F480107

General Info

Members Datasets Scaffolds Average Seq Length
772 288 1544 140

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_101600925|Ga0068857_1016009251
Length 160
Sequence MAAPAKPAAGGKGGAPAKGGPKKEVKALVKLQMPAGQATPAPPVGPALGQAGVNIMDFCKAFNAKTAKDDGLIIPVVITVYADRSYTFITKTPPVAVLIKREAGIAKGSGEPNKNKVGKISMKQVEQIAKLKLPDLNAESLEAAIETVKGTARSMGVEVG

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
186 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
187 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
206 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
207 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
208 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
281 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 2.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.31
Nodule 0
Rhizoplane 0.26
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_101600925 3300005577 Bacteria 636
2 LJQas_1002079 3300000549 Bacteria 2853
3 JGI24035J26624_1015521 3300002126 Bacteria 781
4 Ga0058859_10009949 3300004798 Bacteria 997
5 Ga0058859_10030311 3300004798 Bacteria 1273
6 Ga0058859_11571661 3300004798 Bacteria 900
7 Ga0058863_10012701 3300004799 Bacteria 853
8 Ga0058860_11892679 3300004801 Bacteria 520
9 Ga0058862_10076498 3300004803 Bacteria 2590
10 Ga0065704_10034794 3300005289 Bacteria 901
11 Ga0065712_10075551 3300005290 Bacteria 3839
12 Ga0065715_10001671 3300005293 Bacteria 6504
13 Ga0065707_10094938 3300005295 Bacteria 3431
14 Ga0065707_10120063 3300005295 Bacteria 2137
15 Ga0070676_10058191 3300005328 Bacteria 2290
16 Ga0070683_100083622 3300005329 Bacteria 2990
17 Ga0070690_100135975 3300005330 Bacteria 1664
18 Ga0070690_100550931 3300005330 Bacteria 869
19 Ga0070690_100803136 3300005330 Bacteria 730
20 Ga0070677_10192552 3300005333 Bacteria 978
21 Ga0070677_10581262 3300005333 Bacteria 618
22 Ga0068869_100033436 3300005334 Bacteria 3630
23 Ga0068869_100071512 3300005334 Bacteria 2569
24 Ga0068869_100086440 3300005334 Bacteria 2350
25 Ga0068869_100104253 3300005334 Bacteria 2149
26 Ga0070666_10698951 3300005335 Bacteria 743
27 Ga0070680_100285416 3300005336 Bacteria 1399
28 Ga0070680_100782396 3300005336 Bacteria 822
29 Ga0068868_100042747 3300005338 Bacteria 3538
30 Ga0068868_100110479 3300005338 Bacteria 2233
31 Ga0070660_100324648 3300005339 Bacteria 1265
32 Ga0070689_100053328 3300005340 Bacteria 3129
33 Ga0070689_100115281 3300005340 Bacteria 2141
34 Ga0070689_100135556 3300005340 Bacteria 1977
35 Ga0070691_10079213 3300005341 Bacteria 1606
36 Ga0070691_10554617 3300005341 Bacteria 672
37 Ga0070691_10896539 3300005341 Bacteria 547
38 Ga0070687_100004090 3300005343 Bacteria 5761
39 Ga0070687_100117847 3300005343 Bacteria 1513
40 Ga0070687_101359899 3300005343 Bacteria 529
41 Ga0070661_100236680 3300005344 Bacteria 1405
42 Ga0070661_100383244 3300005344 Bacteria 1109
43 Ga0070692_11087822 3300005345 Bacteria 564
44 Ga0070668_100060390 3300005347 Bacteria 2936
45 Ga0070668_100128533 3300005347 Bacteria 2031
46 Ga0070669_100445201 3300005353 Bacteria 1067
47 Ga0070669_100623556 3300005353 Bacteria 905
48 Ga0070669_100693128 3300005353 Bacteria 860
49 Ga0070675_100006570 3300005354 Bacteria 8937
50 Ga0070675_100188398 3300005354 Bacteria 1787
51 Ga0070675_100589358 3300005354 Bacteria 1008
52 Ga0070675_100809522 3300005354 Bacteria 856
53 Ga0070671_101070822 3300005355 Bacteria 707
54 Ga0070674_100082765 3300005356 Bacteria 2296
55 Ga0070673_100137447 3300005364 Bacteria 2058
56 Ga0070673_100156085 3300005364 Bacteria 1937
57 Ga0070688_100018844 3300005365 Bacteria 3990
58 Ga0070688_100062197 3300005365 Bacteria 2363
59 Ga0070688_100498015 3300005365 Bacteria 918
60 Ga0070688_101430501 3300005365 Bacteria 561
61 Ga0070667_100121834 3300005367 Bacteria 2269
62 Ga0070703_10019147 3300005406 Bacteria 1984
63 Ga0070703_10074556 3300005406 Bacteria 1141
64 Ga0070703_10075293 3300005406 Bacteria 1137
65 Ga0070701_10023692 3300005438 Bacteria 2960
66 Ga0070701_10072610 3300005438 Bacteria 1843
67 Ga0070701_11309535 3300005438 Bacteria 518
68 Ga0070711_100694174 3300005439 Bacteria 856
69 Ga0070705_100008422 3300005440 Bacteria 5109
70 Ga0070705_100024713 3300005440 Bacteria 3247
71 Ga0070705_100109224 3300005440 Bacteria 1763
72 Ga0070705_100275319 3300005440 Bacteria 1194
73 Ga0070700_100184781 3300005441 Bacteria 1453
74 Ga0070694_100181852 3300005444 Bacteria 1556
75 Ga0070694_100283632 3300005444 Bacteria 1263
76 Ga0070694_100340771 3300005444 Bacteria 1159
77 Ga0070708_100013710 3300005445 Bacteria 6649
78 Ga0070708_100306457 3300005445 Bacteria 1496
79 Ga0070708_100478765 3300005445 Bacteria 1175
80 Ga0070708_100727085 3300005445 Bacteria 934
81 Ga0070708_100801188 3300005445 Bacteria 885
82 Ga0070708_101653041 3300005445 Bacteria 596
83 Ga0070663_100067681 3300005455 Bacteria 2591
84 Ga0070678_100142727 3300005456 Bacteria 1918
85 Ga0070678_100988631 3300005456 Bacteria 773
86 Ga0070678_101109798 3300005456 Bacteria 731
87 Ga0070662_100116863 3300005457 Bacteria 2039
88 Ga0070662_100210893 3300005457 Bacteria 1546
89 Ga0070662_100546774 3300005457 Bacteria 970
90 Ga0068867_100034697 3300005459 Bacteria 3658
91 Ga0068867_100047398 3300005459 Bacteria 3159
92 Ga0068867_100651729 3300005459 Bacteria 924
93 Ga0070685_10020159 3300005466 Bacteria 3607
94 Ga0070706_100030979 3300005467 Bacteria 4932
95 Ga0070706_100031741 3300005467 Bacteria 4870
96 Ga0070706_100398697 3300005467 Bacteria 1281
97 Ga0070706_100802148 3300005467 Bacteria 871
98 Ga0070706_101398758 3300005467 Bacteria 640
99 Ga0070707_100180700 3300005468 Bacteria 2056
100 Ga0070707_100200785 3300005468 Bacteria 1944
101 Ga0070707_100283587 3300005468 Bacteria 1609
102 Ga0070707_100490165 3300005468 Bacteria 1190
103 Ga0070707_100944007 3300005468 Bacteria 827
104 Ga0070698_100038993 3300005471 Bacteria 4893
105 Ga0070698_100064792 3300005471 Bacteria 3680
106 Ga0070698_100081929 3300005471 Bacteria 3219
107 Ga0070698_100180227 3300005471 Bacteria 2051
108 Ga0070698_100221562 3300005471 Bacteria 1825
109 Ga0070698_100531343 3300005471 Bacteria 1115
110 Ga0070698_100633971 3300005471 Bacteria 1010
111 Ga0070698_101784745 3300005471 Bacteria 568
112 Ga0070699_100044578 3300005518 Bacteria 3839
113 Ga0070699_100150446 3300005518 Bacteria 2058
114 Ga0070699_100279411 3300005518 Bacteria 1495
115 Ga0070699_100287527 3300005518 Bacteria 1473
116 Ga0070699_100761090 3300005518 Bacteria 886
117 Ga0070684_100312592 3300005535 Bacteria 1443
118 Ga0070697_100099878 3300005536 Bacteria 2409
119 Ga0070697_100111311 3300005536 Bacteria 2282
120 Ga0070697_100696127 3300005536 Bacteria 896
121 Ga0070697_100857128 3300005536 Bacteria 805
122 Ga0070672_100068186 3300005543 Bacteria 2821
123 Ga0070672_100110514 3300005543 Bacteria 2239
124 Ga0070672_100258116 3300005543 Bacteria 1469
125 Ga0070672_100296622 3300005543 Bacteria 1369
126 Ga0070672_100564889 3300005543 Bacteria 989
127 Ga0070686_100176860 3300005544 Bacteria 1513
128 Ga0070686_100592455 3300005544 Bacteria 872
129 Ga0070686_101437427 3300005544 Bacteria 579
130 Ga0070695_100029815 3300005545 Bacteria 3393
131 Ga0070695_100055049 3300005545 Bacteria 2563
132 Ga0070695_100075021 3300005545 Bacteria 2223
133 Ga0070695_100076540 3300005545 Bacteria 2204
134 Ga0070695_100256764 3300005545 Bacteria 1274
