F480122
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 330 | 1544 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100005338|Ga0307408_10000533811 |
| Length | 198 |
| Sequence | MTATGPPEIPDNDLPAARPADQTGGTMAQPQGAELEEIRARRERLRERYLRPVAERAATTAAGVHHVALICRDVEETVRFYQEFLGFPLVELVENRDYPGSSHFFFDIGNHNLLGFFDFPGHDHPPFTETIGGVQHIAISVSAEQFAAARRRLDEAGVEYLGPDRGVDDSLYFRDPNGVGLELYREDLGLFLGHPLLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 159 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 164 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 178 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 181 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 182 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 184 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 186 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 221 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 222 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 223 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 320 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 326 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 327 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 328 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 329 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 330 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.58 |
| Metatranscriptomes | 0.78 |
| Isolates | 0.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.39 |
| Nodule | 0 |
| Rhizoplane | 4.02 |
| Rhizosphere | 93.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307408_100005338 | 3300031548 | Bacteria | 8608 |
| 2 | JGI25404J52841_10068255 | 3300003659 | Bacteria | 743 |
| 3 | Ga0070676_10493460 | 3300005328 | Unclassified | 868 |
| 4 | Ga0070683_100070903 | 3300005329 | Bacteria | 3251 |
| 5 | Ga0070683_100784867 | 3300005329 | Bacteria | 913 |
| 6 | Ga0070670_100035479 | 3300005331 | Bacteria | 4293 |
| 7 | Ga0068869_100064869 | 3300005334 | Bacteria | 2687 |
| 8 | Ga0068869_100144283 | 3300005334 | Bacteria | 1841 |
| 9 | Ga0070682_100053961 | 3300005337 | Bacteria | 2520 |
| 10 | Ga0068868_100005935 | 3300005338 | Bacteria | 8613 |
| 11 | Ga0070689_100284496 | 3300005340 | Bacteria | 1372 |
| 12 | Ga0070691_10178270 | 3300005341 | Bacteria | 1105 |
| 13 | Ga0070691_10546116 | 3300005341 | Bacteria | 676 |
| 14 | Ga0070661_100048775 | 3300005344 | Bacteria | 3100 |
| 15 | Ga0070692_10036116 | 3300005345 | Bacteria | 2506 |
| 16 | Ga0070669_100107618 | 3300005353 | Bacteria | 2112 |
| 17 | Ga0070669_100919316 | 3300005353 | Unclassified | 748 |
| 18 | Ga0070675_100047603 | 3300005354 | Bacteria | 3513 |
| 19 | Ga0070675_100182226 | 3300005354 | Bacteria | 1816 |
| 20 | Ga0070673_101192407 | 3300005364 | Bacteria | 713 |
| 21 | Ga0070659_100069690 | 3300005366 | Bacteria | 2792 |
| 22 | Ga0070667_100131393 | 3300005367 | Bacteria | 2186 |
| 23 | Ga0070709_10007200 | 3300005434 | Bacteria | 6096 |
| 24 | Ga0070709_10051801 | 3300005434 | Bacteria | 2577 |
| 25 | Ga0070714_100001010 | 3300005435 | Bacteria | 20084 |
| 26 | Ga0070714_100002215 | 3300005435 | Bacteria | 14317 |
| 27 | Ga0070714_100004737 | 3300005435 | Bacteria | 10298 |
| 28 | Ga0070714_100054899 | 3300005435 | Bacteria | 3404 |
| 29 | Ga0070714_100122193 | 3300005435 | Bacteria | 2317 |
| 30 | Ga0070714_100125614 | 3300005435 | Bacteria | 2287 |
| 31 | Ga0070714_100208436 | 3300005435 | Bacteria | 1791 |
| 32 | Ga0070714_100264905 | 3300005435 | Bacteria | 1592 |
| 33 | Ga0070714_100353057 | 3300005435 | Bacteria | 1381 |
| 34 | Ga0070714_101381985 | 3300005435 | Bacteria | 687 |
| 35 | Ga0070713_100008165 | 3300005436 | Bacteria | 7413 |
| 36 | Ga0070713_100012039 | 3300005436 | Bacteria | 6334 |
| 37 | Ga0070713_100018297 | 3300005436 | Bacteria | 5326 |
| 38 | Ga0070713_100096315 | 3300005436 | Bacteria | 2555 |
| 39 | Ga0070713_100102284 | 3300005436 | Bacteria | 2484 |
| 40 | Ga0070713_100251368 | 3300005436 | Bacteria | 1612 |
| 41 | Ga0070713_100497425 | 3300005436 | Bacteria | 1150 |
| 42 | Ga0070713_101810283 | 3300005436 | Bacteria | 593 |
| 43 | Ga0070710_10003859 | 3300005437 | Bacteria | 7093 |
| 44 | Ga0070710_10004623 | 3300005437 | Bacteria | 6508 |
| 45 | Ga0070710_10005150 | 3300005437 | Bacteria | 6187 |
| 46 | Ga0070710_10200632 | 3300005437 | Bacteria | 1259 |
| 47 | Ga0070711_100032580 | 3300005439 | Bacteria | 3465 |
| 48 | Ga0070711_100073170 | 3300005439 | Bacteria | 2420 |
| 49 | Ga0070711_100124696 | 3300005439 | Bacteria | 1910 |
| 50 | Ga0070711_100431116 | 3300005439 | Bacteria | 1076 |
| 51 | Ga0070705_100093614 | 3300005440 | Bacteria | 1879 |
| 52 | Ga0070700_100284469 | 3300005441 | Bacteria | 1200 |
| 53 | Ga0070694_100015334 | 3300005444 | Bacteria | 4811 |
| 54 | Ga0070694_100646065 | 3300005444 | Bacteria | 856 |
| 55 | Ga0070708_100001327 | 3300005445 | Bacteria | 18931 |
| 56 | Ga0070708_100020080 | 3300005445 | Bacteria | 5627 |
| 57 | Ga0070708_100020642 | 3300005445 | Bacteria | 5559 |
| 58 | Ga0070708_100091089 | 3300005445 | Bacteria | 2776 |
| 59 | Ga0070708_100128708 | 3300005445 | Bacteria | 2342 |
| 60 | Ga0070708_100222907 | 3300005445 | Bacteria | 1768 |
| 61 | Ga0070708_100344251 | 3300005445 | Bacteria | 1405 |
| 62 | Ga0070708_100560494 | 3300005445 | Bacteria | 1077 |
| 63 | Ga0070663_100751005 | 3300005455 | Bacteria | 833 |
| 64 | Ga0070678_100036643 | 3300005456 | Bacteria | 3435 |
| 65 | Ga0070662_100018037 | 3300005457 | Bacteria | 4768 |
| 66 | Ga0070662_100077684 | 3300005457 | Bacteria | 2464 |
| 67 | Ga0070681_10516303 | 3300005458 | Bacteria | 1108 |
| 68 | Ga0070685_10144584 | 3300005466 | Bacteria | 1501 |
| 69 | Ga0070706_100016163 | 3300005467 | Bacteria | 6892 |
| 70 | Ga0070706_100018392 | 3300005467 | Bacteria | 6446 |
| 71 | Ga0070706_100023038 | 3300005467 | Bacteria | 5735 |
| 72 | Ga0070706_100090355 | 3300005467 | Bacteria | 2840 |
| 73 | Ga0070706_100178027 | 3300005467 | Bacteria | 1985 |
| 74 | Ga0070706_100203483 | 3300005467 | Bacteria | 1849 |
| 75 | Ga0070706_100797103 | 3300005467 | Bacteria | 874 |
| 76 | Ga0070706_100818939 | 3300005467 | Bacteria | 861 |
| 77 | Ga0070707_100009673 | 3300005468 | Bacteria | 8960 |
| 78 | Ga0070707_100011405 | 3300005468 | Bacteria | 8287 |
| 79 | Ga0070707_100016313 | 3300005468 | Bacteria | 6972 |
| 80 | Ga0070707_100019178 | 3300005468 | Bacteria | 6443 |
| 81 | Ga0070707_100024357 | 3300005468 | Bacteria | 5731 |
| 82 | Ga0070707_100058617 | 3300005468 | Bacteria | 3692 |
| 83 | Ga0070707_100101475 | 3300005468 | Bacteria | 2788 |
| 84 | Ga0070707_100179222 | 3300005468 | Bacteria | 2065 |
| 85 | Ga0070707_100244008 | 3300005468 | Bacteria | 1748 |
| 86 | Ga0070707_100350788 | 3300005468 | Bacteria | 1433 |
| 87 | Ga0070698_100000319 | 3300005471 | Bacteria | 48961 |
| 88 | Ga0070698_100001247 | 3300005471 | Bacteria | 28403 |
| 89 | Ga0070698_100004646 | 3300005471 | Bacteria | 15100 |
| 90 | Ga0070698_100005647 | 3300005471 | Bacteria | 13693 |
| 91 | Ga0070698_100111037 | 3300005471 | Bacteria | 2706 |
| 92 | Ga0070698_100129729 | 3300005471 | Bacteria | 2477 |
| 93 | Ga0070698_100166626 | 3300005471 | Bacteria | 2146 |
| 94 | Ga0070698_100274722 | 3300005471 | Bacteria | 1617 |
| 95 | Ga0070699_100199485 | 3300005518 | Bacteria | 1779 |
| 96 | Ga0070699_100569926 | 3300005518 | Unclassified | 1031 |
| 97 | Ga0070679_100869309 | 3300005530 | Bacteria | 845 |
| 98 | Ga0070684_100033277 | 3300005535 | Bacteria | 4400 |
| 99 | Ga0070684_100507153 | 3300005535 | Unclassified | 1118 |
| 100 | Ga0070697_100075313 | 3300005536 | Bacteria | 2774 |
| 101 | Ga0070697_100086845 | 3300005536 | Bacteria | 2582 |
| 102 | Ga0070697_100090922 | 3300005536 | Bacteria | 2523 |
| 103 | Ga0070697_100224063 | 3300005536 | Bacteria | 1603 |
| 104 | Ga0068853_100014389 | 3300005539 | Bacteria | 6479 |
| 105 | Ga0068853_100746545 | 3300005539 | Bacteria | 935 |
| 106 | Ga0070686_100033047 | 3300005544 | Bacteria | 3176 |
| 107 | Ga0070695_100033414 | 3300005545 | Bacteria | 3218 |
| 108 | Ga0070696_100024799 | 3300005546 | Bacteria | 4075 |
| 109 | Ga0070696_100081166 | 3300005546 | Bacteria | 2297 |
| 110 | Ga0070693_100014606 | 3300005547 | Bacteria | 4027 |
| 111 | Ga0070693_100912750 | 3300005547 | Bacteria | 659 |
| 112 | Ga0070665_100341935 | 3300005548 | Bacteria | 1501 |
| 113 | Ga0070704_100347439 | 3300005549 | Bacteria | 1251 |
| 114 | Ga0068855_100058253 | 3300005563 | Bacteria | 4525 |
| 115 | Ga0068855_100107357 | 3300005563 | Bacteria | 3207 |
| 116 | Ga0070664_100000100 | 3300005564 | Bacteria | 55301 |
| 117 | Ga0070664_100347733 | 3300005564 | Bacteria | 1348 |
| 118 | Ga0068857_100012182 | 3300005577 | Bacteria | 7479 |
| 119 | Ga0068857_100088212 | 3300005577 | Bacteria | 2775 |
| 120 | Ga0068857_100116722 | 3300005577 | Bacteria | 2401 |
| 121 | Ga0068854_100449191 | 3300005578 | Bacteria | 1076 |
| 122 | Ga0068856_100012630 | 3300005614 | Bacteria | 8177 |
| 123 | Ga0068856_100060491 | 3300005614 | Bacteria | 3742 |
| 124 | Ga0068856_100093626 | 3300005614 | Bacteria | 2990 |
| 125 | Ga0070702_100028652 | 3300005615 | Bacteria | 3019 |
| 126 | Ga0070702_100283370 | 3300005615 | Bacteria | 1139 |
| 127 | Ga0068852_100088441 | 3300005616 | Bacteria | 2767 |
| 128 | Ga0068852_101028808 | 3300005616 | Bacteria | 843 |
| 129 | Ga0068864_100450971 | 3300005618 | Bacteria | 1230 |
| 130 | Ga0068861_100072262 | 3300005719 | Bacteria | 2676 |
