 3300039438 | Bacteria | 547 |
| 429 | Ga0436360_1144667 | 3300039438 | Bacteria | 2804 |
| 430 | Ga0436361_0100937 | 3300039447 | Bacteria | 8249 |
| 431 | Ga0436361_0125926 | 3300039447 | Bacteria | 553 |
| 432 | Ga0436361_0320334 | 3300039447 | Bacteria | 1211 |
| 433 | Ga0436361_0798110 | 3300039447 | Bacteria | 862 |
| 434 | Ga0436361_1197628 | 3300039447 | Bacteria | 1239 |
| 435 | Ga0439436_0256568 | 3300041404 | Bacteria | 508 |
| 436 | Ga0439461_0119236 | 3300041410 | Bacteria | 658 |
| 437 | Ga0439461_0173001 | 3300041410 | Bacteria | 568 |
| 438 | Ga0439465_0031449 | 3300041413 | Bacteria | 1691 |
| 439 | Ga0451789_0794106 | 3300041443 | Bacteria | 634 |
| 440 | Ga0451790_46757 | 3300041444 | Bacteria | 536 |
| 441 | Ga0451793_1847991 | 3300041452 | Bacteria | 894 |
| 442 | Ga0451797_1338990 | 3300041453 | Bacteria | 671 |
| 443 | Ga0451802_1510085 | 3300041460 | Bacteria | 505 |
| 444 | Ga0451807_0966353 | 3300041486 | Bacteria | 597 |
| 445 | Ga0451807_1668656 | 3300041486 | Bacteria | 667 |
| 446 | Ga0451835_0930043 | 3300041492 | Bacteria | 650 |
| 447 | Ga0451837_1716482 | 3300041494 | Bacteria | 1014 |
| 448 | Ga0451849_1539659 | 3300041505 | Bacteria | 522 |
| 449 | Ga0451843_0825648 | 3300041509 | Bacteria | 1036 |
| 450 | Ga0439445_0064202 | 3300042004 | Bacteria | 1008 |
| 451 | Ga0439446_0014459 | 3300042156 | Bacteria | 2179 |
| 452 | Ga0439434_0044153 | 3300042435 | Bacteria | 1373 |
| 453 | Ga0439434_0351577 | 3300042435 | Bacteria | 515 |
| 454 | Ga0439435_0079858 | 3300042436 | Bacteria | 980 |
| 455 | Ga0439435_0221228 | 3300042436 | Bacteria | 630 |
| 456 | Ga0466965_0337851 | 3300044683 | Bacteria | 823 |
| 457 | Ga0466966_0288732 | 3300044684 | Bacteria | 986 |
| 458 | Ga0466963_0802691 | 3300044694 | Bacteria | 664 |
| 459 | Ga0466963_1120018 | 3300044694 | Bacteria | 554 |
| 460 | Ga0466968_0103806 | 3300044735 | Bacteria | 1272 |
| 461 | Ga0466957_0297169 | 3300044842 | Bacteria | 1084 |
| 462 | Ga0466957_1449880 | 3300044842 | Bacteria | 500 |
| 463 | Ga0466959_0035106 | 3300045049 | Bacteria | 3710 |
| 464 | Ga0466967_0213153 | 3300045976 | Bacteria | 1833 |
| 465 | Ga0495617_089409 | 3300046452 | Bacteria | 1006 |
| 466 | Ga0495627_001535 | 3300046453 | Bacteria | 13242 |
| 467 | Ga0495590_0000637 | 3300046457 | Bacteria | 16257 |
| 468 | Ga0495629_0361733 | 3300046459 | Bacteria | 989 |
| 469 | Ga0495638_0001003 | 3300046460 | Bacteria | 28322 |
| 470 | Ga0495638_0003310 | 3300046460 | Bacteria | 12714 |
| 471 | Ga0495638_0003618 | 3300046460 | Bacteria | 12076 |
| 472 | Ga0495638_0005017 | 3300046460 | Bacteria | 9937 |
| 473 | Ga0495638_0020558 | 3300046460 | Bacteria | 4360 |
| 474 | Ga0495651_0304974 | 3300046462 | Bacteria | 1067 |
| 475 | Ga0495650_0000007 | 3300046471 | Bacteria | 718072 |
| 476 | Ga0495594_0206281 | 3300046499 | Bacteria | 1120 |
| 477 | Ga0495583_0000037 | 3300046506 | Bacteria | 244437 |
| 478 | Ga0495583_0157457 | 3300046506 | Bacteria | 939 |
| 479 | Ga0495606_0020966 | 3300046507 | Bacteria | 4797 |
| 480 | Ga0495606_0161882 | 3300046507 | Bacteria | 1305 |
| 481 | Ga0495608_0560673 | 3300046511 | Bacteria | 688 |
| 482 | Ga0495610_0000205 | 3300046512 | Bacteria | 65600 |
| 483 | Ga0495610_0001610 | 3300046512 | Bacteria | 19895 |
| 484 | Ga0495610_0005214 | 3300046512 | Bacteria | 9303 |
| 485 | Ga0495616_0000159 | 3300046513 | Bacteria | 58948 |
| 486 | Ga0495620_0013393 | 3300046515 | Bacteria | 4200 |
| 487 | Ga0495631_0179595 | 3300046518 | Bacteria | 907 |
| 488 | Ga0495632_0001395 | 3300046519 | Bacteria | 20270 |
| 489 | Ga0495637_0003268 | 3300046520 | Bacteria | 8623 |
| 490 | Ga0495637_0027793 | 3300046520 | Bacteria | 2527 |
| 491 | Ga0495643_0018407 | 3300046522 | Bacteria | 4061 |
| 492 | Ga0495643_0179461 | 3300046522 | Bacteria | 1030 |
| 493 | Ga0495648_0000154 | 3300046524 | Bacteria | 81679 |
| 494 | Ga0495648_0040700 | 3300046524 | Bacteria | 2944 |
| 495 | Ga0495663_0247942 | 3300046525 | Bacteria | 632 |
| 496 | Ga0495642_0064831 | 3300046528 | Bacteria | 1520 |
| 497 | Ga0495654_0000100 | 3300046530 | Bacteria | 98615 |
| 498 | Ga0495621_0092031 | 3300046539 | Bacteria | 1144 |
| 499 | Ga0495597_0015408 | 3300046542 | Bacteria | 3621 |
| 500 | Ga0495597_0026634 | 3300046542 | Bacteria | 2655 |
| 501 | Ga0495668_0000092 | 3300046616 | Bacteria | 142835 |
| 502 | Ga0495668_0006961 | 3300046616 | Bacteria | 7315 |
| 503 | Ga0495668_0011470 | 3300046616 | Bacteria | 5304 |
| 504 | Ga0495668_0026263 | 3300046616 | Bacteria | 3305 |
| 505 | Ga0495668_0042149 | 3300046616 | Bacteria | 2542 |
| 506 | Ga0495668_0185119 | 3300046616 | Bacteria | 1141 |
| 507 | Ga0495668_0212471 | 3300046616 | Bacteria | 1059 |
| 508 | Ga0495625_0000080 | 3300046660 | Bacteria | 156895 |
| 509 | Ga0495625_0003786 | 3300046660 | Bacteria | 14684 |
| 510 | Ga0495625_0006302 | 3300046660 | Bacteria | 10609 |
| 511 | Ga0495625_0030057 | 3300046660 | Bacteria | 4056 |
| 512 | Ga0495625_0035884 | 3300046660 | Bacteria | 3649 |
| 513 | Ga0495669_0019698 | 3300046684 | Bacteria | 2914 |
| 514 | Ga0495613_0000435 | 3300046689 | Bacteria | 35741 |
| 515 | Ga0495670_0302691 | 3300046691 | Bacteria | 857 |
| 516 | Ga0495671_0612659 | 3300046692 | Bacteria | 518 |
| 517 | Ga0495649_0514005 | 3300046694 | Bacteria | 595 |
| 518 | Ga0495649_0647100 | 3300046694 | Bacteria | 520 |
| 519 | Ga0495589_0017924 | 3300046794 | Bacteria | 3632 |
| 520 | Ga0495636_0052056 | 3300047318 | Bacteria | 1717 |
| 521 | Ga0495672_0001481 | 3300047320 | Bacteria | 23043 |
| 522 | Ga0495672_0007251 | 3300047320 | Bacteria | 8364 |
| 523 | Ga0495672_0018839 | 3300047320 | Bacteria | 4572 |
| 524 | Ga0495677_0026683 | 3300047445 | Bacteria | 2095 |
| 525 | Ga0495677_0028117 | 3300047445 | Bacteria | 2041 |
| 526 | Ga0495677_0287973 | 3300047445 | Bacteria | 645 |
| 527 | Ga0495679_002196 | 3300047446 | Bacteria | 10189 |
| 528 | Ga0495673_0000132 | 3300047469 | Bacteria | 138001 |
| 529 | Ga0495673_0000363 | 3300047469 | Bacteria | 54803 |
| 530 | Ga0495673_0012113 | 3300047469 | Bacteria | 4592 |
| 531 | Ga0495681_0008669 | 3300047470 | Bacteria | 6349 |
| 532 | Ga0495686_0003268 | 3300047472 | Bacteria | 14187 |
| 533 | Ga0495686_0010880 | 3300047472 | Bacteria | 6442 |
| 534 | Ga0495686_0029767 | 3300047472 | Bacteria | 3550 |
| 535 | Ga0495686_0038383 | 3300047472 | Bacteria | 3063 |
| 536 | Ga0495686_0078234 | 3300047472 | Bacteria | 2024 |
| 537 | Ga0495686_0082152 | 3300047472 | Bacteria | 1967 |
| 538 | Ga0495686_0219991 | 3300047472 | Bacteria | 1081 |
| 539 | Ga0495686_0232693 | 3300047472 | Bacteria | 1043 |
| 540 | Ga0496101_0071183 | 3300048904 | Bacteria | 2549 |
| 541 | Ga0496107_0000142 | 3300048910 | Bacteria | 35781 |
| 542 | Ga0496107_0178604 | 3300048910 | Bacteria | 1576 |
| 543 | Ga0496108_0521214 | 3300048911 | Bacteria | 1038 |
| 544 | Ga0496108_1329421 | 3300048911 | Bacteria | 604 |
| 545 | Ga0496114_0788179 | 3300048917 | Bacteria | 829 |
| 546 | Ga0496114_0959841 | 3300048917 | Bacteria | 737 |
| 547 | Ga0496115_0149425 | 3300048918 | Bacteria | 1928 |
| 548 | Ga0496115_0282974 | 3300048918 | Bacteria | 1361 |
| 549 | Ga0496115_0835762 | 3300048918 | Bacteria | 714 |
| 550 | Ga0496117_0350852 | 3300048920 | Bacteria | 762 |
| 551 | Ga0496120_0362081 | 3300048923 | Bacteria | 649 |
| 552 | Ga0496121_0005751 | 3300048924 | Bacteria | 15746 |
| 553 | Ga0496121_0075741 | 3300048924 | Bacteria | 2687 |
| 554 | Ga0496121_0296515 | 3300048924 | Bacteria | 1099 |
| 555 | Ga0496122_0277034 | 3300048925 | Bacteria | 920 |
| 556 | Ga0496124_0021831 | 3300048927 | Bacteria | 5888 |
| 557 | Ga0496124_0416722 | 3300048927 | Bacteria | 927 |
| 558 | Ga0496124_0694908 | 3300048927 | Bacteria | 646 |
| 559 | Ga0496124_0784795 | 3300048927 | Bacteria | 592 |
| 560 | Ga0496125_0030771 | 3300048928 | Bacteria | 4795 |
| 561 | Ga0496126_0002357 | 3300048929 | Bacteria | 25776 |
| 562 | Ga0496126_0107854 | 3300048929 | Bacteria | 2429 |
| 563 | Ga0495678_000659 | 3300049459 | Bacteria | 31659 |
| 564 | Ga0501031_0174412 | 3300049568 | Bacteria | 1405 |
| 565 | Ga0501031_0360149 | 3300049568 | Bacteria | 941 |
| 566 | Ga0501031_0407960 | 3300049568 | Bacteria | 879 |
| 567 | Ga0501032_0001563 | 3300049569 | Bacteria | 18270 |
| 568 | Ga0501032_0150796 | 3300049569 | Bacteria | 1529 |
| 569 | Ga0501032_0552039 | 3300049569 | Bacteria | 734 |
| 570 | Ga0501032_0585978 | 3300049569 | Bacteria | 710 |
| 571 | Ga0501032_0626170 | 3300049569 | Bacteria | 684 |
| 572 | Ga0501032_0740714 | 3300049569 | Bacteria | 622 |
| 573 | Ga0501033_0012313 | 3300049570 | Bacteria | 6529 |
| 574 | Ga0501033_0078836 | 3300049570 | Bacteria | 2417 |
| 575 | Ga0501033_0549214 | 3300049570 | Bacteria | 796 |
| 576 | Ga0501034_0039981 | 3300049571 | Bacteria | 4749 |
| 577 | Ga0501034_0040066 | 3300049571 | Bacteria | 4744 |
| 578 | Ga0501034_0105656 | 3300049571 | Bacteria | 2808 |
| 579 | Ga0501034_0208617 | 3300049571 | Bacteria | 1909 |
| 580 | Ga0501034_0254375 | 3300049571 | Bacteria | 1700 |
| 581 | Ga0501034_0262311 | 3300049571 | Bacteria | 1670 |
| 582 | Ga0501034_0305164 | 3300049571 | Bacteria | 1527 |
| 583 | Ga0501034_0398539 | 3300049571 | Bacteria | 1299 |
| 584 | Ga0501034_0399848 | 3300049571 | Bacteria | 1296 |
| 585 | Ga0501034_0639279 | 3300049571 | Bacteria | 966 |
| 586 | Ga0501034_0663761 | 3300049571 | Bacteria | 943 |
| 587 | Ga0501034_0885370 | 3300049571 | Bacteria | 781 |
| 588 | Ga0501036_0014336 | 3300049572 | Bacteria | 6597 |
| 589 | Ga0501036_1566121 | 3300049572 | Bacteria | 532 |
| 590 | Ga0501037_0016941 | 3300049573 | Bacteria | 5362 |
