F480122

General Info

Members Datasets Scaffolds Average Seq Length
772 330 1544 172

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100005338|Ga0307408_10000533811
Length 198
Sequence MTATGPPEIPDNDLPAARPADQTGGTMAQPQGAELEEIRARRERLRERYLRPVAERAATTAAGVHHVALICRDVEETVRFYQEFLGFPLVELVENRDYPGSSHFFFDIGNHNLLGFFDFPGHDHPPFTETIGGVQHIAISVSAEQFAAARRRLDEAGVEYLGPDRGVDDSLYFRDPNGVGLELYREDLGLFLGHPLLG

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
181 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
182 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
185 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
223 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
224 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
326 2558860280 Kutzneria sp. 744 Isolate Unclassified
327 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
328 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
329 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
330 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0.78
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 4.02
Rhizosphere 93.13
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100005338 3300031548 Bacteria 8608
2 JGI25404J52841_10068255 3300003659 Bacteria 743
3 Ga0070676_10493460 3300005328 Unclassified 868
4 Ga0070683_100070903 3300005329 Bacteria 3251
5 Ga0070683_100784867 3300005329 Bacteria 913
6 Ga0070670_100035479 3300005331 Bacteria 4293
7 Ga0068869_100064869 3300005334 Bacteria 2687
8 Ga0068869_100144283 3300005334 Bacteria 1841
9 Ga0070682_100053961 3300005337 Bacteria 2520
10 Ga0068868_100005935 3300005338 Bacteria 8613
11 Ga0070689_100284496 3300005340 Bacteria 1372
12 Ga0070691_10178270 3300005341 Bacteria 1105
13 Ga0070691_10546116 3300005341 Bacteria 676
14 Ga0070661_100048775 3300005344 Bacteria 3100
15 Ga0070692_10036116 3300005345 Bacteria 2506
16 Ga0070669_100107618 3300005353 Bacteria 2112
17 Ga0070669_100919316 3300005353 Unclassified 748
18 Ga0070675_100047603 3300005354 Bacteria 3513
19 Ga0070675_100182226 3300005354 Bacteria 1816
20 Ga0070673_101192407 3300005364 Bacteria 713
21 Ga0070659_100069690 3300005366 Bacteria 2792
22 Ga0070667_100131393 3300005367 Bacteria 2186
23 Ga0070709_10007200 3300005434 Bacteria 6096
24 Ga0070709_10051801 3300005434 Bacteria 2577
25 Ga0070714_100001010 3300005435 Bacteria 20084
26 Ga0070714_100002215 3300005435 Bacteria 14317
27 Ga0070714_100004737 3300005435 Bacteria 10298
28 Ga0070714_100054899 3300005435 Bacteria 3404
29 Ga0070714_100122193 3300005435 Bacteria 2317
30 Ga0070714_100125614 3300005435 Bacteria 2287
31 Ga0070714_100208436 3300005435 Bacteria 1791
32 Ga0070714_100264905 3300005435 Bacteria 1592
33 Ga0070714_100353057 3300005435 Bacteria 1381
34 Ga0070714_101381985 3300005435 Bacteria 687
35 Ga0070713_100008165 3300005436 Bacteria 7413
36 Ga0070713_100012039 3300005436 Bacteria 6334
37 Ga0070713_100018297 3300005436 Bacteria 5326
38 Ga0070713_100096315 3300005436 Bacteria 2555
39 Ga0070713_100102284 3300005436 Bacteria 2484
40 Ga0070713_100251368 3300005436 Bacteria 1612
41 Ga0070713_100497425 3300005436 Bacteria 1150
42 Ga0070713_101810283 3300005436 Bacteria 593
43 Ga0070710_10003859 3300005437 Bacteria 7093
44 Ga0070710_10004623 3300005437 Bacteria 6508
45 Ga0070710_10005150 3300005437 Bacteria 6187
46 Ga0070710_10200632 3300005437 Bacteria 1259
47 Ga0070711_100032580 3300005439 Bacteria 3465
48 Ga0070711_100073170 3300005439 Bacteria 2420
49 Ga0070711_100124696 3300005439 Bacteria 1910
50 Ga0070711_100431116 3300005439 Bacteria 1076
51 Ga0070705_100093614 3300005440 Bacteria 1879
52 Ga0070700_100284469 3300005441 Bacteria 1200
53 Ga0070694_100015334 3300005444 Bacteria 4811
54 Ga0070694_100646065 3300005444 Bacteria 856
55 Ga0070708_100001327 3300005445 Bacteria 18931
56 Ga0070708_100020080 3300005445 Bacteria 5627
57 Ga0070708_100020642 3300005445 Bacteria 5559
58 Ga0070708_100091089 3300005445 Bacteria 2776
59 Ga0070708_100128708 3300005445 Bacteria 2342
60 Ga0070708_100222907 3300005445 Bacteria 1768
61 Ga0070708_100344251 3300005445 Bacteria 1405
62 Ga0070708_100560494 3300005445 Bacteria 1077
63 Ga0070663_100751005 3300005455 Bacteria 833
64 Ga0070678_100036643 3300005456 Bacteria 3435
65 Ga0070662_100018037 3300005457 Bacteria 4768
66 Ga0070662_100077684 3300005457 Bacteria 2464
67 Ga0070681_10516303 3300005458 Bacteria 1108
68 Ga0070685_10144584 3300005466 Bacteria 1501
69 Ga0070706_100016163 3300005467 Bacteria 6892
70 Ga0070706_100018392 3300005467 Bacteria 6446
71 Ga0070706_100023038 3300005467 Bacteria 5735
72 Ga0070706_100090355 3300005467 Bacteria 2840
73 Ga0070706_100178027 3300005467 Bacteria 1985
74 Ga0070706_100203483 3300005467 Bacteria 1849
75 Ga0070706_100797103 3300005467 Bacteria 874
76 Ga0070706_100818939 3300005467 Bacteria 861
77 Ga0070707_100009673 3300005468 Bacteria 8960
78 Ga0070707_100011405 3300005468 Bacteria 8287
79 Ga0070707_100016313 3300005468 Bacteria 6972
80 Ga0070707_100019178 3300005468 Bacteria 6443
81 Ga0070707_100024357 3300005468 Bacteria 5731
82 Ga0070707_100058617 3300005468 Bacteria 3692
83 Ga0070707_100101475 3300005468 Bacteria 2788
84 Ga0070707_100179222 3300005468 Bacteria 2065
85 Ga0070707_100244008 3300005468 Bacteria 1748
86 Ga0070707_100350788 3300005468 Bacteria 1433
87 Ga0070698_100000319 3300005471 Bacteria 48961
88 Ga0070698_100001247 3300005471 Bacteria 28403
89 Ga0070698_100004646 3300005471 Bacteria 15100
90 Ga0070698_100005647 3300005471 Bacteria 13693
91 Ga0070698_100111037 3300005471 Bacteria 2706
92 Ga0070698_100129729 3300005471 Bacteria 2477
93 Ga0070698_100166626 3300005471 Bacteria 2146
94 Ga0070698_100274722 3300005471 Bacteria 1617
95 Ga0070699_100199485 3300005518 Bacteria 1779
96 Ga0070699_100569926 3300005518 Unclassified 1031
97 Ga0070679_100869309 3300005530 Bacteria 845
98 Ga0070684_100033277 3300005535 Bacteria 4400
99 Ga0070684_100507153 3300005535 Unclassified 1118
100 Ga0070697_100075313 3300005536 Bacteria 2774
101 Ga0070697_100086845 3300005536 Bacteria 2582
102 Ga0070697_100090922 3300005536 Bacteria 2523
103 Ga0070697_100224063 3300005536 Bacteria 1603
104 Ga0068853_100014389 3300005539 Bacteria 6479
105 Ga0068853_100746545 3300005539 Bacteria 935
106 Ga0070686_100033047 3300005544 Bacteria 3176
107 Ga0070695_100033414 3300005545 Bacteria 3218
108 Ga0070696_100024799 3300005546 Bacteria 4075
109 Ga0070696_100081166 3300005546 Bacteria 2297
110 Ga0070693_100014606 3300005547 Bacteria 4027
111 Ga0070693_100912750 3300005547 Bacteria 659
112 Ga0070665_100341935 3300005548 Bacteria 1501
113 Ga0070704_100347439 3300005549 Bacteria 1251
114 Ga0068855_100058253 3300005563 Bacteria 4525
115 Ga0068855_100107357 3300005563 Bacteria 3207
116 Ga0070664_100000100 3300005564 Bacteria 55301
117 Ga0070664_100347733 3300005564 Bacteria 1348
118 Ga0068857_100012182 3300005577 Bacteria 7479
119 Ga0068857_100088212 3300005577 Bacteria 2775
120 Ga0068857_100116722 3300005577 Bacteria 2401
121 Ga0068854_100449191 3300005578 Bacteria 1076
122 Ga0068856_100012630 3300005614 Bacteria 8177
123 Ga0068856_100060491 3300005614 Bacteria 3742
124 Ga0068856_100093626 3300005614 Bacteria 2990
125 Ga0070702_100028652 3300005615 Bacteria 3019