| 131 | Ga0068870_10236675 | 3300005840 | Bacteria | 1125 |
| 132 | Ga0068863_100223278 | 3300005841 | Bacteria | 1815 |
| 133 | Ga0068863_100235921 | 3300005841 | Bacteria | 1765 |
| 134 | Ga0068858_100313367 | 3300005842 | Bacteria | 1498 |
| 135 | Ga0068862_100127844 | 3300005844 | Bacteria | 2245 |
| 136 | Ga0068862_100400621 | 3300005844 | Bacteria | 1284 |
| 137 | Ga0081455_10016693 | 3300005937 | Bacteria | 7073 |
| 138 | Ga0081538_10015961 | 3300005981 | Bacteria | 5785 |
| 139 | Ga0081538_10064842 | 3300005981 | Bacteria | 2062 |
| 140 | Ga0081540_1000130 | 3300005983 | Bacteria | 80050 |
| 141 | Ga0081540_1004092 | 3300005983 | Bacteria | 11272 |
| 142 | Ga0081540_1056001 | 3300005983 | Bacteria | 1917 |
| 143 | Ga0081540_1089553 | 3300005983 | Bacteria | 1357 |
| 144 | Ga0070717_10010873 | 3300006028 | Bacteria | 6890 |
| 145 | Ga0070717_10046671 | 3300006028 | Bacteria | 3545 |
| 146 | Ga0070717_10065911 | 3300006028 | Bacteria | 3011 |
| 147 | Ga0070717_10066162 | 3300006028 | Bacteria | 3005 |
| 148 | Ga0070717_10148794 | 3300006028 | Bacteria | 2025 |
| 149 | Ga0070717_10157678 | 3300006028 | Bacteria | 1967 |
| 150 | Ga0070717_10330916 | 3300006028 | Bacteria | 1359 |
| 151 | Ga0070717_10379392 | 3300006028 | Bacteria | 1267 |
| 152 | Ga0070717_10644501 | 3300006028 | Bacteria | 961 |
| 153 | Ga0070717_10964284 | 3300006028 | Bacteria | 777 |
| 154 | Ga0070715_10005251 | 3300006163 | Bacteria | 4307 |
| 155 | Ga0070715_10015091 | 3300006163 | Bacteria | 2875 |
| 156 | Ga0070715_10018662 | 3300006163 | Bacteria | 2647 |
| 157 | Ga0070715_10024955 | 3300006163 | Bacteria | 2363 |
| 158 | Ga0070716_100001534 | 3300006173 | Bacteria | 10351 |
| 159 | Ga0070716_100006455 | 3300006173 | Bacteria | 5729 |
| 160 | Ga0070716_100238641 | 3300006173 | Bacteria | 1231 |
| 161 | Ga0070716_100570672 | 3300006173 | Bacteria | 847 |
| 162 | Ga0070712_100007951 | 3300006175 | Bacteria | 6648 |
| 163 | Ga0070712_100024703 | 3300006175 | Bacteria | 3986 |
| 164 | Ga0070712_100054612 | 3300006175 | Bacteria | 2793 |
| 165 | Ga0070712_100275025 | 3300006175 | Bacteria | 1354 |
| 166 | Ga0070712_100760461 | 3300006175 | Bacteria | 830 |
| 167 | Ga0070712_100848716 | 3300006175 | Bacteria | 785 |
| 168 | Ga0097621_100153799 | 3300006237 | Bacteria | 1974 |
| 169 | Ga0068871_100116068 | 3300006358 | Bacteria | 2257 |
| 170 | Ga0068871_100442456 | 3300006358 | Bacteria | 1164 |
| 171 | Ga0075433_10009897 | 3300006852 | Bacteria | 7644 |
| 172 | Ga0075433_10028568 | 3300006852 | Bacteria | 4743 |
| 173 | Ga0075433_10276819 | 3300006852 | Bacteria | 1487 |
| 174 | Ga0075434_100007625 | 3300006871 | Bacteria | 10013 |
| 175 | Ga0075434_100146637 | 3300006871 | Bacteria | 2380 |
| 176 | Ga0075434_100707867 | 3300006871 | Bacteria | 1024 |
| 177 | Ga0075429_100285194 | 3300006880 | Bacteria | 1446 |
| 178 | Ga0068865_100038579 | 3300006881 | Bacteria | 3235 |
| 179 | Ga0068865_100041412 | 3300006881 | Bacteria | 3134 |
| 180 | Ga0075436_100010364 | 3300006914 | Bacteria | 6386 |
| 181 | Ga0075436_100045437 | 3300006914 | Bacteria | 3029 |
| 182 | Ga0075436_100066655 | 3300006914 | Bacteria | 2488 |
| 183 | Ga0075436_100662442 | 3300006914 | Bacteria | 772 |
| 184 | Ga0075435_100051730 | 3300007076 | Bacteria | 3309 |
| 185 | Ga0075435_100078422 | 3300007076 | Bacteria | 2708 |
| 186 | Ga0075435_100137683 | 3300007076 | Bacteria | 2046 |
| 187 | Ga0075435_100282656 | 3300007076 | Bacteria | 1417 |
| 188 | Ga0075435_100761346 | 3300007076 | Bacteria | 842 |
| 189 | Ga0099794_10093591 | 3300007265 | Bacteria | 1494 |
| 190 | Ga0099795_10113050 | 3300007788 | Bacteria | 1078 |
| 191 | Ga0099795_10306358 | 3300007788 | Unclassified | 700 |
| 192 | Ga0105240_10059569 | 3300009093 | Bacteria | 4764 |
| 193 | Ga0111539_10003076 | 3300009094 | Bacteria | 22107 |
| 194 | Ga0111539_10047678 | 3300009094 | Bacteria | 5119 |
| 195 | Ga0111539_10123155 | 3300009094 | Bacteria | 3039 |
| 196 | Ga0105245_10049990 | 3300009098 | Bacteria | 3745 |
| 197 | Ga0105245_10313176 | 3300009098 | Bacteria | 1544 |
| 198 | Ga0105245_12258827 | 3300009098 | Unclassified | 598 |
| 199 | Ga0114129_10005099 | 3300009147 | Bacteria | 18498 |
| 200 | Ga0114129_10638865 | 3300009147 | Bacteria | 1375 |
| 201 | Ga0114129_11991947 | 3300009147 | Unclassified | 702 |
| 202 | Ga0105241_10125958 | 3300009174 | Bacteria | 2068 |
| 203 | Ga0105241_10144383 | 3300009174 | Bacteria | 1941 |
| 204 | Ga0105241_10213263 | 3300009174 | Bacteria | 1619 |
| 205 | Ga0105241_11761036 | 3300009174 | Bacteria | 603 |
| 206 | Ga0105242_10063619 | 3300009176 | Bacteria | 3038 |
| 207 | Ga0105248_10048664 | 3300009177 | Bacteria | 4755 |
| 208 | Ga0105237_10117691 | 3300009545 | Bacteria | 2651 |
| 209 | Ga0105237_10125170 | 3300009545 | Bacteria | 2565 |
| 210 | Ga0105237_10130239 | 3300009545 | Bacteria | 2510 |
| 211 | Ga0105237_10175878 | 3300009545 | Bacteria | 2140 |
| 212 | Ga0105237_11470312 | 3300009545 | Bacteria | 688 |
| 213 | Ga0105238_10102362 | 3300009551 | Bacteria | 2846 |
| 214 | Ga0105249_10016717 | 3300009553 | Bacteria | 6511 |
| 215 | Ga0105239_10020163 | 3300010375 | Bacteria | 7355 |
| 216 | Ga0105239_10216668 | 3300010375 | Bacteria | 2146 |
| 217 | Ga0105239_10653154 | 3300010375 | Bacteria | 1201 |
| 218 | Ga0105239_11151751 | 3300010375 | Bacteria | 893 |
| 219 | Ga0105246_10081269 | 3300011119 | Bacteria | 2309 |
| 220 | Ga0105246_10657963 | 3300011119 | Bacteria | 913 |
| 221 | Ga0105246_11436169 | 3300011119 | Bacteria | 645 |
| 222 | Ga0157373_10381534 | 3300013100 | Bacteria | 1008 |
| 223 | Ga0157371_10047334 | 3300013102 | Bacteria | 3057 |
| 224 | Ga0157370_10030431 | 3300013104 | Bacteria | 5289 |
| 225 | Ga0157378_10066752 | 3300013297 | Bacteria | 3223 |
| 226 | Ga0163162_10182251 | 3300013306 | Bacteria | 2226 |
| 227 | Ga0157375_10309052 | 3300013308 | Bacteria | 1745 |
| 228 | Ga0163163_10248344 | 3300014325 | Bacteria | 1830 |
| 229 | Ga0163163_11476644 | 3300014325 | Bacteria | 741 |
| 230 | Ga0157380_10099030 | 3300014326 | Bacteria | 2423 |
| 231 | Ga0157377_10030312 | 3300014745 | Bacteria | 2929 |
| 232 | Ga0157377_10032643 | 3300014745 | Bacteria | 2837 |
| 233 | Ga0157379_10006261 | 3300014968 | Bacteria | 10247 |
| 234 | Ga0157376_11151352 | 3300014969 | Bacteria | 803 |
| 235 | Ga0163161_10062730 | 3300017792 | Bacteria | 2708 |
| 236 | Ga0197907_10615449 | 3300020069 | Bacteria | 720 |
| 237 | Ga0213876_10158652 | 3300021384 | Bacteria | 1203 |
| 238 | Ga0224712_10215587 | 3300022467 | Bacteria | 877 |
| 239 | Ga0224572_1047138 | 3300024225 | Bacteria | 806 |
| 240 | Ga0207656_10235650 | 3300025321 | Unclassified | 893 |
| 241 | Ga0207653_10002312 | 3300025885 | Bacteria | 6083 |
| 242 | Ga0207692_10001157 | 3300025898 | Bacteria | 9740 |
| 243 | Ga0207692_10004265 | 3300025898 | Bacteria | 5651 |
| 244 | Ga0207692_10019311 | 3300025898 | Bacteria | 3078 |
| 245 | Ga0207692_10227591 | 3300025898 | Bacteria | 1108 |
| 246 | Ga0207642_10089549 | 3300025899 | Bacteria | 1516 |
| 247 | Ga0207642_10456320 | 3300025899 | Unclassified | 775 |
| 248 | Ga0207710_10023890 | 3300025900 | Bacteria | 2629 |
| 249 | Ga0207688_10008232 | 3300025901 | Bacteria | 5667 |
| 250 | Ga0207647_10092248 | 3300025904 | Unclassified | 1806 |
| 251 | Ga0207685_10021103 | 3300025905 | Bacteria | 2177 |
| 252 | Ga0207685_10045874 | 3300025905 | Bacteria | 1660 |
| 253 | Ga0207685_10055220 | 3300025905 | Bacteria | 1550 |
| 254 | Ga0207685_10106816 | 3300025905 | Bacteria | 1207 |
| 255 | Ga0207685_10282186 | 3300025905 | Bacteria | 815 |
| 256 | Ga0207699_10002999 | 3300025906 | Bacteria | 8026 |
| 257 | Ga0207699_10017902 | 3300025906 | Bacteria | 3743 |
| 258 | Ga0207699_10068477 | 3300025906 | Bacteria | 2161 |
| 259 | Ga0207699_10077108 | 3300025906 | Bacteria | 2055 |
| 260 | Ga0207699_10105289 | 3300025906 | Bacteria | 1798 |
| 261 | Ga0207645_10440071 | 3300025907 | Unclassified | 879 |
| 262 | Ga0207684_10008075 | 3300025910 | Bacteria | 9389 |
| 263 | Ga0207684_10009534 | 3300025910 | Bacteria | 8565 |
| 264 | Ga0207684_10013951 | 3300025910 | Bacteria | 6941 |
| 265 | Ga0207684_10014185 | 3300025910 | Bacteria | 6878 |
| 266 | Ga0207684_10019945 | 3300025910 | Bacteria | 5729 |
| 267 | Ga0207684_10045800 | 3300025910 | Bacteria | 3710 |
| 268 | Ga0207684_10185575 | 3300025910 | Bacteria | 1793 |
| 269 | Ga0207684_10225775 | 3300025910 | Bacteria | 1616 |
| 270 | Ga0207684_10401451 | 3300025910 | Bacteria | 1178 |
| 271 | Ga0207684_10690990 | 3300025910 | Bacteria | 867 |
| 272 | Ga0207684_10777170 | 3300025910 | Bacteria | 810 |
| 273 | Ga0207654_10135929 | 3300025911 | Bacteria | 1562 |
| 274 | Ga0207654_10753922 | 3300025911 | Bacteria | 701 |
| 275 | Ga0207671_10084427 | 3300025914 | Bacteria | 2385 |
| 276 | Ga0207693_10003808 | 3300025915 | Bacteria | 12843 |
| 277 | Ga0207693_10012679 | 3300025915 | Bacteria | 6807 |
| 278 | Ga0207693_10100235 | 3300025915 | Bacteria | 2271 |
| 279 | Ga0207663_10039426 | 3300025916 | Bacteria | 2862 |
| 280 | Ga0207663_10069979 | 3300025916 | Bacteria | 2259 |
| 281 | Ga0207663_10168104 | 3300025916 | Bacteria | 1555 |
| 282 | Ga0207660_10406710 | 3300025917 | Bacteria | 1096 |
| 283 | Ga0207662_10077872 | 3300025918 | Bacteria | 2017 |
| 284 | Ga0207657_10283709 | 3300025919 | Bacteria | 1314 |
| 285 | Ga0207649_10040895 | 3300025920 | Bacteria | 2821 |
| 286 | Ga0207649_10894606 | 3300025920 | Unclassified | 696 |
| 287 | Ga0207652_10473015 | 3300025921 | Bacteria | 1129 |
| 288 | Ga0207646_10000511 | 3300025922 | Bacteria | 51827 |
| 289 | Ga0207646_10003046 | 3300025922 | Bacteria | 19289 |
| 290 | Ga0207646_10005034 | 3300025922 | Bacteria | 14066 |
| 291 | Ga0207646_10014472 | 3300025922 | Bacteria | 7491 |
| 292 | Ga0207646_10049185 | 3300025922 | Bacteria | 3777 |
| 293 | Ga0207646_10056908 | 3300025922 | Bacteria | 3494 |
| 294 | Ga0207646_10117742 | 3300025922 | Bacteria | 2386 |
| 295 | Ga0207646_10149187 | 3300025922 | Bacteria | 2108 |
| 296 | Ga0207646_10324819 | 3300025922 | Bacteria | 1390 |
| 297 | Ga0207681_10064458 | 3300025923 | Bacteria | 2530 |
| 298 | Ga0207694_10098084 | 3300025924 | Bacteria | 2319 |
| 299 | Ga0207694_10222041 | 3300025924 | Bacteria | 1542 |
| 300 | Ga0207650_10023763 | 3300025925 | Bacteria | 4352 |
| 301 | Ga0207659_10032241 | 3300025926 | Bacteria | 3594 |
| 302 | Ga0207687_10035764 | 3300025927 | Bacteria | 3380 |
| 303 | Ga0207687_10614666 | 3300025927 | Bacteria | 917 |
| 304 | Ga0207700_10019617 | 3300025928 | Bacteria | 4569 |
| 305 | Ga0207700_10034078 | 3300025928 | Bacteria | 3651 |
| 306 | Ga0207700_10071725 | 3300025928 | Bacteria | 2668 |
| 307 | Ga0207700_10080816 | 3300025928 | Bacteria | 2536 |
| 308 | Ga0207700_10111386 | 3300025928 | Bacteria | 2203 |
| 309 | Ga0207700_10519910 | 3300025928 | Bacteria | 1054 |
| 310 | Ga0207664_10001881 | 3300025929 | Bacteria | 13801 |
| 311 | Ga0207664_10004113 | 3300025929 | Bacteria | 9823 |
| 312 | Ga0207664_10004491 | 3300025929 | Bacteria | 9454 |
| 313 | Ga0207664_10004915 | 3300025929 | Bacteria | 9083 |
| 314 | Ga0207664_10139170 | 3300025929 | Bacteria | 2051 |
| 315 | Ga0207664_10144363 | 3300025929 | Bacteria | 2017 |
| 316 | Ga0207664_10239566 | 3300025929 | Bacteria | 1579 |
| 317 | Ga0207664_10315530 | 3300025929 | Bacteria | 1378 |
| 318 | Ga0207664_10618389 | 3300025929 | Unclassified | 973 |
| 319 | Ga0207664_10981011 | 3300025929 | Bacteria | 757 |
| 320 | Ga0207644_10717408 | 3300025931 | Bacteria | 834 |
| 321 | Ga0207690_10026581 | 3300025932 | Bacteria | 3645 |
| 322 | Ga0207690_10049873 | 3300025932 | Bacteria | 2792 |
| 323 | Ga0207706_10003790 | 3300025933 | Bacteria | 14412 |
| 324 | Ga0207706_10231811 | 3300025933 | Bacteria | 1615 |
| 325 | Ga0207704_10022983 | 3300025938 | Bacteria | 3352 |
| 326 | Ga0207704_10155310 | 3300025938 | Bacteria | 1621 |
| 327 | Ga0207665_10002597 | 3300025939 | Bacteria | 12146 |
| 328 | Ga0207665_10015571 | 3300025939 | Bacteria | 4990 |
| 329 | Ga0207665_10105650 | 3300025939 | Bacteria | 1972 |
| 330 | Ga0207665_10402452 | 3300025939 | Bacteria | 1043 |
| 331 | Ga0207711_10188364 | 3300025941 | Bacteria | 1879 |
| 332 | Ga0207689_10027319 | 3300025942 | Bacteria | 4778 |
| 333 | Ga0207689_10092782 | 3300025942 | Bacteria | 2480 |
| 334 | Ga0207661_10061670 | 3300025944 | Bacteria | 3030 |
| 335 | Ga0207667_10044234 | 3300025949 | Bacteria | 4720 |
| 336 | Ga0207667_10053071 | 3300025949 | Bacteria | 4267 |
| 337 | Ga0207667_10191813 | 3300025949 | Bacteria | 2097 |
| 338 | Ga0207667_10714821 | 3300025949 | Bacteria | 1003 |
| 339 | Ga0207668_10365036 | 3300025972 | Bacteria | 1211 |
| 340 | Ga0207668_10523358 | 3300025972 | Bacteria | 1023 |
| 341 | Ga0207668_11259698 | 3300025972 | Bacteria | 665 |
| 342 | Ga0207640_10436114 | 3300025981 | Bacteria | 1076 |
| 343 | Ga0207677_10023071 | 3300026023 | Bacteria | 3836 |
| 344 | Ga0207703_10145409 | 3300026035 | Bacteria | 2061 |
| 345 | Ga0207639_10028967 | 3300026041 | Bacteria | 4049 |
| 346 | Ga0207639_10498410 | 3300026041 | Bacteria | 1112 |
| 347 | Ga0207678_10051482 | 3300026067 | Bacteria | 3555 |
| 348 | Ga0207708_10001406 | 3300026075 | Bacteria | 18042 |
| 349 | Ga0207702_10286750 | 3300026078 | Bacteria | 1558 |
| 350 | Ga0207702_11531351 | 3300026078 | Bacteria | 660 |
| 351 | Ga0207641_10915759 | 3300026088 | Bacteria | 871 |
| 352 | Ga0207676_10202150 | 3300026095 | Bacteria | 1756 |
| 353 | Ga0207676_10394148 | 3300026095 | Bacteria | 1292 |
| 354 | Ga0207676_10924919 | 3300026095 | Bacteria | 856 |
| 355 | Ga0207674_10104400 | 3300026116 | Bacteria | 2812 |
| 356 | Ga0207674_10185688 | 3300026116 | Bacteria | 2030 |
| 357 | Ga0207675_100022932 | 3300026118 | Bacteria | 5806 |
| 358 | Ga0207675_100272278 | 3300026118 | Bacteria | 1643 |
| 359 | Ga0207675_100306189 | 3300026118 | Bacteria | 1548 |
| 360 | Ga0207683_10003345 | 3300026121 | Bacteria | 13979 |
| 361 | Ga0207683_10286432 | 3300026121 | Bacteria | 1506 |
| 362 | Ga0207698_10282313 | 3300026142 | Bacteria | 1536 |
| 363 | Ga0207428_10980183 | 3300027907 | Bacteria | 595 |
| 364 | Ga0268265_10226793 | 3300028380 | Bacteria | 1639 |
| 365 | Ga0307515_10000229 | 3300028794 | Bacteria | 139040 |
| 366 | Ga0307511_10010993 | 3300030521 | Bacteria | 8937 |
| 367 | Ga0265766_1005764 | 3300030863 | Bacteria | 794 |
| 368 | Ga0265765_1025361 | 3300030879 | Bacteria | 735 |
| 369 | Ga0265768_103515 | 3300030963 | Bacteria | 846 |
| 370 | Ga0307513_10000383 | 3300031456 | Bacteria | 64328 |
| 371 | Ga0307509_10118689 | 3300031507 | Bacteria | 2628 |
| 372 | Ga0307408_100008318 | 3300031548 | Bacteria | 6851 |
| 373 | Ga0307408_100076758 | 3300031548 | Bacteria | 2486 |
| 374 | Ga0307408_100211113 | 3300031548 | Bacteria | 1578 |
| 375 | Ga0307516_10003386 | 3300031730 | Bacteria | 20559 |
| 376 | Ga0307405_10000342 | 3300031731 | Bacteria | 17372 |
| 377 | Ga0307405_10059830 | 3300031731 | Bacteria | 2402 |
| 378 | Ga0307405_10104862 | 3300031731 | Bacteria | 1903 |
| 379 | Ga0307405_10362360 | 3300031731 | Bacteria | 1122 |
| 380 | Ga0307405_10803400 | 3300031731 | Bacteria | 788 |
| 381 | Ga0307413_10135330 | 3300031824 | Bacteria | 1693 |
| 382 | Ga0307413_10357895 | 3300031824 | Bacteria | 1129 |
| 383 | Ga0307413_10930437 | 3300031824 | Bacteria | 740 |
| 384 | Ga0307410_10001165 | 3300031852 | Bacteria | 11589 |
| 385 | Ga0307410_10073235 | 3300031852 | Bacteria | 2381 |
| 386 | Ga0307410_10195983 | 3300031852 | Bacteria | 1539 |
| 387 | Ga0307410_10265027 | 3300031852 | Bacteria | 1341 |
| 388 | Ga0307410_10566642 | 3300031852 | Bacteria | 943 |
| 389 | Ga0307410_10779645 | 3300031852 | Bacteria | 811 |
| 390 | Ga0326468_10003665 | 3300031889 | Bacteria | 1311 |
| 391 | Ga0307406_10000157 | 3300031901 | Bacteria | 40684 |
| 392 | Ga0307406_10016128 | 3300031901 | Bacteria | 4335 |
| 393 | Ga0307406_10026023 | 3300031901 | Bacteria | 3508 |
| 394 | Ga0307406_10055868 | 3300031901 | Bacteria | 2525 |
| 395 | Ga0307406_10089467 | 3300031901 | Bacteria | 2069 |
| 396 | Ga0307407_10000177 | 3300031903 | Bacteria | 19330 |
| 397 | Ga0307407_10033316 | 3300031903 | Bacteria | 2810 |
| 398 | Ga0307407_10156092 | 3300031903 | Bacteria | 1488 |
| 399 | Ga0307407_10283322 | 3300031903 | Bacteria | 1149 |
| 400 | Ga0307407_10663210 | 3300031903 | Bacteria | 782 |
| 401 | Ga0307412_10079932 | 3300031911 | Bacteria | 2257 |
| 402 | Ga0307412_10158923 | 3300031911 | Bacteria | 1677 |
| 403 | Ga0307412_10432825 | 3300031911 | Bacteria | 1079 |
| 404 | Ga0307412_11691567 | 3300031911 | Bacteria | 580 |
| 405 | Ga0307409_100000258 | 3300031995 | Bacteria | 21414 |
| 406 | Ga0307409_100005108 | 3300031995 | Bacteria | 7491 |
| 407 | Ga0307409_100184674 | 3300031995 | Bacteria | 1849 |
| 408 | Ga0307409_100525579 | 3300031995 | Bacteria | 1157 |
| 409 | Ga0307409_100554543 | 3300031995 | Bacteria | 1128 |
| 410 | Ga0307416_100000321 | 3300032002 | Bacteria | 24771 |
| 411 | Ga0307416_100007263 | 3300032002 | Bacteria | 7022 |
| 412 | Ga0307416_100139955 | 3300032002 | Bacteria | 2197 |
| 413 | Ga0307416_100327081 | 3300032002 | Bacteria | 1538 |
| 414 | Ga0307416_100558110 | 3300032002 | Bacteria | 1219 |
| 415 | Ga0307416_100739062 | 3300032002 | Bacteria | 1076 |
| 416 | Ga0307414_10038749 | 3300032004 | Bacteria | 3204 |
| 417 | Ga0307414_10381953 | 3300032004 | Bacteria | 1218 |
| 418 | Ga0307411_10031603 | 3300032005 | Bacteria | 3260 |
| 419 | Ga0307415_100000080 | 3300032126 | Bacteria | 39486 |
| 420 | Ga0307415_100018041 | 3300032126 | Bacteria | 4249 |
| 421 | Ga0307415_100049304 | 3300032126 | Bacteria | 2846 |
| 422 | Ga0307415_100074555 | 3300032126 | Bacteria | 2399 |
| 423 | Ga0307415_100324410 | 3300032126 | Bacteria | 1285 |
| 424 | Ga0307415_100335780 | 3300032126 | Bacteria | 1266 |
| 425 | Ga0307507_10015090 | 3300033179 | Bacteria | 9128 |
| 426 | Ga0373930_0007975 | 3300034816 | Bacteria | 1840 |
| 427 | Ga0373948_0103248 | 3300034817 | Bacteria | 673 |
| 428 | Ga0373950_0008388 | 3300034818 | Bacteria | 1625 |
| 429 | Ga0373958_0007766 | 3300034819 | Bacteria | 1719 |
| 430 | Ga0373959_0014273 | 3300034820 | Bacteria | 1444 |
| 431 | Ga0373926_0001111 | 3300035083 | Bacteria | 7961 |
| 432 | Ga0373928_0005389 | 3300035084 | Bacteria | 2445 |
| 433 | Ga0373928_0075138 | 3300035084 | Bacteria | 843 |
| 434 | Ga0373929_0052187 | 3300035085 | Bacteria | 937 |
| 435 | Ga0373934_0000165 | 3300035086 | Bacteria | 24127 |
| 436 | Ga0373934_0022630 | 3300035086 | Bacteria | 2425 |
| 437 | Ga0373940_0145272 | 3300035088 | Unclassified | 752 |
| 438 | Ga0373949_0011260 | 3300035090 | Bacteria | 1968 |
| 439 | Ga0373951_0043392 | 3300035091 | Bacteria | 1090 |
| 440 | Ga0373952_0020264 | 3300035092 | Bacteria | 1392 |
| 441 | Ga0373923_0007124 | 3300035111 | Bacteria | 3915 |