| 591 | Ga0501037_0021548 | 3300049573 | Bacteria | 4765 |
| 592 | Ga0501037_0032652 | 3300049573 | Bacteria | 3845 |
| 593 | Ga0501037_0125192 | 3300049573 | Bacteria | 1846 |
| 594 | Ga0501037_0627561 | 3300049573 | Bacteria | 720 |
| 595 | Ga0501038_0030626 | 3300049574 | Bacteria | 4758 |
| 596 | Ga0501038_0092330 | 3300049574 | Bacteria | 2535 |
| 597 | Ga0501038_0140103 | 3300049574 | Bacteria | 1979 |
| 598 | Ga0501038_0180253 | 3300049574 | Bacteria | 1705 |
| 599 | Ga0501038_1163201 | 3300049574 | Bacteria | 561 |
| 600 | Ga0501039_0495372 | 3300049575 | Bacteria | 959 |
| 601 | Ga0501043_0021252 | 3300049579 | Bacteria | 5088 |
| 602 | Ga0501043_0151366 | 3300049579 | Bacteria | 1816 |
| 603 | Ga0501043_0156023 | 3300049579 | Bacteria | 1785 |
| 604 | Ga0501046_0285659 | 3300049580 | Bacteria | 1208 |
| 605 | Ga0501046_0321322 | 3300049580 | Bacteria | 1128 |
| 606 | Ga0501047_0000223 | 3300049581 | Bacteria | 67658 |
| 607 | Ga0501047_0015714 | 3300049581 | Bacteria | 7212 |
| 608 | Ga0501047_0188058 | 3300049581 | Bacteria | 1930 |
| 609 | Ga0501047_0269902 | 3300049581 | Bacteria | 1548 |
| 610 | Ga0501047_0407991 | 3300049581 | Bacteria | 1191 |
| 611 | Ga0501047_0592684 | 3300049581 | Bacteria | 930 |
| 612 | Ga0501047_0990948 | 3300049581 | Bacteria | 654 |
| 613 | Ga0501048_0158776 | 3300049582 | Bacteria | 1600 |
| 614 | Ga0501048_0582161 | 3300049582 | Bacteria | 803 |
| 615 | Ga0501067_0000091 | 3300049583 | Bacteria | 52819 |
| 616 | Ga0501067_0074271 | 3300049583 | Bacteria | 1884 |
| 617 | Ga0501067_0789561 | 3300049583 | Bacteria | 535 |
| 618 | Ga0501068_0002658 | 3300049584 | Bacteria | 9471 |
| 619 | Ga0501070_0012163 | 3300049586 | Bacteria | 7262 |
| 620 | Ga0501070_0102572 | 3300049586 | Bacteria | 2366 |
| 621 | Ga0501070_0178841 | 3300049586 | Bacteria | 1746 |
| 622 | Ga0501070_0601258 | 3300049586 | Bacteria | 877 |
| 623 | Ga0501070_0611868 | 3300049586 | Bacteria | 868 |
| 624 | Ga0501073_0000011 | 3300049589 | Bacteria | 161823 |
| 625 | Ga0501073_0062276 | 3300049589 | Bacteria | 2602 |
| 626 | Ga0501073_0320939 | 3300049589 | Bacteria | 1069 |
| 627 | Ga0501073_0542413 | 3300049589 | Bacteria | 804 |
| 628 | Ga0501073_0881951 | 3300049589 | Bacteria | 616 |
| 629 | Ga0501074_0150663 | 3300049590 | Bacteria | 1663 |
| 630 | Ga0501074_0366185 | 3300049590 | Bacteria | 1023 |
| 631 | Ga0501077_0000011 | 3300049593 | Bacteria | 96805 |
| 632 | Ga0501238_037965 | 3300049671 | Bacteria | 705 |
| 633 | Ga0501080_0001484 | 3300049742 | Bacteria | 19783 |
| 634 | Ga0501080_0021953 | 3300049742 | Bacteria | 5912 |
| 635 | Ga0501080_0339269 | 3300049742 | Bacteria | 1358 |
| 636 | Ga0501080_0354537 | 3300049742 | Bacteria | 1324 |
| 637 | Ga0501080_0645772 | 3300049742 | Bacteria | 937 |
| 638 | Ga0501080_0716149 | 3300049742 | Bacteria | 882 |
| 639 | Ga0501081_1176308 | 3300049743 | Bacteria | 581 |
| 640 | Ga0501083_0002308 | 3300049744 | Bacteria | 13036 |
| 641 | Ga0501083_0031649 | 3300049744 | Bacteria | 3630 |
| 642 | Ga0501083_0678165 | 3300049744 | Bacteria | 670 |
| 643 | Ga0501035_0005658 | 3300049822 | Bacteria | 11796 |
| 644 | Ga0501035_0026323 | 3300049822 | Bacteria | 5322 |
| 645 | Ga0501035_0310512 | 3300049822 | Bacteria | 1327 |
| 646 | Ga0501035_0900908 | 3300049822 | Bacteria | 700 |
| 647 | Ga0501044_0007155 | 3300049823 | Bacteria | 12274 |
| 648 | Ga0501044_0010058 | 3300049823 | Bacteria | 10280 |
| 649 | Ga0501044_0094473 | 3300049823 | Bacteria | 3015 |
| 650 | Ga0501044_0181606 | 3300049823 | Bacteria | 2070 |
| 651 | Ga0501044_0424206 | 3300049823 | Bacteria | 1240 |
| 652 | Ga0501044_0837244 | 3300049823 | Bacteria | 797 |
| 653 | Ga0501044_1489519 | 3300049823 | Bacteria | 542 |
| 654 | nmdc:mga03683_13444_c1 | 3300050489 | Bacteria | 3013 |
| 655 | nmdc:mga03683_359060_c1 | 3300050489 | Bacteria | 691 |
| 656 | nmdc:mga03683_372953_c1 | 3300050489 | Bacteria | 678 |
| 657 | nmdc:mga03683_49616_c1 | 3300050489 | Bacteria | 1748 |
| 658 | nmdc:mga03683_554337_c1 | 3300050489 | Bacteria | 560 |
| 659 | nmdc:mga03683_638409_c1 | 3300050489 | Bacteria | 523 |
| 660 | nmdc:mga03n38_89912_c1 | 3300050490 | Bacteria | 1459 |
| 661 | nmdc:mga00v17_754084_c1 | 3300050491 | Bacteria | 622 |
| 662 | nmdc:mga00v17_7564_c2 | 3300050491 | Bacteria | 2264 |
| 663 | nmdc:mga0yw44_836127_c1 | 3300050492 | Bacteria | 625 |
| 664 | nmdc:mga0k408_172711_c1 | 3300050493 | Bacteria | 1289 |
| 665 | nmdc:mga0k408_29963_c1 | 3300050493 | Bacteria | 3101 |
| 666 | nmdc:mga0k408_523308_c1 | 3300050493 | Bacteria | 702 |
| 667 | nmdc:mga0k408_97809_c1 | 3300050493 | Bacteria | 1141 |
| 668 | nmdc:mga06z11_336129_c1 | 3300050494 | Bacteria | 902 |
| 669 | nmdc:mga06z11_341998_c1 | 3300050494 | Bacteria | 895 |
| 670 | nmdc:mga04h51_116010_c1 | 3300050495 | Bacteria | 992 |
| 671 | nmdc:mga04h51_295750_c1 | 3300050495 | Bacteria | 659 |
| 672 | nmdc:mga07m45_37354_c1 | 3300050496 | Bacteria | 2709 |
| 673 | nmdc:mga07m45_91276_c1 | 3300050496 | Bacteria | 1745 |
| 674 | nmdc:mga0qj67_405942_c1 | 3300050509 | Bacteria | 1099 |
| 675 | nmdc:mga0sz30_14935_c1 | 3300050516 | Bacteria | 3063 |
| 676 | nmdc:mga0sz30_64032_c2 | 3300050516 | Bacteria | 975 |
| 677 | Ga0495612_0100537 | 3300053078 | Bacteria | 1231 |
| 678 | Ga0500578_0000092 | 3300053086 | Bacteria | 102206 |
| 679 | Ga0500578_0269871 | 3300053086 | Bacteria | 1018 |
| 680 | Ga0500643_005170 | 3300053087 | Bacteria | 5692 |
| 681 | Ga0500643_018434 | 3300053087 | Bacteria | 2316 |
| 682 | Ga0500643_107571 | 3300053087 | Bacteria | 754 |
| 683 | Ga0500644_0000121 | 3300053088 | Bacteria | 48128 |
| 684 | Ga0500644_0021802 | 3300053088 | Bacteria | 1924 |
| 685 | Ga0500646_0037398 | 3300053090 | Bacteria | 1356 |
| 686 | Ga0500646_0126818 | 3300053090 | Bacteria | 826 |
| 687 | Ga0500651_0326731 | 3300053093 | Bacteria | 875 |
| 688 | Ga0500641_0007547 | 3300053096 | Bacteria | 3878 |
| 689 | Ga0500650_0257325 | 3300053098 | Bacteria | 781 |
| 690 | Ga0500554_000951 | 3300053102 | Bacteria | 5624 |
| 691 | Ga0500555_015527 | 3300053103 | Bacteria | 2197 |
| 692 | Ga0500555_016079 | 3300053103 | Bacteria | 2156 |
| 693 | Ga0500556_0000273 | 3300053104 | Bacteria | 40555 |
| 694 | Ga0500556_0002733 | 3300053104 | Bacteria | 5447 |
| 695 | Ga0500556_0218323 | 3300053104 | Bacteria | 752 |
| 696 | Ga0500562_000772 | 3300053108 | Bacteria | 7796 |
| 697 | Ga0500562_000990 | 3300053108 | Bacteria | 6929 |
| 698 | Ga0500562_044278 | 3300053108 | Bacteria | 1185 |
| 699 | Ga0500594_0000192 | 3300053118 | Bacteria | 15305 |
| 700 | Ga0500594_0056821 | 3300053118 | Bacteria | 1117 |
| 701 | Ga0500595_005390 | 3300053119 | Bacteria | 5593 |
| 702 | Ga0500595_011491 | 3300053119 | Bacteria | 3465 |
| 703 | Ga0500618_000034 | 3300053125 | Bacteria | 120560 |
| 704 | Ga0500658_0003408 | 3300053134 | Bacteria | 6014 |
| 705 | Ga0500559_0000005 | 3300053136 | Bacteria | 230231 |
| 706 | Ga0500559_0002051 | 3300053136 | Bacteria | 10788 |
| 707 | Ga0500559_0007255 | 3300053136 | Bacteria | 4924 |
| 708 | Ga0500559_0206161 | 3300053136 | Bacteria | 927 |
| 709 | Ga0500559_0588090 | 3300053136 | Bacteria | 505 |
| 710 | Ga0500564_000085 | 3300053138 | Bacteria | 24497 |
| 711 | Ga0500568_0093111 | 3300053139 | Bacteria | 1135 |
| 712 | Ga0500568_0193994 | 3300053139 | Bacteria | 745 |
| 713 | Ga0500588_0247233 | 3300053146 | Bacteria | 669 |
| 714 | Ga0500616_0012756 | 3300053153 | Bacteria | 4906 |
| 715 | Ga0500616_0078177 | 3300053153 | Bacteria | 1669 |
| 716 | Ga0500622_0001197 | 3300053156 | Bacteria | 21349 |
| 717 | Ga0500622_0006251 | 3300053156 | Bacteria | 6960 |
| 718 | Ga0500622_0030614 | 3300053156 | Bacteria | 2825 |
| 719 | Ga0500622_0032748 | 3300053156 | Bacteria | 2725 |
| 720 | Ga0500627_0309980 | 3300053158 | Bacteria | 687 |
| 721 | Ga0500636_0030803 | 3300053177 | Bacteria | 3175 |
| 722 | Ga0500570_221636 | 3300053724 | Bacteria | 541 |
| 723 | Ga0500611_001832 | 3300053727 | Bacteria | 2433 |
| 724 | Ga0500645_000494 | 3300053730 | Bacteria | 26541 |
| 725 | Ga0500645_001063 | 3300053730 | Bacteria | 15218 |
| 726 | Ga0500645_006402 | 3300053730 | Bacteria | 4206 |
| 727 | Ga0500645_093280 | 3300053730 | Bacteria | 853 |
| 728 | Ga0500645_160663 | 3300053730 | Bacteria | 616 |
| 729 | Ga0500645_162920 | 3300053730 | Bacteria | 611 |
| 730 | Ga0501084_0303056 | 3300054114 | Bacteria | 1350 |
| 731 | Ga0501084_0326962 | 3300054114 | Bacteria | 1295 |
| 732 | Ga0587077_024025 | 3300059493 | Bacteria | 1106 |
| 733 | Ga0587080_109882 | 3300059503 | Bacteria | 600 |
| 734 | Ga0587082_060825 | 3300059504 | Bacteria | 744 |
| 735 | Ga0587101_004973 | 3300059623 | Bacteria | 1451 |
| 736 | Ga0587062_006810 | 3300059639 | Bacteria | 1311 |
| 737 | Ga0587069_158590 | 3300059642 | Bacteria | 507 |
| 738 | Ga0587076_117399 | 3300059645 | Bacteria | 613 |
| 739 | Ga0587100_034046 | 3300059648 | Bacteria | 552 |
| 740 | Ga0587107_138814 | 3300059652 | Bacteria | 518 |
| 741 | Ga0587111_0061480 | 3300060346 | Bacteria | 855 |
| 742 | Ga0501082_0019195 | 3300060353 | Bacteria | 5891 |
| 743 | Ga0501082_0392628 | 3300060353 | Bacteria | 1211 |
| 744 | Ga0501082_0905311 | 3300060353 | Bacteria | 772 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0352865 | Ga0395905_0352865_516_914 | 106 |
| 2 | 3300005436 | Ga0070713_100722431 | Ga0070713_1007224311 | 107 |
| 3 | 3300005262 | Ga0065165_1013111 | Ga0065165_10131113 | 108 |
| 4 | 3300009176 | Ga0105242_10302217 | Ga0105242_103022172 | 108 |
| 5 | 3300025945 | Ga0207679_11804904 | Ga0207679_118049042 | 108 |