126 Ga0070702_100283370 3300005615 Bacteria 1139
127 Ga0068852_100088441 3300005616 Bacteria 2767
128 Ga0068852_101028808 3300005616 Bacteria 843
129 Ga0068864_100450971 3300005618 Bacteria 1230
130 Ga0068861_100072262 3300005719 Bacteria 2676
131 Ga0068870_10236675 3300005840 Bacteria 1125
132 Ga0068863_100223278 3300005841 Bacteria 1815
133 Ga0068863_100235921 3300005841 Bacteria 1765
134 Ga0068858_100313367 3300005842 Bacteria 1498
135 Ga0068862_100127844 3300005844 Bacteria 2245
136 Ga0068862_100400621 3300005844 Bacteria 1284
137 Ga0081455_10016693 3300005937 Bacteria 7073
138 Ga0081538_10015961 3300005981 Bacteria 5785
139 Ga0081538_10064842 3300005981 Bacteria 2062
140 Ga0081540_1000130 3300005983 Bacteria 80050
141 Ga0081540_1004092 3300005983 Bacteria 11272
142 Ga0081540_1056001 3300005983 Bacteria 1917
143 Ga0081540_1089553 3300005983 Bacteria 1357
144 Ga0070717_10010873 3300006028 Bacteria 6890
145 Ga0070717_10046671 3300006028 Bacteria 3545
146 Ga0070717_10065911 3300006028 Bacteria 3011
147 Ga0070717_10066162 3300006028 Bacteria 3005
148 Ga0070717_10148794 3300006028 Bacteria 2025
149 Ga0070717_10157678 3300006028 Bacteria 1967
150 Ga0070717_10330916 3300006028 Bacteria 1359
151 Ga0070717_10379392 3300006028 Bacteria 1267
152 Ga0070717_10644501 3300006028 Bacteria 961
153 Ga0070717_10964284 3300006028 Bacteria 777
154 Ga0070715_10005251 3300006163 Bacteria 4307
155 Ga0070715_10015091 3300006163 Bacteria 2875
156 Ga0070715_10018662 3300006163 Bacteria 2647
157 Ga0070715_10024955 3300006163 Bacteria 2363
158 Ga0070716_100001534 3300006173 Bacteria 10351
159 Ga0070716_100006455 3300006173 Bacteria 5729
160 Ga0070716_100238641 3300006173 Bacteria 1231
161 Ga0070716_100570672 3300006173 Bacteria 847
162 Ga0070712_100007951 3300006175 Bacteria 6648
163 Ga0070712_100024703 3300006175 Bacteria 3986
164 Ga0070712_100054612 3300006175 Bacteria 2793
165 Ga0070712_100275025 3300006175 Bacteria 1354
166 Ga0070712_100760461 3300006175 Bacteria 830
167 Ga0070712_100848716 3300006175 Bacteria 785
168 Ga0097621_100153799 3300006237 Bacteria 1974
169 Ga0068871_100116068 3300006358 Bacteria 2257
170 Ga0068871_100442456 3300006358 Bacteria 1164
171 Ga0075433_10009897 3300006852 Bacteria 7644
172 Ga0075433_10028568 3300006852 Bacteria 4743
173 Ga0075433_10276819 3300006852 Bacteria 1487
174 Ga0075434_100007625 3300006871 Bacteria 10013
175 Ga0075434_100146637 3300006871 Bacteria 2380
176 Ga0075434_100707867 3300006871 Bacteria 1024
177 Ga0075429_100285194 3300006880 Bacteria 1446
178 Ga0068865_100038579 3300006881 Bacteria 3235
179 Ga0068865_100041412 3300006881 Bacteria 3134
180 Ga0075436_100010364 3300006914 Bacteria 6386
181 Ga0075436_100045437 3300006914 Bacteria 3029
182 Ga0075436_100066655 3300006914 Bacteria 2488
183 Ga0075436_100662442 3300006914 Bacteria 772
184 Ga0075435_100051730 3300007076 Bacteria 3309
185 Ga0075435_100078422 3300007076 Bacteria 2708
186 Ga0075435_100137683 3300007076 Bacteria 2046
187 Ga0075435_100282656 3300007076 Bacteria 1417
188 Ga0075435_100761346 3300007076 Bacteria 842
189 Ga0099794_10093591 3300007265 Bacteria 1494
190 Ga0099795_10113050 3300007788 Bacteria 1078
191 Ga0099795_10306358 3300007788 Unclassified 700
192 Ga0105240_10059569 3300009093 Bacteria 4764
193 Ga0111539_10003076 3300009094 Bacteria 22107
194 Ga0111539_10047678 3300009094 Bacteria 5119
195 Ga0111539_10123155 3300009094 Bacteria 3039
196 Ga0105245_10049990 3300009098 Bacteria 3745
197 Ga0105245_10313176 3300009098 Bacteria 1544
198 Ga0105245_12258827 3300009098 Unclassified 598
199 Ga0114129_10005099 3300009147 Bacteria 18498
200 Ga0114129_10638865 3300009147 Bacteria 1375
201 Ga0114129_11991947 3300009147 Unclassified 702
202 Ga0105241_10125958 3300009174 Bacteria 2068
203 Ga0105241_10144383 3300009174 Bacteria 1941
204 Ga0105241_10213263 3300009174 Bacteria 1619
205 Ga0105241_11761036 3300009174 Bacteria 603
206 Ga0105242_10063619 3300009176 Bacteria 3038
207 Ga0105248_10048664 3300009177 Bacteria 4755
208 Ga0105237_10117691 3300009545 Bacteria 2651
209 Ga0105237_10125170 3300009545 Bacteria 2565
210 Ga0105237_10130239 3300009545 Bacteria 2510
211 Ga0105237_10175878 3300009545 Bacteria 2140
212 Ga0105237_11470312 3300009545 Bacteria 688
213 Ga0105238_10102362 3300009551 Bacteria 2846
214 Ga0105249_10016717 3300009553 Bacteria 6511
215 Ga0105239_10020163 3300010375 Bacteria 7355
216 Ga0105239_10216668 3300010375 Bacteria 2146
217 Ga0105239_10653154 3300010375 Bacteria 1201
218 Ga0105239_11151751 3300010375 Bacteria 893
219 Ga0105246_10081269 3300011119 Bacteria 2309
220 Ga0105246_10657963 3300011119 Bacteria 913
221 Ga0105246_11436169 3300011119 Bacteria 645
222 Ga0157373_10381534 3300013100 Bacteria 1008
223 Ga0157371_10047334 3300013102 Bacteria 3057
224 Ga0157370_10030431 3300013104 Bacteria 5289
225 Ga0157378_10066752 3300013297 Bacteria 3223
226 Ga0163162_10182251 3300013306 Bacteria 2226
227 Ga0157375_10309052 3300013308 Bacteria 1745
228 Ga0163163_10248344 3300014325 Bacteria 1830
229 Ga0163163_11476644 3300014325 Bacteria 741
230 Ga0157380_10099030 3300014326 Bacteria 2423
231 Ga0157377_10030312 3300014745 Bacteria 2929
232 Ga0157377_10032643 3300014745 Bacteria 2837
233 Ga0157379_10006261 3300014968 Bacteria 10247
234 Ga0157376_11151352 3300014969 Bacteria 803
235 Ga0163161_10062730 3300017792 Bacteria 2708
236 Ga0197907_10615449 3300020069 Bacteria 720
237 Ga0213876_10158652 3300021384 Bacteria 1203
238 Ga0224712_10215587 3300022467 Bacteria 877
239 Ga0224572_1047138 3300024225 Bacteria 806
240 Ga0207656_10235650 3300025321 Unclassified 893
241 Ga0207653_10002312 3300025885 Bacteria 6083
242 Ga0207692_10001157 3300025898 Bacteria 9740
243 Ga0207692_10004265 3300025898 Bacteria 5651
244 Ga0207692_10019311 3300025898 Bacteria 3078
245 Ga0207692_10227591 3300025898 Bacteria 1108
246 Ga0207642_10089549 3300025899 Bacteria 1516
247 Ga0207642_10456320 3300025899 Unclassified 775
248 Ga0207710_10023890 3300025900 Bacteria 2629
249 Ga0207688_10008232 3300025901 Bacteria 5667
250 Ga0207647_10092248 3300025904 Unclassified 1806
251 Ga0207685_10021103 3300025905 Bacteria 2177
252 Ga0207685_10045874 3300025905 Bacteria 1660
253 Ga0207685_10055220 3300025905 Bacteria 1550
254 Ga0207685_10106816 3300025905 Bacteria 1207
255 Ga0207685_10282186 3300025905 Bacteria 815
256 Ga0207699_10002999 3300025906 Bacteria 8026
257 Ga0207699_10017902 3300025906 Bacteria 3743
258 Ga0207699_10068477 3300025906 Bacteria 2161
259 Ga0207699_10077108 3300025906 Bacteria 2055
260 Ga0207699_10105289 3300025906 Bacteria 1798
261 Ga0207645_10440071 3300025907 Unclassified 879
262 Ga0207684_10008075 3300025910 Bacteria 9389
263 Ga0207684_10009534 3300025910 Bacteria 8565
264 Ga0207684_10013951 3300025910 Bacteria 6941
265 Ga0207684_10014185 3300025910 Bacteria 6878
266 Ga0207684_10019945 3300025910 Bacteria 5729
267 Ga0207684_10045800 3300025910 Bacteria 3710
268 Ga0207684_10185575 3300025910 Bacteria 1793
269 Ga0207684_10225775 3300025910 Bacteria 1616
270 Ga0207684_10401451 3300025910 Bacteria 1178
271 Ga0207684_10690990 3300025910 Bacteria 867
272 Ga0207684_10777170 3300025910 Bacteria 810
273 Ga0207654_10135929 3300025911 Bacteria 1562