| 442 | Ga0373923_0044279 | 3300035111 | Bacteria | 1845 |
| 443 | Ga0373923_0078686 | 3300035111 | Bacteria | 1427 |
| 444 | Ga0373932_0073112 | 3300035112 | Unclassified | 1068 |
| 445 | Ga0373936_0001132 | 3300035113 | Bacteria | 9553 |
| 446 | Ga0373936_0076574 | 3300035113 | Bacteria | 1387 |
| 447 | Ga0373936_0083390 | 3300035113 | Bacteria | 1333 |
| 448 | Ga0373936_0284333 | 3300035113 | Bacteria | 744 |
| 449 | Ga0373939_0105236 | 3300035114 | Bacteria | 974 |
| 450 | Ga0373939_0330129 | 3300035114 | Unclassified | 615 |
| 451 | Ga0373941_0038746 | 3300035115 | Bacteria | 1461 |
| 452 | Ga0373945_0077527 | 3300035116 | Bacteria | 1268 |
| 453 | Ga0373945_0178069 | 3300035116 | Bacteria | 874 |
| 454 | Ga0373945_0257045 | 3300035116 | Bacteria | 739 |
| 455 | Ga0373953_0000062 | 3300035117 | Bacteria | 27440 |
| 456 | Ga0373954_0000701 | 3300035118 | Bacteria | 12867 |
| 457 | Ga0373954_0039432 | 3300035118 | Bacteria | 2198 |
| 458 | Ga0373954_0057756 | 3300035118 | Bacteria | 1828 |
| 459 | Ga0373954_0085410 | 3300035118 | Bacteria | 1511 |
| 460 | Ga0373954_0206786 | 3300035118 | Bacteria | 965 |
| 461 | Ga0373956_0000061 | 3300035119 | Bacteria | 37279 |
| 462 | Ga0373956_0026014 | 3300035119 | Bacteria | 2533 |
| 463 | Ga0373956_0089832 | 3300035119 | Bacteria | 1416 |
| 464 | Ga0373956_0213486 | 3300035119 | Bacteria | 915 |
| 465 | Ga0373957_0000042 | 3300035120 | Bacteria | 33397 |
| 466 | Ga0373957_0032000 | 3300035120 | Bacteria | 1935 |
| 467 | Ga0373957_0104270 | 3300035120 | Bacteria | 1137 |
| 468 | Ga0373957_0142431 | 3300035120 | Bacteria | 981 |
| 469 | Ga0373955_0000106 | 3300035172 | Bacteria | 33578 |
| 470 | Ga0373955_0044685 | 3300035172 | Bacteria | 2387 |
| 471 | Ga0373955_0127993 | 3300035172 | Bacteria | 1480 |
| 472 | Ga0373955_0167124 | 3300035172 | Bacteria | 1300 |
| 473 | Ga0373942_0032967 | 3300035207 | Bacteria | 1379 |
| 474 | Ga0373962_0012829 | 3300035242 | Bacteria | 2116 |
| 475 | Ga0373924_0007857 | 3300035410 | Bacteria | 3858 |
| 476 | Ga0373924_0010874 | 3300035410 | Bacteria | 3369 |
| 477 | Ga0373924_0454280 | 3300035410 | Bacteria | 574 |
| 478 | Ga0373931_0016509 | 3300035691 | Bacteria | 3635 |
| 479 | Ga0373931_0275921 | 3300035691 | Bacteria | 1030 |
| 480 | Ga0373935_0001664 | 3300035692 | Bacteria | 12426 |
| 481 | Ga0373935_0007757 | 3300035692 | Bacteria | 6432 |
| 482 | Ga0373935_0058944 | 3300035692 | Bacteria | 2453 |
| 483 | Ga0373935_0313481 | 3300035692 | Bacteria | 1111 |
| 484 | Ga0373935_0836806 | 3300035692 | Bacteria | 680 |
| 485 | Ga0373927_0205325 | 3300035695 | Bacteria | 1294 |
| 486 | Ga0373933_0000046 | 3300035724 | Bacteria | 76647 |
| 487 | Ga0373933_0000764 | 3300035724 | Bacteria | 19666 |
| 488 | Ga0373933_0005963 | 3300035724 | Bacteria | 6630 |
| 489 | Ga0373933_0020037 | 3300035724 | Bacteria | 3787 |
| 490 | Ga0373933_0132446 | 3300035724 | Bacteria | 1568 |
| 491 | Ga0373947_0000017 | 3300035725 | Bacteria | 121216 |
| 492 | Ga0373947_0030240 | 3300035725 | Bacteria | 3182 |
| 493 | Ga0373947_0279008 | 3300035725 | Bacteria | 1111 |
| 494 | Ga0373947_0348488 | 3300035725 | Bacteria | 993 |
| 495 | Ga0373947_0496709 | 3300035725 | Bacteria | 829 |
| 496 | Ga0373937_0000115 | 3300036401 | Bacteria | 76660 |
| 497 | Ga0373937_0002923 | 3300036401 | Bacteria | 14281 |
| 498 | Ga0373937_0009930 | 3300036401 | Bacteria | 8299 |
| 499 | Ga0373937_0018604 | 3300036401 | Bacteria | 6205 |
| 500 | Ga0373937_0045905 | 3300036401 | Bacteria | 3993 |
| 501 | Ga0373937_1334131 | 3300036401 | Bacteria | 665 |
| 502 | Ga0373925_0014582 | 3300037068 | Bacteria | 5679 |
| 503 | Ga0373925_0044387 | 3300037068 | Bacteria | 3300 |
| 504 | Ga0373925_0381641 | 3300037068 | Bacteria | 1147 |
| 505 | Ga0373925_1000666 | 3300037068 | Unclassified | 688 |
| 506 | Ga0395899_0141575 | 3300037312 | Bacteria | 1711 |
| 507 | Ga0395899_0336724 | 3300037312 | Bacteria | 1013 |
| 508 | Ga0395900_0319572 | 3300037418 | Bacteria | 1533 |
| 509 | Ga0395900_0784291 | 3300037418 | Bacteria | 882 |
| 510 | Ga0395898_0078288 | 3300037466 | Bacteria | 3190 |
| 511 | Ga0395898_0081831 | 3300037466 | Bacteria | 3113 |
| 512 | Ga0395898_0200542 | 3300037466 | Bacteria | 1905 |
| 513 | Ga0395905_0241197 | 3300037471 | Bacteria | 1689 |
| 514 | Ga0436364_0018972 | 3300037853 | Bacteria | 541 |
| 515 | Ga0436364_0193061 | 3300037853 | Bacteria | 3061 |
| 516 | Ga0436364_1222187 | 3300037853 | Bacteria | 646 |
| 517 | Ga0395901_0116073 | 3300038443 | Bacteria | 2812 |
| 518 | Ga0436365_0769649 | 3300039437 | Bacteria | 826 |
| 519 | Ga0436365_0864774 | 3300039437 | Bacteria | 1293 |
| 520 | Ga0436363_1395795 | 3300039450 | Bacteria | 1118 |
| 521 | Ga0451833_0092015 | 3300041491 | Bacteria | 1100 |
| 522 | Ga0439448_0023721 | 3300042005 | Bacteria | 1916 |
| 523 | Ga0439450_056441 | 3300042008 | Bacteria | 942 |
| 524 | Ga0439464_0181419 | 3300042439 | Bacteria | 667 |
| 525 | Ga0439440_0029692 | 3300042993 | Bacteria | 1284 |
| 526 | Ga0466969_0044599 | 3300044656 | Bacteria | 2204 |
| 527 | Ga0466969_0067107 | 3300044656 | Bacteria | 1731 |
| 528 | Ga0466969_0259269 | 3300044656 | Bacteria | 788 |
| 529 | Ga0466966_0016233 | 3300044684 | Bacteria | 4923 |
| 530 | Ga0466966_0035174 | 3300044684 | Bacteria | 3238 |
| 531 | Ga0466966_0068529 | 3300044684 | Bacteria | 2227 |
| 532 | Ga0466961_0025632 | 3300044693 | Bacteria | 3791 |
| 533 | Ga0466961_0026163 | 3300044693 | Bacteria | 3753 |
| 534 | Ga0466963_0024305 | 3300044694 | Bacteria | 3857 |
| 535 | Ga0466963_0026912 | 3300044694 | Bacteria | 3679 |
| 536 | Ga0466963_0098811 | 3300044694 | Bacteria | 1996 |
| 537 | Ga0466963_0283774 | 3300044694 | Bacteria | 1164 |
| 538 | Ga0466970_0021915 | 3300044765 | Bacteria | 3333 |
| 539 | Ga0466970_0072563 | 3300044765 | Bacteria | 1852 |
| 540 | Ga0466957_0012941 | 3300044842 | Bacteria | 4834 |
| 541 | Ga0466960_0086197 | 3300044901 | Bacteria | 1592 |
| 542 | Ga0466959_0061956 | 3300045049 | Bacteria | 2719 |
| 543 | Ga0466959_0388084 | 3300045049 | Bacteria | 950 |
| 544 | Ga0466958_0009978 | 3300045836 | Bacteria | 5305 |
| 545 | Ga0466967_0029151 | 3300045976 | Bacteria | 4616 |
| 546 | Ga0466967_0034742 | 3300045976 | Bacteria | 4283 |
| 547 | Ga0466967_0043781 | 3300045976 | Bacteria | 3878 |
| 548 | Ga0466967_0059236 | 3300045976 | Bacteria | 3389 |
| 549 | Ga0466967_0180519 | 3300045976 | Bacteria | 1991 |
| 550 | Ga0466967_0337627 | 3300045976 | Bacteria | 1456 |
| 551 | Ga0466967_0369823 | 3300045976 | Bacteria | 1390 |
| 552 | Ga0466967_0718267 | 3300045976 | Bacteria | 990 |
| 553 | Ga0495592_0000166 | 3300046454 | Bacteria | 58865 |
| 554 | Ga0495592_0013099 | 3300046454 | Bacteria | 6310 |
| 555 | Ga0495592_0096440 | 3300046454 | Bacteria | 2114 |
| 556 | Ga0495592_0108418 | 3300046454 | Bacteria | 1968 |
| 557 | Ga0495629_0025973 | 3300046459 | Bacteria | 4161 |
| 558 | Ga0495629_0403786 | 3300046459 | Bacteria | 928 |
| 559 | Ga0495641_0014800 | 3300046461 | Bacteria | 4204 |
| 560 | Ga0495641_0086212 | 3300046461 | Bacteria | 1405 |
| 561 | Ga0495651_0000067 | 3300046462 | Bacteria | 76665 |
| 562 | Ga0495651_0011292 | 3300046462 | Bacteria | 6864 |
| 563 | Ga0495651_0170462 | 3300046462 | Bacteria | 1550 |
| 564 | Ga0495651_0229751 | 3300046462 | Bacteria | 1278 |
| 565 | Ga0495651_0510447 | 3300046462 | Bacteria | 768 |
| 566 | Ga0495653_0010757 | 3300046463 | Bacteria | 7492 |
| 567 | Ga0495653_0012034 | 3300046463 | Bacteria | 7062 |
| 568 | Ga0495653_0023951 | 3300046463 | Bacteria | 4925 |
| 569 | Ga0495653_0221864 | 3300046463 | Bacteria | 1270 |
| 570 | Ga0495653_0574263 | 3300046463 | Bacteria | 695 |
| 571 | Ga0495580_0221996 | 3300046472 | Bacteria | 1298 |
| 572 | Ga0495582_0041278 | 3300046473 | Bacteria | 2542 |
| 573 | Ga0495582_0106287 | 3300046473 | Bacteria | 1574 |
| 574 | Ga0495639_0132420 | 3300046475 | Bacteria | 1194 |
| 575 | Ga0495662_0005716 | 3300046476 | Bacteria | 6217 |
| 576 | Ga0495662_0027072 | 3300046476 | Bacteria | 2769 |
| 577 | Ga0495664_0016454 | 3300046477 | Bacteria | 4213 |
| 578 | Ga0495664_0027093 | 3300046477 | Bacteria | 3341 |
| 579 | Ga0495608_0000850 | 3300046511 | Bacteria | 21361 |
| 580 | Ga0495608_0101796 | 3300046511 | Bacteria | 1851 |
| 581 | Ga0495608_0105356 | 3300046511 | Bacteria | 1815 |
| 582 | Ga0495608_0175744 | 3300046511 | Bacteria | 1356 |
| 583 | Ga0495608_0792993 | 3300046511 | Bacteria | 559 |
| 584 | Ga0495618_0019512 | 3300046514 | Bacteria | 4171 |
| 585 | Ga0495628_0000916 | 3300046516 | Bacteria | 27072 |
| 586 | Ga0495628_0101958 | 3300046516 | Bacteria | 2214 |
| 587 | Ga0495628_0123675 | 3300046516 | Bacteria | 1982 |
| 588 | Ga0495630_0190999 | 3300046517 | Bacteria | 1562 |
| 589 | Ga0495630_0516761 | 3300046517 | Bacteria | 915 |
| 590 | Ga0495652_0007308 | 3300046529 | Bacteria | 10187 |
| 591 | Ga0495652_0028603 | 3300046529 | Bacteria | 4902 |
| 592 | Ga0495652_0047780 | 3300046529 | Bacteria | 3669 |
| 593 | Ga0495652_0145468 | 3300046529 | Bacteria | 1858 |
| 594 | Ga0495652_0235786 | 3300046529 | Bacteria | 1365 |
| 595 | Ga0495665_0054413 | 3300046531 | Bacteria | 2114 |
| 596 | Ga0495665_0104071 | 3300046531 | Bacteria | 1489 |
| 597 | Ga0495665_0267176 | 3300046531 | Bacteria | 879 |
| 598 | Ga0495640_0018433 | 3300046533 | Bacteria | 5174 |
| 599 | Ga0495640_0020499 | 3300046533 | Bacteria | 4865 |
| 600 | Ga0495640_0036929 | 3300046533 | Bacteria | 3449 |
| 601 | Ga0495640_0083171 | 3300046533 | Bacteria | 2124 |
| 602 | Ga0495640_0688277 | 3300046533 | Bacteria | 614 |
| 603 | Ga0495586_0029041 | 3300046535 | Bacteria | 2960 |
| 604 | Ga0495587_0000078 | 3300046536 | Bacteria | 76639 |
| 605 | Ga0495587_0015551 | 3300046536 | Bacteria | 4748 |
| 606 | Ga0495587_0052225 | 3300046536 | Bacteria | 2412 |
| 607 | Ga0495587_0075032 | 3300046536 | Bacteria | 1963 |
| 608 | Ga0495645_0017608 | 3300046543 | Bacteria | 5120 |
| 609 | Ga0495645_0021043 | 3300046543 | Bacteria | 4713 |
| 610 | Ga0495645_0061609 | 3300046543 | Bacteria | 2718 |
| 611 | Ga0495645_0097555 | 3300046543 | Bacteria | 2093 |
| 612 | Ga0495645_0149779 | 3300046543 | Bacteria | 1622 |
| 613 | Ga0495645_0685112 | 3300046543 | Bacteria | 623 |
| 614 | Ga0495667_0000122 | 3300046559 | Bacteria | 56141 |
| 615 | Ga0495667_0062341 | 3300046559 | Bacteria | 2443 |
| 616 | Ga0495667_0158763 | 3300046559 | Bacteria | 1454 |
| 617 | Ga0495667_0176125 | 3300046559 | Bacteria | 1373 |
| 618 | Ga0495634_0005904 | 3300046642 | Bacteria | 9351 |
| 619 | Ga0495634_0064262 | 3300046642 | Bacteria | 2433 |
| 620 | Ga0495635_0056438 | 3300046663 | Bacteria | 2703 |
| 621 | Ga0495635_0131712 | 3300046663 | Bacteria | 1704 |
| 622 | Ga0495635_0242631 | 3300046663 | Bacteria | 1215 |
| 623 | Ga0495635_0261713 | 3300046663 | Bacteria | 1165 |
| 624 | Ga0495635_0410592 | 3300046663 | Bacteria | 898 |
| 625 | Ga0495657_0000098 | 3300046675 | Bacteria | 76618 |
| 626 | Ga0495657_0030849 | 3300046675 | Bacteria | 3750 |
| 627 | Ga0495657_0034083 | 3300046675 | Bacteria | 3539 |
| 628 | Ga0495657_0034763 | 3300046675 | Bacteria | 3498 |
| 629 | Ga0495657_0279431 | 3300046675 | Bacteria | 999 |
| 630 | Ga0495599_0000115 | 3300046678 | Bacteria | 53313 |
| 631 | Ga0495599_0032418 | 3300046678 | Bacteria | 3280 |
| 632 | Ga0495599_0050210 | 3300046678 | Bacteria | 2613 |
| 633 | Ga0495599_0196033 | 3300046678 | Bacteria | 1241 |
| 634 | Ga0495599_0405641 | 3300046678 | Bacteria | 811 |
| 635 | Ga0495623_0000184 | 3300046679 | Bacteria | 39482 |
| 636 | Ga0495623_0013148 | 3300046679 | Bacteria | 5366 |
| 637 | Ga0495623_0017385 | 3300046679 | Bacteria | 4646 |
| 638 | Ga0495646_0083212 | 3300046680 | Bacteria | 1860 |
| 639 | Ga0495646_0225487 | 3300046680 | Bacteria | 1011 |
| 640 | Ga0495658_0229243 | 3300046683 | Bacteria | 1164 |
| 641 | Ga0495613_0006722 | 3300046689 | Bacteria | 8586 |
| 642 | Ga0495624_0078166 | 3300046690 | Bacteria | 2052 |
| 643 | Ga0495624_0080551 | 3300046690 | Bacteria | 2018 |
| 644 | Ga0495624_0153044 | 3300046690 | Bacteria | 1410 |
| 645 | Ga0495624_0189247 | 3300046690 | Bacteria | 1252 |
| 646 | Ga0495624_0490734 | 3300046690 | Bacteria | 735 |
| 647 | Ga0495624_0689655 | 3300046690 | Unclassified | 606 |
| 648 | Ga0495600_0044741 | 3300046809 | Bacteria | 2887 |
| 649 | Ga0495600_0063555 | 3300046809 | Bacteria | 2412 |
| 650 | Ga0495600_0106015 | 3300046809 | Bacteria | 1831 |
| 651 | Ga0495600_0183953 | 3300046809 | Bacteria | 1346 |
| 652 | Ga0495600_0254864 | 3300046809 | Bacteria | 1115 |
| 653 | Ga0495581_0004878 | 3300047315 | Bacteria | 7759 |
| 654 | Ga0495604_0000142 | 3300047317 | Bacteria | 61620 |
| 655 | Ga0495604_0002956 | 3300047317 | Bacteria | 13606 |
| 656 | Ga0495604_0047887 | 3300047317 | Bacteria | 3327 |
| 657 | Ga0495604_0050516 | 3300047317 | Bacteria | 3228 |
| 658 | Ga0495604_0140320 | 3300047317 | Bacteria | 1727 |
| 659 | Ga0495674_0003502 | 3300047319 | Bacteria | 15276 |
| 660 | Ga0495674_0054318 | 3300047319 | Bacteria | 3518 |
| 661 | Ga0495674_0084311 | 3300047319 | Bacteria | 2723 |
| 662 | Ga0495674_0127331 | 3300047319 | Bacteria | 2147 |
| 663 | Ga0495674_0147368 | 3300047319 | Bacteria | 1975 |
| 664 | Ga0495674_0275688 | 3300047319 | Bacteria | 1379 |
| 665 | Ga0495674_0474183 | 3300047319 | Bacteria | 1003 |
| 666 | Ga0495676_0023985 | 3300047321 | Bacteria | 5287 |
| 667 | Ga0495676_0760191 | 3300047321 | Bacteria | 625 |
| 668 | Ga0495680_0000111 | 3300047322 | Bacteria | 76638 |
| 669 | Ga0495680_0005094 | 3300047322 | Bacteria | 12403 |
| 670 | Ga0495680_0006295 | 3300047322 | Bacteria | 11056 |
| 671 | Ga0495680_0091051 | 3300047322 | Bacteria | 2286 |
| 672 | Ga0495675_0001489 | 3300047444 | Bacteria | 14176 |
| 673 | Ga0495675_0038835 | 3300047444 | Bacteria | 3031 |
| 674 | Ga0495675_0227612 | 3300047444 | Bacteria | 1126 |
| 675 | Ga0495684_0057283 | 3300047471 | Bacteria | 2970 |
| 676 | Ga0495684_0091925 | 3300047471 | Bacteria | 2298 |
| 677 | Ga0495684_0126365 | 3300047471 | Bacteria | 1923 |
| 678 | Ga0495684_0341984 | 3300047471 | Bacteria | 1064 |
| 679 | Ga0495593_0003863 | 3300047673 | Bacteria | 8949 |
| 680 | Ga0495602_0000820 | 3300048088 | Bacteria | 29788 |
| 681 | Ga0495602_0004405 | 3300048088 | Bacteria | 14696 |
| 682 | Ga0495602_0041429 | 3300048088 | Bacteria | 4206 |
| 683 | Ga0495602_0078803 | 3300048088 | Bacteria | 2781 |
| 684 | Ga0495602_0245696 | 3300048088 | Bacteria | 1336 |
| 685 | Ga0495614_0161863 | 3300048089 | Bacteria | 1001 |
| 686 | Ga0496100_0035549 | 3300048903 | Bacteria | 3135 |
| 687 | Ga0496100_0099113 | 3300048903 | Bacteria | 2004 |
| 688 | Ga0496100_0317520 | 3300048903 | Bacteria | 1169 |
| 689 | Ga0496101_0072935 | 3300048904 | Bacteria | 2521 |
| 690 | Ga0496102_0057409 | 3300048905 | Bacteria | 3554 |
| 691 | Ga0496102_0496346 | 3300048905 | Bacteria | 1142 |
| 692 | Ga0496103_0584830 | 3300048906 | Bacteria | 712 |
| 693 | Ga0496104_0036122 | 3300048907 | Bacteria | 4616 |
| 694 | Ga0496104_0068528 | 3300048907 | Bacteria | 3371 |
| 695 | Ga0496104_0331253 | 3300048907 | Bacteria | 1435 |
| 696 | Ga0496105_0002449 | 3300048908 | Bacteria | 13426 |
| 697 | Ga0496105_0023215 | 3300048908 | Bacteria | 5029 |
| 698 | Ga0496105_0246766 | 3300048908 | Bacteria | 1447 |
| 699 | Ga0496106_0109247 | 3300048909 | Bacteria | 2152 |
| 700 | Ga0496107_0099752 | 3300048910 | Bacteria | 2128 |
| 701 | Ga0496108_0010097 | 3300048911 | Bacteria | 7661 |
| 702 | Ga0496108_0351906 | 3300048911 | Bacteria | 1285 |
| 703 | Ga0496109_0010090 | 3300048912 | Bacteria | 8059 |
| 704 | Ga0496109_0096026 | 3300048912 | Bacteria | 2745 |
| 705 | Ga0496109_0247544 | 3300048912 | Bacteria | 1678 |
| 706 | Ga0496109_0570633 | 3300048912 | Bacteria | 1067 |
| 707 | Ga0496110_0011780 | 3300048913 | Bacteria | 7177 |
| 708 | Ga0496111_0102276 | 3300048914 | Bacteria | 2106 |
| 709 | Ga0496112_0000184 | 3300048915 | Bacteria | 40185 |
| 710 | Ga0496112_0217418 | 3300048915 | Bacteria | 1867 |
| 711 | Ga0496112_0376686 | 3300048915 | Bacteria | 1360 |
| 712 | Ga0496113_0003802 | 3300048916 | Bacteria | 9131 |
| 713 | Ga0496114_0087446 | 3300048917 | Bacteria | 2642 |
| 714 | Ga0496114_0141329 | 3300048917 | Bacteria | 2084 |
| 715 | Ga0496115_0040923 | 3300048918 | Bacteria | 3685 |
| 716 | Ga0496115_0045292 | 3300048918 | Bacteria | 3511 |
| 717 | Ga0496126_0045008 | 3300048929 | Bacteria | 4059 |
| 718 | Ga0501038_0004414 | 3300049574 | Bacteria | 13086 |
| 719 | Ga0501039_0003933 | 3300049575 | Bacteria | 11167 |
| 720 | Ga0501041_0001834 | 3300049577 | Bacteria | 11904 |
| 721 | Ga0501042_0004212 | 3300049578 | Bacteria | 9156 |
| 722 | Ga0501042_0560681 | 3300049578 | Bacteria | 830 |
| 723 | Ga0501043_0011448 | 3300049579 | Bacteria | 6946 |
| 724 | Ga0501043_0020106 | 3300049579 | Bacteria | 5240 |
| 725 | Ga0501046_0003864 | 3300049580 | Bacteria | 13704 |
| 726 | Ga0501047_0000031 | 3300049581 | Bacteria | 215903 |
| 727 | Ga0501068_0016931 | 3300049584 | Bacteria | 4210 |
| 728 | Ga0501071_0003836 | 3300049587 | Bacteria | 9459 |
| 729 | Ga0501074_0007110 | 3300049590 | Bacteria | 8089 |
| 730 | Ga0501075_0004173 | 3300049591 | Bacteria | 9753 |
| 731 | Ga0501079_0006985 | 3300049741 | Bacteria | 8509 |
| 732 | Ga0501081_0000730 | 3300049743 | Bacteria | 19173 |
| 733 | Ga0501083_0025481 | 3300049744 | Bacteria | 4094 |
| 734 | Ga0501035_0005927 | 3300049822 | Bacteria | 11503 |
| 735 | Ga0501035_0072319 | 3300049822 | Bacteria | 3052 |
| 736 | Ga0501044_0011851 | 3300049823 | Bacteria | 9447 |
| 737 | nmdc:mga05p37_48767_c1 | 3300050507 | Bacteria | 5208 |
| 738 | nmdc:mga05p37_490287_c1 | 3300050507 | Bacteria | 1413 |
| 739 | nmdc:mga09592_215828_c1 | 3300050508 | Bacteria | 1662 |
| 740 | nmdc:mga0n895_292103_c1 | 3300050512 | Bacteria | 1653 |
| 741 | nmdc:mga0n895_6775_c1 | 3300050512 | Bacteria | 9774 |
| 742 | nmdc:mga0n895_93484_c1 | 3300050512 | Bacteria | 3011 |
| 743 | nmdc:mga0rr50_392899_c1 | 3300050513 | Bacteria | 1171 |
| 744 | nmdc:mga0rr50_509345_c1 | 3300050513 | Bacteria | 1024 |
| 745 | nmdc:mga08x19_14122_c1 | 3300050514 | Bacteria | 4840 |
| 746 | nmdc:mga08x19_240744_c1 | 3300050514 | Bacteria | 1247 |
| 747 | nmdc:mga08x19_370817_c1 | 3300050514 | Unclassified | 1002 |
| 748 | nmdc:mga0a205_110632_c1 | 3300050515 | Bacteria | 2646 |
| 749 | nmdc:mga0a205_45417_c1 | 3300050515 | Bacteria | 4236 |
| 750 | nmdc:mga0a205_55318_c1 | 3300050515 | Bacteria | 3833 |
| 751 | Ga0495601_0011127 | 3300053077 | Bacteria | 5374 |
| 752 | Ga0495601_0037820 | 3300053077 | Bacteria | 3017 |
| 753 | Ga0495601_0053364 | 3300053077 | Bacteria | 2555 |
| 754 | Ga0495601_0467908 | 3300053077 | Bacteria | 815 |
| 755 | Ga0495612_0001875 | 3300053078 | Bacteria | 8646 |
| 756 | Ga0495595_0007699 | 3300053084 | Bacteria | 4413 |
| 757 | Ga0495595_0089134 | 3300053084 | Bacteria | 1478 |
| 758 | Ga0495595_0363892 | 3300053084 | Bacteria | 731 |
| 759 | Ga0495619_0018280 | 3300053085 | Bacteria | 4448 |
| 760 | Ga0495619_0066334 | 3300053085 | Bacteria | 2408 |
| 761 | Ga0500559_0071811 | 3300053136 | Bacteria | 1559 |
| 762 | Ga0500604_0058068 | 3300053151 | Bacteria | 1209 |
| 763 | Ga0500616_0005675 | 3300053153 | Bacteria | 8412 |
| 764 | Ga0501084_0002745 | 3300054114 | Bacteria | 14209 |
| 765 | Ga0590074_014940 | 3300059423 | Bacteria | 1315 |
| 766 | Ga0587085_078600 | 3300059506 | Bacteria | 660 |
| 767 | Ga0530510_0005792 | 3300061734 | Bacteria | 8565 |
| 768 | 2559431201 | 2558860280 | Bacteria | 11429938 |
| 769 | 2795784885 | 2795385470 | Bacteria | 8317180 |
| 770 | 2811846467 | 2808606982 | Bacteria | 7791042 |
| 771 | 2866553892 | 2866552031 | Bacteria | 5824618 |
| 772 | 2990093423 | 2990088156 | Bacteria | 6657676 |
| 773 | Ga0307408_100005338 | |||
| 774 | JGI25404J52841_10068255 | |||
| 775 | Ga0070676_10493460 | |||
| 776 | Ga0070683_100070903 | |||
| 777 | Ga0070683_100784867 | |||
| 778 | Ga0070670_100035479 | |||
| 779 | Ga0068869_100064869 | |||
| 780 | Ga0068869_100144283 | |||
| 781 | Ga0070682_100053961 | |||
| 782 | Ga0068868_100005935 | |||
| 783 | Ga0070689_100284496 | |||
| 784 | Ga0070691_10178270 | |||
| 785 | Ga0070691_10546116 | |||
| 786 | Ga0070661_100048775 | |||
| 787 | Ga0070692_10036116 | |||
| 788 | Ga0070669_100107618 | |||
| 789 | Ga0070669_100919316 | |||
| 790 | Ga0070675_100047603 | |||
| 791 | Ga0070675_100182226 | |||
| 792 | Ga0070673_101192407 | |||
| 793 | Ga0070659_100069690 | |||
| 794 | Ga0070667_100131393 | |||
| 795 | Ga0070709_10007200 | |||
| 796 | Ga0070709_10051801 | |||
| 797 | Ga0070714_100001010 | |||
| 798 | Ga0070714_100002215 | |||
| 799 | Ga0070714_100004737 | |||
| 800 | Ga0070714_100054899 | |||
| 801 | Ga0070714_100122193 | |||
| 802 | Ga0070714_100125614 | |||
| 803 | Ga0070714_100208436 | |||
| 804 | Ga0070714_100264905 | |||
| 805 | Ga0070714_100353057 | |||
| 806 | Ga0070714_101381985 | |||
| 807 | Ga0070713_100008165 | |||
| 808 | Ga0070713_100012039 | |||
| 809 | Ga0070713_100018297 | |||
| 810 | Ga0070713_100096315 | |||
| 811 | Ga0070713_100102284 | |||
| 812 | Ga0070713_100251368 | |||
| 813 | Ga0070713_100497425 | |||
| 814 | Ga0070713_101810283 | |||
| 815 | Ga0070710_10003859 | |||
| 816 | Ga0070710_10004623 | |||
| 817 | Ga0070710_10005150 | |||
| 818 | Ga0070710_10200632 | |||
| 819 | Ga0070711_100032580 | |||
| 820 | Ga0070711_100073170 | |||
| 821 | Ga0070711_100124696 | |||
| 822 | Ga0070711_100431116 | |||
| 823 | Ga0070705_100093614 | |||
| 824 | Ga0070700_100284469 | |||
| 825 | Ga0070694_100015334 | |||
| 826 | Ga0070694_100646065 | |||
| 827 | Ga0070708_100001327 | |||
| 828 | Ga0070708_100020080 | |||
| 829 | Ga0070708_100020642 | |||
| 830 | Ga0070708_100091089 | |||
| 831 | Ga0070708_100128708 | |||
| 832 | Ga0070708_100222907 | |||
| 833 | Ga0070708_100344251 | |||
| 834 | Ga0070708_100560494 | |||
| 835 | Ga0070663_100751005 | |||
| 836 | Ga0070678_100036643 | |||
| 837 | Ga0070662_100018037 | |||
| 838 | Ga0070662_100077684 | |||
| 839 | Ga0070681_10516303 | |||
| 840 | Ga0070685_10144584 | |||
| 841 | Ga0070706_100016163 | |||
| 842 | Ga0070706_100018392 | |||
| 843 | Ga0070706_100023038 | |||
| 844 | Ga0070706_100090355 | |||
| 845 | Ga0070706_100178027 | |||
| 846 | Ga0070706_100203483 | |||
| 847 | Ga0070706_100797103 | |||
| 848 | Ga0070706_100818939 | |||
| 849 | Ga0070707_100009673 | |||
| 850 | Ga0070707_100011405 | |||
| 851 | Ga0070707_100016313 | |||
| 852 | Ga0070707_100019178 | |||
| 853 | Ga0070707_100024357 | |||
| 854 | Ga0070707_100058617 | |||
| 855 | Ga0070707_100101475 | |||
| 856 | Ga0070707_100179222 | |||
| 857 | Ga0070707_100244008 | |||
| 858 | Ga0070707_100350788 | |||
| 859 | Ga0070698_100000319 | |||
| 860 | Ga0070698_100001247 | |||
| 861 | Ga0070698_100004646 | |||
| 862 | Ga0070698_100005647 | |||
| 863 | Ga0070698_100111037 | |||
| 864 | Ga0070698_100129729 | |||
| 865 | Ga0070698_100166626 | |||
| 866 | Ga0070698_100274722 | |||
| 867 | Ga0070699_100199485 | |||
| 868 | Ga0070699_100569926 | |||
| 869 | Ga0070679_100869309 | |||
| 870 | Ga0070684_100033277 | |||
| 871 | Ga0070684_100507153 | |||
| 872 | Ga0070697_100075313 | |||
| 873 | Ga0070697_100086845 | |||
| 874 | Ga0070697_100090922 | |||
| 875 | Ga0070697_100224063 | |||
| 876 | Ga0068853_100014389 | |||
| 877 | Ga0068853_100746545 | |||
| 878 | Ga0070686_100033047 | |||
| 879 | Ga0070695_100033414 | |||
| 880 | Ga0070696_100024799 | |||
| 881 | Ga0070696_100081166 | |||
| 882 | Ga0070693_100014606 | |||
| 883 | Ga0070693_100912750 | |||
| 884 | Ga0070665_100341935 | |||
| 885 | Ga0070704_100347439 | |||
| 886 | Ga0068855_100058253 | |||
| 887 | Ga0068855_100107357 | |||
| 888 | Ga0070664_100000100 | |||
| 889 | Ga0070664_100347733 | |||
| 890 | Ga0068857_100012182 | |||
| 891 | Ga0068857_100088212 | |||
| 892 | Ga0068857_100116722 | |||
| 893 | Ga0068854_100449191 | |||
| 894 | Ga0068856_100012630 | |||
| 895 | Ga0068856_100060491 | |||
| 896 | Ga0068856_100093626 | |||
| 897 | Ga0070702_100028652 | |||
| 898 | Ga0070702_100283370 | |||
| 899 | Ga0068852_100088441 | |||
| 900 | Ga0068852_101028808 | |||
| 901 | Ga0068864_100450971 | |||
| 902 | Ga0068861_100072262 | |||
| 903 | Ga0068870_10236675 | |||
| 904 | Ga0068863_100223278 | |||
| 905 | Ga0068863_100235921 | |||
| 906 | Ga0068858_100313367 | |||
| 907 | Ga0068862_100127844 | |||
| 908 | Ga0068862_100400621 | |||
| 909 | Ga0081455_10016693 | |||
| 910 | Ga0081538_10015961 | |||
| 911 | Ga0081538_10064842 | |||
| 912 | Ga0081540_1000130 | |||
| 913 | Ga0081540_1004092 | |||
| 914 | Ga0081540_1056001 | |||
| 915 | Ga0081540_1089553 | |||
| 916 | Ga0070717_10010873 | |||
| 917 | Ga0070717_10046671 | |||
| 918 | Ga0070717_10065911 | |||
| 919 | Ga0070717_10066162 | |||
| 920 | Ga0070717_10148794 | |||
| 921 | Ga0070717_10157678 | |||
| 922 | Ga0070717_10330916 | |||
| 923 | Ga0070717_10379392 | |||
| 924 | Ga0070717_10644501 | |||
| 925 | Ga0070717_10964284 | |||
| 926 | Ga0070715_10005251 | |||
| 927 | Ga0070715_10015091 | |||
| 928 | Ga0070715_10018662 | |||
| 929 | Ga0070715_10024955 | |||
| 930 | Ga0070716_100001534 | |||
| 931 | Ga0070716_100006455 | |||
| 932 | Ga0070716_100238641 | |||
| 933 | Ga0070716_100570672 | |||
| 934 | Ga0070712_100007951 | |||
| 935 | Ga0070712_100024703 | |||
| 936 | Ga0070712_100054612 | |||
| 937 | Ga0070712_100275025 | |||
| 938 | Ga0070712_100760461 | |||
| 939 | Ga0070712_100848716 | |||
| 940 | Ga0097621_100153799 | |||
| 941 | Ga0068871_100116068 | |||
| 942 | Ga0068871_100442456 | |||
| 943 | Ga0075433_10009897 | |||
| 944 | Ga0075433_10028568 | |||
| 945 | Ga0075433_10276819 | |||
| 946 | Ga0075434_100007625 | |||
| 947 | Ga0075434_100146637 | |||
| 948 | Ga0075434_100707867 | |||
| 949 | Ga0075429_100285194 | |||
| 950 | Ga0068865_100038579 | |||
| 951 | Ga0068865_100041412 | |||
| 952 | Ga0075436_100010364 | |||
| 953 | Ga0075436_100045437 | |||
| 954 | Ga0075436_100066655 | |||
| 955 | Ga0075436_100662442 | |||
| 956 | Ga0075435_100051730 | |||
| 957 | Ga0075435_100078422 | |||
| 958 | Ga0075435_100137683 | |||
| 959 | Ga0075435_100282656 | |||
| 960 | Ga0075435_100761346 | |||
| 961 | Ga0099794_10093591 | |||
| 962 | Ga0099795_10113050 | |||
| 963 | Ga0099795_10306358 | |||
| 964 | Ga0105240_10059569 | |||
| 965 | Ga0111539_10003076 | |||
| 966 | Ga0111539_10047678 | |||
| 967 | Ga0111539_10123155 | |||
| 968 | Ga0105245_10049990 | |||
| 969 | Ga0105245_10313176 | |||
| 970 | Ga0105245_12258827 | |||
| 971 | Ga0114129_10005099 | |||
| 972 | Ga0114129_10638865 | |||
| 973 | Ga0114129_11991947 | |||
| 974 | Ga0105241_10125958 | |||
| 975 | Ga0105241_10144383 | |||
| 976 | Ga0105241_10213263 | |||
| 977 | Ga0105241_11761036 | |||
| 978 | Ga0105242_10063619 | |||
| 979 | Ga0105248_10048664 | |||
| 980 | Ga0105237_10117691 | |||
| 981 | Ga0105237_10125170 | |||
| 982 | Ga0105237_10130239 | |||
| 983 | Ga0105237_10175878 | |||
| 984 | Ga0105237_11470312 | |||
| 985 | Ga0105238_10102362 | |||
| 986 | Ga0105249_10016717 | |||
| 987 | Ga0105239_10020163 | |||
| 988 | Ga0105239_10216668 | |||
| 989 | Ga0105239_10653154 | |||
| 990 | Ga0105239_11151751 | |||
| 991 | Ga0105246_10081269 | |||
| 992 | Ga0105246_10657963 | |||
| 993 | Ga0105246_11436169 | |||
| 994 | Ga0157373_10381534 | |||
| 995 | Ga0157371_10047334 | |||
| 996 | Ga0157370_10030431 | |||
| 997 | Ga0157378_10066752 | |||
| 998 | Ga0163162_10182251 | |||
| 999 | Ga0157375_10309052 | |||
| 1000 | Ga0163163_10248344 | |||
| 1001 | Ga0163163_11476644 | |||
| 1002 | Ga0157380_10099030 | |||
| 1003 | Ga0157377_10030312 | |||
| 1004 | Ga0157377_10032643 | |||
| 1005 | Ga0157379_10006261 | |||
| 1006 | Ga0157376_11151352 | |||
| 1007 | Ga0163161_10062730 | |||
| 1008 | Ga0197907_10615449 | |||
| 1009 | Ga0213876_10158652 | |||
| 1010 | Ga0224712_10215587 | |||
| 1011 | Ga0224572_1047138 | |||
| 1012 | Ga0207656_10235650 | |||
| 1013 | Ga0207653_10002312 | |||
| 1014 | Ga0207692_10001157 | |||
| 1015 | Ga0207692_10004265 | |||
| 1016 | Ga0207692_10019311 | |||
| 1017 | Ga0207692_10227591 | |||
| 1018 | Ga0207642_10089549 | |||
| 1019 | Ga0207642_10456320 | |||
| 1020 | Ga0207710_10023890 | |||
| 1021 | Ga0207688_10008232 | |||
| 1022 | Ga0207647_10092248 | |||
| 1023 | Ga0207685_10021103 | |||
| 1024 | Ga0207685_10045874 | |||
| 1025 | Ga0207685_10055220 | |||