| 6 | 3300009093 | Ga0105240_10047987 | Ga0105240_100479876 | 109 |
| 7 | 3300025901 | Ga0207688_10311583 | Ga0207688_103115832 | 109 |
| 8 | 3300025913 | Ga0207695_10035247 | Ga0207695_100352473 | 109 |
| 9 | 3300005844 | Ga0068862_101682674 | Ga0068862_1016826742 | 110 |
| 10 | 3300006871 | Ga0075434_100310133 | Ga0075434_1003101333 | 110 |
| 11 | 3300009553 | Ga0105249_10059537 | Ga0105249_100595373 | 110 |
| 12 | 3300020082 | Ga0206353_10095337 | Ga0206353_100953372 | 110 |
| 13 | 3300028380 | Ga0268265_10021366 | Ga0268265_100213663 | 110 |
| 14 | 3300028380 | Ga0268265_10455444 | Ga0268265_104554441 | 110 |
| 15 | 3300041494 | Ga0451837_1716482 | Ga0451837_1716482_256_591 | 110 |
| 16 | 3300044842 | Ga0466957_1449880 | Ga0466957_1449880_57_452 | 110 |
| 17 | 3300049569 | Ga0501032_0001563 | Ga0501032_0001563_15202_15537 | 110 |
| 18 | 3300049569 | Ga0501032_0585978 | Ga0501032_0585978_249_599 | 110 |
| 19 | 3300049573 | Ga0501037_0021548 | Ga0501037_0021548_33_368 | 110 |
| 20 | 3300049579 | Ga0501043_0156023 | Ga0501043_0156023_182_517 | 110 |
| 21 | 3300049583 | Ga0501067_0000091 | Ga0501067_0000091_5047_5382 | 110 |
| 22 | 3300049584 | Ga0501068_0002658 | Ga0501068_0002658_4156_4491 | 110 |
| 23 | 3300049589 | Ga0501073_0000011 | Ga0501073_0000011_78872_79207 | 110 |
| 24 | 3300049593 | Ga0501077_0000011 | Ga0501077_0000011_82486_82821 | 110 |
| 25 | 3300049742 | Ga0501080_0001484 | Ga0501080_0001484_19028_19363 | 110 |
| 26 | 3300049823 | Ga0501044_0007155 | Ga0501044_0007155_11277_11612 | 110 |
| 27 | 3300054114 | Ga0501084_0326962 | Ga0501084_0326962_538_873 | 110 |
| 28 | 3300060353 | Ga0501082_0905311 | Ga0501082_0905311_116_451 | 110 |
| 29 | 3300014969 | Ga0157376_10978742 | Ga0157376_109787421 | 111 |
| 30 | 3300028573 | Ga0265334_10096613 | Ga0265334_100966132 | 111 |
| 31 | 3300028800 | Ga0265338_10039703 | Ga0265338_100397035 | 111 |
| 32 | 3300031239 | Ga0265328_10107402 | Ga0265328_101074022 | 111 |
| 33 | 3300031241 | Ga0265325_10006244 | Ga0265325_100062445 | 111 |
| 34 | 3300031242 | Ga0265329_10033006 | Ga0265329_100330062 | 111 |
| 35 | 3300031249 | Ga0265339_10000389 | Ga0265339_100003897 | 111 |
| 36 | 3300031595 | Ga0265313_10000449 | Ga0265313_1000044931 | 111 |
| 37 | 3300031711 | Ga0265314_10047669 | Ga0265314_100476692 | 111 |
| 38 | 3300041444 | Ga0451790_46757 | Ga0451790_46757_71_418 | 111 |
| 39 | 3300005262 | Ga0065165_1000979 | Ga0065165_100097936 | 112 |
| 40 | 3300009098 | Ga0105245_10638442 | Ga0105245_106384422 | 112 |
| 41 | 3300009545 | Ga0105237_10000309 | Ga0105237_1000030913 | 112 |
| 42 | 3300009551 | Ga0105238_10402617 | Ga0105238_104026173 | 112 |
| 43 | 3300010375 | Ga0105239_10000575 | Ga0105239_100005755 | 112 |
| 44 | 3300025295 | Ga0209564_1001352 | Ga0209564_100135217 | 112 |
| 45 | 3300025299 | Ga0209256_1001833 | Ga0209256_100183321 | 112 |
| 46 | 3300041413 | Ga0439465_0031449 | Ga0439465_0031449_866_1231 | 112 |
| 47 | 3300041486 | Ga0451807_0966353 | Ga0451807_0966353_34_399 | 112 |
| 48 | 3300041509 | Ga0451843_0825648 | Ga0451843_0825648_205_543 | 112 |
| 49 | 3300042436 | Ga0439435_0221228 | Ga0439435_0221228_178_543 | 112 |
| 50 | 3300046460 | Ga0495638_0003618 | Ga0495638_0003618_2784_3191 | 112 |
| 51 | 3300048918 | Ga0496115_0282974 | Ga0496115_0282974_981_1325 | 112 |
| 52 | 3300050493 | nmdc:mga0k408_172711_c1 | nmdc:mga0k408_172711_c1_39_389 | 112 |
| 53 | 3300053136 | Ga0500559_0588090 | Ga0500559_0588090_17_355 | 112 |
| 54 | iso_pu_bacteria | 8045864390 | 8045865266 | 112 |
| 55 | 3300005327 | Ga0070658_10131827 | Ga0070658_101318272 | 113 |
| 56 | 3300009093 | Ga0105240_11363495 | Ga0105240_113634952 | 113 |
| 57 | 3300013100 | Ga0157373_11341198 | Ga0157373_113411981 | 113 |
| 58 | 3300013102 | Ga0157371_10061002 | Ga0157371_100610023 | 113 |
| 59 | 3300013104 | Ga0157370_10245263 | Ga0157370_102452633 | 113 |
| 60 | 3300013307 | Ga0157372_10735492 | Ga0157372_107354922 | 113 |
| 61 | 3300037312 | Ga0395899_0459232 | Ga0395899_0459232_438_806 | 113 |
| 62 | 3300037466 | Ga0395898_0527032 | Ga0395898_0527032_123_491 | 113 |
| 63 | 3300038443 | Ga0395901_0161843 | Ga0395901_0161843_1032_1400 | 113 |
| 64 | 3300039438 | Ga0436360_0414423 | Ga0436360_0414423_695_1036 | 113 |
| 65 | 3300044842 | Ga0466957_0297169 | Ga0466957_0297169_34_405 | 113 |
| 66 | 3300047472 | Ga0495686_0010880 | Ga0495686_0010880_245_640 | 113 |
| 67 | 3300048911 | Ga0496108_1329421 | Ga0496108_1329421_196_537 | 113 |
| 68 | 3300048927 | Ga0496124_0694908 | Ga0496124_0694908_118_498 | 113 |
| 69 | 3300049571 | Ga0501034_0305164 | Ga0501034_0305164_848_1219 | 113 |
| 70 | 3300050489 | nmdc:mga03683_554337_c1 | nmdc:mga03683_554337_c1_129_470 | 113 |
| 71 | 3300050495 | nmdc:mga04h51_116010_c1 | nmdc:mga04h51_116010_c1_146_517 | 113 |
| 72 | iso_pu_bacteria | 2643221629 | 2644167644 | 113 |
| 73 | iso_pu_bacteria | 2643221662 | 2644349104 | 113 |
| 74 | 3300005347 | Ga0070668_100017835 | Ga0070668_1000178356 | 114 |
| 75 | 3300005548 | Ga0070665_100469453 | Ga0070665_1004694532 | 114 |
| 76 | 3300005844 | Ga0068862_100012982 | Ga0068862_1000129823 | 114 |
| 77 | 3300013104 | Ga0157370_11381062 | Ga0157370_113810622 | 114 |
| 78 | 3300014969 | Ga0157376_11459360 | Ga0157376_114593602 | 114 |
| 79 | 3300025972 | Ga0207668_10010026 | Ga0207668_100100266 | 114 |
| 80 | 3300025972 | Ga0207668_10320715 | Ga0207668_103207152 | 114 |
| 81 | 3300028379 | Ga0268266_10040177 | Ga0268266_100401775 | 114 |
| 82 | 3300028380 | Ga0268265_10014725 | Ga0268265_100147255 | 114 |
| 83 | 3300031247 | Ga0265340_10057760 | Ga0265340_100577602 | 114 |
| 84 | 3300031711 | Ga0265314_10048467 | Ga0265314_100484674 | 114 |
| 85 | 3300032002 | Ga0307416_100281241 | Ga0307416_1002812413 | 114 |
| 86 | 3300037312 | Ga0395899_0447533 | Ga0395899_0447533_211_606 | 114 |
| 87 | 3300037466 | Ga0395898_0124963 | Ga0395898_0124963_725_1120 | 114 |
| 88 | 3300041452 | Ga0451793_1847991 | Ga0451793_1847991_318_695 | 114 |
| 89 | 3300048920 | Ga0496117_0350852 | Ga0496117_0350852_45_422 | 114 |
| 90 | 3300048923 | Ga0496120_0362081 | Ga0496120_0362081_149_532 | 114 |
| 91 | 3300048924 | Ga0496121_0296515 | Ga0496121_0296515_589_972 | 114 |
| 92 | 3300005327 | Ga0070658_10194762 | Ga0070658_101947623 | 115 |
| 93 | 3300005337 | Ga0070682_100977607 | Ga0070682_1009776072 | 115 |
| 94 | 3300005539 | Ga0068853_100010907 | Ga0068853_1000109075 | 115 |
| 95 | 3300005548 | Ga0070665_100017471 | Ga0070665_1000174714 | 115 |
| 96 | 3300005563 | Ga0068855_100021728 | Ga0068855_1000217287 | 115 |
| 97 | 3300005564 | Ga0070664_101015629 | Ga0070664_1010156292 | 115 |
| 98 | 3300005719 | Ga0068861_100713484 | Ga0068861_1007134842 | 115 |
| 99 | 3300006038 | Ga0075365_10841960 | Ga0075365_108419602 | 115 |
| 100 | 3300006042 | Ga0075368_10240587 | Ga0075368_102405872 | 115 |
| 101 | 3300006048 | Ga0075363_100021497 | Ga0075363_1000214972 | 115 |
| 102 | 3300006051 | Ga0075364_10069003 | Ga0075364_100690032 | 115 |
| 103 | 3300006051 | Ga0075364_10124886 | Ga0075364_101248863 | 115 |
| 104 | 3300006177 | Ga0075362_10055076 | Ga0075362_100550762 | 115 |
| 105 | 3300006177 | Ga0075362_10179820 | Ga0075362_101798202 | 115 |
| 106 | 3300006178 | Ga0075367_10505949 | Ga0075367_105059491 | 115 |
| 107 | 3300006186 | Ga0075369_10185433 | Ga0075369_101854331 | 115 |
| 108 | 3300006195 | Ga0075366_10468727 | Ga0075366_104687272 | 115 |
| 109 | 3300006195 | Ga0075366_10609802 | Ga0075366_106098021 | 115 |
| 110 | 3300006353 | Ga0075370_10059177 | Ga0075370_100591772 | 115 |
| 111 | 3300009093 | Ga0105240_10055987 | Ga0105240_100559875 | 115 |
| 112 | 3300009551 | Ga0105238_11969105 | Ga0105238_119691051 | 115 |
| 113 | 3300013296 | Ga0157374_12687445 | Ga0157374_126874451 | 115 |
| 114 | 3300013307 | Ga0157372_11865941 | Ga0157372_118659412 | 115 |
| 115 | 3300014969 | Ga0157376_10193623 | Ga0157376_101936231 | 115 |
| 116 | 3300020069 | Ga0197907_10040603 | Ga0197907_100406033 | 115 |
| 117 | 3300022467 | Ga0224712_10059741 | Ga0224712_100597412 | 115 |
| 118 | 3300022467 | Ga0224712_10128235 | Ga0224712_101282352 | 115 |
| 119 | 3300025231 | Ga0207427_101879 | Ga0207427_1018793 | 115 |
| 120 | 3300025261 | Ga0209233_1001040 | Ga0209233_100104010 | 115 |
| 121 | 3300025909 | Ga0207705_10058559 | Ga0207705_100585592 | 115 |
| 122 | 3300025913 | Ga0207695_10131122 | Ga0207695_101311224 | 115 |
| 123 | 3300025914 | Ga0207671_10000617 | Ga0207671_100006172 | 115 |
| 124 | 3300025919 | Ga0207657_10009762 | Ga0207657_100097629 | 115 |
| 125 | 3300025924 | Ga0207694_10934418 | Ga0207694_109344181 | 115 |
| 126 | 3300025932 | Ga0207690_10161424 | Ga0207690_101614243 | 115 |
| 127 | 3300025945 | Ga0207679_10838635 | Ga0207679_108386352 | 115 |
| 128 | 3300025949 | Ga0207667_10040883 | Ga0207667_100408837 | 115 |
| 129 | 3300025949 | Ga0207667_10284756 | Ga0207667_102847562 | 115 |
| 130 | 3300026041 | Ga0207639_10007233 | Ga0207639_100072334 | 115 |
| 131 | 3300026041 | Ga0207639_10761404 | Ga0207639_107614042 | 115 |
| 132 | 3300027665 | Ga0209983_1018319 | Ga0209983_10183193 | 115 |
| 133 | 3300027876 | Ga0209974_10126650 | Ga0209974_101266502 | 115 |
| 134 | 3300027876 | Ga0209974_10238010 | Ga0209974_102380102 | 115 |
| 135 | 3300028379 | Ga0268266_10000265 | Ga0268266_1000026542 | 115 |
| 136 | 3300031548 | Ga0307408_100902659 | Ga0307408_1009026592 | 115 |
| 137 | 3300031824 | Ga0307413_10217370 | Ga0307413_102173703 | 115 |
| 138 | 3300031824 | Ga0307413_11834971 | Ga0307413_118349712 | 115 |
| 139 | 3300031903 | Ga0307407_10609780 | Ga0307407_106097801 | 115 |
| 140 | 3300032005 | Ga0307411_11929502 | Ga0307411_119295021 | 115 |