274 Ga0207654_10753922 3300025911 Bacteria 701
275 Ga0207671_10084427 3300025914 Bacteria 2385
276 Ga0207693_10003808 3300025915 Bacteria 12843
277 Ga0207693_10012679 3300025915 Bacteria 6807
278 Ga0207693_10100235 3300025915 Bacteria 2271
279 Ga0207663_10039426 3300025916 Bacteria 2862
280 Ga0207663_10069979 3300025916 Bacteria 2259
281 Ga0207663_10168104 3300025916 Bacteria 1555
282 Ga0207660_10406710 3300025917 Bacteria 1096
283 Ga0207662_10077872 3300025918 Bacteria 2017
284 Ga0207657_10283709 3300025919 Bacteria 1314
285 Ga0207649_10040895 3300025920 Bacteria 2821
286 Ga0207649_10894606 3300025920 Unclassified 696
287 Ga0207652_10473015 3300025921 Bacteria 1129
288 Ga0207646_10000511 3300025922 Bacteria 51827
289 Ga0207646_10003046 3300025922 Bacteria 19289
290 Ga0207646_10005034 3300025922 Bacteria 14066
291 Ga0207646_10014472 3300025922 Bacteria 7491
292 Ga0207646_10049185 3300025922 Bacteria 3777
293 Ga0207646_10056908 3300025922 Bacteria 3494
294 Ga0207646_10117742 3300025922 Bacteria 2386
295 Ga0207646_10149187 3300025922 Bacteria 2108
296 Ga0207646_10324819 3300025922 Bacteria 1390
297 Ga0207681_10064458 3300025923 Bacteria 2530
298 Ga0207694_10098084 3300025924 Bacteria 2319
299 Ga0207694_10222041 3300025924 Bacteria 1542
300 Ga0207650_10023763 3300025925 Bacteria 4352
301 Ga0207659_10032241 3300025926 Bacteria 3594
302 Ga0207687_10035764 3300025927 Bacteria 3380
303 Ga0207687_10614666 3300025927 Bacteria 917
304 Ga0207700_10019617 3300025928 Bacteria 4569
305 Ga0207700_10034078 3300025928 Bacteria 3651
306 Ga0207700_10071725 3300025928 Bacteria 2668
307 Ga0207700_10080816 3300025928 Bacteria 2536
308 Ga0207700_10111386 3300025928 Bacteria 2203
309 Ga0207700_10519910 3300025928 Bacteria 1054
310 Ga0207664_10001881 3300025929 Bacteria 13801
311 Ga0207664_10004113 3300025929 Bacteria 9823
312 Ga0207664_10004491 3300025929 Bacteria 9454
313 Ga0207664_10004915 3300025929 Bacteria 9083
314 Ga0207664_10139170 3300025929 Bacteria 2051
315 Ga0207664_10144363 3300025929 Bacteria 2017
316 Ga0207664_10239566 3300025929 Bacteria 1579
317 Ga0207664_10315530 3300025929 Bacteria 1378
318 Ga0207664_10618389 3300025929 Unclassified 973
319 Ga0207664_10981011 3300025929 Bacteria 757
320 Ga0207644_10717408 3300025931 Bacteria 834
321 Ga0207690_10026581 3300025932 Bacteria 3645
322 Ga0207690_10049873 3300025932 Bacteria 2792
323 Ga0207706_10003790 3300025933 Bacteria 14412
324 Ga0207706_10231811 3300025933 Bacteria 1615
325 Ga0207704_10022983 3300025938 Bacteria 3352
326 Ga0207704_10155310 3300025938 Bacteria 1621
327 Ga0207665_10002597 3300025939 Bacteria 12146
328 Ga0207665_10015571 3300025939 Bacteria 4990
329 Ga0207665_10105650 3300025939 Bacteria 1972
330 Ga0207665_10402452 3300025939 Bacteria 1043
331 Ga0207711_10188364 3300025941 Bacteria 1879
332 Ga0207689_10027319 3300025942 Bacteria 4778
333 Ga0207689_10092782 3300025942 Bacteria 2480
334 Ga0207661_10061670 3300025944 Bacteria 3030
335 Ga0207667_10044234 3300025949 Bacteria 4720
336 Ga0207667_10053071 3300025949 Bacteria 4267
337 Ga0207667_10191813 3300025949 Bacteria 2097
338 Ga0207667_10714821 3300025949 Bacteria 1003
339 Ga0207668_10365036 3300025972 Bacteria 1211
340 Ga0207668_10523358 3300025972 Bacteria 1023
341 Ga0207668_11259698 3300025972 Bacteria 665
342 Ga0207640_10436114 3300025981 Bacteria 1076
343 Ga0207677_10023071 3300026023 Bacteria 3836
344 Ga0207703_10145409 3300026035 Bacteria 2061
345 Ga0207639_10028967 3300026041 Bacteria 4049
346 Ga0207639_10498410 3300026041 Bacteria 1112
347 Ga0207678_10051482 3300026067 Bacteria 3555
348 Ga0207708_10001406 3300026075 Bacteria 18042
349 Ga0207702_10286750 3300026078 Bacteria 1558
350 Ga0207702_11531351 3300026078 Bacteria 660
351 Ga0207641_10915759 3300026088 Bacteria 871
352 Ga0207676_10202150 3300026095 Bacteria 1756
353 Ga0207676_10394148 3300026095 Bacteria 1292
354 Ga0207676_10924919 3300026095 Bacteria 856
355 Ga0207674_10104400 3300026116 Bacteria 2812
356 Ga0207674_10185688 3300026116 Bacteria 2030
357 Ga0207675_100022932 3300026118 Bacteria 5806
358 Ga0207675_100272278 3300026118 Bacteria 1643
359 Ga0207675_100306189 3300026118 Bacteria 1548
360 Ga0207683_10003345 3300026121 Bacteria 13979
361 Ga0207683_10286432 3300026121 Bacteria 1506
362 Ga0207698_10282313 3300026142 Bacteria 1536
363 Ga0207428_10980183 3300027907 Bacteria 595
364 Ga0268265_10226793 3300028380 Bacteria 1639
365 Ga0307515_10000229 3300028794 Bacteria 139040
366 Ga0307511_10010993 3300030521 Bacteria 8937
367 Ga0265766_1005764 3300030863 Bacteria 794
368 Ga0265765_1025361 3300030879 Bacteria 735
369 Ga0265768_103515 3300030963 Bacteria 846
370 Ga0307513_10000383 3300031456 Bacteria 64328
371 Ga0307509_10118689 3300031507 Bacteria 2628
372 Ga0307408_100008318 3300031548 Bacteria 6851
373 Ga0307408_100076758 3300031548 Bacteria 2486
374 Ga0307408_100211113 3300031548 Bacteria 1578
375 Ga0307516_10003386 3300031730 Bacteria 20559
376 Ga0307405_10000342 3300031731 Bacteria 17372
377 Ga0307405_10059830 3300031731 Bacteria 2402
378 Ga0307405_10104862 3300031731 Bacteria 1903
379 Ga0307405_10362360 3300031731 Bacteria 1122
380 Ga0307405_10803400 3300031731 Bacteria 788
381 Ga0307413_10135330 3300031824 Bacteria 1693
382 Ga0307413_10357895 3300031824 Bacteria 1129
383 Ga0307413_10930437 3300031824 Bacteria 740
384 Ga0307410_10001165 3300031852 Bacteria 11589
385 Ga0307410_10073235 3300031852 Bacteria 2381
386 Ga0307410_10195983 3300031852 Bacteria 1539
387 Ga0307410_10265027 3300031852 Bacteria 1341
388 Ga0307410_10566642 3300031852 Bacteria 943
389 Ga0307410_10779645 3300031852 Bacteria 811
390 Ga0326468_10003665 3300031889 Bacteria 1311
391 Ga0307406_10000157 3300031901 Bacteria 40684
392 Ga0307406_10016128 3300031901 Bacteria 4335
393 Ga0307406_10026023 3300031901 Bacteria 3508
394 Ga0307406_10055868 3300031901 Bacteria 2525
395 Ga0307406_10089467 3300031901 Bacteria 2069
396 Ga0307407_10000177 3300031903 Bacteria 19330
397 Ga0307407_10033316 3300031903 Bacteria 2810
398 Ga0307407_10156092 3300031903 Bacteria 1488
399 Ga0307407_10283322 3300031903 Bacteria 1149
400 Ga0307407_10663210 3300031903 Bacteria 782
401 Ga0307412_10079932 3300031911 Bacteria 2257
402 Ga0307412_10158923 3300031911 Bacteria 1677
403 Ga0307412_10432825 3300031911 Bacteria 1079
404 Ga0307412_11691567 3300031911 Bacteria 580
405 Ga0307409_100000258 3300031995 Bacteria 21414
406 Ga0307409_100005108 3300031995 Bacteria 7491
407 Ga0307409_100184674 3300031995 Bacteria 1849
408 Ga0307409_100525579 3300031995 Bacteria 1157
409 Ga0307409_100554543 3300031995 Bacteria 1128
410 Ga0307416_100000321 3300032002 Bacteria 24771
411 Ga0307416_100007263 3300032002 Bacteria 7022
412 Ga0307416_100139955 3300032002 Bacteria 2197
413 Ga0307416_100327081 3300032002 Bacteria 1538
414 Ga0307416_100558110 3300032002 Bacteria 1219
415 Ga0307416_100739062 3300032002 Bacteria 1076
416 Ga0307414_10038749 3300032004 Bacteria 3204
417 Ga0307414_10381953 3300032004 Bacteria 1218
418 Ga0307411_10031603 3300032005 Bacteria 3260
419 Ga0307415_100000080 3300032126 Bacteria 39486
420 Ga0307415_100018041 3300032126 Bacteria 4249
421 Ga0307415_100049304 3300032126 Bacteria 2846
422 Ga0307415_100074555 3300032126 Bacteria 2399