135 Ga0070695_100303560 3300005545 Bacteria 1181
136 Ga0070695_100445829 3300005545 Bacteria 991
137 Ga0070695_100958933 3300005545 Bacteria 694
138 Ga0070696_100002821 3300005546 Bacteria 11547
139 Ga0070696_100022619 3300005546 Bacteria 4273
140 Ga0070696_100076870 3300005546 Bacteria 2358
141 Ga0070696_100224234 3300005546 Bacteria 1411
142 Ga0070696_100629730 3300005546 Bacteria 868
143 Ga0070696_100650183 3300005546 Bacteria 855
144 Ga0070696_100993278 3300005546 Bacteria 701
145 Ga0070696_101087364 3300005546 Bacteria 672
146 Ga0070693_100262650 3300005547 Bacteria 1149
147 Ga0070665_100144701 3300005548 Bacteria 2380
148 Ga0070704_100005977 3300005549 Bacteria 7135
149 Ga0070704_100010131 3300005549 Bacteria 5731
150 Ga0070704_100022877 3300005549 Bacteria 4072
151 Ga0070704_100040571 3300005549 Bacteria 3205
152 Ga0070704_100325557 3300005549 Bacteria 1289
153 Ga0070704_100485378 3300005549 Bacteria 1070
154 Ga0070704_100524392 3300005549 Bacteria 1031
155 Ga0070704_100919730 3300005549 Bacteria 788
156 Ga0070704_102099443 3300005549 Bacteria 525
157 Ga0068855_100469611 3300005563 Bacteria 1371
158 Ga0070664_100445539 3300005564 Bacteria 1188
159 Ga0070664_100472914 3300005564 Bacteria 1153
160 Ga0068854_100195924 3300005578 Bacteria 1585
161 Ga0068854_100586759 3300005578 Bacteria 950
162 Ga0068854_101565455 3300005578 Bacteria 600
163 Ga0070702_100034683 3300005615 Bacteria 2782
164 Ga0070702_100205911 3300005615 Bacteria 1306
165 Ga0070702_100839530 3300005615 Bacteria 714
166 Ga0068852_100167671 3300005616 Bacteria 2056
167 Ga0068852_101487006 3300005616 Bacteria 700
168 Ga0068859_100006485 3300005617 Bacteria 11877
169 Ga0068859_100265816 3300005617 Bacteria 1807
170 Ga0068859_100392406 3300005617 Bacteria 1484
171 Ga0068859_100848330 3300005617 Bacteria 1000
172 Ga0068864_100132843 3300005618 Bacteria 2238
173 Ga0068864_100309644 3300005618 Bacteria 1480
174 Ga0068864_101317222 3300005618 Bacteria 723
175 Ga0068864_101524168 3300005618 Bacteria 672
176 Ga0068866_10009547 3300005718 Bacteria 4123
177 Ga0068866_10278030 3300005718 Bacteria 1036
178 Ga0068861_100018492 3300005719 Bacteria 4965
179 Ga0068861_100144716 3300005719 Bacteria 1944
180 Ga0068861_101135476 3300005719 Bacteria 753
181 Ga0068861_101378487 3300005719 Bacteria 688
182 Ga0068851_10015650 3300005834 Bacteria 3617
183 Ga0068870_10047581 3300005840 Bacteria 2255
184 Ga0068870_10273743 3300005840 Bacteria 1056
185 Ga0068870_10388716 3300005840 Bacteria 905
186 Ga0068870_10432499 3300005840 Bacteria 864
187 Ga0068863_100056059 3300005841 Bacteria 3731
188 Ga0068863_100157443 3300005841 Bacteria 2175
189 Ga0068858_100018526 3300005842 Bacteria 6518
190 Ga0068858_100489986 3300005842 Bacteria 1187
191 Ga0068858_100610194 3300005842 Bacteria 1059
192 Ga0068860_100095944 3300005843 Bacteria 2827
193 Ga0068860_100172799 3300005843 Bacteria 2087
194 Ga0068862_100019974 3300005844 Bacteria 5591
195 Ga0068862_100028512 3300005844 Bacteria 4702
196 Ga0068862_100136776 3300005844 Bacteria 2172
197 Ga0068862_101112192 3300005844 Bacteria 785
198 Ga0081455_10284223 3300005937 Bacteria 1194
199 Ga0075365_10109887 3300006038 Bacteria 1894
200 Ga0075368_10184474 3300006042 Bacteria 880
201 Ga0075368_10511639 3300006042 Bacteria 537
202 Ga0075363_100033397 3300006048 Bacteria 2679
203 Ga0075363_100058856 3300006048 Bacteria 2064
204 Ga0075363_100925424 3300006048 Bacteria 535
205 Ga0075364_10151550 3300006051 Bacteria 1562
206 Ga0075364_10297609 3300006051 Bacteria 1098
207 Ga0075364_10492806 3300006051 Bacteria 838
208 Ga0075364_10669025 3300006051 Bacteria 709
209 Ga0070715_10228446 3300006163 Bacteria 961
210 Ga0075362_10001146 3300006177 Bacteria 8277
211 Ga0075362_10185513 3300006177 Bacteria 1009
212 Ga0075362_10412549 3300006177 Bacteria 682
213 Ga0075367_10001903 3300006178 Bacteria 9255
214 Ga0075367_10071203 3300006178 Bacteria 2091
215 Ga0075367_10157732 3300006178 Bacteria 1410
216 Ga0075367_10445170 3300006178 Bacteria 821
217 Ga0075366_10019018 3300006195 Bacteria 3970
218 Ga0075366_10047335 3300006195 Bacteria 2549
219 Ga0075366_10134886 3300006195 Bacteria 1490
220 Ga0075366_10196041 3300006195 Bacteria 1228
221 Ga0075366_10670209 3300006195 Bacteria 644
222 Ga0097621_100070753 3300006237 Bacteria 2881
223 Ga0097621_100391089 3300006237 Bacteria 1243
224 Ga0075370_10013931 3300006353 Bacteria 4279
225 Ga0075370_10947745 3300006353 Bacteria 527
226 Ga0068871_100156003 3300006358 Bacteria 1949
227 Ga0068871_100346614 3300006358 Bacteria 1313
228 Ga0068871_100992304 3300006358 Bacteria 782
229 Ga0075428_100038516 3300006844 Bacteria 5261
230 Ga0075428_100078443 3300006844 Bacteria 3605
231 Ga0075428_100177937 3300006844 Bacteria 2303
232 Ga0075428_100382981 3300006844 Bacteria 1508
233 Ga0075428_100481220 3300006844 Bacteria 1329
234 Ga0075428_100691711 3300006844 Bacteria 1086
235 Ga0075428_101033914 3300006844 Bacteria 869
236 Ga0075428_101077944 3300006844 Bacteria 849
237 Ga0075430_100212450 3300006846 Bacteria 1605
238 Ga0075430_100403238 3300006846 Bacteria 1129
239 Ga0075430_100931613 3300006846 Bacteria 716
240 Ga0075430_101661945 3300006846 Bacteria 524
241 Ga0075431_100031478 3300006847 Bacteria 5464
242 Ga0075431_100055527 3300006847 Bacteria 4085
243 Ga0075431_100059761 3300006847 Bacteria 3933
244 Ga0075431_100387869 3300006847 Bacteria 1400
245 Ga0075431_100450320 3300006847 Bacteria 1283
246 Ga0075431_100610405 3300006847 Bacteria 1074
247 Ga0075431_101611462 3300006847 Bacteria 607
248 Ga0075431_102053067 3300006847 Bacteria 527
249 Ga0075433_10010573 3300006852 Bacteria 7417
250 Ga0075433_10013136 3300006852 Bacteria 6720
251 Ga0075433_10026861 3300006852 Bacteria 4878
252 Ga0075433_10049470 3300006852 Bacteria 3657
253 Ga0075433_10126728 3300006852 Bacteria 2267
254 Ga0075433_10137283 3300006852 Bacteria 2173
255 Ga0075433_10143012 3300006852 Bacteria 2126
256 Ga0075433_10170317 3300006852 Bacteria 1938
257 Ga0075433_10256641 3300006852 Bacteria 1550
258 Ga0075433_10550877 3300006852 Bacteria 1014
259 Ga0075433_10557286 3300006852 Bacteria 1007
260 Ga0075433_11276150 3300006852 Bacteria 637
261 Ga0075434_100045216 3300006871 Bacteria 4368
262 Ga0075434_100054503 3300006871 Bacteria 3972
263 Ga0075434_100074288 3300006871 Bacteria 3393
264 Ga0075434_100125609 3300006871 Bacteria 2582
265 Ga0075434_100182614 3300006871 Bacteria 2118
266 Ga0075434_100206680 3300006871 Bacteria 1984
267 Ga0075434_100241964 3300006871 Bacteria 1824
268 Ga0075434_100515501 3300006871 Bacteria 1216
269 Ga0075434_100946685 3300006871 Bacteria 876
270 Ga0075429_100036840 3300006880 Bacteria 4256
271 Ga0075429_100039515 3300006880 Bacteria 4106
272 Ga0075429_100054059 3300006880 Bacteria 3493
273 Ga0075429_100117106 3300006880 Bacteria 2328
274 Ga0075429_100156329 3300006880 Bacteria 1997
275 Ga0075429_100352898 3300006880 Bacteria 1288
276 Ga0075429_100441777 3300006880 Bacteria 1140
277 Ga0075429_100574573 3300006880 Bacteria 988
278 Ga0075429_100923668 3300006880 Bacteria 763
279 Ga0068865_100011001 3300006881 Bacteria 5647
280 Ga0068865_101144521 3300006881 Bacteria 687
281 Ga0075436_100071470 3300006914 Bacteria 2399
282 Ga0075436_100077951 3300006914 Bacteria 2295
283 Ga0075436_100154710 3300006914 Bacteria 1615
284 Ga0075436_100359275 3300006914 Bacteria 1051