| 141 | 3300038443 | Ga0395901_0722334 | Ga0395901_0722334_308_688 | 115 |
| 142 | 3300038443 | Ga0395901_1079397 | Ga0395901_1079397_358_738 | 115 |
| 143 | 3300041404 | Ga0439436_0256568 | Ga0439436_0256568_33_413 | 115 |
| 144 | 3300041460 | Ga0451802_1510085 | Ga0451802_1510085_61_441 | 115 |
| 145 | 3300041492 | Ga0451835_0930043 | Ga0451835_0930043_209_589 | 115 |
| 146 | 3300042004 | Ga0439445_0064202 | Ga0439445_0064202_328_708 | 115 |
| 147 | 3300042435 | Ga0439434_0044153 | Ga0439434_0044153_11_391 | 115 |
| 148 | 3300042435 | Ga0439434_0351577 | Ga0439434_0351577_61_441 | 115 |
| 149 | 3300044683 | Ga0466965_0337851 | Ga0466965_0337851_49_429 | 115 |
| 150 | 3300047472 | Ga0495686_0078234 | Ga0495686_0078234_408_788 | 115 |
| 151 | 3300047472 | Ga0495686_0232693 | Ga0495686_0232693_53_433 | 115 |
| 152 | 3300048917 | Ga0496114_0788179 | Ga0496114_0788179_28_408 | 115 |
| 153 | 3300048929 | Ga0496126_0107854 | Ga0496126_0107854_1177_1557 | 115 |
| 154 | 3300049568 | Ga0501031_0407960 | Ga0501031_0407960_207_587 | 115 |
| 155 | 3300049569 | Ga0501032_0740714 | Ga0501032_0740714_13_393 | 115 |
| 156 | 3300049570 | Ga0501033_0012313 | Ga0501033_0012313_3711_4091 | 115 |
| 157 | 3300049571 | Ga0501034_0040066 | Ga0501034_0040066_4326_4706 | 115 |
| 158 | 3300049571 | Ga0501034_0254375 | Ga0501034_0254375_348_728 | 115 |
| 159 | 3300049571 | Ga0501034_0262311 | Ga0501034_0262311_861_1241 | 115 |
| 160 | 3300049571 | Ga0501034_0398539 | Ga0501034_0398539_197_577 | 115 |
| 161 | 3300049571 | Ga0501034_0885370 | Ga0501034_0885370_213_593 | 115 |
| 162 | 3300049573 | Ga0501037_0125192 | Ga0501037_0125192_1234_1614 | 115 |
| 163 | 3300049573 | Ga0501037_0627561 | Ga0501037_0627561_173_553 | 115 |
| 164 | 3300049574 | Ga0501038_0180253 | Ga0501038_0180253_771_1151 | 115 |
| 165 | 3300049580 | Ga0501046_0285659 | Ga0501046_0285659_481_861 | 115 |
| 166 | 3300049581 | Ga0501047_0015714 | Ga0501047_0015714_3582_3962 | 115 |
| 167 | 3300049581 | Ga0501047_0990948 | Ga0501047_0990948_91_471 | 115 |
| 168 | 3300049586 | Ga0501070_0012163 | Ga0501070_0012163_6335_6715 | 115 |
| 169 | 3300049590 | Ga0501074_0366185 | Ga0501074_0366185_477_857 | 115 |
| 170 | 3300049742 | Ga0501080_0645772 | Ga0501080_0645772_275_655 | 115 |
| 171 | 3300049822 | Ga0501035_0026323 | Ga0501035_0026323_4107_4487 | 115 |
| 172 | 3300049823 | Ga0501044_1489519 | Ga0501044_1489519_64_444 | 115 |
| 173 | 3300050489 | nmdc:mga03683_13444_c1 | nmdc:mga03683_13444_c1_759_1139 | 115 |
| 174 | 3300050489 | nmdc:mga03683_359060_c1 | nmdc:mga03683_359060_c1_133_513 | 115 |
| 175 | 3300050489 | nmdc:mga03683_49616_c1 | nmdc:mga03683_49616_c1_480_860 | 115 |
| 176 | 3300050490 | nmdc:mga03n38_89912_c1 | nmdc:mga03n38_89912_c1_492_872 | 115 |
| 177 | 3300050491 | nmdc:mga00v17_754084_c1 | nmdc:mga00v17_754084_c1_167_547 | 115 |
| 178 | 3300050491 | nmdc:mga00v17_7564_c2 | nmdc:mga00v17_7564_c2_1635_2015 | 115 |
| 179 | 3300050493 | nmdc:mga0k408_523308_c1 | nmdc:mga0k408_523308_c1_272_652 | 115 |
| 180 | 3300050493 | nmdc:mga0k408_97809_c1 | nmdc:mga0k408_97809_c1_740_1120 | 115 |
| 181 | 3300050494 | nmdc:mga06z11_341998_c1 | nmdc:mga06z11_341998_c1_302_682 | 115 |
| 182 | 3300050495 | nmdc:mga04h51_295750_c1 | nmdc:mga04h51_295750_c1_34_414 | 115 |
| 183 | 3300050496 | nmdc:mga07m45_91276_c1 | nmdc:mga07m45_91276_c1_546_926 | 115 |
| 184 | 3300050516 | nmdc:mga0sz30_64032_c2 | nmdc:mga0sz30_64032_c2_100_480 | 115 |
| 185 | 3300053108 | Ga0500562_044278 | Ga0500562_044278_306_686 | 115 |
| 186 | 3300053139 | Ga0500568_0093111 | Ga0500568_0093111_644_1024 | 115 |
| 187 | 3300053153 | Ga0500616_0012756 | Ga0500616_0012756_3043_3423 | 115 |
| 188 | 3300053730 | Ga0500645_093280 | Ga0500645_093280_43_423 | 115 |
| 189 | 3300059504 | Ga0587082_060825 | Ga0587082_060825_325_705 | 115 |
| 190 | 3300059623 | Ga0587101_004973 | Ga0587101_004973_662_1042 | 115 |
| 191 | 3300059639 | Ga0587062_006810 | Ga0587062_006810_314_694 | 115 |
| 192 | 3300059645 | Ga0587076_117399 | Ga0587076_117399_197_577 | 115 |
| 193 | 3300059648 | Ga0587100_034046 | Ga0587100_034046_83_463 | 115 |
| 194 | 3300060346 | Ga0587111_0061480 | Ga0587111_0061480_194_574 | 115 |
| 195 | 3300004799 | Ga0058863_11578230 | Ga0058863_115782302 | 116 |
| 196 | 3300005327 | Ga0070658_10197317 | Ga0070658_101973173 | 116 |
| 197 | 3300005329 | Ga0070683_100605156 | Ga0070683_1006051562 | 116 |
| 198 | 3300005329 | Ga0070683_101412591 | Ga0070683_1014125911 | 116 |
| 199 | 3300005331 | Ga0070670_101338743 | Ga0070670_1013387431 | 116 |
| 200 | 3300005339 | Ga0070660_100083536 | Ga0070660_1000835363 | 116 |
| 201 | 3300005344 | Ga0070661_100022236 | Ga0070661_1000222366 | 116 |
| 202 | 3300005344 | Ga0070661_100073003 | Ga0070661_1000730032 | 116 |
| 203 | 3300005344 | Ga0070661_100129884 | Ga0070661_1001298843 | 116 |
| 204 | 3300005344 | Ga0070661_100762644 | Ga0070661_1007626441 | 116 |
| 205 | 3300005355 | Ga0070671_100273360 | Ga0070671_1002733603 | 116 |
| 206 | 3300005364 | Ga0070673_100341036 | Ga0070673_1003410362 | 116 |
| 207 | 3300005364 | Ga0070673_100857530 | Ga0070673_1008575302 | 116 |
| 208 | 3300005366 | Ga0070659_100029991 | Ga0070659_1000299911 | 116 |
| 209 | 3300005456 | Ga0070678_100108961 | Ga0070678_1001089613 | 116 |
| 210 | 3300005456 | Ga0070678_100220898 | Ga0070678_1002208983 | 116 |
| 211 | 3300005459 | Ga0068867_100590040 | Ga0068867_1005900402 | 116 |
| 212 | 3300005530 | Ga0070679_100566984 | Ga0070679_1005669842 | 116 |
| 213 | 3300005530 | Ga0070679_101688685 | Ga0070679_1016886851 | 116 |
| 214 | 3300005535 | Ga0070684_100928012 | Ga0070684_1009280122 | 116 |
| 215 | 3300005539 | Ga0068853_100000349 | Ga0068853_10000034931 | 116 |
| 216 | 3300005539 | Ga0068853_100310939 | Ga0068853_1003109392 | 116 |
| 217 | 3300005563 | Ga0068855_100019409 | Ga0068855_1000194097 | 116 |
| 218 | 3300005563 | Ga0068855_100103516 | Ga0068855_1001035163 | 116 |
| 219 | 3300005563 | Ga0068855_100621957 | Ga0068855_1006219572 | 116 |
| 220 | 3300005564 | Ga0070664_100635099 | Ga0070664_1006350992 | 116 |
| 221 | 3300005577 | Ga0068857_100817247 | Ga0068857_1008172472 | 116 |
| 222 | 3300005578 | Ga0068854_100080564 | Ga0068854_1000805642 | 116 |
| 223 | 3300005578 | Ga0068854_100175192 | Ga0068854_1001751922 | 116 |
| 224 | 3300005614 | Ga0068856_100032721 | Ga0068856_1000327212 | 116 |
| 225 | 3300005614 | Ga0068856_100347165 | Ga0068856_1003471652 | 116 |
| 226 | 3300005614 | Ga0068856_100406014 | Ga0068856_1004060142 | 116 |
| 227 | 3300005614 | Ga0068856_100572408 | Ga0068856_1005724081 | 116 |
| 228 | 3300005616 | Ga0068852_100010308 | Ga0068852_1000103083 | 116 |
| 229 | 3300005616 | Ga0068852_100056190 | Ga0068852_1000561904 | 116 |
| 230 | 3300005616 | Ga0068852_100078086 | Ga0068852_1000780863 | 116 |
| 231 | 3300005616 | Ga0068852_101637586 | Ga0068852_1016375861 | 116 |
| 232 | 3300005834 | Ga0068851_10174409 | Ga0068851_101744092 | 116 |
| 233 | 3300005841 | Ga0068863_102249157 | Ga0068863_1022491571 | 116 |
| 234 | 3300009098 | Ga0105245_11185930 | Ga0105245_111859302 | 116 |
| 235 | 3300009148 | Ga0105243_11398020 | Ga0105243_113980202 | 116 |
| 236 | 3300009174 | Ga0105241_10021133 | Ga0105241_100211335 | 116 |
| 237 | 3300009174 | Ga0105241_10421379 | Ga0105241_104213793 | 116 |
| 238 | 3300009176 | Ga0105242_11621230 | Ga0105242_116212301 | 116 |
| 239 | 3300009545 | Ga0105237_10255147 | Ga0105237_102551473 | 116 |
| 240 | 3300009545 | Ga0105237_10835634 | Ga0105237_108356342 | 116 |
| 241 | 3300009551 | Ga0105238_10081963 | Ga0105238_100819633 | 116 |
| 242 | 3300009551 | Ga0105238_10217173 | Ga0105238_102171733 | 116 |
| 243 | 3300009551 | Ga0105238_10688069 | Ga0105238_106880691 | 116 |
| 244 | 3300010375 | Ga0105239_10026037 | Ga0105239_100260372 | 116 |
| 245 | 3300010375 | Ga0105239_10955857 | Ga0105239_109558572 | 116 |
| 246 | 3300010375 | Ga0105239_11148449 | Ga0105239_111484492 | 116 |
| 247 | 3300010375 | Ga0105239_12219715 | Ga0105239_122197152 | 116 |
| 248 | 3300011119 | Ga0105246_10454803 | Ga0105246_104548032 | 116 |
| 249 | 3300013104 | Ga0157370_11694642 | Ga0157370_116946422 | 116 |
| 250 | 3300013105 | Ga0157369_10029152 | Ga0157369_100291524 | 116 |
| 251 | 3300013296 | Ga0157374_10320429 | Ga0157374_103204292 | 116 |
| 252 | 3300013296 | Ga0157374_10766630 | Ga0157374_107666302 | 116 |
| 253 | 3300013308 | Ga0157375_11332632 | Ga0157375_113326321 | 116 |
| 254 | 3300014325 | Ga0163163_10454052 | Ga0163163_104540522 | 116 |
| 255 | 3300014325 | Ga0163163_10470242 | Ga0163163_104702423 | 116 |
| 256 | 3300014325 | Ga0163163_12292274 | Ga0163163_122922742 | 116 |
| 257 | 3300014497 | Ga0182008_10113850 | Ga0182008_101138503 | 116 |
| 258 | 3300020069 | Ga0197907_10058942 | Ga0197907_100589421 | 116 |
| 259 | 3300020070 | Ga0206356_11296514 | Ga0206356_112965142 | 116 |
| 260 | 3300020070 | Ga0206356_11504143 | Ga0206356_115041432 | 116 |
| 261 | 3300020075 | Ga0206349_1124037 | Ga0206349_11240371 | 116 |
| 262 | 3300020076 | Ga0206355_1348711 | Ga0206355_13487111 | 116 |
| 263 | 3300020077 | Ga0206351_10492450 | Ga0206351_104924502 | 116 |
| 264 | 3300020078 | Ga0206352_11266876 | Ga0206352_112668762 | 116 |
| 265 | 3300020080 | Ga0206350_10872178 | Ga0206350_108721782 | 116 |
| 266 | 3300020081 | Ga0206354_10464058 | Ga0206354_104640581 | 116 |
| 267 | 3300020082 | Ga0206353_11387986 | Ga0206353_113879861 | 116 |
| 268 | 3300020610 | Ga0154015_1147209 | Ga0154015_11472092 | 116 |
| 269 | 3300025321 | Ga0207656_10074112 | Ga0207656_100741122 | 116 |
| 270 | 3300025907 | Ga0207645_10159340 | Ga0207645_101593402 | 116 |