423 Ga0307415_100324410 3300032126 Bacteria 1285
424 Ga0307415_100335780 3300032126 Bacteria 1266
425 Ga0307507_10015090 3300033179 Bacteria 9128
426 Ga0373930_0007975 3300034816 Bacteria 1840
427 Ga0373948_0103248 3300034817 Bacteria 673
428 Ga0373950_0008388 3300034818 Bacteria 1625
429 Ga0373958_0007766 3300034819 Bacteria 1719
430 Ga0373959_0014273 3300034820 Bacteria 1444
431 Ga0373926_0001111 3300035083 Bacteria 7961
432 Ga0373928_0005389 3300035084 Bacteria 2445
433 Ga0373928_0075138 3300035084 Bacteria 843
434 Ga0373929_0052187 3300035085 Bacteria 937
435 Ga0373934_0000165 3300035086 Bacteria 24127
436 Ga0373934_0022630 3300035086 Bacteria 2425
437 Ga0373940_0145272 3300035088 Unclassified 752
438 Ga0373949_0011260 3300035090 Bacteria 1968
439 Ga0373951_0043392 3300035091 Bacteria 1090
440 Ga0373952_0020264 3300035092 Bacteria 1392
441 Ga0373923_0007124 3300035111 Bacteria 3915
442 Ga0373923_0044279 3300035111 Bacteria 1845
443 Ga0373923_0078686 3300035111 Bacteria 1427
444 Ga0373932_0073112 3300035112 Unclassified 1068
445 Ga0373936_0001132 3300035113 Bacteria 9553
446 Ga0373936_0076574 3300035113 Bacteria 1387
447 Ga0373936_0083390 3300035113 Bacteria 1333
448 Ga0373936_0284333 3300035113 Bacteria 744
449 Ga0373939_0105236 3300035114 Bacteria 974
450 Ga0373939_0330129 3300035114 Unclassified 615
451 Ga0373941_0038746 3300035115 Bacteria 1461
452 Ga0373945_0077527 3300035116 Bacteria 1268
453 Ga0373945_0178069 3300035116 Bacteria 874
454 Ga0373945_0257045 3300035116 Bacteria 739
455 Ga0373953_0000062 3300035117 Bacteria 27440
456 Ga0373954_0000701 3300035118 Bacteria 12867
457 Ga0373954_0039432 3300035118 Bacteria 2198
458 Ga0373954_0057756 3300035118 Bacteria 1828
459 Ga0373954_0085410 3300035118 Bacteria 1511
460 Ga0373954_0206786 3300035118 Bacteria 965
461 Ga0373956_0000061 3300035119 Bacteria 37279
462 Ga0373956_0026014 3300035119 Bacteria 2533
463 Ga0373956_0089832 3300035119 Bacteria 1416
464 Ga0373956_0213486 3300035119 Bacteria 915
465 Ga0373957_0000042 3300035120 Bacteria 33397
466 Ga0373957_0032000 3300035120 Bacteria 1935
467 Ga0373957_0104270 3300035120 Bacteria 1137
468 Ga0373957_0142431 3300035120 Bacteria 981
469 Ga0373955_0000106 3300035172 Bacteria 33578
470 Ga0373955_0044685 3300035172 Bacteria 2387
471 Ga0373955_0127993 3300035172 Bacteria 1480
472 Ga0373955_0167124 3300035172 Bacteria 1300
473 Ga0373942_0032967 3300035207 Bacteria 1379
474 Ga0373962_0012829 3300035242 Bacteria 2116
475 Ga0373924_0007857 3300035410 Bacteria 3858
476 Ga0373924_0010874 3300035410 Bacteria 3369
477 Ga0373924_0454280 3300035410 Bacteria 574
478 Ga0373931_0016509 3300035691 Bacteria 3635
479 Ga0373931_0275921 3300035691 Bacteria 1030
480 Ga0373935_0001664 3300035692 Bacteria 12426
481 Ga0373935_0007757 3300035692 Bacteria 6432
482 Ga0373935_0058944 3300035692 Bacteria 2453
483 Ga0373935_0313481 3300035692 Bacteria 1111
484 Ga0373935_0836806 3300035692 Bacteria 680
485 Ga0373927_0205325 3300035695 Bacteria 1294
486 Ga0373933_0000046 3300035724 Bacteria 76647
487 Ga0373933_0000764 3300035724 Bacteria 19666
488 Ga0373933_0005963 3300035724 Bacteria 6630
489 Ga0373933_0020037 3300035724 Bacteria 3787
490 Ga0373933_0132446 3300035724 Bacteria 1568
491 Ga0373947_0000017 3300035725 Bacteria 121216
492 Ga0373947_0030240 3300035725 Bacteria 3182
493 Ga0373947_0279008 3300035725 Bacteria 1111
494 Ga0373947_0348488 3300035725 Bacteria 993
495 Ga0373947_0496709 3300035725 Bacteria 829
496 Ga0373937_0000115 3300036401 Bacteria 76660
497 Ga0373937_0002923 3300036401 Bacteria 14281
498 Ga0373937_0009930 3300036401 Bacteria 8299
499 Ga0373937_0018604 3300036401 Bacteria 6205
500 Ga0373937_0045905 3300036401 Bacteria 3993
501 Ga0373937_1334131 3300036401 Bacteria 665
502 Ga0373925_0014582 3300037068 Bacteria 5679
503 Ga0373925_0044387 3300037068 Bacteria 3300
504 Ga0373925_0381641 3300037068 Bacteria 1147
505 Ga0373925_1000666 3300037068 Unclassified 688
506 Ga0395899_0141575 3300037312 Bacteria 1711
507 Ga0395899_0336724 3300037312 Bacteria 1013
508 Ga0395900_0319572 3300037418 Bacteria 1533
509 Ga0395900_0784291 3300037418 Bacteria 882
510 Ga0395898_0078288 3300037466 Bacteria 3190
511 Ga0395898_0081831 3300037466 Bacteria 3113
512 Ga0395898_0200542 3300037466 Bacteria 1905
513 Ga0395905_0241197 3300037471 Bacteria 1689
514 Ga0436364_0018972 3300037853 Bacteria 541
515 Ga0436364_0193061 3300037853 Bacteria 3061
516 Ga0436364_1222187 3300037853 Bacteria 646
517 Ga0395901_0116073 3300038443 Bacteria 2812
518 Ga0436365_0769649 3300039437 Bacteria 826
519 Ga0436365_0864774 3300039437 Bacteria 1293
520 Ga0436363_1395795 3300039450 Bacteria 1118
521 Ga0451833_0092015 3300041491 Bacteria 1100
522 Ga0439448_0023721 3300042005 Bacteria 1916
523 Ga0439450_056441 3300042008 Bacteria 942
524 Ga0439464_0181419 3300042439 Bacteria 667
525 Ga0439440_0029692 3300042993 Bacteria 1284
526 Ga0466969_0044599 3300044656 Bacteria 2204
527 Ga0466969_0067107 3300044656 Bacteria 1731
528 Ga0466969_0259269 3300044656 Bacteria 788
529 Ga0466966_0016233 3300044684 Bacteria 4923
530 Ga0466966_0035174 3300044684 Bacteria 3238
531 Ga0466966_0068529 3300044684 Bacteria 2227
532 Ga0466961_0025632 3300044693 Bacteria 3791
533 Ga0466961_0026163 3300044693 Bacteria 3753
534 Ga0466963_0024305 3300044694 Bacteria 3857
535 Ga0466963_0026912 3300044694 Bacteria 3679
536 Ga0466963_0098811 3300044694 Bacteria 1996
537 Ga0466963_0283774 3300044694 Bacteria 1164
538 Ga0466970_0021915 3300044765 Bacteria 3333
539 Ga0466970_0072563 3300044765 Bacteria 1852
540 Ga0466957_0012941 3300044842 Bacteria 4834
541 Ga0466960_0086197 3300044901 Bacteria 1592
542 Ga0466959_0061956 3300045049 Bacteria 2719
543 Ga0466959_0388084 3300045049 Bacteria 950
544 Ga0466958_0009978 3300045836 Bacteria 5305
545 Ga0466967_0029151 3300045976 Bacteria 4616
546 Ga0466967_0034742 3300045976 Bacteria 4283
547 Ga0466967_0043781 3300045976 Bacteria 3878
548 Ga0466967_0059236 3300045976 Bacteria 3389
549 Ga0466967_0180519 3300045976 Bacteria 1991
550 Ga0466967_0337627 3300045976 Bacteria 1456
551 Ga0466967_0369823 3300045976 Bacteria 1390
552 Ga0466967_0718267 3300045976 Bacteria 990
553 Ga0495592_0000166 3300046454 Bacteria 58865
554 Ga0495592_0013099 3300046454 Bacteria 6310
555 Ga0495592_0096440 3300046454 Bacteria 2114
556 Ga0495592_0108418 3300046454 Bacteria 1968
557 Ga0495629_0025973 3300046459 Bacteria 4161
558 Ga0495629_0403786 3300046459 Bacteria 928
559 Ga0495641_0014800 3300046461 Bacteria 4204
560 Ga0495641_0086212 3300046461 Bacteria 1405
561 Ga0495651_0000067 3300046462 Bacteria 76665
562 Ga0495651_0011292 3300046462 Bacteria 6864
563 Ga0495651_0170462 3300046462 Bacteria 1550
564 Ga0495651_0229751 3300046462 Bacteria 1278
565 Ga0495651_0510447 3300046462 Bacteria 768
566 Ga0495653_0010757 3300046463 Bacteria 7492
567 Ga0495653_0012034 3300046463 Bacteria 7062
568 Ga0495653_0023951 3300046463 Bacteria 4925
569 Ga0495653_0221864 3300046463 Bacteria 1270
570 Ga0495653_0574263 3300046463 Bacteria 695
571 Ga0495580_0221996 3300046472 Bacteria 1298
572 Ga0495582_0041278 3300046473 Bacteria 2542
573 Ga0495582_0106287 3300046473 Bacteria 1574
574 Ga0495639_0132420 3300046475 Bacteria 1194