| 1026 | Ga0207685_10106816 | |||
| 1027 | Ga0207685_10282186 | |||
| 1028 | Ga0207699_10002999 | |||
| 1029 | Ga0207699_10017902 | |||
| 1030 | Ga0207699_10068477 | |||
| 1031 | Ga0207699_10077108 | |||
| 1032 | Ga0207699_10105289 | |||
| 1033 | Ga0207645_10440071 | |||
| 1034 | Ga0207684_10008075 | |||
| 1035 | Ga0207684_10009534 | |||
| 1036 | Ga0207684_10013951 | |||
| 1037 | Ga0207684_10014185 | |||
| 1038 | Ga0207684_10019945 | |||
| 1039 | Ga0207684_10045800 | |||
| 1040 | Ga0207684_10185575 | |||
| 1041 | Ga0207684_10225775 | |||
| 1042 | Ga0207684_10401451 | |||
| 1043 | Ga0207684_10690990 | |||
| 1044 | Ga0207684_10777170 | |||
| 1045 | Ga0207654_10135929 | |||
| 1046 | Ga0207654_10753922 | |||
| 1047 | Ga0207671_10084427 | |||
| 1048 | Ga0207693_10003808 | |||
| 1049 | Ga0207693_10012679 | |||
| 1050 | Ga0207693_10100235 | |||
| 1051 | Ga0207663_10039426 | |||
| 1052 | Ga0207663_10069979 | |||
| 1053 | Ga0207663_10168104 | |||
| 1054 | Ga0207660_10406710 | |||
| 1055 | Ga0207662_10077872 | |||
| 1056 | Ga0207657_10283709 | |||
| 1057 | Ga0207649_10040895 | |||
| 1058 | Ga0207649_10894606 | |||
| 1059 | Ga0207652_10473015 | |||
| 1060 | Ga0207646_10000511 | |||
| 1061 | Ga0207646_10003046 | |||
| 1062 | Ga0207646_10005034 | |||
| 1063 | Ga0207646_10014472 | |||
| 1064 | Ga0207646_10049185 | |||
| 1065 | Ga0207646_10056908 | |||
| 1066 | Ga0207646_10117742 | |||
| 1067 | Ga0207646_10149187 | |||
| 1068 | Ga0207646_10324819 | |||
| 1069 | Ga0207681_10064458 | |||
| 1070 | Ga0207694_10098084 | |||
| 1071 | Ga0207694_10222041 | |||
| 1072 | Ga0207650_10023763 | |||
| 1073 | Ga0207659_10032241 | |||
| 1074 | Ga0207687_10035764 | |||
| 1075 | Ga0207687_10614666 | |||
| 1076 | Ga0207700_10019617 | |||
| 1077 | Ga0207700_10034078 | |||
| 1078 | Ga0207700_10071725 | |||
| 1079 | Ga0207700_10080816 | |||
| 1080 | Ga0207700_10111386 | |||
| 1081 | Ga0207700_10519910 | |||
| 1082 | Ga0207664_10001881 | |||
| 1083 | Ga0207664_10004113 | |||
| 1084 | Ga0207664_10004491 | |||
| 1085 | Ga0207664_10004915 | |||
| 1086 | Ga0207664_10139170 | |||
| 1087 | Ga0207664_10144363 | |||
| 1088 | Ga0207664_10239566 | |||
| 1089 | Ga0207664_10315530 | |||
| 1090 | Ga0207664_10618389 | |||
| 1091 | Ga0207664_10981011 | |||
| 1092 | Ga0207644_10717408 | |||
| 1093 | Ga0207690_10026581 | |||
| 1094 | Ga0207690_10049873 | |||
| 1095 | Ga0207706_10003790 | |||
| 1096 | Ga0207706_10231811 | |||
| 1097 | Ga0207704_10022983 | |||
| 1098 | Ga0207704_10155310 | |||
| 1099 | Ga0207665_10002597 | |||
| 1100 | Ga0207665_10015571 | |||
| 1101 | Ga0207665_10105650 | |||
| 1102 | Ga0207665_10402452 | |||
| 1103 | Ga0207711_10188364 | |||
| 1104 | Ga0207689_10027319 | |||
| 1105 | Ga0207689_10092782 | |||
| 1106 | Ga0207661_10061670 | |||
| 1107 | Ga0207667_10044234 | |||
| 1108 | Ga0207667_10053071 | |||
| 1109 | Ga0207667_10191813 | |||
| 1110 | Ga0207667_10714821 | |||
| 1111 | Ga0207668_10365036 | |||
| 1112 | Ga0207668_10523358 | |||
| 1113 | Ga0207668_11259698 | |||
| 1114 | Ga0207640_10436114 | |||
| 1115 | Ga0207677_10023071 | |||
| 1116 | Ga0207703_10145409 | |||
| 1117 | Ga0207639_10028967 | |||
| 1118 | Ga0207639_10498410 | |||
| 1119 | Ga0207678_10051482 | |||
| 1120 | Ga0207708_10001406 | |||
| 1121 | Ga0207702_10286750 | |||
| 1122 | Ga0207702_11531351 | |||
| 1123 | Ga0207641_10915759 | |||
| 1124 | Ga0207676_10202150 | |||
| 1125 | Ga0207676_10394148 | |||
| 1126 | Ga0207676_10924919 | |||
| 1127 | Ga0207674_10104400 | |||
| 1128 | Ga0207674_10185688 | |||
| 1129 | Ga0207675_100022932 | |||
| 1130 | Ga0207675_100272278 | |||
| 1131 | Ga0207675_100306189 | |||
| 1132 | Ga0207683_10003345 | |||
| 1133 | Ga0207683_10286432 | |||
| 1134 | Ga0207698_10282313 | |||
| 1135 | Ga0207428_10980183 | |||
| 1136 | Ga0268265_10226793 | |||
| 1137 | Ga0307515_10000229 | |||
| 1138 | Ga0307511_10010993 | |||
| 1139 | Ga0265766_1005764 | |||
| 1140 | Ga0265765_1025361 | |||
| 1141 | Ga0265768_103515 | |||
| 1142 | Ga0307513_10000383 | |||
| 1143 | Ga0307509_10118689 | |||
| 1144 | Ga0307408_100008318 | |||
| 1145 | Ga0307408_100076758 | |||
| 1146 | Ga0307408_100211113 | |||
| 1147 | Ga0307516_10003386 | |||
| 1148 | Ga0307405_10000342 | |||
| 1149 | Ga0307405_10059830 | |||
| 1150 | Ga0307405_10104862 | |||
| 1151 | Ga0307405_10362360 | |||
| 1152 | Ga0307405_10803400 | |||
| 1153 | Ga0307413_10135330 | |||
| 1154 | Ga0307413_10357895 | |||
| 1155 | Ga0307413_10930437 | |||
| 1156 | Ga0307410_10001165 | |||
| 1157 | Ga0307410_10073235 | |||
| 1158 | Ga0307410_10195983 | |||
| 1159 | Ga0307410_10265027 | |||
| 1160 | Ga0307410_10566642 | |||
| 1161 | Ga0307410_10779645 | |||
| 1162 | Ga0326468_10003665 | |||
| 1163 | Ga0307406_10000157 | |||
| 1164 | Ga0307406_10016128 | |||
| 1165 | Ga0307406_10026023 | |||
| 1166 | Ga0307406_10055868 | |||
| 1167 | Ga0307406_10089467 | |||
| 1168 | Ga0307407_10000177 | |||
| 1169 | Ga0307407_10033316 | |||
| 1170 | Ga0307407_10156092 | |||
| 1171 | Ga0307407_10283322 | |||
| 1172 | Ga0307407_10663210 | |||
| 1173 | Ga0307412_10079932 | |||
| 1174 | Ga0307412_10158923 | |||
| 1175 | Ga0307412_10432825 | |||
| 1176 | Ga0307412_11691567 | |||
| 1177 | Ga0307409_100000258 | |||
| 1178 | Ga0307409_100005108 | |||
| 1179 | Ga0307409_100184674 | |||
| 1180 | Ga0307409_100525579 | |||
| 1181 | Ga0307409_100554543 | |||
| 1182 | Ga0307416_100000321 | |||
| 1183 | Ga0307416_100007263 | |||
| 1184 | Ga0307416_100139955 | |||
| 1185 | Ga0307416_100327081 | |||
| 1186 | Ga0307416_100558110 | |||
| 1187 | Ga0307416_100739062 | |||
| 1188 | Ga0307414_10038749 | |||
| 1189 | Ga0307414_10381953 | |||
| 1190 | Ga0307411_10031603 | |||
| 1191 | Ga0307415_100000080 | |||
| 1192 | Ga0307415_100018041 | |||
| 1193 | Ga0307415_100049304 | |||
| 1194 | Ga0307415_100074555 | |||
| 1195 | Ga0307415_100324410 | |||
| 1196 | Ga0307415_100335780 | |||
| 1197 | Ga0307507_10015090 | |||
| 1198 | Ga0373930_0007975 | |||
| 1199 | Ga0373948_0103248 | |||
| 1200 | Ga0373950_0008388 | |||
| 1201 | Ga0373958_0007766 | |||
| 1202 | Ga0373959_0014273 | |||
| 1203 | Ga0373926_0001111 | |||
| 1204 | Ga0373928_0005389 | |||
| 1205 | Ga0373928_0075138 | |||
| 1206 | Ga0373929_0052187 | |||
| 1207 | Ga0373934_0000165 | |||
| 1208 | Ga0373934_0022630 | |||
| 1209 | Ga0373940_0145272 | |||
| 1210 | Ga0373949_0011260 | |||
| 1211 | Ga0373951_0043392 | |||
| 1212 | Ga0373952_0020264 | |||
| 1213 | Ga0373923_0007124 | |||
| 1214 | Ga0373923_0044279 | |||
| 1215 | Ga0373923_0078686 | |||
| 1216 | Ga0373932_0073112 | |||
| 1217 | Ga0373936_0001132 | |||
| 1218 | Ga0373936_0076574 | |||
| 1219 | Ga0373936_0083390 | |||
| 1220 | Ga0373936_0284333 | |||
| 1221 | Ga0373939_0105236 | |||
| 1222 | Ga0373939_0330129 | |||
| 1223 | Ga0373941_0038746 | |||
| 1224 | Ga0373945_0077527 | |||
| 1225 | Ga0373945_0178069 | |||
| 1226 | Ga0373945_0257045 | |||
| 1227 | Ga0373953_0000062 | |||
| 1228 | Ga0373954_0000701 | |||
| 1229 | Ga0373954_0039432 | |||
| 1230 | Ga0373954_0057756 | |||
| 1231 | Ga0373954_0085410 | |||
| 1232 | Ga0373954_0206786 | |||
| 1233 | Ga0373956_0000061 | |||
| 1234 | Ga0373956_0026014 | |||
| 1235 | Ga0373956_0089832 | |||
| 1236 | Ga0373956_0213486 | |||
| 1237 | Ga0373957_0000042 | |||
| 1238 | Ga0373957_0032000 | |||
| 1239 | Ga0373957_0104270 | |||
| 1240 | Ga0373957_0142431 | |||
| 1241 | Ga0373955_0000106 | |||
| 1242 | Ga0373955_0044685 | |||
| 1243 | Ga0373955_0127993 | |||
| 1244 | Ga0373955_0167124 | |||
| 1245 | Ga0373942_0032967 | |||
| 1246 | Ga0373962_0012829 | |||
| 1247 | Ga0373924_0007857 | |||
| 1248 | Ga0373924_0010874 | |||
| 1249 | Ga0373924_0454280 | |||
| 1250 | Ga0373931_0016509 | |||
| 1251 | Ga0373931_0275921 | |||
| 1252 | Ga0373935_0001664 | |||
| 1253 | Ga0373935_0007757 | |||
| 1254 | Ga0373935_0058944 | |||
| 1255 | Ga0373935_0313481 | |||
| 1256 | Ga0373935_0836806 | |||
| 1257 | Ga0373927_0205325 | |||
| 1258 | Ga0373933_0000046 | |||
| 1259 | Ga0373933_0000764 | |||
| 1260 | Ga0373933_0005963 | |||
| 1261 | Ga0373933_0020037 | |||
| 1262 | Ga0373933_0132446 | |||
| 1263 | Ga0373947_0000017 | |||
| 1264 | Ga0373947_0030240 | |||
| 1265 | Ga0373947_0279008 | |||
| 1266 | Ga0373947_0348488 | |||
| 1267 | Ga0373947_0496709 | |||
| 1268 | Ga0373937_0000115 | |||
| 1269 | Ga0373937_0002923 | |||
| 1270 | Ga0373937_0009930 | |||
| 1271 | Ga0373937_0018604 | |||
| 1272 | Ga0373937_0045905 | |||
| 1273 | Ga0373937_1334131 | |||
| 1274 | Ga0373925_0014582 | |||
| 1275 | Ga0373925_0044387 | |||
| 1276 | Ga0373925_0381641 | |||
| 1277 | Ga0373925_1000666 | |||
| 1278 | Ga0395899_0141575 | |||
| 1279 | Ga0395899_0336724 | |||
| 1280 | Ga0395900_0319572 | |||
| 1281 | Ga0395900_0784291 | |||
| 1282 | Ga0395898_0078288 | |||
| 1283 | Ga0395898_0081831 | |||
| 1284 | Ga0395898_0200542 | |||
| 1285 | Ga0395905_0241197 | |||
| 1286 | Ga0436364_0018972 | |||
| 1287 | Ga0436364_0193061 | |||
| 1288 | Ga0436364_1222187 | |||
| 1289 | Ga0395901_0116073 | |||
| 1290 | Ga0436365_0769649 | |||
| 1291 | Ga0436365_0864774 | |||
| 1292 | Ga0436363_1395795 | |||
| 1293 | Ga0451833_0092015 | |||
| 1294 | Ga0439448_0023721 | |||
| 1295 | Ga0439450_056441 | |||
| 1296 | Ga0439464_0181419 | |||
| 1297 | Ga0439440_0029692 | |||
| 1298 | Ga0466969_0044599 | |||
| 1299 | Ga0466969_0067107 | |||
| 1300 | Ga0466969_0259269 | |||
| 1301 | Ga0466966_0016233 | |||
| 1302 | Ga0466966_0035174 | |||
| 1303 | Ga0466966_0068529 | |||
| 1304 | Ga0466961_0025632 | |||
| 1305 | Ga0466961_0026163 | |||
| 1306 | Ga0466963_0024305 | |||
| 1307 | Ga0466963_0026912 | |||
| 1308 | Ga0466963_0098811 | |||
| 1309 | Ga0466963_0283774 | |||
| 1310 | Ga0466970_0021915 | |||
| 1311 | Ga0466970_0072563 | |||
| 1312 | Ga0466957_0012941 | |||
| 1313 | Ga0466960_0086197 | |||
| 1314 | Ga0466959_0061956 | |||
| 1315 | Ga0466959_0388084 | |||
| 1316 | Ga0466958_0009978 | |||
| 1317 | Ga0466967_0029151 | |||
| 1318 | Ga0466967_0034742 | |||
| 1319 | Ga0466967_0043781 | |||
| 1320 | Ga0466967_0059236 | |||
| 1321 | Ga0466967_0180519 | |||
| 1322 | Ga0466967_0337627 | |||
| 1323 | Ga0466967_0369823 | |||
| 1324 | Ga0466967_0718267 | |||
| 1325 | Ga0495592_0000166 | |||
| 1326 | Ga0495592_0013099 | |||
| 1327 | Ga0495592_0096440 | |||
| 1328 | Ga0495592_0108418 | |||
| 1329 | Ga0495629_0025973 | |||
| 1330 | Ga0495629_0403786 | |||
| 1331 | Ga0495641_0014800 | |||
| 1332 | Ga0495641_0086212 | |||
| 1333 | Ga0495651_0000067 | |||
| 1334 | Ga0495651_0011292 | |||
| 1335 | Ga0495651_0170462 | |||
| 1336 | Ga0495651_0229751 | |||
| 1337 | Ga0495651_0510447 | |||
| 1338 | Ga0495653_0010757 | |||
| 1339 | Ga0495653_0012034 | |||
| 1340 | Ga0495653_0023951 | |||
| 1341 | Ga0495653_0221864 | |||
| 1342 | Ga0495653_0574263 | |||
| 1343 | Ga0495580_0221996 | |||
| 1344 | Ga0495582_0041278 | |||
| 1345 | Ga0495582_0106287 | |||
| 1346 | Ga0495639_0132420 | |||
| 1347 | Ga0495662_0005716 | |||
| 1348 | Ga0495662_0027072 | |||
| 1349 | Ga0495664_0016454 | |||
| 1350 | Ga0495664_0027093 | |||
| 1351 | Ga0495608_0000850 | |||
| 1352 | Ga0495608_0101796 | |||
| 1353 | Ga0495608_0105356 | |||
| 1354 | Ga0495608_0175744 | |||
| 1355 | Ga0495608_0792993 | |||
| 1356 | Ga0495618_0019512 | |||
| 1357 | Ga0495628_0000916 | |||
| 1358 | Ga0495628_0101958 | |||
| 1359 | Ga0495628_0123675 | |||
| 1360 | Ga0495630_0190999 | |||
| 1361 | Ga0495630_0516761 | |||
| 1362 | Ga0495652_0007308 | |||
| 1363 | Ga0495652_0028603 | |||
| 1364 | Ga0495652_0047780 | |||
| 1365 | Ga0495652_0145468 | |||
| 1366 | Ga0495652_0235786 | |||
| 1367 | Ga0495665_0054413 | |||
| 1368 | Ga0495665_0104071 | |||
| 1369 | Ga0495665_0267176 | |||
| 1370 | Ga0495640_0018433 | |||
| 1371 | Ga0495640_0020499 | |||
| 1372 | Ga0495640_0036929 | |||
| 1373 | Ga0495640_0083171 | |||
| 1374 | Ga0495640_0688277 | |||
| 1375 | Ga0495586_0029041 | |||
| 1376 | Ga0495587_0000078 | |||
| 1377 | Ga0495587_0015551 | |||
| 1378 | Ga0495587_0052225 | |||
| 1379 | Ga0495587_0075032 | |||
| 1380 | Ga0495645_0017608 | |||
| 1381 | Ga0495645_0021043 | |||
| 1382 | Ga0495645_0061609 | |||
| 1383 | Ga0495645_0097555 | |||
| 1384 | Ga0495645_0149779 | |||
| 1385 | Ga0495645_0685112 | |||
| 1386 | Ga0495667_0000122 | |||
| 1387 | Ga0495667_0062341 | |||
| 1388 | Ga0495667_0158763 | |||
| 1389 | Ga0495667_0176125 | |||
| 1390 | Ga0495634_0005904 | |||
| 1391 | Ga0495634_0064262 | |||
| 1392 | Ga0495635_0056438 | |||
| 1393 | Ga0495635_0131712 | |||
| 1394 | Ga0495635_0242631 | |||
| 1395 | Ga0495635_0261713 | |||
| 1396 | Ga0495635_0410592 | |||
| 1397 | Ga0495657_0000098 | |||
| 1398 | Ga0495657_0030849 | |||
| 1399 | Ga0495657_0034083 | |||
| 1400 | Ga0495657_0034763 | |||
| 1401 | Ga0495657_0279431 | |||
| 1402 | Ga0495599_0000115 | |||
| 1403 | Ga0495599_0032418 | |||
| 1404 | Ga0495599_0050210 | |||
| 1405 | Ga0495599_0196033 | |||
| 1406 | Ga0495599_0405641 | |||
| 1407 | Ga0495623_0000184 | |||
| 1408 | Ga0495623_0013148 | |||
| 1409 | Ga0495623_0017385 | |||
| 1410 | Ga0495646_0083212 | |||
| 1411 | Ga0495646_0225487 | |||
| 1412 | Ga0495658_0229243 | |||
| 1413 | Ga0495613_0006722 | |||
| 1414 | Ga0495624_0078166 | |||
| 1415 | Ga0495624_0080551 | |||
| 1416 | Ga0495624_0153044 | |||
| 1417 | Ga0495624_0189247 | |||
| 1418 | Ga0495624_0490734 | |||
| 1419 | Ga0495624_0689655 | |||
| 1420 | Ga0495600_0044741 | |||
| 1421 | Ga0495600_0063555 | |||
| 1422 | Ga0495600_0106015 | |||
| 1423 | Ga0495600_0183953 | |||
| 1424 | Ga0495600_0254864 | |||
| 1425 | Ga0495581_0004878 | |||
| 1426 | Ga0495604_0000142 | |||
| 1427 | Ga0495604_0002956 | |||
| 1428 | Ga0495604_0047887 | |||
| 1429 | Ga0495604_0050516 | |||
| 1430 | Ga0495604_0140320 | |||
| 1431 | Ga0495674_0003502 | |||
| 1432 | Ga0495674_0054318 | |||
| 1433 | Ga0495674_0084311 | |||
| 1434 | Ga0495674_0127331 | |||
| 1435 | Ga0495674_0147368 | |||
| 1436 | Ga0495674_0275688 | |||
| 1437 | Ga0495674_0474183 | |||
| 1438 | Ga0495676_0023985 | |||
| 1439 | Ga0495676_0760191 | |||
| 1440 | Ga0495680_0000111 | |||
| 1441 | Ga0495680_0005094 | |||
| 1442 | Ga0495680_0006295 | |||
| 1443 | Ga0495680_0091051 | |||
| 1444 | Ga0495675_0001489 | |||
| 1445 | Ga0495675_0038835 | |||
| 1446 | Ga0495675_0227612 | |||
| 1447 | Ga0495684_0057283 | |||
| 1448 | Ga0495684_0091925 | |||
| 1449 | Ga0495684_0126365 | |||
| 1450 | Ga0495684_0341984 | |||
| 1451 | Ga0495593_0003863 | |||
| 1452 | Ga0495602_0000820 | |||
| 1453 | Ga0495602_0004405 | |||
| 1454 | Ga0495602_0041429 | |||
| 1455 | Ga0495602_0078803 | |||
| 1456 | Ga0495602_0245696 | |||
| 1457 | Ga0495614_0161863 | |||
| 1458 | Ga0496100_0035549 | |||
| 1459 | Ga0496100_0099113 | |||
| 1460 | Ga0496100_0317520 | |||
| 1461 | Ga0496101_0072935 | |||
| 1462 | Ga0496102_0057409 | |||
| 1463 | Ga0496102_0496346 | |||
| 1464 | Ga0496103_0584830 | |||
| 1465 | Ga0496104_0036122 | |||
| 1466 | Ga0496104_0068528 | |||
| 1467 | Ga0496104_0331253 | |||
| 1468 | Ga0496105_0002449 | |||
| 1469 | Ga0496105_0023215 | |||
| 1470 | Ga0496105_0246766 | |||
| 1471 | Ga0496106_0109247 | |||
| 1472 | Ga0496107_0099752 | |||
| 1473 | Ga0496108_0010097 | |||
| 1474 | Ga0496108_0351906 | |||
| 1475 | Ga0496109_0010090 | |||
| 1476 | Ga0496109_0096026 | |||
| 1477 | Ga0496109_0247544 | |||
| 1478 | Ga0496109_0570633 | |||
| 1479 | Ga0496110_0011780 | |||
| 1480 | Ga0496111_0102276 | |||
| 1481 | Ga0496112_0000184 | |||
| 1482 | Ga0496112_0217418 | |||
| 1483 | Ga0496112_0376686 | |||
| 1484 | Ga0496113_0003802 | |||
| 1485 | Ga0496114_0087446 | |||
| 1486 | Ga0496114_0141329 | |||
| 1487 | Ga0496115_0040923 | |||
| 1488 | Ga0496115_0045292 | |||
| 1489 | Ga0496126_0045008 | |||
| 1490 | Ga0501038_0004414 | |||
| 1491 | Ga0501039_0003933 | |||
| 1492 | Ga0501041_0001834 | |||
| 1493 | Ga0501042_0004212 | |||
| 1494 | Ga0501042_0560681 | |||
| 1495 | Ga0501043_0011448 | |||
| 1496 | Ga0501043_0020106 | |||
| 1497 | Ga0501046_0003864 | |||
| 1498 | Ga0501047_0000031 | |||
| 1499 | Ga0501068_0016931 | |||
| 1500 | Ga0501071_0003836 | |||
| 1501 | Ga0501074_0007110 | |||
| 1502 | Ga0501075_0004173 | |||
| 1503 | Ga0501079_0006985 | |||
| 1504 | Ga0501081_0000730 | |||
| 1505 | Ga0501083_0025481 | |||
| 1506 | Ga0501035_0005927 | |||
| 1507 | Ga0501035_0072319 | |||
| 1508 | Ga0501044_0011851 | |||
| 1509 | nmdc:mga05p37_48767_c1 | |||
| 1510 | nmdc:mga05p37_490287_c1 | |||
| 1511 | nmdc:mga09592_215828_c1 | |||
| 1512 | nmdc:mga0n895_292103_c1 | |||
| 1513 | nmdc:mga0n895_6775_c1 | |||
| 1514 | nmdc:mga0n895_93484_c1 | |||
| 1515 | nmdc:mga0rr50_392899_c1 | |||
| 1516 | nmdc:mga0rr50_509345_c1 | |||
| 1517 | nmdc:mga08x19_14122_c1 | |||
| 1518 | nmdc:mga08x19_240744_c1 | |||
| 1519 | nmdc:mga08x19_370817_c1 | |||
| 1520 | nmdc:mga0a205_110632_c1 | |||
| 1521 | nmdc:mga0a205_45417_c1 | |||
| 1522 | nmdc:mga0a205_55318_c1 | |||
| 1523 | Ga0495601_0011127 | |||
| 1524 | Ga0495601_0037820 | |||
| 1525 | Ga0495601_0053364 | |||
| 1526 | Ga0495601_0467908 | |||
| 1527 | Ga0495612_0001875 | |||
| 1528 | Ga0495595_0007699 | |||
| 1529 | Ga0495595_0089134 | |||
| 1530 | Ga0495595_0363892 | |||
| 1531 | Ga0495619_0018280 | |||
| 1532 | Ga0495619_0066334 | |||
| 1533 | Ga0500559_0071811 | |||
| 1534 | Ga0500604_0058068 | |||
| 1535 | Ga0500616_0005675 | |||
| 1536 | Ga0501084_0002745 | |||
| 1537 | Ga0590074_014940 | |||
| 1538 | Ga0587085_078600 | |||
| 1539 | Ga0530510_0005792 | |||
| 1540 | 2559431201 | |||
| 1541 | 2795784885 | |||
| 1542 | 2811846467 | |||
| 1543 | 2866553892 | |||
| 1544 | 2990093423 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rk0-assembly1.cif.gz_B | crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec | 0.8207 | 34 | 161 |
| 5vb0-assembly6.cif.gz_H | crystal structure of fosfomycin resistance protein fosa3 | 0.8194 | 34 | 163 |
| 4mtr-assembly1.cif.gz_B | zn-bound gloa2 | 0.8189 | 36 | 161 |
| 3oaj-assembly1.cif.gz_A | crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 | 0.8183 | 32 | 161 |
| 4mtr-assembly1.cif.gz_A | zn-bound gloa2 | 0.8182 | 36 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1X7YDR8_31_97_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8356 | 35 | 93 | 3.10.180.10 |
| 2rk0B01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8214 | 40 | 157 | 3.10.180.10 |
| af_Q2FVA5_9_134_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8207 | 36 | 161 | 3.10.180.10 |
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8189 | 36 | 161 | 3.10.180.10 |
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8126 | 36 | 161 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A261CVE0-F1-model_v4 | Glyoxalase | 0.9777 | 10 | 171 |
|
| AF-A0A069JIC4-F1-model_v4 | merged | 0.9742 | 4 | 171 |
|
| AF-A0A554UZH7-F1-model_v4 | VOC family protein | 0.9734 | 8 | 171 |
|
| AF-A0A358SJ16-F1-model_v4 | VOC family protein | 0.9724 | 1 | 172 |
|
| AF-A0A2W6D648-F1-model_v4 | VOC family protein | 0.9698 | 25 | 171 |
|