| 271 | 3300025909 | Ga0207705_10262017 | Ga0207705_102620172 | 116 |
| 272 | 3300025909 | Ga0207705_10295202 | Ga0207705_102952023 | 116 |
| 273 | 3300025909 | Ga0207705_10437210 | Ga0207705_104372102 | 116 |
| 274 | 3300025911 | Ga0207654_10162003 | Ga0207654_101620032 | 116 |
| 275 | 3300025912 | Ga0207707_11035266 | Ga0207707_110352661 | 116 |
| 276 | 3300025913 | Ga0207695_10255677 | Ga0207695_102556773 | 116 |
| 277 | 3300025913 | Ga0207695_10766330 | Ga0207695_107663302 | 116 |
| 278 | 3300025913 | Ga0207695_11577470 | Ga0207695_115774701 | 116 |
| 279 | 3300025914 | Ga0207671_10177492 | Ga0207671_101774922 | 116 |
| 280 | 3300025919 | Ga0207657_10012082 | Ga0207657_100120825 | 116 |
| 281 | 3300025919 | Ga0207657_10097737 | Ga0207657_100977373 | 116 |
| 282 | 3300025920 | Ga0207649_10000527 | Ga0207649_1000052720 | 116 |
| 283 | 3300025920 | Ga0207649_10623496 | Ga0207649_106234961 | 116 |
| 284 | 3300025921 | Ga0207652_11812646 | Ga0207652_118126461 | 116 |
| 285 | 3300025924 | Ga0207694_10112207 | Ga0207694_101122073 | 116 |
| 286 | 3300025924 | Ga0207694_10274456 | Ga0207694_102744563 | 116 |
| 287 | 3300025924 | Ga0207694_10467447 | Ga0207694_104674472 | 116 |
| 288 | 3300025932 | Ga0207690_10424572 | Ga0207690_104245722 | 116 |
| 289 | 3300025932 | Ga0207690_10941690 | Ga0207690_109416902 | 116 |
| 290 | 3300025933 | Ga0207706_10075551 | Ga0207706_100755513 | 116 |
| 291 | 3300025944 | Ga0207661_10572424 | Ga0207661_105724242 | 116 |
| 292 | 3300025944 | Ga0207661_10917667 | Ga0207661_109176672 | 116 |
| 293 | 3300025949 | Ga0207667_10082927 | Ga0207667_100829274 | 116 |
| 294 | 3300025949 | Ga0207667_10093804 | Ga0207667_100938043 | 116 |
| 295 | 3300025949 | Ga0207667_10279455 | Ga0207667_102794553 | 116 |
| 296 | 3300025949 | Ga0207667_10646516 | Ga0207667_106465163 | 116 |
| 297 | 3300025960 | Ga0207651_10765515 | Ga0207651_107655152 | 116 |
| 298 | 3300025981 | Ga0207640_10014606 | Ga0207640_100146062 | 116 |
| 299 | 3300025981 | Ga0207640_10049846 | Ga0207640_100498462 | 116 |
| 300 | 3300026041 | Ga0207639_10011930 | Ga0207639_100119304 | 116 |
| 301 | 3300026041 | Ga0207639_10258747 | Ga0207639_102587473 | 116 |
| 302 | 3300026041 | Ga0207639_10465282 | Ga0207639_104652822 | 116 |
| 303 | 3300026067 | Ga0207678_10068601 | Ga0207678_100686012 | 116 |
| 304 | 3300026078 | Ga0207702_10043009 | Ga0207702_100430093 | 116 |
| 305 | 3300026078 | Ga0207702_10250781 | Ga0207702_102507812 | 116 |
| 306 | 3300026078 | Ga0207702_10513496 | Ga0207702_105134962 | 116 |
| 307 | 3300026078 | Ga0207702_10618732 | Ga0207702_106187322 | 116 |
| 308 | 3300026116 | Ga0207674_10057472 | Ga0207674_100574723 | 116 |
| 309 | 3300026121 | Ga0207683_10157290 | Ga0207683_101572903 | 116 |
| 310 | 3300026121 | Ga0207683_10558484 | Ga0207683_105584842 | 116 |
| 311 | 3300026142 | Ga0207698_10026340 | Ga0207698_100263404 | 116 |
| 312 | 3300026142 | Ga0207698_10083603 | Ga0207698_100836032 | 116 |
| 313 | 3300026142 | Ga0207698_10220880 | Ga0207698_102208802 | 116 |
| 314 | 3300026142 | Ga0207698_10834375 | Ga0207698_108343751 | 116 |
| 315 | 3300028379 | Ga0268266_10945253 | Ga0268266_109452531 | 116 |
| 316 | 3300031995 | Ga0307409_101070701 | Ga0307409_1010707012 | 116 |
| 317 | 3300032004 | Ga0307414_10420079 | Ga0307414_104200792 | 116 |
| 318 | 3300034817 | Ga0373948_0086323 | Ga0373948_0086323_65_451 | 116 |
| 319 | 3300035691 | Ga0373931_0096749 | Ga0373931_0096749_418_804 | 116 |
| 320 | 3300037418 | Ga0395900_0425217 | Ga0395900_0425217_749_1132 | 116 |
| 321 | 3300041453 | Ga0451797_1338990 | Ga0451797_1338990_79_456 | 116 |
| 322 | 3300045976 | Ga0466967_0213153 | Ga0466967_0213153_1184_1567 | 116 |
| 323 | 3300048911 | Ga0496108_0521214 | Ga0496108_0521214_123_509 | 116 |
| 324 | 3300048927 | Ga0496124_0416722 | Ga0496124_0416722_204_590 | 116 |
| 325 | 3300049568 | Ga0501031_0174412 | Ga0501031_0174412_590_973 | 116 |
| 326 | 3300049568 | Ga0501031_0360149 | Ga0501031_0360149_236_622 | 116 |
| 327 | 3300049569 | Ga0501032_0552039 | Ga0501032_0552039_192_578 | 116 |
| 328 | 3300049569 | Ga0501032_0626170 | Ga0501032_0626170_48_431 | 116 |
| 329 | 3300049570 | Ga0501033_0078836 | Ga0501033_0078836_641_1027 | 116 |
| 330 | 3300049571 | Ga0501034_0105656 | Ga0501034_0105656_1841_2230 | 116 |
| 331 | 3300049571 | Ga0501034_0399848 | Ga0501034_0399848_806_1192 | 116 |
| 332 | 3300049571 | Ga0501034_0639279 | Ga0501034_0639279_309_692 | 116 |
| 333 | 3300049571 | Ga0501034_0663761 | Ga0501034_0663761_503_886 | 116 |
| 334 | 3300049572 | Ga0501036_0014336 | Ga0501036_0014336_1520_1906 | 116 |
| 335 | 3300049573 | Ga0501037_0016941 | Ga0501037_0016941_4692_5078 | 116 |
| 336 | 3300049574 | Ga0501038_0092330 | Ga0501038_0092330_1604_1987 | 116 |
| 337 | 3300049574 | Ga0501038_0140103 | Ga0501038_0140103_876_1262 | 116 |
| 338 | 3300049579 | Ga0501043_0151366 | Ga0501043_0151366_149_532 | 116 |
| 339 | 3300049581 | Ga0501047_0592684 | Ga0501047_0592684_39_425 | 116 |
| 340 | 3300049586 | Ga0501070_0102572 | Ga0501070_0102572_43_426 | 116 |
| 341 | 3300049586 | Ga0501070_0178841 | Ga0501070_0178841_405_791 | 116 |
| 342 | 3300049589 | Ga0501073_0320939 | Ga0501073_0320939_640_1026 | 116 |
| 343 | 3300049742 | Ga0501080_0339269 | Ga0501080_0339269_291_677 | 116 |
| 344 | 3300049742 | Ga0501080_0716149 | Ga0501080_0716149_105_488 | 116 |
| 345 | 3300049743 | Ga0501081_1176308 | Ga0501081_1176308_140_496 | 116 |
| 346 | 3300049822 | Ga0501035_0005658 | Ga0501035_0005658_7903_8286 | 116 |
| 347 | 3300049823 | Ga0501044_0010058 | Ga0501044_0010058_9466_9849 | 116 |
| 348 | 3300049823 | Ga0501044_0181606 | Ga0501044_0181606_164_550 | 116 |
| 349 | 3300049823 | Ga0501044_0424206 | Ga0501044_0424206_228_608 | 116 |
| 350 | 3300050489 | nmdc:mga03683_638409_c1 | nmdc:mga03683_638409_c1_17_403 | 116 |
| 351 | 3300050494 | nmdc:mga06z11_336129_c1 | nmdc:mga06z11_336129_c1_391_777 | 116 |
| 352 | 3300053158 | Ga0500627_0309980 | Ga0500627_0309980_72_458 | 116 |
| 353 | 3300053730 | Ga0500645_006402 | Ga0500645_006402_2178_2573 | 116 |
| 354 | 3300054114 | Ga0501084_0303056 | Ga0501084_0303056_882_1265 | 116 |
| 355 | 3300059493 | Ga0587077_024025 | Ga0587077_024025_681_1067 | 116 |
| 356 | 3300059503 | Ga0587080_109882 | Ga0587080_109882_24_407 | 116 |
| 357 | 3300059642 | Ga0587069_158590 | Ga0587069_158590_109_492 | 116 |
| 358 | 3300059652 | Ga0587107_138814 | Ga0587107_138814_92_478 | 116 |
| 359 | 3300005458 | Ga0070681_10503913 | Ga0070681_105039131 | 117 |
| 360 | 3300005530 | Ga0070679_100041910 | Ga0070679_1000419102 | 117 |
| 361 | 3300025921 | Ga0207652_10020496 | Ga0207652_100204963 | 117 |
| 362 | 3300028379 | Ga0268266_10444684 | Ga0268266_104446842 | 117 |
| 363 | 3300041410 | Ga0439461_0119236 | Ga0439461_0119236_155_562 | 117 |
| 364 | 3300053102 | Ga0500554_000951 | Ga0500554_000951_1981_2400 | 117 |
| 365 | 3300005327 | Ga0070658_10009132 | Ga0070658_100091323 | 118 |
| 366 | 3300005339 | Ga0070660_100034638 | Ga0070660_1000346384 | 118 |
| 367 | 3300005578 | Ga0068854_102010667 | Ga0068854_1020106672 | 118 |
| 368 | 3300006353 | Ga0075370_10112636 | Ga0075370_101126364 | 118 |
| 369 | 3300009551 | Ga0105238_10843008 | Ga0105238_108430081 | 118 |
| 370 | 3300013105 | Ga0157369_10405210 | Ga0157369_104052102 | 118 |
| 371 | 3300025304 | Ga0209257_1001481 | Ga0209257_100148117 | 118 |
| 372 | 3300030521 | Ga0307511_10071077 | Ga0307511_100710774 | 118 |
| 373 | 3300035112 | Ga0373932_0074617 | Ga0373932_0074617_246_605 | 118 |
| 374 | 3300035691 | Ga0373931_0256077 | Ga0373931_0256077_469_828 | 118 |
| 375 | 3300037312 | Ga0395899_0117329 | Ga0395899_0117329_824_1225 | 118 |
| 376 | 3300037418 | Ga0395900_0194693 | Ga0395900_0194693_125_526 | 118 |
| 377 | 3300038443 | Ga0395901_0684846 | Ga0395901_0684846_281_682 | 118 |
| 378 | 3300049569 | Ga0501032_0150796 | Ga0501032_0150796_385_780 | 118 |
| 379 | 3300049570 | Ga0501033_0549214 | Ga0501033_0549214_276_671 | 118 |
| 380 | 3300049572 | Ga0501036_1566121 | Ga0501036_1566121_155_514 | 118 |
| 381 | 3300049573 | Ga0501037_0032652 | Ga0501037_0032652_250_609 | 118 |
| 382 | 3300049574 | Ga0501038_0030626 | Ga0501038_0030626_1581_1940 | 118 |
| 383 | 3300049574 | Ga0501038_1163201 | Ga0501038_1163201_59_418 | 118 |
| 384 | 3300049575 | Ga0501039_0495372 | Ga0501039_0495372_379_738 | 118 |
| 385 | 3300049579 | Ga0501043_0021252 | Ga0501043_0021252_1405_1764 | 118 |
| 386 | 3300049580 | Ga0501046_0321322 | Ga0501046_0321322_623_982 | 118 |
| 387 | 3300049581 | Ga0501047_0188058 | Ga0501047_0188058_1207_1602 | 118 |
| 388 | 3300049581 | Ga0501047_0269902 | Ga0501047_0269902_1036_1431 | 118 |
| 389 | 3300049581 | Ga0501047_0407991 | Ga0501047_0407991_409_768 | 118 |
| 390 | 3300049582 | Ga0501048_0158776 | Ga0501048_0158776_1112_1471 | 118 |
| 391 | 3300049582 | Ga0501048_0582161 | Ga0501048_0582161_131_490 | 118 |
| 392 | 3300049583 | Ga0501067_0074271 | Ga0501067_0074271_328_687 | 118 |
| 393 | 3300049586 | Ga0501070_0601258 | Ga0501070_0601258_369_728 | 118 |
| 394 | 3300049589 | Ga0501073_0062276 | Ga0501073_0062276_1452_1811 | 118 |
| 395 | 3300049589 | Ga0501073_0542413 | Ga0501073_0542413_329_688 | 118 |
| 396 | 3300049590 | Ga0501074_0150663 | Ga0501074_0150663_339_698 | 118 |
| 397 | 3300049742 | Ga0501080_0021953 | Ga0501080_0021953_1384_1743 | 118 |
| 398 | 3300049744 | Ga0501083_0002308 | Ga0501083_0002308_9722_10081 | 118 |
| 399 | 3300049744 | Ga0501083_0678165 | Ga0501083_0678165_118_477 | 118 |
| 400 | 3300049822 | Ga0501035_0310512 | Ga0501035_0310512_211_570 | 118 |