575 Ga0495662_0005716 3300046476 Bacteria 6217
576 Ga0495662_0027072 3300046476 Bacteria 2769
577 Ga0495664_0016454 3300046477 Bacteria 4213
578 Ga0495664_0027093 3300046477 Bacteria 3341
579 Ga0495608_0000850 3300046511 Bacteria 21361
580 Ga0495608_0101796 3300046511 Bacteria 1851
581 Ga0495608_0105356 3300046511 Bacteria 1815
582 Ga0495608_0175744 3300046511 Bacteria 1356
583 Ga0495608_0792993 3300046511 Bacteria 559
584 Ga0495618_0019512 3300046514 Bacteria 4171
585 Ga0495628_0000916 3300046516 Bacteria 27072
586 Ga0495628_0101958 3300046516 Bacteria 2214
587 Ga0495628_0123675 3300046516 Bacteria 1982
588 Ga0495630_0190999 3300046517 Bacteria 1562
589 Ga0495630_0516761 3300046517 Bacteria 915
590 Ga0495652_0007308 3300046529 Bacteria 10187
591 Ga0495652_0028603 3300046529 Bacteria 4902
592 Ga0495652_0047780 3300046529 Bacteria 3669
593 Ga0495652_0145468 3300046529 Bacteria 1858
594 Ga0495652_0235786 3300046529 Bacteria 1365
595 Ga0495665_0054413 3300046531 Bacteria 2114
596 Ga0495665_0104071 3300046531 Bacteria 1489
597 Ga0495665_0267176 3300046531 Bacteria 879
598 Ga0495640_0018433 3300046533 Bacteria 5174
599 Ga0495640_0020499 3300046533 Bacteria 4865
600 Ga0495640_0036929 3300046533 Bacteria 3449
601 Ga0495640_0083171 3300046533 Bacteria 2124
602 Ga0495640_0688277 3300046533 Bacteria 614
603 Ga0495586_0029041 3300046535 Bacteria 2960
604 Ga0495587_0000078 3300046536 Bacteria 76639
605 Ga0495587_0015551 3300046536 Bacteria 4748
606 Ga0495587_0052225 3300046536 Bacteria 2412
607 Ga0495587_0075032 3300046536 Bacteria 1963
608 Ga0495645_0017608 3300046543 Bacteria 5120
609 Ga0495645_0021043 3300046543 Bacteria 4713
610 Ga0495645_0061609 3300046543 Bacteria 2718
611 Ga0495645_0097555 3300046543 Bacteria 2093
612 Ga0495645_0149779 3300046543 Bacteria 1622
613 Ga0495645_0685112 3300046543 Bacteria 623
614 Ga0495667_0000122 3300046559 Bacteria 56141
615 Ga0495667_0062341 3300046559 Bacteria 2443
616 Ga0495667_0158763 3300046559 Bacteria 1454
617 Ga0495667_0176125 3300046559 Bacteria 1373
618 Ga0495634_0005904 3300046642 Bacteria 9351
619 Ga0495634_0064262 3300046642 Bacteria 2433
620 Ga0495635_0056438 3300046663 Bacteria 2703
621 Ga0495635_0131712 3300046663 Bacteria 1704
622 Ga0495635_0242631 3300046663 Bacteria 1215
623 Ga0495635_0261713 3300046663 Bacteria 1165
624 Ga0495635_0410592 3300046663 Bacteria 898
625 Ga0495657_0000098 3300046675 Bacteria 76618
626 Ga0495657_0030849 3300046675 Bacteria 3750
627 Ga0495657_0034083 3300046675 Bacteria 3539
628 Ga0495657_0034763 3300046675 Bacteria 3498
629 Ga0495657_0279431 3300046675 Bacteria 999
630 Ga0495599_0000115 3300046678 Bacteria 53313
631 Ga0495599_0032418 3300046678 Bacteria 3280
632 Ga0495599_0050210 3300046678 Bacteria 2613
633 Ga0495599_0196033 3300046678 Bacteria 1241
634 Ga0495599_0405641 3300046678 Bacteria 811
635 Ga0495623_0000184 3300046679 Bacteria 39482
636 Ga0495623_0013148 3300046679 Bacteria 5366
637 Ga0495623_0017385 3300046679 Bacteria 4646
638 Ga0495646_0083212 3300046680 Bacteria 1860
639 Ga0495646_0225487 3300046680 Bacteria 1011
640 Ga0495658_0229243 3300046683 Bacteria 1164
641 Ga0495613_0006722 3300046689 Bacteria 8586
642 Ga0495624_0078166 3300046690 Bacteria 2052
643 Ga0495624_0080551 3300046690 Bacteria 2018
644 Ga0495624_0153044 3300046690 Bacteria 1410
645 Ga0495624_0189247 3300046690 Bacteria 1252
646 Ga0495624_0490734 3300046690 Bacteria 735
647 Ga0495624_0689655 3300046690 Unclassified 606
648 Ga0495600_0044741 3300046809 Bacteria 2887
649 Ga0495600_0063555 3300046809 Bacteria 2412
650 Ga0495600_0106015 3300046809 Bacteria 1831
651 Ga0495600_0183953 3300046809 Bacteria 1346
652 Ga0495600_0254864 3300046809 Bacteria 1115
653 Ga0495581_0004878 3300047315 Bacteria 7759
654 Ga0495604_0000142 3300047317 Bacteria 61620
655 Ga0495604_0002956 3300047317 Bacteria 13606
656 Ga0495604_0047887 3300047317 Bacteria 3327
657 Ga0495604_0050516 3300047317 Bacteria 3228
658 Ga0495604_0140320 3300047317 Bacteria 1727
659 Ga0495674_0003502 3300047319 Bacteria 15276
660 Ga0495674_0054318 3300047319 Bacteria 3518
661 Ga0495674_0084311 3300047319 Bacteria 2723
662 Ga0495674_0127331 3300047319 Bacteria 2147
663 Ga0495674_0147368 3300047319 Bacteria 1975
664 Ga0495674_0275688 3300047319 Bacteria 1379
665 Ga0495674_0474183 3300047319 Bacteria 1003
666 Ga0495676_0023985 3300047321 Bacteria 5287
667 Ga0495676_0760191 3300047321 Bacteria 625
668 Ga0495680_0000111 3300047322 Bacteria 76638
669 Ga0495680_0005094 3300047322 Bacteria 12403
670 Ga0495680_0006295 3300047322 Bacteria 11056
671 Ga0495680_0091051 3300047322 Bacteria 2286
672 Ga0495675_0001489 3300047444 Bacteria 14176
673 Ga0495675_0038835 3300047444 Bacteria 3031
674 Ga0495675_0227612 3300047444 Bacteria 1126
675 Ga0495684_0057283 3300047471 Bacteria 2970
676 Ga0495684_0091925 3300047471 Bacteria 2298
677 Ga0495684_0126365 3300047471 Bacteria 1923
678 Ga0495684_0341984 3300047471 Bacteria 1064
679 Ga0495593_0003863 3300047673 Bacteria 8949
680 Ga0495602_0000820 3300048088 Bacteria 29788
681 Ga0495602_0004405 3300048088 Bacteria 14696
682 Ga0495602_0041429 3300048088 Bacteria 4206
683 Ga0495602_0078803 3300048088 Bacteria 2781
684 Ga0495602_0245696 3300048088 Bacteria 1336
685 Ga0495614_0161863 3300048089 Bacteria 1001
686 Ga0496100_0035549 3300048903 Bacteria 3135
687 Ga0496100_0099113 3300048903 Bacteria 2004
688 Ga0496100_0317520 3300048903 Bacteria 1169
689 Ga0496101_0072935 3300048904 Bacteria 2521
690 Ga0496102_0057409 3300048905 Bacteria 3554
691 Ga0496102_0496346 3300048905 Bacteria 1142
692 Ga0496103_0584830 3300048906 Bacteria 712
693 Ga0496104_0036122 3300048907 Bacteria 4616
694 Ga0496104_0068528 3300048907 Bacteria 3371
695 Ga0496104_0331253 3300048907 Bacteria 1435
696 Ga0496105_0002449 3300048908 Bacteria 13426
697 Ga0496105_0023215 3300048908 Bacteria 5029
698 Ga0496105_0246766 3300048908 Bacteria 1447
699 Ga0496106_0109247 3300048909 Bacteria 2152
700 Ga0496107_0099752 3300048910 Bacteria 2128
701 Ga0496108_0010097 3300048911 Bacteria 7661
702 Ga0496108_0351906 3300048911 Bacteria 1285
703 Ga0496109_0010090 3300048912 Bacteria 8059
704 Ga0496109_0096026 3300048912 Bacteria 2745
705 Ga0496109_0247544 3300048912 Bacteria 1678
706 Ga0496109_0570633 3300048912 Bacteria 1067
707 Ga0496110_0011780 3300048913 Bacteria 7177
708 Ga0496111_0102276 3300048914 Bacteria 2106
709 Ga0496112_0000184 3300048915 Bacteria 40185
710 Ga0496112_0217418 3300048915 Bacteria 1867
711 Ga0496112_0376686 3300048915 Bacteria 1360
712 Ga0496113_0003802 3300048916 Bacteria 9131
713 Ga0496114_0087446 3300048917 Bacteria 2642
714 Ga0496114_0141329 3300048917 Bacteria 2084
715 Ga0496115_0040923 3300048918 Bacteria 3685
716 Ga0496115_0045292 3300048918 Bacteria 3511
717 Ga0496126_0045008 3300048929 Bacteria 4059
718 Ga0501038_0004414 3300049574 Bacteria 13086
719 Ga0501039_0003933 3300049575 Bacteria 11167
720 Ga0501041_0001834 3300049577 Bacteria 11904
721 Ga0501042_0004212 3300049578 Bacteria 9156
722 Ga0501042_0560681 3300049578 Bacteria 830
723 Ga0501043_0011448 3300049579 Bacteria 6946
724 Ga0501043_0020106 3300049579 Bacteria 5240
725 Ga0501046_0003864 3300049580 Bacteria 13704
726 Ga0501047_0000031 3300049581 Bacteria 215903