285 Ga0097620_100006485 3300006931 Bacteria 11877
286 Ga0097620_100265819 3300006931 Bacteria 1807
287 Ga0097620_100392436 3300006931 Bacteria 1484
288 Ga0097620_100848230 3300006931 Bacteria 1000
289 Ga0075435_100008029 3300007076 Bacteria 7552
290 Ga0075435_100199873 3300007076 Bacteria 1693
291 Ga0075435_100316903 3300007076 Bacteria 1335
292 Ga0075435_100385537 3300007076 Bacteria 1204
293 Ga0075435_100960463 3300007076 Bacteria 746
294 Ga0105240_10763055 3300009093 Bacteria 1050
295 Ga0105240_11274520 3300009093 Bacteria 776
296 Ga0111539_10031852 3300009094 Bacteria 6405
297 Ga0111539_10041302 3300009094 Bacteria 5547
298 Ga0111539_10044169 3300009094 Bacteria 5339
299 Ga0111539_10045305 3300009094 Bacteria 5266
300 Ga0111539_10160076 3300009094 Bacteria 2633
301 Ga0111539_10170170 3300009094 Bacteria 2546
302 Ga0111539_10207560 3300009094 Bacteria 2283
303 Ga0111539_10311606 3300009094 Bacteria 1832
304 Ga0111539_10692476 3300009094 Bacteria 1186
305 Ga0111539_10711019 3300009094 Bacteria 1169
306 Ga0111539_10752056 3300009094 Bacteria 1134
307 Ga0111539_11212904 3300009094 Bacteria 876
308 Ga0111539_11832460 3300009094 Bacteria 703
309 Ga0105245_10065898 3300009098 Bacteria 3276
310 Ga0105245_11605305 3300009098 Bacteria 702
311 Ga0105247_10698723 3300009101 Bacteria 763
312 Ga0105247_10814951 3300009101 Bacteria 713
313 Ga0114129_10016065 3300009147 Bacteria 10648
314 Ga0114129_10024758 3300009147 Bacteria 8509
315 Ga0114129_10060754 3300009147 Bacteria 5283
316 Ga0114129_10151865 3300009147 Bacteria 3169
317 Ga0114129_10152039 3300009147 Bacteria 3167
318 Ga0114129_10268996 3300009147 Bacteria 2281
319 Ga0114129_10590631 3300009147 Bacteria 1440
320 Ga0114129_11174047 3300009147 Bacteria 957
321 Ga0114129_11212689 3300009147 Bacteria 939
322 Ga0114129_11696797 3300009147 Bacteria 771
323 Ga0105243_11202549 3300009148 Bacteria 771
324 Ga0105243_12265894 3300009148 Bacteria 580
325 Ga0105242_10033180 3300009176 Bacteria 4133
326 Ga0105242_10551873 3300009176 Bacteria 1105
327 Ga0105242_10685229 3300009176 Bacteria 1001
328 Ga0105242_11673050 3300009176 Bacteria 672
329 Ga0105248_10069618 3300009177 Bacteria 3951
330 Ga0105248_10093930 3300009177 Bacteria 3378
331 Ga0105248_11062379 3300009177 Bacteria 915
332 Ga0105249_10018258 3300009553 Bacteria 6236
333 Ga0105249_10075568 3300009553 Bacteria 3121
334 Ga0105249_11296933 3300009553 Bacteria 800
335 Ga0105239_10005718 3300010375 Bacteria 14523
336 Ga0105239_10465115 3300010375 Bacteria 1436
337 Ga0105246_10088198 3300011119 Bacteria 2228
338 Ga0105246_11899907 3300011119 Bacteria 572
339 Ga0157378_10071072 3300013297 Bacteria 3125
340 Ga0157378_10322735 3300013297 Bacteria 1500
341 Ga0157378_11190477 3300013297 Bacteria 801
342 Ga0163162_10055553 3300013306 Bacteria 3987
343 Ga0163162_10294931 3300013306 Bacteria 1753
344 Ga0157375_10083480 3300013308 Bacteria 3240
345 Ga0157375_10946748 3300013308 Bacteria 1003
346 Ga0157375_11355544 3300013308 Bacteria 837
347 Ga0163163_10000446 3300014325 Bacteria 37797
348 Ga0157380_10008190 3300014326 Bacteria 7448
349 Ga0157380_10068381 3300014326 Bacteria 2862
350 Ga0157380_10111654 3300014326 Bacteria 2298
351 Ga0157380_10145568 3300014326 Bacteria 2042
352 Ga0157380_10151509 3300014326 Bacteria 2005
353 Ga0157377_10495981 3300014745 Bacteria 852
354 Ga0157377_10647040 3300014745 Bacteria 760
355 Ga0157377_10744833 3300014745 Bacteria 716
356 Ga0157377_10830120 3300014745 Bacteria 684
357 Ga0157379_10079613 3300014968 Bacteria 2934
358 Ga0157379_10573509 3300014968 Bacteria 1051
359 Ga0157376_10752992 3300014969 Bacteria 983
360 Ga0163161_10048397 3300017792 Bacteria 3070
361 Ga0163161_10052357 3300017792 Bacteria 2959
362 Ga0207697_10078080 3300025315 Bacteria 1393
363 Ga0207656_10101493 3300025321 Bacteria 1320
364 Ga0207653_10016183 3300025885 Bacteria 2342
365 Ga0207653_10033410 3300025885 Bacteria 1669
366 Ga0207653_10153508 3300025885 Bacteria 849
367 Ga0207653_10258791 3300025885 Bacteria 668
368 Ga0207682_10614320 3300025893 Bacteria 512
369 Ga0207642_10708997 3300025899 Bacteria 634
370 Ga0207688_10074577 3300025901 Bacteria 1930
371 Ga0207680_10247963 3300025903 Bacteria 1229
372 Ga0207685_10163727 3300025905 Bacteria 1017
373 Ga0207699_10010539 3300025906 Bacteria 4644
374 Ga0207645_10020173 3300025907 Bacteria 4364
375 Ga0207645_10027190 3300025907 Bacteria 3696
376 Ga0207643_10014738 3300025908 Bacteria 4251
377 Ga0207643_10019033 3300025908 Bacteria 3761
378 Ga0207643_10372447 3300025908 Bacteria 899
379 Ga0207684_10033293 3300025910 Bacteria 4382
380 Ga0207684_10043552 3300025910 Bacteria 3806
381 Ga0207684_10609278 3300025910 Bacteria 932
382 Ga0207663_10081029 3300025916 Bacteria 2124
383 Ga0207660_10105948 3300025917 Bacteria 2108
384 Ga0207660_10124710 3300025917 Bacteria 1954
385 Ga0207660_10250624 3300025917 Bacteria 1397
386 Ga0207662_10049015 3300025918 Bacteria 2504
387 Ga0207662_10059649 3300025918 Bacteria 2287
388 Ga0207662_10075330 3300025918 Bacteria 2050
389 Ga0207657_10235823 3300025919 Bacteria 1462
390 Ga0207649_10098865 3300025920 Bacteria 1927
391 Ga0207646_10126715 3300025922 Bacteria 2296
392 Ga0207646_10277167 3300025922 Bacteria 1515
393 Ga0207646_10459556 3300025922 Bacteria 1148
394 Ga0207646_10490482 3300025922 Bacteria 1107
395 Ga0207646_10684574 3300025922 Bacteria 917
396 Ga0207646_11585822 3300025922 Bacteria 565
397 Ga0207681_10019126 3300025923 Bacteria 4325
398 Ga0207681_10036207 3300025923 Bacteria 3255
399 Ga0207681_11438104 3300025923 Bacteria 578
400 Ga0207694_10204149 3300025924 Bacteria 1608
401 Ga0207659_10002914 3300025926 Bacteria 10190
402 Ga0207659_10016029 3300025926 Bacteria 4869
403 Ga0207659_10056582 3300025926 Bacteria 2810
404 Ga0207659_10071199 3300025926 Bacteria 2538
405 Ga0207659_10695184 3300025926 Bacteria 871
406 Ga0207687_10092380 3300025927 Bacteria 2210
407 Ga0207644_10076123 3300025931 Bacteria 2468
408 Ga0207706_10036777 3300025933 Bacteria 4348
409 Ga0207706_10063292 3300025933 Bacteria 3257
410 Ga0207706_10597216 3300025933 Bacteria 948
411 Ga0207686_10082635 3300025934 Bacteria 2100
412 Ga0207686_10569572 3300025934 Bacteria 888
413 Ga0207670_10067702 3300025936 Bacteria 2457
414 Ga0207670_10087739 3300025936 Bacteria 2192
415 Ga0207670_10219533 3300025936 Bacteria 1454
416 Ga0207670_11138123 3300025936 Bacteria 660
417 Ga0207669_10141415 3300025937 Bacteria 1671
418 Ga0207669_10206455 3300025937 Bacteria 1430
419 Ga0207704_10032275 3300025938 Bacteria 2961
420 Ga0207704_10164934 3300025938 Bacteria 1581
421 Ga0207704_10624870 3300025938 Bacteria 884
422 Ga0207704_10665634 3300025938 Bacteria 859
423 Ga0207665_10149931 3300025939 Bacteria 1669
424 Ga0207691_10012896 3300025940 Bacteria 8003
425 Ga0207691_10026550 3300025940 Bacteria 5433
426 Ga0207691_10189597 3300025940 Bacteria 1794
427 Ga0207691_10229535 3300025940 Bacteria 1608
428 Ga0207711_10046967 3300025941 Bacteria 3690
429 Ga0207711_10136373 3300025941 Bacteria 2205
430 Ga0207711_10270579 3300025941 Bacteria 1563
431 Ga0207711_10402891 3300025941 Bacteria 1271
432 Ga0207689_10032303 3300025942 Bacteria 4355
433 Ga0207689_10047425 3300025942 Bacteria 3547
434 Ga0207689_10110763 3300025942 Bacteria 2256
435 Ga0207689_10755216 3300025942 Bacteria 821
436 Ga0207689_10863414 3300025942 Bacteria 764
437 Ga0207661_10146636 3300025944 Bacteria 2037
438 Ga0207679_10195992 3300025945 Bacteria 1683
439 Ga0207679_10768654 3300025945 Bacteria 877
440 Ga0207651_10030998 3300025960 Bacteria 3412
441 Ga0207712_10166922 3300025961 Bacteria 1717
442 Ga0207712_10291619 3300025961 Bacteria 1335
443 Ga0207712_10694733 3300025961 Bacteria 887
444 Ga0207640_10322989 3300025981 Bacteria 1230
445 Ga0207640_10739011 3300025981 Bacteria 847
446 Ga0207658_10047846 3300025986 Bacteria 3132
447 Ga0207658_10173801 3300025986 Bacteria 1777
448 Ga0207658_10231662 3300025986 Bacteria 1560
449 Ga0207703_10025954 3300026035 Bacteria 4610
450 Ga0207703_10060003 3300026035 Bacteria 3108
451 Ga0207703_10317443 3300026035 Bacteria 1426
452 Ga0207703_10545489 3300026035 Bacteria 1093
453 Ga0207678_10011123 3300026067 Bacteria 7905
454 Ga0207678_10097055 3300026067 Bacteria 2519
455 Ga0207708_10008070 3300026075 Bacteria 7802
456 Ga0207708_10051640 3300026075 Bacteria 3131
457 Ga0207708_10410004 3300026075 Bacteria 1122
458 Ga0207708_10422445 3300026075 Bacteria 1106
459 Ga0207641_10050867 3300026088 Bacteria 3507
460 Ga0207641_10055300 3300026088 Bacteria 3369
461 Ga0207641_10626404 3300026088 Bacteria 1055
462 Ga0207641_11122064 3300026088 Bacteria 785
463 Ga0207648_10009206 3300026089 Bacteria 9485
464 Ga0207648_10074138 3300026089 Bacteria 2966
465 Ga0207648_10154264 3300026089 Bacteria 2027
466 Ga0207648_10307999 3300026089 Bacteria 1421
467 Ga0207676_10382052 3300026095 Bacteria 1311
468 Ga0207674_10221495 3300026116 Bacteria 1840
469 Ga0207674_10590696 3300026116 Bacteria 1073
470 Ga0207674_10853471 3300026116 Bacteria 878
471 Ga0207675_100045564 3300026118 Bacteria 4098
472 Ga0207675_100111077 3300026118 Bacteria 2586
473 Ga0207675_100136291 3300026118 Bacteria 2329
474 Ga0207675_100203476 3300026118 Bacteria 1902
475 Ga0207675_100555812 3300026118 Bacteria 1147
476 Ga0207675_100600366 3300026118 Bacteria 1104
477 Ga0207683_10328521 3300026121 Bacteria 1401
478 Ga0207683_10355615 3300026121 Bacteria 1345
479 Ga0207698_10452440 3300026142 Bacteria 1240
480 Ga0207698_10646928 3300026142 Bacteria 1047
481 Ga0209588_1113720 3300027671 Bacteria 868
482 Ga0209966_1026810 3300027695 Bacteria 1149
483 Ga0209813_10065275 3300027866 Bacteria 1171
484 Ga0209813_10137191 3300027866 Bacteria 865
485 Ga0207428_10000060 3300027907 Bacteria 156452
486 Ga0207428_10029887 3300027907 Bacteria 4508
487 Ga0207428_10040482 3300027907 Bacteria 3780
488 Ga0207428_10054154 3300027907 Bacteria 3196
489 Ga0207428_10061862 3300027907 Bacteria 2962
490 Ga0207428_10141228 3300027907 Bacteria 1838
491 Ga0207428_10145485 3300027907 Bacteria 1807
492 Ga0207428_10205458 3300027907 Bacteria 1481
493 Ga0268266_10021300 3300028379 Bacteria 5523
494 Ga0268266_10655376 3300028379 Bacteria 1010
495 Ga0268265_10038199 3300028380 Bacteria 3530
496 Ga0268265_10038559 3300028380 Bacteria 3515
497 Ga0268265_10061706 3300028380 Bacteria 2878
498 Ga0268265_10104848 3300028380 Bacteria 2293
499 Ga0268265_10140323 3300028380 Bacteria 2022
500 Ga0268265_11563668 3300028380 Bacteria 664
501 Ga0268264_10067924 3300028381 Bacteria 3010
502 Ga0268264_10107842 3300028381 Bacteria 2434
503 Ga0268264_10555451 3300028381 Bacteria 1126
504 Ga0268264_11039134 3300028381 Bacteria 826
505 Ga0268264_11352034 3300028381 Bacteria 723
506 Ga0265323_10022789 3300028653 Bacteria 2392
507 Ga0265338_10071330 3300028800 Bacteria 2973
508 Ga0265316_10150435 3300031344 Bacteria 1744
509 Ga0265316_10190351 3300031344 Bacteria 1524
510 Ga0307408_100127008 3300031548 Bacteria 1984
511 Ga0316579_10030791 3300031691 Bacteria 2453
512 Ga0265342_10233784 3300031712 Bacteria 986
513 Ga0265342_10300924 3300031712 Bacteria 845
514 Ga0265342_10570623 3300031712 Bacteria 573
515 Ga0316576_10005298 3300031727 Bacteria 7855
516 Ga0316576_10094802 3300031727 Bacteria 2226
517 Ga0316576_10342043 3300031727 Bacteria 1114
518 Ga0316576_10811508 3300031727 Bacteria 673
519 Ga0316578_10000297 3300031728 Bacteria 15165
520 Ga0316577_10009003 3300031733 Bacteria 5357
521 Ga0316577_10011869 3300031733 Bacteria 4731
522 Ga0307410_11179080 3300031852 Bacteria 666
523 Ga0307410_11592606 3300031852 Bacteria 577
524 Ga0307406_10059420 3300031901 Bacteria 2461
525 Ga0307407_10013301 3300031903 Bacteria 3989
526 Ga0307416_100304404 3300032002 Bacteria 1586
527 Ga0307414_11011450 3300032004 Bacteria 765
528 Ga0316585_10012059 3300032137 Bacteria 2555
529 Ga0316580_10087116 3300032139 Bacteria 955
530 Ga0316593_10008187 3300032168 Bacteria 2904
531 Ga0316593_10028393 3300032168 Bacteria 1803
532 Ga0316593_10292351 3300032168 Bacteria 615
533 Ga0316592_1052611 3300033524 Bacteria 910
534 Ga0316592_1157097 3300033524 Bacteria 538
535 Ga0316588_1003479 3300033528 Bacteria 2881
536 Ga0373940_0229519 3300035088 Bacteria 619
537 Ga0373939_0307331 3300035114 Bacteria 634
538 Ga0373939_0348106 3300035114 Bacteria 602
539 Ga0373941_0071222 3300035115 Bacteria 1155
540 Ga0373956_0232719 3300035119 Bacteria 875
541 Ga0373957_0033366 3300035120 Bacteria 1901
542 Ga0373955_0047196 3300035172 Bacteria 2331
543 Ga0373955_0317612 3300035172 Bacteria 941
544 Ga0373942_0293730 3300035207 Bacteria 562
545 Ga0373962_0133495 3300035242 Bacteria 801
546 Ga0316574_0063917 3300035398 Bacteria 2315
547 Ga0373933_0014827 3300035724 Bacteria 4337
548 Ga0373937_0000078 3300036401 Bacteria 88688
549 Ga0373937_0891339 3300036401 Bacteria 838
550 Ga0373937_1154887 3300036401 Bacteria 723
551 Ga0373937_1386763 3300036401 Bacteria 651
552 Ga0316582_0002725 3300036647 Bacteria 8392
553 Ga0316582_0073119 3300036647 Bacteria 2224
554 Ga0316582_0576077 3300036647 Bacteria 775
555 Ga0316582_0748180 3300036647 Bacteria 671
556 Ga0316584_0001224 3300036712 Bacteria 15162
557 Ga0316584_0017652 3300036712 Bacteria 5136
558 Ga0316584_0067149 3300036712 Bacteria 2688
559 Ga0395900_1496817 3300037418 Bacteria 587
560 Ga0395900_1779128 3300037418 Bacteria 527
561 Ga0395905_0000127 3300037471 Bacteria 124627
562 Ga0316581_0001155 3300037588 Bacteria 5774
563 Ga0400484_14470 3300038725 Bacteria 1513
564 Ga0400490_18295 3300038726 Bacteria 112507
565 Ga0400489_74770 3300039093 Bacteria 1519
566 Ga0400489_94755 3300039093 Bacteria 5058
567 Ga0451577_0071647 3300042876 Bacteria 3090
568 Ga0451577_0171014 3300042876 Bacteria 1958
569 Ga0451577_0507078 3300042876 Bacteria 1095
570 Ga0451577_1094768 3300042876 Bacteria 713
571 Ga0453683_0252967 3300044673 Bacteria 1123
572 Ga0453684_0136769 3300044712 Bacteria 2932
573 Ga0453684_0177559 3300044712 Bacteria 2503
574 Ga0453684_0183906 3300044712 Bacteria 2451
575 Ga0453684_0242108 3300044712 Bacteria 2076
576 Ga0453684_0443228 3300044712 Bacteria 1447
577 Ga0453684_1498688 3300044712 Bacteria 696
578 Ga0466971_0216084 3300044719 Bacteria 908
579 Ga0451576_0007199 3300045051 Bacteria 13406
580 Ga0451576_0026183 3300045051 Bacteria 6275
581 Ga0451576_0187191 3300045051 Bacteria 2162
582 Ga0451576_0266675 3300045051 Bacteria 1790
583 Ga0451576_0384665 3300045051 Bacteria 1471
584 Ga0451576_0465981 3300045051 Bacteria 1327
585 Ga0451576_0866702 3300045051 Bacteria 948
586 Ga0451576_1075030 3300045051 Bacteria 842
587 Ga0451576_2289459 3300045051 Bacteria 554
588 Ga0466958_0584780 3300045836 Bacteria 726
589 Ga0495592_0031012 3300046454 Bacteria 4043
590 Ga0495592_0221085 3300046454 Bacteria 1266
591 Ga0495603_0057275 3300046455 Bacteria 2306
592 Ga0495629_0168867 3300046459 Bacteria 1519
593 Ga0495638_0024402 3300046460 Bacteria 3943
594 Ga0495651_0085033 3300046462 Bacteria 2383
595 Ga0495580_0989476 3300046472 Bacteria 537
596 Ga0495584_0592712 3300046491 Bacteria 565
597 Ga0495628_0757482 3300046516 Bacteria 682
598 Ga0495663_0134371 3300046525 Bacteria 836
599 Ga0495656_0037242 3300046615 Bacteria 2008
600 Ga0495588_0215608 3300046674 Bacteria 1013
601 Ga0495599_0237720 3300046678 Bacteria 1111
602 Ga0495647_0024089 3300046681 Bacteria 2213
603 Ga0495658_0046634 3300046683 Bacteria 2437
604 Ga0495669_0071099 3300046684 Bacteria 1586
605 Ga0495581_0033233 3300047315 Bacteria 2987
606 Ga0495672_0002464 3300047320 Bacteria 17011
607 Ga0495672_0043313 3300047320 Bacteria 2707
608 Ga0495672_0389158 3300047320 Bacteria 640
609 Ga0495676_0065863 3300047321 Bacteria 2810
610 Ga0495680_0695797 3300047322 Bacteria 672
611 Ga0495684_0209390 3300047471 Bacteria 1435
612 Ga0496104_0173613 3300048907 Bacteria 2066
613 Ga0496110_1183471 3300048913 Bacteria 673
614 Ga0501031_0272876 3300049568 Bacteria 1098
615 Ga0501031_0441059 3300049568 Bacteria 841
616 Ga0501032_0000374 3300049569 Bacteria 36951
617 Ga0501034_0018701 3300049571 Bacteria 7101
618 Ga0501036_0017806 3300049572 Bacteria 5948
619 Ga0501036_0301190 3300049572 Bacteria 1341
620 Ga0501036_0603130 3300049572 Bacteria 911
621 Ga0501037_0473563 3300049573 Bacteria 852
622 Ga0501038_0045948 3300049574 Bacteria 3788
623 Ga0501038_0170359 3300049574 Bacteria 1763
624 Ga0501038_1374706 3300049574 Bacteria 508
625 Ga0501039_0167330 3300049575 Bacteria 1728
626 Ga0501039_0259226 3300049575 Bacteria 1367
627 Ga0501039_0882230 3300049575 Bacteria 697
628 Ga0501040_0321492 3300049576 Bacteria 1107
629 Ga0501041_0158755 3300049577 Bacteria 1413
630 Ga0501042_0982795 3300049578 Bacteria 615
631 Ga0501043_0000210 3300049579 Bacteria 53550
632 Ga0501046_0262451 3300049580 Bacteria 1269
633 Ga0501046_0759938 3300049580 Bacteria 681
634 Ga0501047_0214018 3300049581 Bacteria 1785
635 Ga0501048_0034838 3300049582 Bacteria 3628
636 Ga0501067_0068438 3300049583 Bacteria 1965
637 Ga0501068_0090651 3300049584 Bacteria 1886
638 Ga0501069_0111979 3300049585 Bacteria 1555
639 Ga0501071_0007445 3300049587 Bacteria 7191
640 Ga0501072_0074480 3300049588 Bacteria 2685
641 Ga0501072_0282942 3300049588 Bacteria 1319
642 Ga0501072_0634028 3300049588 Bacteria 842
643 Ga0501072_0718233 3300049588 Bacteria 785
644 Ga0501072_1325373 3300049588 Bacteria 558
645 Ga0501073_0158329 3300049589 Bacteria 1569
646 Ga0501073_0669432 3300049589 Bacteria 716
647 Ga0501075_0036590 3300049591 Bacteria 3664
648 Ga0501075_0220769 3300049591 Bacteria 1446
649 Ga0501075_0331999 3300049591 Bacteria 1159
650 Ga0501075_0380234 3300049591 Bacteria 1076
651 Ga0501075_0469188 3300049591 Bacteria 960
652 Ga0501076_0011863 3300049592 Bacteria 6506
653 Ga0501076_0021725 3300049592 Bacteria 4926
654 Ga0501077_0081922 3300049593 Bacteria 2045
655 Ga0501077_0400312 3300049593 Bacteria 878
656 Ga0501077_0861998 3300049593 Bacteria 582
657 Ga0501079_0046902 3300049741 Bacteria 3334
658 Ga0501079_0113411 3300049741 Bacteria 2107
659 Ga0501079_0544403 3300049741 Bacteria 913
660 Ga0501079_0840386 3300049741 Bacteria 723
661 Ga0501079_1189829 3300049741 Bacteria 600
662 Ga0501080_0214485 3300049742 Bacteria 1763
663 Ga0501080_0352108 3300049742 Bacteria 1329
664 Ga0501081_0078671 3300049743 Bacteria 2306
665 Ga0501081_0079271 3300049743 Bacteria 2297
666 Ga0501081_0101888 3300049743 Bacteria 2030
667 Ga0501081_0205487 3300049743 Bacteria 1429
668 Ga0501081_0302313 3300049743 Bacteria 1174
669 Ga0501081_0425542 3300049743 Bacteria 985
670 Ga0501045_1241358 3300049824 Bacteria 543
671 nmdc:mga03683_281245_c1 3300050489 Bacteria 777
672 nmdc:mga03683_491325_c1 3300050489 Bacteria 594
673 nmdc:mga03n38_38257_c1 3300050490 Bacteria 2074
674 nmdc:mga00v17_285365_c1 3300050491 Bacteria 1072
675 nmdc:mga0k408_141669_c1 3300050493 Bacteria 1430
676 nmdc:mga06z11_191863_c1 3300050494 Bacteria 1183
677 nmdc:mga06z11_220241_c1 3300050494 Bacteria 1109
678 nmdc:mga06z11_24933_c1 3300050494 Bacteria 2828
679 nmdc:mga06z11_4269_c1 3300050494 Bacteria 5609
680 nmdc:mga04h51_39611_c2 3300050495 Bacteria 894
681 nmdc:mga04h51_50959_c1 3300050495 Bacteria 1389
682 nmdc:mga07m45_187699_c1 3300050496 Bacteria 1202
683 nmdc:mga07m45_379435_c1 3300050496 Bacteria 821
684 nmdc:mga05p37_1133184_c1 3300050507 Bacteria 816
685 nmdc:mga05p37_1306043_c1 3300050507 Bacteria 739
686 nmdc:mga05p37_159208_c1 3300050507 Bacteria 2758
687 nmdc:mga05p37_244512_c1 3300050507 Bacteria 2155
688 nmdc:mga05p37_282772_c1 3300050507 Bacteria 1978
689 nmdc:mga05p37_30386_c1 3300050507 Bacteria 6592
690 nmdc:mga05p37_30906_c1 3300050507 Bacteria 6537
691 nmdc:mga05p37_488740_c1 3300050507 Bacteria 1416
692 nmdc:mga05p37_610380_c1 3300050507 Bacteria 1230
693 nmdc:mga05p37_76733_c1 3300050507 Bacteria 4113
694 nmdc:mga05p37_81276_c1 3300050507 Bacteria 3992
695 nmdc:mga05p37_97364_c1 3300050507 Bacteria 3624
696 nmdc:mga09592_110504_c1 3300050508 Bacteria 2358
697 nmdc:mga09592_218625_c1 3300050508 Bacteria 1651
698 nmdc:mga09592_384884_c1 3300050508 Bacteria 1213
699 nmdc:mga09592_420769_c1 3300050508 Bacteria 1154
700 nmdc:mga09592_452350_c1 3300050508 Bacteria 1108
701 nmdc:mga09592_454145_c1 3300050508 Bacteria 1105
702 nmdc:mga09592_679334_c1 3300050508 Bacteria 877
703 nmdc:mga09592_73440_c2 3300050508 Bacteria 669
704 nmdc:mga0qj67_1015778_c1 3300050509 Bacteria 650
705 nmdc:mga0qj67_179402_c1 3300050509 Bacteria 1720
706 nmdc:mga0qj67_46996_c1 3300050509 Bacteria 3409
707 nmdc:mga0qj67_586487_c1 3300050509 Bacteria 892
708 nmdc:mga0qj67_94477_c1 3300050509 Bacteria 2405
709 nmdc:mga06r32_1158064_c1 3300050510 Bacteria 721
710 nmdc:mga06r32_158233_c1 3300050510 Bacteria 2247
711 nmdc:mga06r32_248197_c1 3300050510 Bacteria 1767
712 nmdc:mga06r32_314849_c1 3300050510 Bacteria 1551
713 nmdc:mga06r32_50469_c1 3300050510 Bacteria 3980
714 nmdc:mga08y16_111365_c1 3300050511 Bacteria 2850
715 nmdc:mga08y16_122568_c1 3300050511 Bacteria 2705
716 nmdc:mga08y16_27546_c1 3300050511 Bacteria 5987
717 nmdc:mga08y16_60112_c1 3300050511 Bacteria 3970
718 nmdc:mga08y16_616989_c1 3300050511 Bacteria 1092
719 nmdc:mga08y16_633787_c1 3300050511 Bacteria 1075
720 nmdc:mga08y16_69571_c1 3300050511 Bacteria 3670
721 nmdc:mga08y16_88690_c1 3300050511 Bacteria 3224
722 nmdc:mga08y16_951414_c1 3300050511 Bacteria 842
723 nmdc:mga0n895_131894_c1 3300050512 Bacteria 2524
724 nmdc:mga0n895_251359_c1 3300050512 Bacteria 1794
725 nmdc:mga0n895_260219_c1 3300050512 Bacteria 1761
726 nmdc:mga0n895_28440_c1 3300050512 Bacteria 5317
727 nmdc:mga0n895_28590_c1 3300050512 Bacteria 5305
728 nmdc:mga0n895_376865_c1 3300050512 Bacteria 1436
729 nmdc:mga0n895_43493_c1 3300050512 Bacteria 4377
730 nmdc:mga0n895_616351_c1 3300050512 Bacteria 1086
731 nmdc:mga0n895_690666_c1 3300050512 Bacteria 1017
732 nmdc:mga0n895_722602_c1 3300050512 Bacteria 991
733 nmdc:mga0n895_88897_c1 3300050512 Bacteria 3090
734 nmdc:mga0rr50_13018_c1 3300050513 Bacteria 5399
735 nmdc:mga0rr50_464017_c1 3300050513 Bacteria 1074
736 nmdc:mga0rr50_478867_c1 3300050513 Bacteria 1057
737 nmdc:mga0rr50_756433_c1 3300050513 Bacteria 829
738 nmdc:mga08x19_128548_c1 3300050514 Bacteria 1703
739 nmdc:mga08x19_311300_c1 3300050514 Bacteria 1095
740 nmdc:mga08x19_444806_c1 3300050514 Bacteria 912
741 nmdc:mga08x19_68733_c1 3300050514 Bacteria 2306
742 nmdc:mga08x19_73423_c1 3300050514 Bacteria 2233
743 nmdc:mga0a205_1078494_c1 3300050515 Bacteria 650
744 nmdc:mga0a205_11826_c1 3300050515 Bacteria 8057
745 nmdc:mga0a205_21169_c1 3300050515 Bacteria 6150
746 nmdc:mga0a205_248553_c1 3300050515 Bacteria 1658
747 nmdc:mga0a205_273607_c2 3300050515 Bacteria 1068
748 nmdc:mga0a205_30993_c1 3300050515 Bacteria 5122
749 nmdc:mga0a205_36075_c1 3300050515 Bacteria 4751
750 nmdc:mga0a205_47334_c1 3300050515 Bacteria 4149
751 nmdc:mga0a205_537996_c1 3300050515 Bacteria 1024
752 nmdc:mga0a205_56454_c1 3300050515 Bacteria 3791
753 nmdc:mga0a205_59833_c1 3300050515 Bacteria 3680
754 nmdc:mga0a205_800757_c1 3300050515 Bacteria 790
755 nmdc:mga0a205_804480_c1 3300050515 Bacteria 788
756 Ga0500555_048213 3300053103 Bacteria 1171
757 Ga0500645_038869 3300053730 Bacteria 1411
758 Ga0501084_0131001 3300054114 Bacteria 2111
759 Ga0501084_1240005 3300054114 Bacteria 625
760 Ga0501084_1321070 3300054114 Bacteria 604
761 Ga0587073_0063810 3300059492 Bacteria 871
762 Ga0587092_070950 3300059512 Bacteria 670
763 Ga0587075_097056 3300059644 Bacteria 583
764 Ga0587079_053459 3300059647 Bacteria 854
765 Ga0501082_0169679 3300060353 Bacteria 1897
766 Ga0501082_0436861 3300060353 Bacteria 1143
767 Ga0501082_0450129 3300060353 Bacteria 1125
768 Ga0501082_0656564 3300060353 Bacteria 918
769 Ga0530510_0065951 3300061734 Bacteria 2624
770 Ga0530510_0379794 3300061734 Bacteria 1063
771 Ga0530510_0480930 3300061734 Bacteria 941
772 Ga0530510_1207381 3300061734 Bacteria 580
773 Ga0068857_101600925
774 LJQas_1002079
775 JGI24035J26624_1015521
776 Ga0058859_10009949
777 Ga0058859_10030311
778 Ga0058859_11571661
779 Ga0058863_10012701
780 Ga0058860_11892679
781 Ga0058862_10076498
782 Ga0065704_10034794
783 Ga0065712_10075551
784 Ga0065715_10001671
785 Ga0065707_10094938
786 Ga0065707_10120063
787 Ga0070676_10058191
788 Ga0070683_100083622
789 Ga0070690_100135975
790 Ga0070690_100550931
791 Ga0070690_100803136
792 Ga0070677_10192552
793 Ga0070677_10581262
794 Ga0068869_100033436
795 Ga0068869_100071512
796 Ga0068869_100086440
797 Ga0068869_100104253
798 Ga0070666_10698951
799 Ga0070680_100285416
800 Ga0070680_100782396
801 Ga0068868_100042747
802 Ga0068868_100110479
803 Ga0070660_100324648
804 Ga0070689_100053328
805 Ga0070689_100115281
806 Ga0070689_100135556
807 Ga0070691_10079213
808 Ga0070691_10554617
809 Ga0070691_10896539
810 Ga0070687_100004090
811 Ga0070687_100117847
812 Ga0070687_101359899
813 Ga0070661_100236680
814 Ga0070661_100383244
815 Ga0070692_11087822
816 Ga0070668_100060390
817 Ga0070668_100128533
818 Ga0070669_100445201
819 Ga0070669_100623556
820 Ga0070669_100693128
821 Ga0070675_100006570
822 Ga0070675_100188398
823 Ga0070675_100589358
824 Ga0070675_100809522
825 Ga0070671_101070822
826 Ga0070674_100082765
827 Ga0070673_100137447
828 Ga0070673_100156085
829 Ga0070688_100018844
830 Ga0070688_100062197
831 Ga0070688_100498015
832 Ga0070688_101430501
833 Ga0070667_100121834
834 Ga0070703_10019147
835 Ga0070703_10074556
836 Ga0070703_10075293
837 Ga0070701_10023692
838 Ga0070701_10072610
839 Ga0070701_11309535
840 Ga0070711_100694174
841 Ga0070705_100008422
842 Ga0070705_100024713
843 Ga0070705_100109224
844 Ga0070705_100275319
845 Ga0070700_100184781
846 Ga0070694_100181852
847 Ga0070694_100283632
848 Ga0070694_100340771
849 Ga0070708_100013710
850 Ga0070708_100306457
851 Ga0070708_100478765
852 Ga0070708_100727085
853 Ga0070708_100801188
854 Ga0070708_101653041
855 Ga0070663_100067681
856 Ga0070678_100142727
857 Ga0070678_100988631
858 Ga0070678_101109798
859 Ga0070662_100116863
860 Ga0070662_100210893
861 Ga0070662_100546774
862 Ga0068867_100034697
863 Ga0068867_100047398
864 Ga0068867_100651729
865 Ga0070685_10020159
866 Ga0070706_100030979
867 Ga0070706_100031741
868 Ga0070706_100398697
869 Ga0070706_100802148
870 Ga0070706_101398758
871 Ga0070707_100180700
872 Ga0070707_100200785
873 Ga0070707_100283587
874 Ga0070707_100490165
875 Ga0070707_100944007
876 Ga0070698_100038993
877 Ga0070698_100064792
878 Ga0070698_100081929
879 Ga0070698_100180227
880 Ga0070698_100221562
881 Ga0070698_100531343
882 Ga0070698_100633971
883 Ga0070698_101784745
884 Ga0070699_100044578
885 Ga0070699_100150446
886 Ga0070699_100279411
887 Ga0070699_100287527
888 Ga0070699_100761090
889 Ga0070684_100312592
890 Ga0070697_100099878
891 Ga0070697_100111311
892 Ga0070697_100696127
893 Ga0070697_100857128
894 Ga0070672_100068186
895 Ga0070672_100110514
896 Ga0070672_100258116
897 Ga0070672_100296622
898 Ga0070672_100564889
899 Ga0070686_100176860
900 Ga0070686_100592455
901 Ga0070686_101437427
902 Ga0070695_100029815
903 Ga0070695_100055049
904 Ga0070695_100075021
905 Ga0070695_100076540
906 Ga0070695_100256764
907 Ga0070695_100303560
908 Ga0070695_100445829
909 Ga0070695_100958933
910 Ga0070696_100002821
911 Ga0070696_100022619
912 Ga0070696_100076870
913 Ga0070696_100224234
914 Ga0070696_100629730
915 Ga0070696_100650183
916 Ga0070696_100993278
917 Ga0070696_101087364
918 Ga0070693_100262650
919 Ga0070665_100144701
920 Ga0070704_100005977
921 Ga0070704_100010131
922 Ga0070704_100022877
923 Ga0070704_100040571
924 Ga0070704_100325557
925 Ga0070704_100485378
926 Ga0070704_100524392
927 Ga0070704_100919730
928 Ga0070704_102099443
929 Ga0068855_100469611
930 Ga0070664_100445539
931 Ga0070664_100472914
932 Ga0068854_100195924
933 Ga0068854_100586759
934 Ga0068854_101565455
935 Ga0070702_100034683
936 Ga0070702_100205911
937 Ga0070702_100839530
938 Ga0068852_100167671
939 Ga0068852_101487006
940 Ga0068859_100006485
941 Ga0068859_100265816
942 Ga0068859_100392406
943 Ga0068859_100848330
944 Ga0068864_100132843
945 Ga0068864_100309644
946 Ga0068864_101317222
947 Ga0068864_101524168
948 Ga0068866_10009547
949 Ga0068866_10278030
950 Ga0068861_100018492
951 Ga0068861_100144716
952 Ga0068861_101135476
953 Ga0068861_101378487
954 Ga0068851_10015650
955 Ga0068870_10047581
956 Ga0068870_10273743
957 Ga0068870_10388716
958 Ga0068870_10432499
959 Ga0068863_100056059
960 Ga0068863_100157443
961 Ga0068858_100018526
962 Ga0068858_100489986
963 Ga0068858_100610194
964 Ga0068860_100095944
965 Ga0068860_100172799
966 Ga0068862_100019974
967 Ga0068862_100028512
968 Ga0068862_100136776
969 Ga0068862_101112192
970 Ga0081455_10284223
971 Ga0075365_10109887
972 Ga0075368_10184474
973 Ga0075368_10511639
974 Ga0075363_100033397
975 Ga0075363_100058856
976 Ga0075363_100925424
977 Ga0075364_10151550
978 Ga0075364_10297609
979 Ga0075364_10492806
980 Ga0075364_10669025
981 Ga0070715_10228446
982 Ga0075362_10001146
983 Ga0075362_10185513
984 Ga0075362_10412549
985 Ga0075367_10001903
986 Ga0075367_10071203
987 Ga0075367_10157732
988 Ga0075367_10445170
989 Ga0075366_10019018
990 Ga0075366_10047335
991 Ga0075366_10134886
992 Ga0075366_10196041
993 Ga0075366_10670209
994 Ga0097621_100070753
995 Ga0097621_100391089
996 Ga0075370_10013931
997 Ga0075370_10947745
998 Ga0068871_100156003
999 Ga0068871_100346614
1000 Ga0068871_100992304
1001 Ga0075428_100038516
1002 Ga0075428_100078443
1003 Ga0075428_100177937
1004 Ga0075428_100382981
1005 Ga0075428_100481220
1006 Ga0075428_100691711
1007 Ga0075428_101033914
1008 Ga0075428_101077944
1009 Ga0075430_100212450
1010 Ga0075430_100403238
1011 Ga0075430_100931613
1012 Ga0075430_101661945
1013 Ga0075431_100031478
1014 Ga0075431_100055527
1015 Ga0075431_100059761
1016 Ga0075431_100387869
1017 Ga0075431_100450320
1018 Ga0075431_100610405
1019 Ga0075431_101611462
1020 Ga0075431_102053067
1021 Ga0075433_10010573
1022 Ga0075433_10013136
1023 Ga0075433_10026861
1024 Ga0075433_10049470
1025 Ga0075433_10126728
1026 Ga0075433_10137283
1027 Ga0075433_10143012
1028 Ga0075433_10170317
1029 Ga0075433_10256641
1030 Ga0075433_10550877
1031 Ga0075433_10557286
1032 Ga0075433_11276150
1033 Ga0075434_100045216
1034 Ga0075434_100054503
1035 Ga0075434_100074288
1036 Ga0075434_100125609
1037 Ga0075434_100182614
1038 Ga0075434_100206680
1039 Ga0075434_100241964
1040 Ga0075434_100515501
1041 Ga0075434_100946685
1042 Ga0075429_100036840
1043 Ga0075429_100039515
1044 Ga0075429_100054059
1045 Ga0075429_100117106
1046 Ga0075429_100156329
1047 Ga0075429_100352898
1048 Ga0075429_100441777
1049 Ga0075429_100574573
1050 Ga0075429_100923668
1051 Ga0068865_100011001
1052 Ga0068865_101144521
1053 Ga0075436_100071470
1054 Ga0075436_100077951
1055 Ga0075436_100154710
1056 Ga0075436_100359275
1057 Ga0097620_100006485
1058 Ga0097620_100265819
1059 Ga0097620_100392436
1060 Ga0097620_100848230
1061 Ga0075435_100008029
1062 Ga0075435_100199873
1063 Ga0075435_100316903
1064 Ga0075435_100385537
1065 Ga0075435_100960463
1066 Ga0105240_10763055
1067 Ga0105240_11274520
1068 Ga0111539_10031852
1069 Ga0111539_10041302
1070 Ga0111539_10044169
1071 Ga0111539_10045305
1072 Ga0111539_10160076
1073 Ga0111539_10170170
1074 Ga0111539_10207560
1075 Ga0111539_10311606
1076 Ga0111539_10692476
1077 Ga0111539_10711019
1078 Ga0111539_10752056
1079 Ga0111539_11212904
1080 Ga0111539_11832460
1081 Ga0105245_10065898
1082 Ga0105245_11605305
1083 Ga0105247_10698723
1084 Ga0105247_10814951
1085 Ga0114129_10016065
1086 Ga0114129_10024758
1087 Ga0114129_10060754
1088 Ga0114129_10151865
1089 Ga0114129_10152039
1090 Ga0114129_10268996
1091 Ga0114129_10590631
1092 Ga0114129_11174047
1093 Ga0114129_11212689
1094 Ga0114129_11696797
1095 Ga0105243_11202549
1096 Ga0105243_12265894
1097 Ga0105242_10033180
1098 Ga0105242_10551873
1099 Ga0105242_10685229
1100 Ga0105242_11673050
1101 Ga0105248_10069618
1102 Ga0105248_10093930
1103 Ga0105248_11062379
1104 Ga0105249_10018258
1105 Ga0105249_10075568
1106 Ga0105249_11296933
1107 Ga0105239_10005718
1108 Ga0105239_10465115
1109 Ga0105246_10088198
1110 Ga0105246_11899907
1111 Ga0157378_10071072
1112 Ga0157378_10322735
1113 Ga0157378_11190477
1114 Ga0163162_10055553
1115 Ga0163162_10294931
1116 Ga0157375_10083480
1117 Ga0157375_10946748
1118 Ga0157375_11355544
1119 Ga0163163_10000446
1120 Ga0157380_10008190
1121 Ga0157380_10068381
1122 Ga0157380_10111654
1123 Ga0157380_10145568
1124 Ga0157380_10151509
1125 Ga0157377_10495981
1126 Ga0157377_10647040
1127 Ga0157377_10744833
1128 Ga0157377_10830120
1129 Ga0157379_10079613
1130 Ga0157379_10573509
1131 Ga0157376_10752992
1132 Ga0163161_10048397
1133 Ga0163161_10052357
1134 Ga0207697_10078080
1135 Ga0207656_10101493
1136 Ga0207653_10016183
1137 Ga0207653_10033410
1138 Ga0207653_10153508
1139 Ga0207653_10258791
1140 Ga0207682_10614320
1141 Ga0207642_10708997
1142 Ga0207688_10074577
1143 Ga0207680_10247963
1144 Ga0207685_10163727
1145 Ga0207699_10010539
1146 Ga0207645_10020173
1147 Ga0207645_10027190
1148 Ga0207643_10014738
1149 Ga0207643_10019033
1150 Ga0207643_10372447
1151 Ga0207684_10033293
1152 Ga0207684_10043552
1153 Ga0207684_10609278
1154 Ga0207663_10081029
1155 Ga0207660_10105948
1156 Ga0207660_10124710
1157 Ga0207660_10250624
1158 Ga0207662_10049015
1159 Ga0207662_10059649
1160 Ga0207662_10075330
1161 Ga0207657_10235823
1162 Ga0207649_10098865
1163 Ga0207646_10126715
1164 Ga0207646_10277167
1165 Ga0207646_10459556
1166 Ga0207646_10490482
1167 Ga0207646_10684574
1168 Ga0207646_11585822
1169 Ga0207681_10019126
1170 Ga0207681_10036207
1171 Ga0207681_11438104
1172 Ga0207694_10204149
1173 Ga0207659_10002914
1174 Ga0207659_10016029
1175 Ga0207659_10056582
1176 Ga0207659_10071199
1177 Ga0207659_10695184
1178 Ga0207687_10092380
1179 Ga0207644_10076123
1180 Ga0207706_10036777
1181 Ga0207706_10063292
1182 Ga0207706_10597216
1183 Ga0207686_10082635
1184 Ga0207686_10569572
1185 Ga0207670_10067702
1186 Ga0207670_10087739
1187 Ga0207670_10219533
1188 Ga0207670_11138123
1189 Ga0207669_10141415
1190 Ga0207669_10206455
1191 Ga0207704_10032275
1192 Ga0207704_10164934
1193 Ga0207704_10624870
1194 Ga0207704_10665634
1195 Ga0207665_10149931
1196 Ga0207691_10012896
1197 Ga0207691_10026550
1198 Ga0207691_10189597
1199 Ga0207691_10229535
1200 Ga0207711_10046967
1201 Ga0207711_10136373
1202 Ga0207711_10270579
1203 Ga0207711_10402891
1204 Ga0207689_10032303
1205 Ga0207689_10047425
1206 Ga0207689_10110763
1207 Ga0207689_10755216
1208 Ga0207689_10863414
1209 Ga0207661_10146636
1210 Ga0207679_10195992
1211 Ga0207679_10768654
1212 Ga0207651_10030998
1213 Ga0207712_10166922
1214 Ga0207712_10291619
1215 Ga0207712_10694733
1216 Ga0207640_10322989
1217 Ga0207640_10739011
1218 Ga0207658_10047846
1219 Ga0207658_10173801
1220 Ga0207658_10231662
1221 Ga0207703_10025954
1222 Ga0207703_10060003
1223 Ga0207703_10317443
1224 Ga0207703_10545489
1225 Ga0207678_10011123
1226 Ga0207678_10097055
1227 Ga0207708_10008070
1228 Ga0207708_10051640
1229 Ga0207708_10410004
1230 Ga0207708_10422445
1231 Ga0207641_10050867
1232 Ga0207641_10055300
1233 Ga0207641_10626404
1234 Ga0207641_11122064
1235 Ga0207648_10009206
1236 Ga0207648_10074138
1237 Ga0207648_10154264
1238 Ga0207648_10307999
1239 Ga0207676_10382052
1240 Ga0207674_10221495
1241 Ga0207674_10590696
1242 Ga0207674_10853471
1243 Ga0207675_100045564
1244 Ga0207675_100111077
1245 Ga0207675_100136291
1246 Ga0207675_100203476
1247 Ga0207675_100555812
1248 Ga0207675_100600366
1249 Ga0207683_10328521
1250 Ga0207683_10355615
1251 Ga0207698_10452440
1252 Ga0207698_10646928
1253 Ga0209588_1113720
1254 Ga0209966_1026810
1255 Ga0209813_10065275
1256 Ga0209813_10137191
1257 Ga0207428_10000060
1258 Ga0207428_10029887
1259 Ga0207428_10040482
1260 Ga0207428_10054154
1261 Ga0207428_10061862
1262 Ga0207428_10141228
1263 Ga0207428_10145485
1264 Ga0207428_10205458
1265 Ga0268266_10021300
1266 Ga0268266_10655376
1267 Ga0268265_10038199
1268 Ga0268265_10038559
1269 Ga0268265_10061706
1270 Ga0268265_10104848
1271 Ga0268265_10140323
1272 Ga0268265_11563668
1273 Ga0268264_10067924
1274 Ga0268264_10107842
1275 Ga0268264_10555451
1276 Ga0268264_11039134
1277 Ga0268264_11352034
1278 Ga0265323_10022789
1279 Ga0265338_10071330
1280 Ga0265316_10150435
1281 Ga0265316_10190351
1282 Ga0307408_100127008
1283 Ga0316579_10030791
1284 Ga0265342_10233784
1285 Ga0265342_10300924
1286 Ga0265342_10570623
1287 Ga0316576_10005298
1288 Ga0316576_10094802
1289 Ga0316576_10342043
1290 Ga0316576_10811508
1291 Ga0316578_10000297
1292 Ga0316577_10009003
1293 Ga0316577_10011869
1294 Ga0307410_11179080
1295 Ga0307410_11592606
1296 Ga0307406_10059420
1297 Ga0307407_10013301
1298 Ga0307416_100304404
1299 Ga0307414_11011450
1300 Ga0316585_10012059
1301 Ga0316580_10087116
1302 Ga0316593_10008187
1303 Ga0316593_10028393
1304 Ga0316593_10292351
1305 Ga0316592_1052611
1306 Ga0316592_1157097
1307 Ga0316588_1003479
1308 Ga0373940_0229519
1309 Ga0373939_0307331
1310 Ga0373939_0348106
1311 Ga0373941_0071222
1312 Ga0373956_0232719
1313 Ga0373957_0033366
1314 Ga0373955_0047196
1315 Ga0373955_0317612
1316 Ga0373942_0293730
1317 Ga0373962_0133495
1318 Ga0316574_0063917
1319 Ga0373933_0014827
1320 Ga0373937_0000078
1321 Ga0373937_0891339
1322 Ga0373937_1154887
1323 Ga0373937_1386763
1324 Ga0316582_0002725
1325 Ga0316582_0073119
1326 Ga0316582_0576077
1327 Ga0316582_0748180
1328 Ga0316584_0001224
1329 Ga0316584_0017652
1330 Ga0316584_0067149
1331 Ga0395900_1496817
1332 Ga0395900_1779128
1333 Ga0395905_0000127
1334 Ga0316581_0001155
1335 Ga0400484_14470
1336 Ga0400490_18295
1337 Ga0400489_74770
1338 Ga0400489_94755
1339 Ga0451577_0071647
1340 Ga0451577_0171014
1341 Ga0451577_0507078
1342 Ga0451577_1094768
1343 Ga0453683_0252967
1344 Ga0453684_0136769
1345 Ga0453684_0177559
1346 Ga0453684_0183906
1347 Ga0453684_0242108
1348 Ga0453684_0443228
1349 Ga0453684_1498688
1350 Ga0466971_0216084
1351 Ga0451576_0007199
1352 Ga0451576_0026183
1353 Ga0451576_0187191
1354 Ga0451576_0266675
1355 Ga0451576_0384665
1356 Ga0451576_0465981
1357 Ga0451576_0866702
1358 Ga0451576_1075030
1359 Ga0451576_2289459
1360 Ga0466958_0584780
1361 Ga0495592_0031012
1362 Ga0495592_0221085
1363 Ga0495603_0057275
1364 Ga0495629_0168867
1365 Ga0495638_0024402
1366 Ga0495651_0085033
1367 Ga0495580_0989476
1368 Ga0495584_0592712
1369 Ga0495628_0757482
1370 Ga0495663_0134371
1371 Ga0495656_0037242
1372 Ga0495588_0215608
1373 Ga0495599_0237720
1374 Ga0495647_0024089
1375 Ga0495658_0046634
1376 Ga0495669_0071099
1377 Ga0495581_0033233
1378 Ga0495672_0002464
1379 Ga0495672_0043313
1380 Ga0495672_0389158
1381 Ga0495676_0065863
1382 Ga0495680_0695797
1383 Ga0495684_0209390
1384 Ga0496104_0173613
1385 Ga0496110_1183471
1386 Ga0501031_0272876
1387 Ga0501031_0441059
1388 Ga0501032_0000374
1389 Ga0501034_0018701
1390 Ga0501036_0017806
1391 Ga0501036_0301190
1392 Ga0501036_0603130
1393 Ga0501037_0473563
1394 Ga0501038_0045948
1395 Ga0501038_0170359
1396 Ga0501038_1374706
1397 Ga0501039_0167330
1398 Ga0501039_0259226
1399 Ga0501039_0882230
1400 Ga0501040_0321492
1401 Ga0501041_0158755
1402 Ga0501042_0982795
1403 Ga0501043_0000210
1404 Ga0501046_0262451
1405 Ga0501046_0759938
1406 Ga0501047_0214018
1407 Ga0501048_0034838
1408 Ga0501067_0068438
1409 Ga0501068_0090651
1410 Ga0501069_0111979
1411 Ga0501071_0007445
1412 Ga0501072_0074480
1413 Ga0501072_0282942
1414 Ga0501072_0634028
1415 Ga0501072_0718233
1416 Ga0501072_1325373
1417 Ga0501073_0158329
1418 Ga0501073_0669432
1419 Ga0501075_0036590
1420 Ga0501075_0220769
1421 Ga0501075_0331999
1422 Ga0501075_0380234
1423 Ga0501075_0469188
1424 Ga0501076_0011863
1425 Ga0501076_0021725
1426 Ga0501077_0081922
1427 Ga0501077_0400312
1428 Ga0501077_0861998
1429 Ga0501079_0046902
1430 Ga0501079_0113411
1431 Ga0501079_0544403
1432 Ga0501079_0840386
1433 Ga0501079_1189829
1434 Ga0501080_0214485
1435 Ga0501080_0352108
1436 Ga0501081_0078671
1437 Ga0501081_0079271
1438 Ga0501081_0101888
1439 Ga0501081_0205487
1440 Ga0501081_0302313
1441 Ga0501081_0425542
1442 Ga0501045_1241358
1443 nmdc:mga03683_281245_c1
1444 nmdc:mga03683_491325_c1
1445 nmdc:mga03n38_38257_c1
1446 nmdc:mga00v17_285365_c1
1447 nmdc:mga0k408_141669_c1
1448 nmdc:mga06z11_191863_c1
1449 nmdc:mga06z11_220241_c1
1450 nmdc:mga06z11_24933_c1
1451 nmdc:mga06z11_4269_c1
1452 nmdc:mga04h51_39611_c2
1453 nmdc:mga04h51_50959_c1
1454 nmdc:mga07m45_187699_c1
1455 nmdc:mga07m45_379435_c1
1456 nmdc:mga05p37_1133184_c1
1457 nmdc:mga05p37_1306043_c1
1458 nmdc:mga05p37_159208_c1
1459 nmdc:mga05p37_244512_c1
1460 nmdc:mga05p37_282772_c1
1461 nmdc:mga05p37_30386_c1
1462 nmdc:mga05p37_30906_c1
1463 nmdc:mga05p37_488740_c1
1464 nmdc:mga05p37_610380_c1
1465 nmdc:mga05p37_76733_c1
1466 nmdc:mga05p37_81276_c1
1467 nmdc:mga05p37_97364_c1
1468 nmdc:mga09592_110504_c1
1469 nmdc:mga09592_218625_c1
1470 nmdc:mga09592_384884_c1
1471 nmdc:mga09592_420769_c1
1472 nmdc:mga09592_452350_c1
1473 nmdc:mga09592_454145_c1
1474 nmdc:mga09592_679334_c1
1475 nmdc:mga09592_73440_c2
1476 nmdc:mga0qj67_1015778_c1
1477 nmdc:mga0qj67_179402_c1
1478 nmdc:mga0qj67_46996_c1
1479 nmdc:mga0qj67_586487_c1
1480 nmdc:mga0qj67_94477_c1
1481 nmdc:mga06r32_1158064_c1
1482 nmdc:mga06r32_158233_c1
1483 nmdc:mga06r32_248197_c1
1484 nmdc:mga06r32_314849_c1
1485 nmdc:mga06r32_50469_c1
1486 nmdc:mga08y16_111365_c1
1487 nmdc:mga08y16_122568_c1
1488 nmdc:mga08y16_27546_c1
1489 nmdc:mga08y16_60112_c1
1490 nmdc:mga08y16_616989_c1
1491 nmdc:mga08y16_633787_c1
1492 nmdc:mga08y16_69571_c1
1493 nmdc:mga08y16_88690_c1
1494 nmdc:mga08y16_951414_c1
1495 nmdc:mga0n895_131894_c1
1496 nmdc:mga0n895_251359_c1
1497 nmdc:mga0n895_260219_c1
1498 nmdc:mga0n895_28440_c1
1499 nmdc:mga0n895_28590_c1
1500 nmdc:mga0n895_376865_c1
1501 nmdc:mga0n895_43493_c1
1502 nmdc:mga0n895_616351_c1
1503 nmdc:mga0n895_690666_c1
1504 nmdc:mga0n895_722602_c1
1505 nmdc:mga0n895_88897_c1
1506 nmdc:mga0rr50_13018_c1
1507 nmdc:mga0rr50_464017_c1
1508 nmdc:mga0rr50_478867_c1
1509 nmdc:mga0rr50_756433_c1
1510 nmdc:mga08x19_128548_c1
1511 nmdc:mga08x19_311300_c1
1512 nmdc:mga08x19_444806_c1
1513 nmdc:mga08x19_68733_c1
1514 nmdc:mga08x19_73423_c1
1515 nmdc:mga0a205_1078494_c1
1516 nmdc:mga0a205_11826_c1
1517 nmdc:mga0a205_21169_c1
1518 nmdc:mga0a205_248553_c1
1519 nmdc:mga0a205_273607_c2
1520 nmdc:mga0a205_30993_c1
1521 nmdc:mga0a205_36075_c1
1522 nmdc:mga0a205_47334_c1
1523 nmdc:mga0a205_537996_c1
1524 nmdc:mga0a205_56454_c1
1525 nmdc:mga0a205_59833_c1
1526 nmdc:mga0a205_800757_c1
1527 nmdc:mga0a205_804480_c1
1528 Ga0500555_048213
1529 Ga0500645_038869
1530 Ga0501084_0131001
1531 Ga0501084_1240005
1532 Ga0501084_1321070
1533 Ga0587073_0063810
1534 Ga0587092_070950
1535 Ga0587075_097056
1536 Ga0587079_053459
1537 Ga0501082_0169679
1538 Ga0501082_0436861
1539 Ga0501082_0450129
1540 Ga0501082_0656564
1541 Ga0530510_0065951
1542 Ga0530510_0379794
1543 Ga0530510_0480930
1544 Ga0530510_1207381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

91

159

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

29

86

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9957 71 140
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.9916 71 140
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.9913 70 140
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9818 71 140
1s72-assembly1.cif.gz_I refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution 0.9778 73 140
ID Description Score Start End Superfamily
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.991 72 139 1.10.10.250
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9863 3 67 3.30.1550.10
1hc8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.976 67 140 1.10.10.250
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9727 73 140 1.10.10.250
af_P54030_78_161_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9702 80 140 1.10.10.250
ID Description Score Start End GO Terms
AF-A0A356V906-F1-model_v4 50S ribosomal protein L11 1.005 72 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A496M9P7-F1-model_v4 deleted 1.002 71 140
AF-A0A2S7TEL3-F1-model_v4 deleted 1.002 73 140
AF-A0A7C3NAE7-F1-model_v4 50S ribosomal protein L11 1.002 76 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A645A187-F1-model_v4 50S ribosomal protein L11 1.001 78 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Map