| 401 | 3300049822 | Ga0501035_0900908 | Ga0501035_0900908_54_449 | 118 |
| 402 | 3300049823 | Ga0501044_0094473 | Ga0501044_0094473_517_876 | 118 |
| 403 | 3300049823 | Ga0501044_0837244 | Ga0501044_0837244_101_496 | 118 |
| 404 | 3300053118 | Ga0500594_0056821 | Ga0500594_0056821_525_887 | 118 |
| 405 | 3300053119 | Ga0500595_011491 | Ga0500595_011491_2940_3338 | 118 |
| 406 | 3300053146 | Ga0500588_0247233 | Ga0500588_0247233_170_532 | 118 |
| 407 | 3300005444 | Ga0070694_100284839 | Ga0070694_1002848391 | 119 |
| 408 | 3300005466 | Ga0070685_10190985 | Ga0070685_101909852 | 119 |
| 409 | 3300005545 | Ga0070695_100703847 | Ga0070695_1007038472 | 119 |
| 410 | 3300005547 | Ga0070693_100972213 | Ga0070693_1009722132 | 119 |
| 411 | 3300005549 | Ga0070704_100206559 | Ga0070704_1002065593 | 119 |
| 412 | 3300005617 | Ga0068859_100120881 | Ga0068859_1001208814 | 119 |
| 413 | 3300005617 | Ga0068859_100752223 | Ga0068859_1007522233 | 119 |
| 414 | 3300005618 | Ga0068864_100427496 | Ga0068864_1004274962 | 119 |
| 415 | 3300005842 | Ga0068858_100825971 | Ga0068858_1008259712 | 119 |
| 416 | 3300005843 | Ga0068860_100037022 | Ga0068860_1000370223 | 119 |
| 417 | 3300005937 | Ga0081455_10312237 | Ga0081455_103122372 | 119 |
| 418 | 3300006931 | Ga0097620_100120883 | Ga0097620_1001208832 | 119 |
| 419 | 3300006931 | Ga0097620_100752240 | Ga0097620_1007522401 | 119 |
| 420 | 3300009176 | Ga0105242_10304418 | Ga0105242_103044182 | 119 |
| 421 | 3300009177 | Ga0105248_10543939 | Ga0105248_105439392 | 119 |
| 422 | 3300013306 | Ga0163162_10962799 | Ga0163162_109627993 | 119 |
| 423 | 3300014968 | Ga0157379_10580490 | Ga0157379_105804901 | 119 |
| 424 | 3300025934 | Ga0207686_10026441 | Ga0207686_100264413 | 119 |
| 425 | 3300025935 | Ga0207709_10642613 | Ga0207709_106426132 | 119 |
| 426 | 3300026035 | Ga0207703_10646146 | Ga0207703_106461462 | 119 |
| 427 | 3300026067 | Ga0207678_11113957 | Ga0207678_111139572 | 119 |
| 428 | 3300026089 | Ga0207648_10763797 | Ga0207648_107637972 | 119 |
| 429 | 3300026095 | Ga0207676_10399343 | Ga0207676_103993433 | 119 |
| 430 | 3300028381 | Ga0268264_10091721 | Ga0268264_100917213 | 119 |
| 431 | 3300028381 | Ga0268264_10936607 | Ga0268264_109366072 | 119 |
| 432 | 3300031824 | Ga0307413_10693012 | Ga0307413_106930122 | 119 |
| 433 | 3300031852 | Ga0307410_10611627 | Ga0307410_106116273 | 119 |
| 434 | 3300031903 | Ga0307407_10735309 | Ga0307407_107353092 | 119 |
| 435 | 3300046616 | Ga0495668_0185119 | Ga0495668_0185119_187_546 | 119 |
| 436 | 3300047320 | Ga0495672_0007251 | Ga0495672_0007251_6378_6740 | 119 |
| 437 | 3300047320 | Ga0495672_0018839 | Ga0495672_0018839_645_1007 | 119 |
| 438 | 3300047472 | Ga0495686_0219991 | Ga0495686_0219991_77_472 | 119 |
| 439 | 3300049571 | Ga0501034_0039981 | Ga0501034_0039981_3154_3516 | 119 |
| 440 | 3300049571 | Ga0501034_0208617 | Ga0501034_0208617_1235_1597 | 119 |
| 441 | 3300049581 | Ga0501047_0000223 | Ga0501047_0000223_29835_30197 | 119 |
| 442 | 3300049583 | Ga0501067_0789561 | Ga0501067_0789561_85_447 | 119 |
| 443 | 3300049589 | Ga0501073_0881951 | Ga0501073_0881951_138_500 | 119 |
| 444 | 3300049742 | Ga0501080_0354537 | Ga0501080_0354537_356_718 | 119 |
| 445 | 3300049744 | Ga0501083_0031649 | Ga0501083_0031649_250_612 | 119 |
| 446 | 3300050509 | nmdc:mga0qj67_405942_c1 | nmdc:mga0qj67_405942_c1_190_552 | 119 |
| 447 | 3300060353 | Ga0501082_0019195 | Ga0501082_0019195_2709_3071 | 119 |
| 448 | 3300060353 | Ga0501082_0392628 | Ga0501082_0392628_665_1027 | 119 |
| 449 | 3300005844 | Ga0068862_100506044 | Ga0068862_1005060443 | 120 |
| 450 | 3300028380 | Ga0268265_10433755 | Ga0268265_104337553 | 120 |
| 451 | 3300046452 | Ga0495617_089409 | Ga0495617_089409_407_778 | 120 |
| 452 | 3300046694 | Ga0495649_0647100 | Ga0495649_0647100_30_395 | 120 |
| 453 | 3300009094 | Ga0111539_12908340 | Ga0111539_129083401 | 121 |
| 454 | 3300037312 | Ga0395899_0768125 | Ga0395899_0768125_189_584 | 121 |
| 455 | 3300037418 | Ga0395900_0392615 | Ga0395900_0392615_734_1129 | 121 |
| 456 | 3300037471 | Ga0395905_0568134 | Ga0395905_0568134_237_632 | 121 |
| 457 | 3300038443 | Ga0395901_0234392 | Ga0395901_0234392_1465_1860 | 121 |
| 458 | iso_pu_bacteria | 2582581279 | 2585148691 | 121 |
| 459 | 3300025942 | Ga0207689_10408706 | Ga0207689_104087062 | 122 |
| 460 | 3300039447 | Ga0436361_0320334 | Ga0436361_0320334_800_1189 | 122 |
| 461 | 3300053139 | Ga0500568_0193994 | Ga0500568_0193994_42_437 | 122 |
| 462 | 3300009093 | Ga0105240_10799647 | Ga0105240_107996471 | 123 |
| 463 | 3300021441 | Ga0213871_10009389 | Ga0213871_100093892 | 123 |
| 464 | 3300025913 | Ga0207695_11402538 | Ga0207695_114025381 | 123 |
| 465 | 3300031251 | Ga0265327_10001033 | Ga0265327_1000103337 | 123 |
| 466 | 3300031711 | Ga0265314_10133553 | Ga0265314_101335532 | 123 |
| 467 | 3300038742 | Ga0400486_14046 | Ga0400486_14046_692_1078 | 123 |
| 468 | 3300039438 | Ga0436360_1144667 | Ga0436360_1144667_2283_2666 | 123 |
| 469 | 3300005535 | Ga0070684_100158021 | Ga0070684_1001580212 | 124 |
| 470 | 3300005539 | Ga0068853_100278472 | Ga0068853_1002784722 | 124 |
| 471 | 3300021361 | Ga0213872_10009986 | Ga0213872_100099866 | 124 |
| 472 | 3300026041 | Ga0207639_10041375 | Ga0207639_100413753 | 124 |
| 473 | 3300028800 | Ga0265338_10151121 | Ga0265338_101511212 | 124 |
| 474 | 3300031456 | Ga0307513_10000261 | Ga0307513_1000026152 | 124 |
| 475 | 3300037418 | Ga0395900_0759534 | Ga0395900_0759534_155_541 | 124 |
| 476 | 3300039447 | Ga0436361_0100937 | Ga0436361_0100937_4084_4476 | 124 |
| 477 | 3300039447 | Ga0436361_0125926 | Ga0436361_0125926_102_494 | 124 |
| 478 | 3300039447 | Ga0436361_0798110 | Ga0436361_0798110_430_822 | 124 |
| 479 | 3300039447 | Ga0436361_1197628 | Ga0436361_1197628_57_449 | 124 |
| 480 | 3300046539 | Ga0495621_0092031 | Ga0495621_0092031_426_812 | 124 |
| 481 | 3300053104 | Ga0500556_0002733 | Ga0500556_0002733_95_481 | 124 |
| 482 | 3300053177 | Ga0500636_0030803 | Ga0500636_0030803_452_850 | 124 |
| 483 | 3300053730 | Ga0500645_001063 | Ga0500645_001063_4807_5193 | 124 |
| 484 | 3300053730 | Ga0500645_160663 | Ga0500645_160663_215_601 | 124 |
| 485 | 3300005331 | Ga0070670_100434510 | Ga0070670_1004345103 | 125 |
| 486 | 3300005548 | Ga0070665_102076908 | Ga0070665_1020769081 | 125 |
| 487 | 3300005578 | Ga0068854_100644567 | Ga0068854_1006445672 | 125 |
| 488 | 3300009551 | Ga0105238_11020589 | Ga0105238_110205892 | 125 |
| 489 | 3300009551 | Ga0105238_11185607 | Ga0105238_111856071 | 125 |
| 490 | 3300013105 | Ga0157369_12574549 | Ga0157369_125745492 | 125 |
| 491 | 3300013296 | Ga0157374_10312398 | Ga0157374_103123981 | 125 |
| 492 | 3300013297 | Ga0157378_12882229 | Ga0157378_128822291 | 125 |
| 493 | 3300013306 | Ga0163162_13271065 | Ga0163162_132710651 | 125 |
| 494 | 3300025924 | Ga0207694_10645076 | Ga0207694_106450762 | 125 |
| 495 | 3300025924 | Ga0207694_10900726 | Ga0207694_109007262 | 125 |
| 496 | 3300026078 | Ga0207702_10404588 | Ga0207702_104045881 | 125 |
| 497 | 3300028379 | Ga0268266_11960414 | Ga0268266_119604142 | 125 |
| 498 | 3300028794 | Ga0307515_10025521 | Ga0307515_100255212 | 125 |
| 499 | 3300028800 | Ga0265338_10019208 | Ga0265338_100192083 | 125 |
| 500 | 3300028800 | Ga0265338_10747010 | Ga0265338_107470101 | 125 |
| 501 | 3300036401 | Ga0373937_1504134 | Ga0373937_1504134_117_503 | 125 |
| 502 | 3300037418 | Ga0395900_0221214 | Ga0395900_0221214_188_580 | 125 |
| 503 | 3300037466 | Ga0395898_0481906 | Ga0395898_0481906_645_1037 | 125 |
| 504 | 3300037471 | Ga0395905_0015746 | Ga0395905_0015746_103_495 | 125 |
| 505 | 3300038443 | Ga0395901_0143673 | Ga0395901_0143673_967_1359 | 125 |
| 506 | 3300044684 | Ga0466966_0288732 | Ga0466966_0288732_503_904 | 125 |
| 507 | 3300045049 | Ga0466959_0035106 | Ga0466959_0035106_887_1288 | 125 |
| 508 | 3300046457 | Ga0495590_0000637 | Ga0495590_0000637_15088_15480 | 125 |
| 509 | 3300046616 | Ga0495668_0026263 | Ga0495668_0026263_837_1229 | 125 |
| 510 | 3300046689 | Ga0495613_0000435 | Ga0495613_0000435_4689_5084 | 125 |
| 511 | 3300047472 | Ga0495686_0003268 | Ga0495686_0003268_9748_10140 | 125 |
| 512 | 3300048910 | Ga0496107_0178604 | Ga0496107_0178604_320_712 | 125 |
| 513 | 3300053087 | Ga0500643_005170 | Ga0500643_005170_27_419 | 125 |
| 514 | 3300053088 | Ga0500644_0021802 | Ga0500644_0021802_344_736 | 125 |
| 515 | 3300053108 | Ga0500562_000990 | Ga0500562_000990_699_1091 | 125 |
| 516 | 3300053119 | Ga0500595_005390 | Ga0500595_005390_1235_1627 | 125 |
| 517 | 3300053136 | Ga0500559_0206161 | Ga0500559_0206161_389_787 | 125 |
| 518 | 3300053156 | Ga0500622_0001197 | Ga0500622_0001197_11563_11955 | 125 |
| 519 | 3300005347 | Ga0070668_100006163 | Ga0070668_1000061638 | 126 |
| 520 | 3300005347 | Ga0070668_100025816 | Ga0070668_1000258163 | 126 |
| 521 | 3300005355 | Ga0070671_100107910 | Ga0070671_1001079103 | 126 |
| 522 | 3300005367 | Ga0070667_100415394 | Ga0070667_1004153942 | 126 |
| 523 | 3300005367 | Ga0070667_100564393 | Ga0070667_1005643933 | 126 |
| 524 | 3300005617 | Ga0068859_100019102 | Ga0068859_1000191023 | 126 |
| 525 | 3300005617 | Ga0068859_100403489 | Ga0068859_1004034892 | 126 |
| 526 | 3300005719 | Ga0068861_100166684 | Ga0068861_1001666843 | 126 |
| 527 | 3300005841 | Ga0068863_100063458 | Ga0068863_1000634583 | 126 |
| 528 | 3300005842 | Ga0068858_100101300 | Ga0068858_1001013004 | 126 |
| 529 | 3300005843 | Ga0068860_100000260 | Ga0068860_10000026073 | 126 |
| 530 | 3300005843 | Ga0068860_100096991 | Ga0068860_1000969912 | 126 |
| 531 | 3300005843 | Ga0068860_100841702 | Ga0068860_1008417022 | 126 |