727 Ga0501068_0016931 3300049584 Bacteria 4210
728 Ga0501071_0003836 3300049587 Bacteria 9459
729 Ga0501074_0007110 3300049590 Bacteria 8089
730 Ga0501075_0004173 3300049591 Bacteria 9753
731 Ga0501079_0006985 3300049741 Bacteria 8509
732 Ga0501081_0000730 3300049743 Bacteria 19173
733 Ga0501083_0025481 3300049744 Bacteria 4094
734 Ga0501035_0005927 3300049822 Bacteria 11503
735 Ga0501035_0072319 3300049822 Bacteria 3052
736 Ga0501044_0011851 3300049823 Bacteria 9447
737 nmdc:mga05p37_48767_c1 3300050507 Bacteria 5208
738 nmdc:mga05p37_490287_c1 3300050507 Bacteria 1413
739 nmdc:mga09592_215828_c1 3300050508 Bacteria 1662
740 nmdc:mga0n895_292103_c1 3300050512 Bacteria 1653
741 nmdc:mga0n895_6775_c1 3300050512 Bacteria 9774
742 nmdc:mga0n895_93484_c1 3300050512 Bacteria 3011
743 nmdc:mga0rr50_392899_c1 3300050513 Bacteria 1171
744 nmdc:mga0rr50_509345_c1 3300050513 Bacteria 1024
745 nmdc:mga08x19_14122_c1 3300050514 Bacteria 4840
746 nmdc:mga08x19_240744_c1 3300050514 Bacteria 1247
747 nmdc:mga08x19_370817_c1 3300050514 Unclassified 1002
748 nmdc:mga0a205_110632_c1 3300050515 Bacteria 2646
749 nmdc:mga0a205_45417_c1 3300050515 Bacteria 4236
750 nmdc:mga0a205_55318_c1 3300050515 Bacteria 3833
751 Ga0495601_0011127 3300053077 Bacteria 5374
752 Ga0495601_0037820 3300053077 Bacteria 3017
753 Ga0495601_0053364 3300053077 Bacteria 2555
754 Ga0495601_0467908 3300053077 Bacteria 815
755 Ga0495612_0001875 3300053078 Bacteria 8646
756 Ga0495595_0007699 3300053084 Bacteria 4413
757 Ga0495595_0089134 3300053084 Bacteria 1478
758 Ga0495595_0363892 3300053084 Bacteria 731
759 Ga0495619_0018280 3300053085 Bacteria 4448
760 Ga0495619_0066334 3300053085 Bacteria 2408
761 Ga0500559_0071811 3300053136 Bacteria 1559
762 Ga0500604_0058068 3300053151 Bacteria 1209
763 Ga0500616_0005675 3300053153 Bacteria 8412
764 Ga0501084_0002745 3300054114 Bacteria 14209
765 Ga0590074_014940 3300059423 Bacteria 1315
766 Ga0587085_078600 3300059506 Bacteria 660
767 Ga0530510_0005792 3300061734 Bacteria 8565
768 2559431201 2558860280 Bacteria 11429938
769 2795784885 2795385470 Bacteria 8317180
770 2811846467 2808606982 Bacteria 7791042
771 2866553892 2866552031 Bacteria 5824618
772 2990093423 2990088156 Bacteria 6657676
773 Ga0307408_100005338
774 JGI25404J52841_10068255
775 Ga0070676_10493460
776 Ga0070683_100070903
777 Ga0070683_100784867
778 Ga0070670_100035479
779 Ga0068869_100064869
780 Ga0068869_100144283
781 Ga0070682_100053961
782 Ga0068868_100005935
783 Ga0070689_100284496
784 Ga0070691_10178270
785 Ga0070691_10546116
786 Ga0070661_100048775
787 Ga0070692_10036116
788 Ga0070669_100107618
789 Ga0070669_100919316
790 Ga0070675_100047603
791 Ga0070675_100182226
792 Ga0070673_101192407
793 Ga0070659_100069690
794 Ga0070667_100131393
795 Ga0070709_10007200
796 Ga0070709_10051801
797 Ga0070714_100001010
798 Ga0070714_100002215
799 Ga0070714_100004737
800 Ga0070714_100054899
801 Ga0070714_100122193
802 Ga0070714_100125614
803 Ga0070714_100208436
804 Ga0070714_100264905
805 Ga0070714_100353057
806 Ga0070714_101381985
807 Ga0070713_100008165
808 Ga0070713_100012039
809 Ga0070713_100018297
810 Ga0070713_100096315
811 Ga0070713_100102284
812 Ga0070713_100251368
813 Ga0070713_100497425
814 Ga0070713_101810283
815 Ga0070710_10003859
816 Ga0070710_10004623
817 Ga0070710_10005150
818 Ga0070710_10200632
819 Ga0070711_100032580
820 Ga0070711_100073170
821 Ga0070711_100124696
822 Ga0070711_100431116
823 Ga0070705_100093614
824 Ga0070700_100284469
825 Ga0070694_100015334
826 Ga0070694_100646065
827 Ga0070708_100001327
828 Ga0070708_100020080
829 Ga0070708_100020642
830 Ga0070708_100091089
831 Ga0070708_100128708
832 Ga0070708_100222907
833 Ga0070708_100344251
834 Ga0070708_100560494
835 Ga0070663_100751005
836 Ga0070678_100036643
837 Ga0070662_100018037
838 Ga0070662_100077684
839 Ga0070681_10516303
840 Ga0070685_10144584
841 Ga0070706_100016163
842 Ga0070706_100018392
843 Ga0070706_100023038
844 Ga0070706_100090355
845 Ga0070706_100178027
846 Ga0070706_100203483
847 Ga0070706_100797103
848 Ga0070706_100818939
849 Ga0070707_100009673
850 Ga0070707_100011405
851 Ga0070707_100016313
852 Ga0070707_100019178
853 Ga0070707_100024357
854 Ga0070707_100058617
855 Ga0070707_100101475
856 Ga0070707_100179222
857 Ga0070707_100244008
858 Ga0070707_100350788
859 Ga0070698_100000319
860 Ga0070698_100001247
861 Ga0070698_100004646
862 Ga0070698_100005647
863 Ga0070698_100111037
864 Ga0070698_100129729
865 Ga0070698_100166626
866 Ga0070698_100274722
867 Ga0070699_100199485
868 Ga0070699_100569926
869 Ga0070679_100869309
870 Ga0070684_100033277
871 Ga0070684_100507153
872 Ga0070697_100075313
873 Ga0070697_100086845
874 Ga0070697_100090922
875 Ga0070697_100224063
876 Ga0068853_100014389
877 Ga0068853_100746545
878 Ga0070686_100033047
879 Ga0070695_100033414
880 Ga0070696_100024799
881 Ga0070696_100081166
882 Ga0070693_100014606
883 Ga0070693_100912750
884 Ga0070665_100341935
885 Ga0070704_100347439
886 Ga0068855_100058253
887 Ga0068855_100107357
888 Ga0070664_100000100
889 Ga0070664_100347733
890 Ga0068857_100012182
891 Ga0068857_100088212
892 Ga0068857_100116722
893 Ga0068854_100449191
894 Ga0068856_100012630
895 Ga0068856_100060491
896 Ga0068856_100093626
897 Ga0070702_100028652
898 Ga0070702_100283370
899 Ga0068852_100088441
900 Ga0068852_101028808
901 Ga0068864_100450971
902 Ga0068861_100072262
903 Ga0068870_10236675
904 Ga0068863_100223278
905 Ga0068863_100235921
906 Ga0068858_100313367
907 Ga0068862_100127844
908 Ga0068862_100400621
909 Ga0081455_10016693
910 Ga0081538_10015961
911 Ga0081538_10064842
912 Ga0081540_1000130
913 Ga0081540_1004092
914 Ga0081540_1056001
915 Ga0081540_1089553
916 Ga0070717_10010873
917 Ga0070717_10046671
918 Ga0070717_10065911
919 Ga0070717_10066162
920 Ga0070717_10148794
921 Ga0070717_10157678
922 Ga0070717_10330916
923 Ga0070717_10379392
924 Ga0070717_10644501
925 Ga0070717_10964284
926 Ga0070715_10005251
927 Ga0070715_10015091
928 Ga0070715_10018662
929 Ga0070715_10024955
930 Ga0070716_100001534
931 Ga0070716_100006455
932 Ga0070716_100238641
933 Ga0070716_100570672
934 Ga0070712_100007951
935 Ga0070712_100024703
936 Ga0070712_100054612
937 Ga0070712_100275025
938 Ga0070712_100760461
939 Ga0070712_100848716
940 Ga0097621_100153799
941 Ga0068871_100116068
942 Ga0068871_100442456
943 Ga0075433_10009897
944 Ga0075433_10028568
945 Ga0075433_10276819
946 Ga0075434_100007625
947 Ga0075434_100146637
948 Ga0075434_100707867
949 Ga0075429_100285194
950 Ga0068865_100038579
951 Ga0068865_100041412
952 Ga0075436_100010364
953 Ga0075436_100045437
954 Ga0075436_100066655
955 Ga0075436_100662442
956 Ga0075435_100051730
957 Ga0075435_100078422
958 Ga0075435_100137683
959 Ga0075435_100282656
960 Ga0075435_100761346
961 Ga0099794_10093591
962 Ga0099795_10113050
963 Ga0099795_10306358
964 Ga0105240_10059569
965 Ga0111539_10003076
966 Ga0111539_10047678
967 Ga0111539_10123155
968 Ga0105245_10049990
969 Ga0105245_10313176
970 Ga0105245_12258827
971 Ga0114129_10005099
972 Ga0114129_10638865
973 Ga0114129_11991947
974 Ga0105241_10125958
975 Ga0105241_10144383
976 Ga0105241_10213263
977 Ga0105241_11761036
978 Ga0105242_10063619
979 Ga0105248_10048664
980 Ga0105237_10117691
981 Ga0105237_10125170
982 Ga0105237_10130239
983 Ga0105237_10175878
984 Ga0105237_11470312
985 Ga0105238_10102362
986 Ga0105249_10016717
987 Ga0105239_10020163
988 Ga0105239_10216668
989 Ga0105239_10653154
990 Ga0105239_11151751
991 Ga0105246_10081269
992 Ga0105246_10657963
993 Ga0105246_11436169
994 Ga0157373_10381534
995 Ga0157371_10047334
996 Ga0157370_10030431
997 Ga0157378_10066752
998 Ga0163162_10182251
999 Ga0157375_10309052
1000 Ga0163163_10248344
1001 Ga0163163_11476644
1002 Ga0157380_10099030
1003 Ga0157377_10030312
1004 Ga0157377_10032643
1005 Ga0157379_10006261
1006 Ga0157376_11151352
1007 Ga0163161_10062730
1008 Ga0197907_10615449
1009 Ga0213876_10158652
1010 Ga0224712_10215587
1011 Ga0224572_1047138
1012 Ga0207656_10235650
1013 Ga0207653_10002312
1014 Ga0207692_10001157
1015 Ga0207692_10004265
1016 Ga0207692_10019311
1017 Ga0207692_10227591
1018 Ga0207642_10089549
1019 Ga0207642_10456320
1020 Ga0207710_10023890
1021 Ga0207688_10008232
1022 Ga0207647_10092248
1023 Ga0207685_10021103
1024 Ga0207685_10045874
1025 Ga0207685_10055220
1026 Ga0207685_10106816
1027 Ga0207685_10282186
1028 Ga0207699_10002999
1029 Ga0207699_10017902
1030 Ga0207699_10068477
1031 Ga0207699_10077108
1032 Ga0207699_10105289
1033 Ga0207645_10440071
1034 Ga0207684_10008075
1035 Ga0207684_10009534
1036 Ga0207684_10013951
1037 Ga0207684_10014185
1038 Ga0207684_10019945
1039 Ga0207684_10045800
1040 Ga0207684_10185575
1041 Ga0207684_10225775
1042 Ga0207684_10401451
1043 Ga0207684_10690990
1044 Ga0207684_10777170
1045 Ga0207654_10135929
1046 Ga0207654_10753922
1047 Ga0207671_10084427
1048 Ga0207693_10003808
1049 Ga0207693_10012679
1050 Ga0207693_10100235
1051 Ga0207663_10039426
1052 Ga0207663_10069979
1053 Ga0207663_10168104
1054 Ga0207660_10406710
1055 Ga0207662_10077872
1056 Ga0207657_10283709
1057 Ga0207649_10040895
1058 Ga0207649_10894606
1059 Ga0207652_10473015
1060 Ga0207646_10000511
1061 Ga0207646_10003046
1062 Ga0207646_10005034
1063 Ga0207646_10014472
1064 Ga0207646_10049185
1065 Ga0207646_10056908
1066 Ga0207646_10117742
1067 Ga0207646_10149187
1068 Ga0207646_10324819
1069 Ga0207681_10064458
1070 Ga0207694_10098084
1071 Ga0207694_10222041
1072 Ga0207650_10023763
1073 Ga0207659_10032241
1074 Ga0207687_10035764
1075 Ga0207687_10614666
1076 Ga0207700_10019617
1077 Ga0207700_10034078
1078 Ga0207700_10071725
1079 Ga0207700_10080816
1080 Ga0207700_10111386
1081 Ga0207700_10519910
1082 Ga0207664_10001881
1083 Ga0207664_10004113
1084 Ga0207664_10004491
1085 Ga0207664_10004915
1086 Ga0207664_10139170
1087 Ga0207664_10144363
1088 Ga0207664_10239566
1089 Ga0207664_10315530
1090 Ga0207664_10618389
1091 Ga0207664_10981011
1092 Ga0207644_10717408
1093 Ga0207690_10026581
1094 Ga0207690_10049873
1095 Ga0207706_10003790
1096 Ga0207706_10231811
1097 Ga0207704_10022983
1098 Ga0207704_10155310
1099 Ga0207665_10002597
1100 Ga0207665_10015571
1101 Ga0207665_10105650
1102 Ga0207665_10402452
1103 Ga0207711_10188364
1104 Ga0207689_10027319
1105 Ga0207689_10092782
1106 Ga0207661_10061670
1107 Ga0207667_10044234
1108 Ga0207667_10053071
1109 Ga0207667_10191813
1110 Ga0207667_10714821
1111 Ga0207668_10365036
1112 Ga0207668_10523358
1113 Ga0207668_11259698
1114 Ga0207640_10436114
1115 Ga0207677_10023071
1116 Ga0207703_10145409
1117 Ga0207639_10028967
1118 Ga0207639_10498410
1119 Ga0207678_10051482
1120 Ga0207708_10001406
1121 Ga0207702_10286750
1122 Ga0207702_11531351
1123 Ga0207641_10915759
1124 Ga0207676_10202150
1125 Ga0207676_10394148
1126 Ga0207676_10924919
1127 Ga0207674_10104400
1128 Ga0207674_10185688
1129 Ga0207675_100022932
1130 Ga0207675_100272278
1131 Ga0207675_100306189
1132 Ga0207683_10003345
1133 Ga0207683_10286432
1134 Ga0207698_10282313
1135 Ga0207428_10980183
1136 Ga0268265_10226793
1137 Ga0307515_10000229
1138 Ga0307511_10010993
1139 Ga0265766_1005764
1140 Ga0265765_1025361
1141 Ga0265768_103515
1142 Ga0307513_10000383
1143 Ga0307509_10118689
1144 Ga0307408_100008318
1145 Ga0307408_100076758
1146 Ga0307408_100211113
1147 Ga0307516_10003386
1148 Ga0307405_10000342
1149 Ga0307405_10059830
1150 Ga0307405_10104862
1151 Ga0307405_10362360
1152 Ga0307405_10803400
1153 Ga0307413_10135330
1154 Ga0307413_10357895
1155 Ga0307413_10930437
1156 Ga0307410_10001165
1157 Ga0307410_10073235
1158 Ga0307410_10195983
1159 Ga0307410_10265027
1160 Ga0307410_10566642
1161 Ga0307410_10779645
1162 Ga0326468_10003665
1163 Ga0307406_10000157
1164 Ga0307406_10016128
1165 Ga0307406_10026023
1166 Ga0307406_10055868
1167 Ga0307406_10089467
1168 Ga0307407_10000177
1169 Ga0307407_10033316
1170 Ga0307407_10156092
1171 Ga0307407_10283322
1172 Ga0307407_10663210
1173 Ga0307412_10079932
1174 Ga0307412_10158923
1175 Ga0307412_10432825
1176 Ga0307412_11691567
1177 Ga0307409_100000258
1178 Ga0307409_100005108
1179 Ga0307409_100184674
1180 Ga0307409_100525579
1181 Ga0307409_100554543
1182 Ga0307416_100000321
1183 Ga0307416_100007263
1184 Ga0307416_100139955
1185 Ga0307416_100327081
1186 Ga0307416_100558110
1187 Ga0307416_100739062
1188 Ga0307414_10038749
1189 Ga0307414_10381953
1190 Ga0307411_10031603
1191 Ga0307415_100000080
1192 Ga0307415_100018041
1193 Ga0307415_100049304
1194 Ga0307415_100074555
1195 Ga0307415_100324410
1196 Ga0307415_100335780
1197 Ga0307507_10015090
1198 Ga0373930_0007975
1199 Ga0373948_0103248
1200 Ga0373950_0008388
1201 Ga0373958_0007766
1202 Ga0373959_0014273
1203 Ga0373926_0001111
1204 Ga0373928_0005389
1205 Ga0373928_0075138
1206 Ga0373929_0052187
1207 Ga0373934_0000165
1208 Ga0373934_0022630
1209 Ga0373940_0145272
1210 Ga0373949_0011260
1211 Ga0373951_0043392
1212 Ga0373952_0020264
1213 Ga0373923_0007124
1214 Ga0373923_0044279
1215 Ga0373923_0078686
1216 Ga0373932_0073112
1217 Ga0373936_0001132
1218 Ga0373936_0076574
1219 Ga0373936_0083390
1220 Ga0373936_0284333
1221 Ga0373939_0105236
1222 Ga0373939_0330129
1223 Ga0373941_0038746
1224 Ga0373945_0077527
1225 Ga0373945_0178069
1226 Ga0373945_0257045
1227 Ga0373953_0000062
1228 Ga0373954_0000701
1229 Ga0373954_0039432
1230 Ga0373954_0057756
1231 Ga0373954_0085410
1232 Ga0373954_0206786
1233 Ga0373956_0000061
1234 Ga0373956_0026014
1235 Ga0373956_0089832
1236 Ga0373956_0213486
1237 Ga0373957_0000042
1238 Ga0373957_0032000
1239 Ga0373957_0104270
1240 Ga0373957_0142431
1241 Ga0373955_0000106
1242 Ga0373955_0044685
1243 Ga0373955_0127993
1244 Ga0373955_0167124
1245 Ga0373942_0032967
1246 Ga0373962_0012829
1247 Ga0373924_0007857
1248 Ga0373924_0010874
1249 Ga0373924_0454280
1250 Ga0373931_0016509
1251 Ga0373931_0275921
1252 Ga0373935_0001664
1253 Ga0373935_0007757
1254 Ga0373935_0058944
1255 Ga0373935_0313481
1256 Ga0373935_0836806
1257 Ga0373927_0205325
1258 Ga0373933_0000046
1259 Ga0373933_0000764
1260 Ga0373933_0005963
1261 Ga0373933_0020037
1262 Ga0373933_0132446
1263 Ga0373947_0000017
1264 Ga0373947_0030240
1265 Ga0373947_0279008
1266 Ga0373947_0348488
1267 Ga0373947_0496709
1268 Ga0373937_0000115
1269 Ga0373937_0002923
1270 Ga0373937_0009930
1271 Ga0373937_0018604
1272 Ga0373937_0045905
1273 Ga0373937_1334131
1274 Ga0373925_0014582
1275 Ga0373925_0044387
1276 Ga0373925_0381641
1277 Ga0373925_1000666
1278 Ga0395899_0141575
1279 Ga0395899_0336724
1280 Ga0395900_0319572
1281 Ga0395900_0784291
1282 Ga0395898_0078288
1283 Ga0395898_0081831
1284 Ga0395898_0200542
1285 Ga0395905_0241197
1286 Ga0436364_0018972
1287 Ga0436364_0193061
1288 Ga0436364_1222187
1289 Ga0395901_0116073
1290 Ga0436365_0769649
1291 Ga0436365_0864774
1292 Ga0436363_1395795
1293 Ga0451833_0092015
1294 Ga0439448_0023721
1295 Ga0439450_056441
1296 Ga0439464_0181419
1297 Ga0439440_0029692
1298 Ga0466969_0044599
1299 Ga0466969_0067107
1300 Ga0466969_0259269
1301 Ga0466966_0016233
1302 Ga0466966_0035174
1303 Ga0466966_0068529
1304 Ga0466961_0025632
1305 Ga0466961_0026163
1306 Ga0466963_0024305
1307 Ga0466963_0026912
1308 Ga0466963_0098811
1309 Ga0466963_0283774
1310 Ga0466970_0021915
1311 Ga0466970_0072563
1312 Ga0466957_0012941
1313 Ga0466960_0086197
1314 Ga0466959_0061956
1315 Ga0466959_0388084
1316 Ga0466958_0009978
1317 Ga0466967_0029151
1318 Ga0466967_0034742
1319 Ga0466967_0043781
1320 Ga0466967_0059236
1321 Ga0466967_0180519
1322 Ga0466967_0337627
1323 Ga0466967_0369823
1324 Ga0466967_0718267
1325 Ga0495592_0000166
1326 Ga0495592_0013099
1327 Ga0495592_0096440
1328 Ga0495592_0108418
1329 Ga0495629_0025973
1330 Ga0495629_0403786
1331 Ga0495641_0014800
1332 Ga0495641_0086212
1333 Ga0495651_0000067
1334 Ga0495651_0011292
1335 Ga0495651_0170462
1336 Ga0495651_0229751
1337 Ga0495651_0510447
1338 Ga0495653_0010757
1339 Ga0495653_0012034
1340 Ga0495653_0023951
1341 Ga0495653_0221864
1342 Ga0495653_0574263
1343 Ga0495580_0221996
1344 Ga0495582_0041278
1345 Ga0495582_0106287
1346 Ga0495639_0132420
1347 Ga0495662_0005716
1348 Ga0495662_0027072
1349 Ga0495664_0016454
1350 Ga0495664_0027093
1351 Ga0495608_0000850
1352 Ga0495608_0101796
1353 Ga0495608_0105356
1354 Ga0495608_0175744
1355 Ga0495608_0792993
1356 Ga0495618_0019512
1357 Ga0495628_0000916
1358 Ga0495628_0101958
1359 Ga0495628_0123675
1360 Ga0495630_0190999
1361 Ga0495630_0516761
1362 Ga0495652_0007308
1363 Ga0495652_0028603
1364 Ga0495652_0047780
1365 Ga0495652_0145468
1366 Ga0495652_0235786
1367 Ga0495665_0054413
1368 Ga0495665_0104071
1369 Ga0495665_0267176
1370 Ga0495640_0018433
1371 Ga0495640_0020499
1372 Ga0495640_0036929
1373 Ga0495640_0083171
1374 Ga0495640_0688277
1375 Ga0495586_0029041
1376 Ga0495587_0000078
1377 Ga0495587_0015551
1378 Ga0495587_0052225
1379 Ga0495587_0075032
1380 Ga0495645_0017608
1381 Ga0495645_0021043
1382 Ga0495645_0061609
1383 Ga0495645_0097555
1384 Ga0495645_0149779
1385 Ga0495645_0685112
1386 Ga0495667_0000122
1387 Ga0495667_0062341
1388 Ga0495667_0158763
1389 Ga0495667_0176125
1390 Ga0495634_0005904
1391 Ga0495634_0064262
1392 Ga0495635_0056438
1393 Ga0495635_0131712
1394 Ga0495635_0242631
1395 Ga0495635_0261713
1396 Ga0495635_0410592
1397 Ga0495657_0000098
1398 Ga0495657_0030849
1399 Ga0495657_0034083
1400 Ga0495657_0034763
1401 Ga0495657_0279431
1402 Ga0495599_0000115
1403 Ga0495599_0032418
1404 Ga0495599_0050210
1405 Ga0495599_0196033
1406 Ga0495599_0405641
1407 Ga0495623_0000184
1408 Ga0495623_0013148
1409 Ga0495623_0017385
1410 Ga0495646_0083212
1411 Ga0495646_0225487
1412 Ga0495658_0229243
1413 Ga0495613_0006722
1414 Ga0495624_0078166
1415 Ga0495624_0080551
1416 Ga0495624_0153044
1417 Ga0495624_0189247
1418 Ga0495624_0490734
1419 Ga0495624_0689655
1420 Ga0495600_0044741
1421 Ga0495600_0063555
1422 Ga0495600_0106015
1423 Ga0495600_0183953
1424 Ga0495600_0254864
1425 Ga0495581_0004878
1426 Ga0495604_0000142
1427 Ga0495604_0002956
1428 Ga0495604_0047887
1429 Ga0495604_0050516
1430 Ga0495604_0140320
1431 Ga0495674_0003502
1432 Ga0495674_0054318
1433 Ga0495674_0084311
1434 Ga0495674_0127331
1435 Ga0495674_0147368
1436 Ga0495674_0275688
1437 Ga0495674_0474183
1438 Ga0495676_0023985
1439 Ga0495676_0760191
1440 Ga0495680_0000111
1441 Ga0495680_0005094
1442 Ga0495680_0006295
1443 Ga0495680_0091051
1444 Ga0495675_0001489
1445 Ga0495675_0038835
1446 Ga0495675_0227612
1447 Ga0495684_0057283
1448 Ga0495684_0091925
1449 Ga0495684_0126365
1450 Ga0495684_0341984
1451 Ga0495593_0003863
1452 Ga0495602_0000820
1453 Ga0495602_0004405
1454 Ga0495602_0041429
1455 Ga0495602_0078803
1456 Ga0495602_0245696
1457 Ga0495614_0161863
1458 Ga0496100_0035549
1459 Ga0496100_0099113
1460 Ga0496100_0317520
1461 Ga0496101_0072935
1462 Ga0496102_0057409
1463 Ga0496102_0496346
1464 Ga0496103_0584830
1465 Ga0496104_0036122
1466 Ga0496104_0068528
1467 Ga0496104_0331253
1468 Ga0496105_0002449
1469 Ga0496105_0023215
1470 Ga0496105_0246766
1471 Ga0496106_0109247
1472 Ga0496107_0099752
1473 Ga0496108_0010097
1474 Ga0496108_0351906
1475 Ga0496109_0010090
1476 Ga0496109_0096026
1477 Ga0496109_0247544
1478 Ga0496109_0570633
1479 Ga0496110_0011780
1480 Ga0496111_0102276
1481 Ga0496112_0000184
1482 Ga0496112_0217418
1483 Ga0496112_0376686
1484 Ga0496113_0003802
1485 Ga0496114_0087446
1486 Ga0496114_0141329
1487 Ga0496115_0040923
1488 Ga0496115_0045292
1489 Ga0496126_0045008
1490 Ga0501038_0004414
1491 Ga0501039_0003933
1492 Ga0501041_0001834
1493 Ga0501042_0004212
1494 Ga0501042_0560681
1495 Ga0501043_0011448
1496 Ga0501043_0020106
1497 Ga0501046_0003864
1498 Ga0501047_0000031
1499 Ga0501068_0016931
1500 Ga0501071_0003836
1501 Ga0501074_0007110
1502 Ga0501075_0004173
1503 Ga0501079_0006985
1504 Ga0501081_0000730
1505 Ga0501083_0025481
1506 Ga0501035_0005927
1507 Ga0501035_0072319
1508 Ga0501044_0011851
1509 nmdc:mga05p37_48767_c1
1510 nmdc:mga05p37_490287_c1
1511 nmdc:mga09592_215828_c1
1512 nmdc:mga0n895_292103_c1
1513 nmdc:mga0n895_6775_c1
1514 nmdc:mga0n895_93484_c1
1515 nmdc:mga0rr50_392899_c1
1516 nmdc:mga0rr50_509345_c1
1517 nmdc:mga08x19_14122_c1
1518 nmdc:mga08x19_240744_c1
1519 nmdc:mga08x19_370817_c1
1520 nmdc:mga0a205_110632_c1
1521 nmdc:mga0a205_45417_c1
1522 nmdc:mga0a205_55318_c1
1523 Ga0495601_0011127
1524 Ga0495601_0037820
1525 Ga0495601_0053364
1526 Ga0495601_0467908
1527 Ga0495612_0001875
1528 Ga0495595_0007699
1529 Ga0495595_0089134
1530 Ga0495595_0363892
1531 Ga0495619_0018280
1532 Ga0495619_0066334
1533 Ga0500559_0071811
1534 Ga0500604_0058068
1535 Ga0500616_0005675
1536 Ga0501084_0002745
1537 Ga0590074_014940
1538 Ga0587085_078600
1539 Ga0530510_0005792
1540 2559431201
1541 2795784885
1542 2811846467
1543 2866553892
1544 2990093423

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

63

183

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8207 34 161
5vb0-assembly6.cif.gz_H crystal structure of fosfomycin resistance protein fosa3 0.8194 34 163
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8189 36 161
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.8183 32 161
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8182 36 157
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8356 35 93 3.10.180.10
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8214 40 157 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8207 36 161 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8189 36 161 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8126 36 161 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A261CVE0-F1-model_v4 Glyoxalase 0.9777 10 171
AF-A0A069JIC4-F1-model_v4 merged 0.9742 4 171
AF-A0A554UZH7-F1-model_v4 VOC family protein 0.9734 8 171
AF-A0A358SJ16-F1-model_v4 VOC family protein 0.9724 1 172
AF-A0A2W6D648-F1-model_v4 VOC family protein 0.9698 25 171

Map