| 532 | 3300005844 | Ga0068862_100016822 | Ga0068862_1000168226 | 126 |
| 533 | 3300005844 | Ga0068862_100051275 | Ga0068862_1000512753 | 126 |
| 534 | 3300005844 | Ga0068862_100260309 | Ga0068862_1002603092 | 126 |
| 535 | 3300006931 | Ga0097620_100019103 | Ga0097620_1000191033 | 126 |
| 536 | 3300006931 | Ga0097620_100403516 | Ga0097620_1004035162 | 126 |
| 537 | 3300009553 | Ga0105249_10464385 | Ga0105249_104643852 | 126 |
| 538 | 3300013307 | Ga0157372_10929886 | Ga0157372_109298862 | 126 |
| 539 | 3300025961 | Ga0207712_10305947 | Ga0207712_103059472 | 126 |
| 540 | 3300025972 | Ga0207668_10014536 | Ga0207668_100145365 | 126 |
| 541 | 3300025972 | Ga0207668_10027478 | Ga0207668_100274785 | 126 |
| 542 | 3300025972 | Ga0207668_10055694 | Ga0207668_100556942 | 126 |
| 543 | 3300025986 | Ga0207658_10346156 | Ga0207658_103461562 | 126 |
| 544 | 3300025986 | Ga0207658_10428023 | Ga0207658_104280233 | 126 |
| 545 | 3300025986 | Ga0207658_10854422 | Ga0207658_108544222 | 126 |
| 546 | 3300026035 | Ga0207703_10921093 | Ga0207703_109210932 | 126 |
| 547 | 3300026088 | Ga0207641_10029964 | Ga0207641_100299645 | 126 |
| 548 | 3300026095 | Ga0207676_10380290 | Ga0207676_103802901 | 126 |
| 549 | 3300026118 | Ga0207675_100179033 | Ga0207675_1001790332 | 126 |
| 550 | 3300028380 | Ga0268265_10002571 | Ga0268265_100025716 | 126 |
| 551 | 3300028380 | Ga0268265_10064180 | Ga0268265_100641803 | 126 |
| 552 | 3300028380 | Ga0268265_10287805 | Ga0268265_102878052 | 126 |
| 553 | 3300028381 | Ga0268264_10000169 | Ga0268264_1000016912 | 126 |
| 554 | 3300028381 | Ga0268264_10077769 | Ga0268264_100777694 | 126 |
| 555 | 3300028794 | Ga0307515_10646645 | Ga0307515_106466452 | 126 |
| 556 | 3300031730 | Ga0307516_10000004 | Ga0307516_10000004107 | 126 |
| 557 | 3300041443 | Ga0451789_0794106 | Ga0451789_0794106_168_557 | 126 |
| 558 | 3300053153 | Ga0500616_0078177 | Ga0500616_0078177_540_947 | 126 |
| 559 | 3300053730 | Ga0500645_162920 | Ga0500645_162920_116_514 | 126 |
| 560 | iso_pu_bacteria | 2582581280 | 2585153871 | 126 |
| 561 | iso_pu_bacteria | 2582581293 | 2585198083 | 126 |
| 562 | iso_pu_bacteria | 2585428106 | 2587916640 | 126 |
| 563 | iso_pu_bacteria | 2643221545 | 2643747807 | 126 |
| 564 | iso_pu_bacteria | 2643221583 | 2643924932 | 126 |
| 565 | iso_pu_bacteria | 2643221614 | 2644084900 | 126 |
| 566 | iso_pu_bacteria | 2643221640 | 2644225829 | 126 |
| 567 | iso_pu_bacteria | 2643221642 | 2644235318 | 126 |
| 568 | iso_pu_bacteria | 2643221661 | 2644342452 | 126 |
| 569 | iso_pu_bacteria | 2643221666 | 2644365752 | 126 |
| 570 | iso_pu_bacteria | 2643221691 | 2644511421 | 126 |
| 571 | iso_pu_bacteria | 2791355048 | 2792459551 | 126 |
| 572 | iso_pu_bacteria | 2818991435 | 2819537946 | 126 |
| 573 | iso_pu_bacteria | 2818991454 | 2819648493 | 126 |
| 574 | iso_pu_bacteria | 2843744320 | 2843747940 | 126 |
| 575 | iso_pu_bacteria | 2849560528 | 2849564902 | 126 |
| 576 | iso_pu_bacteria | 2849573788 | 2849574755 | 126 |
| 577 | iso_pu_bacteria | 2851153111 | 2851153143 | 126 |
| 578 | iso_pu_bacteria | 2857504554 | 2857506281 | 126 |
| 579 | iso_pu_bacteria | 2884960567 | 2884965032 | 126 |
| 580 | iso_pu_bacteria | 2898329390 | 2898329963 | 126 |
| 581 | iso_pu_bacteria | 2928531327 | 2928535305 | 126 |
| 582 | 3300009093 | Ga0105240_10005608 | Ga0105240_100056082 | 127 |
| 583 | 3300009174 | Ga0105241_10581337 | Ga0105241_105813372 | 127 |
| 584 | 3300009551 | Ga0105238_10495598 | Ga0105238_104955983 | 127 |
| 585 | 3300025913 | Ga0207695_10211921 | Ga0207695_102119213 | 127 |
| 586 | 3300041486 | Ga0451807_1668656 | Ga0451807_1668656_215_604 | 127 |
| 587 | 3300044694 | Ga0466963_0802691 | Ga0466963_0802691_243_629 | 127 |
| 588 | 3300046511 | Ga0495608_0560673 | Ga0495608_0560673_81_467 | 127 |
| 589 | 3300053078 | Ga0495612_0100537 | Ga0495612_0100537_823_1209 | 127 |
| 590 | 3300003791 | Ga0055530_10003549 | Ga0055530_1000354910 | 128 |
| 591 | 3300003794 | Ga0055531_10001331 | Ga0055531_1000133115 | 128 |
| 592 | 3300004625 | Ga0055543_1042023 | Ga0055543_10420232 | 128 |
| 593 | 3300005262 | Ga0065165_1000532 | Ga0065165_100053243 | 128 |
| 594 | 3300005347 | Ga0070668_100482370 | Ga0070668_1004823702 | 128 |
| 595 | 3300005445 | Ga0070708_100664087 | Ga0070708_1006640872 | 128 |
| 596 | 3300005618 | Ga0068864_101840214 | Ga0068864_1018402141 | 128 |
| 597 | 3300006881 | Ga0068865_100001399 | Ga0068865_10000139910 | 128 |
| 598 | 3300006946 | Ga0079104_1036659 | Ga0079104_10366592 | 128 |
| 599 | 3300009177 | Ga0105248_10421508 | Ga0105248_104215082 | 128 |
| 600 | 3300014969 | Ga0157376_10303706 | Ga0157376_103037062 | 128 |
| 601 | 3300021441 | Ga0213871_10049334 | Ga0213871_100493342 | 128 |
| 602 | 3300025250 | Ga0209026_1001440 | Ga0209026_10014403 | 128 |
| 603 | 3300025297 | Ga0209758_1000696 | Ga0209758_100069616 | 128 |
| 604 | 3300025298 | Ga0209050_1000141 | Ga0209050_100014136 | 128 |
| 605 | 3300025304 | Ga0209257_1000636 | Ga0209257_100063625 | 128 |
| 606 | 3300025914 | Ga0207671_10633742 | Ga0207671_106337422 | 128 |
| 607 | 3300025938 | Ga0207704_10005421 | Ga0207704_100054213 | 128 |
| 608 | 3300025949 | Ga0207667_11057329 | Ga0207667_110573292 | 128 |
| 609 | 3300026023 | Ga0207677_10507817 | Ga0207677_105078172 | 128 |
| 610 | 3300035086 | Ga0373934_0255967 | Ga0373934_0255967_93_491 | 128 |
| 611 | 3300035089 | Ga0373944_0074975 | Ga0373944_0074975_17_415 | 128 |
| 612 | 3300035170 | Ga0373943_0725635 | Ga0373943_0725635_92_490 | 128 |
| 613 | 3300035171 | Ga0373946_0003816 | Ga0373946_0003816_634_1032 | 128 |
| 614 | 3300035692 | Ga0373935_0497054 | Ga0373935_0497054_250_648 | 128 |
| 615 | 3300035695 | Ga0373927_0000323 | Ga0373927_0000323_3125_3523 | 128 |
| 616 | 3300037068 | Ga0373925_0000061 | Ga0373925_0000061_93272_93670 | 128 |
| 617 | 3300037471 | Ga0395905_0003612 | Ga0395905_0003612_13587_13979 | 128 |
| 618 | 3300038443 | Ga0395901_0078590 | Ga0395901_0078590_366_761 | 128 |
| 619 | 3300039438 | Ga0436360_0681050 | Ga0436360_0681050_78_479 | 128 |
| 620 | 3300044694 | Ga0466963_1120018 | Ga0466963_1120018_150_539 | 128 |
| 621 | 3300044735 | Ga0466968_0103806 | Ga0466968_0103806_148_543 | 128 |
| 622 | 3300046459 | Ga0495629_0361733 | Ga0495629_0361733_198_593 | 128 |
| 623 | 3300046462 | Ga0495651_0304974 | Ga0495651_0304974_360_755 | 128 |
| 624 | 3300046499 | Ga0495594_0206281 | Ga0495594_0206281_37_432 | 128 |
| 625 | 3300046528 | Ga0495642_0064831 | Ga0495642_0064831_835_1230 | 128 |
| 626 | 3300046616 | Ga0495668_0042149 | Ga0495668_0042149_288_683 | 128 |
| 627 | 3300046684 | Ga0495669_0019698 | Ga0495669_0019698_678_1073 | 128 |
| 628 | 3300046694 | Ga0495649_0514005 | Ga0495649_0514005_31_429 | 128 |
| 629 | 3300047318 | Ga0495636_0052056 | Ga0495636_0052056_416_811 | 128 |
| 630 | 3300047445 | Ga0495677_0026683 | Ga0495677_0026683_1096_1491 | 128 |
| 631 | 3300047445 | Ga0495677_0028117 | Ga0495677_0028117_1384_1782 | 128 |
| 632 | 3300047445 | Ga0495677_0287973 | Ga0495677_0287973_187_573 | 128 |
| 633 | 3300049586 | Ga0501070_0611868 | Ga0501070_0611868_71_466 | 128 |
| 634 | 3300053090 | Ga0500646_0037398 | Ga0500646_0037398_207_602 | 128 |
| 635 | 3300053093 | Ga0500651_0326731 | Ga0500651_0326731_77_469 | 128 |
| 636 | 3300053098 | Ga0500650_0257325 | Ga0500650_0257325_191_589 | 128 |
| 637 | 3300053103 | Ga0500555_016079 | Ga0500555_016079_1743_2138 | 128 |
| 638 | 3300053108 | Ga0500562_000772 | Ga0500562_000772_1927_2337 | 128 |
| 639 | 3300005334 | Ga0068869_100309997 | Ga0068869_1003099972 | 129 |
| 640 | 3300025942 | Ga0207689_10243971 | Ga0207689_102439712 | 129 |
| 641 | 3300028794 | Ga0307515_10191957 | Ga0307515_101919571 | 129 |
| 642 | 3300046460 | Ga0495638_0001003 | Ga0495638_0001003_26860_27264 | 129 |
| 643 | 3300046512 | Ga0495610_0001610 | Ga0495610_0001610_4159_4563 | 129 |
| 644 | 3300046524 | Ga0495648_0000154 | Ga0495648_0000154_26847_27251 | 129 |
| 645 | 3300046542 | Ga0495597_0015408 | Ga0495597_0015408_2841_3242 | 129 |
| 646 | 3300046616 | Ga0495668_0212471 | Ga0495668_0212471_542_943 | 129 |
| 647 | 3300047469 | Ga0495673_0000363 | Ga0495673_0000363_38970_39374 | 129 |
| 648 | 3300049459 | Ga0495678_000659 | Ga0495678_000659_26884_27288 | 129 |
| 649 | 3300050492 | nmdc:mga0yw44_836127_c1 | nmdc:mga0yw44_836127_c1_211_612 | 129 |
| 650 | 3300053086 | Ga0500578_0000092 | Ga0500578_0000092_25382_25786 | 129 |
| 651 | 3300053087 | Ga0500643_018434 | Ga0500643_018434_275_670 | 129 |
| 652 | 3300053088 | Ga0500644_0000121 | Ga0500644_0000121_20592_20996 | 129 |
| 653 | 3300053096 | Ga0500641_0007547 | Ga0500641_0007547_831_1226 | 129 |
| 654 | 3300053103 | Ga0500555_015527 | Ga0500555_015527_837_1241 | 129 |
| 655 | 3300053104 | Ga0500556_0218323 | Ga0500556_0218323_311_715 | 129 |
| 656 | 3300053118 | Ga0500594_0000192 | Ga0500594_0000192_6956_7360 | 129 |
| 657 | 3300053138 | Ga0500564_000085 | Ga0500564_000085_8351_8755 | 129 |
| 658 | 3300003215 | JGI25153J46596_10042779 | JGI25153J46596_100427793 | 130 |
| 659 | 3300003773 | Ga0055537_1006822 | Ga0055537_10068225 | 130 |
| 660 | 3300003775 | Ga0055524_1005226 | Ga0055524_10052262 | 130 |
| 661 | 3300003790 | Ga0055528_1008119 | Ga0055528_10081193 | 130 |
| 662 | 3300003791 | Ga0055530_10007123 | Ga0055530_100071234 | 130 |
| 663 | 3300003791 | Ga0055530_10007274 | Ga0055530_100072743 | 130 |
| 664 | 3300003794 | Ga0055531_10001678 | Ga0055531_1000167813 | 130 |
| 665 | 3300003794 | Ga0055531_10002494 | Ga0055531_100024944 | 130 |
| 666 | 3300006186 | Ga0075369_10012967 | Ga0075369_100129674 | 130 |
| 667 | 3300006195 | Ga0075366_10016093 | Ga0075366_100160935 | 130 |
| 668 | 3300006195 | Ga0075366_10032228 | Ga0075366_100322285 | 130 |
| 669 | 3300006353 | Ga0075370_10086622 | Ga0075370_100866223 | 130 |
| 670 | 3300006353 | Ga0075370_10341506 | Ga0075370_103415062 | 130 |
| 671 | 3300025263 | Ga0209565_1000475 | Ga0209565_10004755 | 130 |
| 672 | 3300025273 | Ga0209673_1002142 | Ga0209673_10021423 | 130 |
| 673 | 3300025291 | Ga0209675_1040462 | Ga0209675_10404623 | 130 |
| 674 | 3300025292 | Ga0209676_1000679 | Ga0209676_100067929 | 130 |
| 675 | 3300025292 | Ga0209676_1000835 | Ga0209676_100083522 | 130 |
| 676 | 3300025295 | Ga0209564_1030943 | Ga0209564_10309432 | 130 |
| 677 | 3300025297 | Ga0209758_1002742 | Ga0209758_100274215 | 130 |
| 678 | 3300025298 | Ga0209050_1000807 | Ga0209050_100080725 | 130 |
| 679 | 3300025298 | Ga0209050_1001452 | Ga0209050_10014528 | 130 |
| 680 | 3300025299 | Ga0209256_1007087 | Ga0209256_100708710 | 130 |
| 681 | 3300025299 | Ga0209256_1010425 | Ga0209256_10104257 | 130 |
| 682 | 3300025302 | Ga0207426_1074054 | Ga0207426_10740542 | 130 |
| 683 | 3300025303 | Ga0209051_1006308 | Ga0209051_10063085 | 130 |
| 684 | 3300025304 | Ga0209257_1000609 | Ga0209257_100060952 | 130 |
| 685 | 3300025304 | Ga0209257_1002443 | Ga0209257_100244312 | 130 |
| 686 | 3300025304 | Ga0209257_1005103 | Ga0209257_100510311 | 130 |
| 687 | 3300028800 | Ga0265338_10173021 | Ga0265338_101730212 | 130 |
| 688 | 3300031711 | Ga0265314_10104975 | Ga0265314_101049753 | 130 |
| 689 | 3300041410 | Ga0439461_0173001 | Ga0439461_0173001_114_506 | 130 |
| 690 | 3300041505 | Ga0451849_1539659 | Ga0451849_1539659_13_405 | 130 |
| 691 | 3300042436 | Ga0439435_0079858 | Ga0439435_0079858_129_521 | 130 |
| 692 | 3300046453 | Ga0495627_001535 | Ga0495627_001535_9942_10334 | 130 |
| 693 | 3300046460 | Ga0495638_0020558 | Ga0495638_0020558_1746_2138 | 130 |
| 694 | 3300046471 | Ga0495650_0000007 | Ga0495650_0000007_156986_157378 | 130 |
| 695 | 3300046506 | Ga0495583_0000037 | Ga0495583_0000037_62401_62805 | 130 |
| 696 | 3300046506 | Ga0495583_0157457 | Ga0495583_0157457_375_767 | 130 |
| 697 | 3300046507 | Ga0495606_0020966 | Ga0495606_0020966_1295_1687 | 130 |
| 698 | 3300046507 | Ga0495606_0161882 | Ga0495606_0161882_695_1099 | 130 |
| 699 | 3300046512 | Ga0495610_0005214 | Ga0495610_0005214_5084_5476 | 130 |
| 700 | 3300046515 | Ga0495620_0013393 | Ga0495620_0013393_2069_2461 | 130 |
| 701 | 3300046520 | Ga0495637_0003268 | Ga0495637_0003268_5290_5682 | 130 |
| 702 | 3300046520 | Ga0495637_0027793 | Ga0495637_0027793_228_620 | 130 |
| 703 | 3300046522 | Ga0495643_0018407 | Ga0495643_0018407_120_512 | 130 |
| 704 | 3300046522 | Ga0495643_0179461 | Ga0495643_0179461_229_621 | 130 |
| 705 | 3300046524 | Ga0495648_0040700 | Ga0495648_0040700_2091_2483 | 130 |
| 706 | 3300046525 | Ga0495663_0247942 | Ga0495663_0247942_112_516 | 130 |
| 707 | 3300046530 | Ga0495654_0000100 | Ga0495654_0000100_67868_68260 | 130 |
| 708 | 3300046542 | Ga0495597_0026634 | Ga0495597_0026634_977_1381 | 130 |
| 709 | 3300046616 | Ga0495668_0000092 | Ga0495668_0000092_27298_27690 | 130 |
| 710 | 3300046616 | Ga0495668_0006961 | Ga0495668_0006961_1282_1686 | 130 |
| 711 | 3300046616 | Ga0495668_0011470 | Ga0495668_0011470_1832_2224 | 130 |
| 712 | 3300046660 | Ga0495625_0000080 | Ga0495625_0000080_29430_29822 | 130 |
| 713 | 3300046660 | Ga0495625_0003786 | Ga0495625_0003786_3057_3449 | 130 |
| 714 | 3300046660 | Ga0495625_0006302 | Ga0495625_0006302_6787_7179 | 130 |
| 715 | 3300046660 | Ga0495625_0030057 | Ga0495625_0030057_1624_2016 | 130 |
| 716 | 3300046660 | Ga0495625_0035884 | Ga0495625_0035884_1593_1997 | 130 |
| 717 | 3300046691 | Ga0495670_0302691 | Ga0495670_0302691_283_675 | 130 |
| 718 | 3300046692 | Ga0495671_0612659 | Ga0495671_0612659_55_447 | 130 |
| 719 | 3300046794 | Ga0495589_0017924 | Ga0495589_0017924_2610_3002 | 130 |
| 720 | 3300047320 | Ga0495672_0001481 | Ga0495672_0001481_151_543 | 130 |
| 721 | 3300047446 | Ga0495679_002196 | Ga0495679_002196_1528_1920 | 130 |
| 722 | 3300047469 | Ga0495673_0000132 | Ga0495673_0000132_39640_40032 | 130 |
| 723 | 3300047469 | Ga0495673_0012113 | Ga0495673_0012113_1579_1971 | 130 |
| 724 | 3300047470 | Ga0495681_0008669 | Ga0495681_0008669_1369_1761 | 130 |
| 725 | 3300047472 | Ga0495686_0029767 | Ga0495686_0029767_2390_2782 | 130 |
| 726 | 3300047472 | Ga0495686_0038383 | Ga0495686_0038383_962_1354 | 130 |
| 727 | 3300048904 | Ga0496101_0071183 | Ga0496101_0071183_646_1050 | 130 |
| 728 | 3300048910 | Ga0496107_0000142 | Ga0496107_0000142_4337_4741 | 130 |
| 729 | 3300048917 | Ga0496114_0959841 | Ga0496114_0959841_12_419 | 130 |
| 730 | 3300048918 | Ga0496115_0149425 | Ga0496115_0149425_1452_1856 | 130 |
| 731 | 3300048918 | Ga0496115_0835762 | Ga0496115_0835762_246_638 | 130 |
| 732 | 3300048924 | Ga0496121_0005751 | Ga0496121_0005751_5967_6371 | 130 |
| 733 | 3300048924 | Ga0496121_0075741 | Ga0496121_0075741_2141_2542 | 130 |
| 734 | 3300048925 | Ga0496122_0277034 | Ga0496122_0277034_320_712 | 130 |
| 735 | 3300048927 | Ga0496124_0021831 | Ga0496124_0021831_2371_2763 | 130 |
| 736 | 3300048927 | Ga0496124_0784795 | Ga0496124_0784795_111_503 | 130 |
| 737 | 3300048928 | Ga0496125_0030771 | Ga0496125_0030771_1755_2162 | 130 |
| 738 | 3300048929 | Ga0496126_0002357 | Ga0496126_0002357_4556_4963 | 130 |
| 739 | 3300049671 | Ga0501238_037965 | Ga0501238_037965_289_681 | 130 |
| 740 | 3300050489 | nmdc:mga03683_372953_c1 | nmdc:mga03683_372953_c1_144_548 | 130 |
| 741 | 3300050493 | nmdc:mga0k408_29963_c1 | nmdc:mga0k408_29963_c1_687_1079 | 130 |
| 742 | 3300050496 | nmdc:mga07m45_37354_c1 | nmdc:mga07m45_37354_c1_1737_2129 | 130 |
| 743 | 3300050516 | nmdc:mga0sz30_14935_c1 | nmdc:mga0sz30_14935_c1_151_543 | 130 |
| 744 | 3300053086 | Ga0500578_0269871 | Ga0500578_0269871_449_841 | 130 |
| 745 | 3300053087 | Ga0500643_107571 | Ga0500643_107571_281_673 | 130 |
| 746 | 3300053090 | Ga0500646_0126818 | Ga0500646_0126818_135_527 | 130 |
| 747 | 3300053104 | Ga0500556_0000273 | Ga0500556_0000273_30430_30822 | 130 |
| 748 | 3300053125 | Ga0500618_000034 | Ga0500618_000034_117255_117647 | 130 |
| 749 | 3300053136 | Ga0500559_0000005 | Ga0500559_0000005_9412_9804 | 130 |
| 750 | 3300053136 | Ga0500559_0002051 | Ga0500559_0002051_1985_2377 | 130 |
| 751 | 3300053136 | Ga0500559_0007255 | Ga0500559_0007255_4014_4406 | 130 |
| 752 | 3300053156 | Ga0500622_0006251 | Ga0500622_0006251_2547_2939 | 130 |
| 753 | 3300053156 | Ga0500622_0030614 | Ga0500622_0030614_293_685 | 130 |
| 754 | 3300053156 | Ga0500622_0032748 | Ga0500622_0032748_1768_2160 | 130 |
| 755 | 3300053727 | Ga0500611_001832 | Ga0500611_001832_1345_1737 | 130 |
| 756 | 3300053730 | Ga0500645_000494 | Ga0500645_000494_14430_14822 | 130 |
| 757 | iso_pu_bacteria | 2643221584 | 2643931320 | 130 |
| 758 | iso_pu_bacteria | 2510917020 | 2511122776 | 131 |
| 759 | 3300003215 | JGI25153J46596_10010803 | JGI25153J46596_100108037 | 135 |
| 760 | 3300025295 | Ga0209564_1011781 | Ga0209564_10117817 | 135 |
| 761 | 3300025295 | Ga0209564_1082980 | Ga0209564_10829801 | 135 |
| 762 | 3300025297 | Ga0209758_1002892 | Ga0209758_100289216 | 135 |
| 763 | 3300042156 | Ga0439446_0014459 | Ga0439446_0014459_1248_1655 | 135 |
| 764 | 3300046460 | Ga0495638_0003310 | Ga0495638_0003310_9611_10018 | 135 |
| 765 | 3300046460 | Ga0495638_0005017 | Ga0495638_0005017_184_591 | 135 |
| 766 | 3300046512 | Ga0495610_0000205 | Ga0495610_0000205_40723_41130 | 135 |
| 767 | 3300046513 | Ga0495616_0000159 | Ga0495616_0000159_39401_39808 | 135 |
| 768 | 3300046518 | Ga0495631_0179595 | Ga0495631_0179595_267_674 | 135 |
| 769 | 3300046519 | Ga0495632_0001395 | Ga0495632_0001395_8296_8703 | 135 |
| 770 | 3300047472 | Ga0495686_0082152 | Ga0495686_0082152_990_1397 | 135 |
| 771 | 3300053134 | Ga0500658_0003408 | Ga0500658_0003408_357_764 | 135 |
| 772 | 3300053724 | Ga0500570_221636 | Ga0500570_221636_86_493 | 135 |
| 773 | iso_pu_bacteria | 2643221552 | 2643778525 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.8692 | 15 | 115 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.8614 | 15 | 117 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.8534 | 15 | 117 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.8251 | 17 | 118 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.8103 | 17 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0F1L8_21_105_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8851 | 17 | 105 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8712 | 17 | 115 | 2.60.300.12 |
| af_P9WMN5_14_118_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8652 | 18 | 125 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8537 | 17 | 115 | 2.60.300.12 |
| af_A0A0R0F1L8_21_105_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8463 | 17 | 105 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A068VLL9-F1-model_v4 | DH200=94 genomic scaffold, scaffold_4615 | 0.9327 | 13 | 116 |
GO:0005739
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A1G1M7N8-F1-model_v4 | FeS cluster biogenesis domain-containing protein | 0.9304 | 17 | 118 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A1U7XV07-F1-model_v4 | Iron-sulfur assembly protein IscA-like 1, mitochondrial isoform X3 | 0.9243 | 13 | 110 |
GO:0005739
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A1J5J855-F1-model_v4 | Fe-S cluster assembly protein HesB | 0.9179 | 16 | 113 |
GO:0005737
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A1G1M7N8-F1-model_v4 | FeS cluster biogenesis domain-containing protein | 0.9123 | 17 | 118 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar