F480000
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 769 | 367 | 738 | 37 |
Family's Representative Sequence
| Representative Sequence | 3300044673|Ga0453683_0866875|Ga0453683_0866875_307_441 |
| Length | 44 |
| Sequence | MEPQGEPVKVRTSVKKICDKCKVIKRNGIVRIICENPKHKQKQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 4 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 5 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 6 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 7 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 8 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 9 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 10 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 11 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 12 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 13 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 14 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 15 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 16 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 17 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 18 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 19 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 20 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 21 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 22 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 23 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 24 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 25 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 26 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 27 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 28 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 29 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 30 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 104 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 198 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 204 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 208 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 209 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 224 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 237 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 246 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 247 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 248 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 249 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 250 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 251 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 252 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 253 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 257 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 259 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 260 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 261 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 262 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 263 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 264 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 265 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 266 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 267 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 268 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 269 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 366 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 367 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.91 |
| Metatranscriptomes | 8.06 |
| Isolates | 4.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.3 |
| Nodule | 0.65 |
| Rhizoplane | 2.34 |
| Rhizosphere | 87.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10177453 | 3300001990 | Bacteria | 629 |
| 2 | JGI24735J21928_10011983 | 3300002067 | Bacteria | 2743 |
| 3 | Ga0068868_102068432 | 3300005338 | Bacteria | 541 |
| 4 | Ga0070660_100066916 | 3300005339 | Bacteria | 2798 |
| 5 | Ga0070672_100082364 | 3300005543 | Bacteria | 2581 |
| 6 | Ga0070672_100120557 | 3300005543 | Bacteria | 2146 |
| 7 | Ga0070672_100136941 | 3300005543 | Bacteria | 2017 |
| 8 | Ga0070672_100361221 | 3300005543 | Bacteria | 1239 |
| 9 | Ga0070672_101022531 | 3300005543 | Bacteria | 733 |
| 10 | Ga0070665_100005852 | 3300005548 | Bacteria | 12613 |
| 11 | Ga0070665_100533295 | 3300005548 | Bacteria | 1186 |
| 12 | Ga0070665_101743623 | 3300005548 | Bacteria | 630 |
| 13 | Ga0068855_100051467 | 3300005563 | Bacteria | 4851 |
| 14 | Ga0068855_100646242 | 3300005563 | Bacteria | 1136 |
| 15 | Ga0068855_101043625 | 3300005563 | Bacteria | 857 |
| 16 | Ga0068855_101653194 | 3300005563 | Bacteria | 654 |
| 17 | Ga0070664_100053940 | 3300005564 | Bacteria | 3410 |
| 18 | Ga0070664_100575500 | 3300005564 | Bacteria | 1043 |
| 19 | Ga0068857_100012717 | 3300005577 | Bacteria | 7336 |
| 20 | Ga0068857_100336166 | 3300005577 | Bacteria | 1397 |
| 21 | Ga0068857_100677378 | 3300005577 | Bacteria | 979 |
| 22 | Ga0068857_101088557 | 3300005577 | Bacteria | 771 |
| 23 | Ga0068854_100007372 | 3300005578 | Bacteria | 7030 |
| 24 | Ga0068854_100161965 | 3300005578 | Bacteria | 1733 |
| 25 | Ga0068854_100353795 | 3300005578 | Bacteria | 1203 |
| 26 | Ga0068856_100032828 | 3300005614 | Bacteria | 5083 |
| 27 | Ga0068856_100046027 | 3300005614 | Bacteria | 4297 |
| 28 | Ga0068856_100095580 | 3300005614 | Bacteria | 2959 |
| 29 | Ga0068856_100179201 | 3300005614 | Bacteria | 2132 |
| 30 | Ga0068856_100887446 | 3300005614 | Bacteria | 910 |
| 31 | Ga0068856_102014232 | 3300005614 | Bacteria | 588 |
| 32 | Ga0068852_100724171 | 3300005616 | Bacteria | 1006 |
| 33 | Ga0068852_101256952 | 3300005616 | Bacteria | 762 |
| 34 | Ga0068859_100006170 | 3300005617 | Bacteria | 12179 |
| 35 | Ga0068859_100015861 | 3300005617 | Bacteria | 7571 |
| 36 | Ga0068859_100051052 | 3300005617 | Bacteria | 4156 |
| 37 | Ga0068859_100307316 | 3300005617 | Bacteria | 1679 |
| 38 | Ga0068859_102207301 | 3300005617 | Bacteria | 607 |
| 39 | Ga0068864_100003967 | 3300005618 | Bacteria | 12179 |
| 40 | Ga0068866_10660196 | 3300005718 | Bacteria | 713 |
| 41 | Ga0068861_100084611 | 3300005719 | Bacteria | 2490 |
| 42 | Ga0068861_100470617 | 3300005719 | Bacteria | 1130 |
| 43 | Ga0068861_100515831 | 3300005719 | Bacteria | 1083 |
| 44 | Ga0068861_100711034 | 3300005719 | Bacteria | 934 |
| 45 | Ga0068861_100815600 | 3300005719 | Unclassified | 877 |
| 46 | Ga0068861_102631146 | 3300005719 | Bacteria | 507 |
| 47 | Ga0068851_10001517 | 3300005834 | Bacteria | 10195 |
| 48 | Ga0068851_10021382 | 3300005834 | Bacteria | 3141 |
| 49 | Ga0068851_10153838 | 3300005834 | Bacteria | 1259 |
| 50 | Ga0068851_10939121 | 3300005834 | Bacteria | 543 |
| 51 | Ga0068870_10229071 | 3300005840 | Bacteria | 1141 |
| 52 | Ga0068870_10810343 | 3300005840 | Bacteria | 655 |
| 53 | Ga0068863_100002985 | 3300005841 | Bacteria | 16732 |
| 54 | Ga0068863_100648692 | 3300005841 | Bacteria | 1047 |
| 55 | Ga0068863_101189063 | 3300005841 | Bacteria | 768 |
| 56 | Ga0068858_100014524 | 3300005842 | Bacteria | 7419 |
| 57 | Ga0068858_100210863 | 3300005842 | Bacteria | 1838 |
| 58 | Ga0068858_100246290 | 3300005842 | Bacteria | 1697 |
| 59 | Ga0068858_100350110 | 3300005842 | Bacteria | 1415 |
| 60 | Ga0068858_100476591 | 3300005842 | Bacteria | 1204 |
| 61 | Ga0068858_101512403 | 3300005842 | Bacteria | 662 |
| 62 | Ga0068860_100039390 | 3300005843 | Bacteria | 4520 |
| 63 | Ga0068860_100153524 | 3300005843 | Bacteria | 2218 |
| 64 | Ga0068860_100321487 | 3300005843 | Bacteria | 1519 |
| 65 | Ga0068860_100668546 | 3300005843 | Bacteria | 1047 |
| 66 | Ga0068862_100190769 | 3300005844 | Bacteria | 1844 |
| 67 | Ga0068862_100323202 | 3300005844 | Bacteria | 1425 |
| 68 | Ga0068862_100708155 | 3300005844 | Bacteria | 976 |
| 69 | Ga0068862_102324973 | 3300005844 | Bacteria | 548 |
| 70 | Ga0070717_11047569 | 3300006028 | Bacteria | 743 |
| 71 | Ga0075364_10375158 | 3300006051 | Bacteria | 970 |
| 72 | Ga0070715_10043359 | 3300006163 | Bacteria | 1896 |
| 73 | Ga0070716_100000006 | 3300006173 | Bacteria | 268067 |
| 74 | Ga0070716_100001339 | 3300006173 | Bacteria | 10909 |
| 75 | Ga0070716_100543179 | 3300006173 | Bacteria | 865 |
| 76 | Ga0070712_100005043 | 3300006175 | Bacteria | 8177 |
| 77 | Ga0075362_10192111 | 3300006177 | Bacteria | 992 |
| 78 | Ga0097621_101121116 | 3300006237 | Bacteria | 739 |
| 79 | Ga0075370_10075298 | 3300006353 | Bacteria | 1935 |
| 80 | Ga0075428_100003062 | 3300006844 | Bacteria | 18244 |
| 81 | Ga0075428_100006341 | 3300006844 | Bacteria | 13159 |
| 82 | Ga0075428_100038426 | 3300006844 | Bacteria | 5267 |
| 83 | Ga0075428_100107185 | 3300006844 | Bacteria | 3045 |
| 84 | Ga0075428_100165799 | 3300006844 | Bacteria | 2396 |
| 85 | Ga0075428_102721038 | 3300006844 | Bacteria | 504 |
| 86 | Ga0075431_100191382 | 3300006847 | Bacteria | 2096 |
| 87 | Ga0075433_10012698 | 3300006852 | Bacteria | 6815 |
| 88 | Ga0075434_100001475 | 3300006871 | Bacteria | 19810 |
| 89 | Ga0075434_100344425 | 3300006871 | Bacteria | 1511 |
| 90 | Ga0075434_100437807 | 3300006871 | Bacteria | 1328 |
| 91 | Ga0075429_100278556 | 3300006880 | Bacteria | 1464 |
| 92 | Ga0075429_100878323 | 3300006880 | Bacteria | 785 |
| 93 | Ga0068865_100355751 | 3300006881 | Bacteria | 1187 |
| 94 | Ga0068865_101154282 | 3300006881 | Bacteria | 684 |
| 95 | Ga0068865_101444153 | 3300006881 | Bacteria | 615 |
| 96 | Ga0075436_101316987 | 3300006914 | Bacteria | 547 |
| 97 | Ga0097620_100006169 | 3300006931 | Bacteria | 12179 |
| 98 | Ga0097620_100015860 | 3300006931 | Bacteria | 7571 |
| 99 | Ga0097620_100051049 | 3300006931 | Bacteria | 4156 |
| 100 | Ga0097620_100307352 | 3300006931 | Bacteria | 1679 |
| 101 | Ga0097620_101284497 | 3300006931 | Bacteria | 806 |
| 102 | Ga0097620_102207265 | 3300006931 | Bacteria | 607 |
| 103 | Ga0079104_1002693 | 3300006946 | Bacteria | 9148 |
| 104 | Ga0075435_100012418 | 3300007076 | Bacteria | 6307 |
| 105 | Ga0075435_100031563 | 3300007076 | Bacteria | 4174 |
| 106 | Ga0075435_100289377 | 3300007076 | Bacteria | 1400 |
| 107 | Ga0105244_10058327 | 3300009036 | Bacteria | 1949 |
| 108 | Ga0105250_10583177 | 3300009092 | Bacteria | 516 |
| 109 | Ga0105240_10009383 | 3300009093 | Bacteria | 13863 |
| 110 | Ga0105240_10048597 | 3300009093 | Bacteria | 5361 |
| 111 | Ga0105240_11310307 | 3300009093 | Bacteria | 764 |
| 112 | Ga0105240_11531772 | 3300009093 | Bacteria | 699 |
| 113 | Ga0105240_11847530 | 3300009093 | Bacteria | 629 |
| 114 | Ga0111539_10011746 | 3300009094 | Bacteria | 10987 |
| 115 | Ga0111539_10014963 | 3300009094 | Bacteria | 9671 |
| 116 | Ga0111539_10198320 | 3300009094 | Bacteria | 2341 |
| 117 | Ga0111539_10302448 | 3300009094 | Bacteria | 1862 |
| 118 | Ga0105245_10042696 | 3300009098 | Bacteria | 4045 |
| 119 | Ga0105245_10405940 | 3300009098 | Bacteria | 1363 |
| 120 | Ga0114129_10042483 | 3300009147 | Bacteria | 6402 |
| 121 | Ga0114129_10211024 | 3300009147 | Bacteria | 2625 |
| 122 | Ga0114129_10255555 | 3300009147 | Bacteria | 2350 |
| 123 | Ga0114129_10258633 | 3300009147 | Bacteria | 2335 |
| 124 | Ga0105243_10295437 | 3300009148 | Bacteria | 1466 |
| 125 | Ga0105243_10763257 | 3300009148 | Bacteria | 949 |
| 126 | Ga0105241_10137383 | 3300009174 | Bacteria | 1986 |
| 127 | Ga0105242_10021951 | 3300009176 | Bacteria | 5017 |
| 128 | Ga0105242_10188055 | 3300009176 | Bacteria | 1826 |
| 129 | Ga0105248_10241168 | 3300009177 | Bacteria | 2035 |
| 130 | Ga0105248_10654246 | 3300009177 | Bacteria | 1186 |
| 131 | Ga0105248_11131652 | 3300009177 | Bacteria | 885 |
| 132 | Ga0105248_11256289 | 3300009177 | Bacteria | 837 |
| 133 | Ga0105237_10000003 | 3300009545 | Bacteria | 556908 |
| 134 | Ga0105237_10000018 | 3300009545 | Bacteria | 237291 |
| 135 | Ga0105237_10101803 | 3300009545 | Bacteria | 2864 |
| 136 | Ga0105238_10000255 | 3300009551 | Bacteria | 59531 |
| 137 | Ga0105238_10018549 | 3300009551 | Bacteria | 7083 |
| 138 | Ga0105238_10058741 | 3300009551 | Bacteria | 3855 |
| 139 | Ga0105238_10073921 | 3300009551 | Bacteria | 3402 |
| 140 | Ga0105238_10207957 | 3300009551 | Bacteria | 1933 |
| 141 | Ga0105249_11028563 | 3300009553 | Bacteria | 893 |
| 142 | Ga0105249_11765687 | 3300009553 | Bacteria | 691 |
| 143 | Ga0099796_10066540 | 3300010159 | Bacteria | 1291 |
| 144 | Ga0105239_10001561 | 3300010375 | Bacteria | 30314 |
| 145 | Ga0105239_10763772 | 3300010375 | Bacteria | 1107 |
| 146 | Ga0105246_10328381 | 3300011119 | Bacteria | 1246 |
| 147 | Ga0105246_11672177 | 3300011119 | Bacteria | 604 |
| 148 | Ga0157313_1021621 | 3300012503 | Bacteria | 662 |
| 149 | Ga0157373_10464664 | 3300013100 | Bacteria | 912 |
| 150 | Ga0157371_10282570 | 3300013102 | Bacteria | 1199 |
| 151 | Ga0157370_10394595 | 3300013104 | Bacteria | 1274 |
| 152 | Ga0157370_10666108 | 3300013104 | Bacteria | 951 |
| 153 | Ga0157370_11448891 | 3300013104 | Bacteria | 618 |
| 154 | Ga0157374_10000565 | 3300013296 | Bacteria | 32833 |
| 155 | Ga0157374_10171084 | 3300013296 | Bacteria | 2119 |
| 156 | Ga0157374_11451744 | 3300013296 | Bacteria | 709 |
| 157 | Ga0157374_11868993 | 3300013296 | Bacteria | 626 |
| 158 | Ga0157378_10415240 | 3300013297 | Bacteria | 1329 |
| 159 | Ga0157378_11909340 | 3300013297 | Bacteria | 643 |
| 160 | Ga0163162_10231885 | 3300013306 | Bacteria | 1976 |
| 161 | Ga0163162_10961964 | 3300013306 | Bacteria | 965 |
| 162 | Ga0163162_11743616 | 3300013306 | Bacteria | 711 |
| 163 | Ga0157372_10023803 | 3300013307 | Bacteria | 6644 |
| 164 | Ga0157372_11549147 | 3300013307 | Bacteria | 763 |
| 165 | Ga0157372_11900300 | 3300013307 | Bacteria | 684 |
| 166 | Ga0157372_12583516 | 3300013307 | Bacteria | 583 |
| 167 | Ga0157372_13376633 | 3300013307 | Bacteria | 508 |
| 168 | Ga0157375_10043964 | 3300013308 | Bacteria | 4335 |
| 169 | Ga0157375_10426876 | 3300013308 | Bacteria | 1491 |
| 170 | Ga0157375_13136060 | 3300013308 | Bacteria | 551 |
| 171 | Ga0163163_10000689 | 3300014325 | Bacteria | 28712 |
| 172 | Ga0163163_11499838 | 3300014325 | Bacteria | 736 |
| 173 | Ga0157380_10057818 | 3300014326 | Bacteria | 3090 |
| 174 | Ga0157380_10173058 | 3300014326 | Bacteria | 1889 |
| 175 | Ga0157380_10255211 | 3300014326 | Bacteria | 1589 |
| 176 | Ga0157380_10588049 | 3300014326 | Bacteria | 1099 |
| 177 | Ga0157377_10091916 | 3300014745 | Bacteria | 1793 |
| 178 | Ga0157379_10021635 | 3300014968 | Bacteria | 5695 |
| 179 | Ga0157379_10727069 | 3300014968 | Bacteria | 933 |
| 180 | Ga0157376_10200736 | 3300014969 | Bacteria | 1835 |
| 181 | Ga0157376_11542577 | 3300014969 | Bacteria | 698 |
| 182 | Ga0157376_11888675 | 3300014969 | Bacteria | 634 |
| 183 | Ga0163161_10500951 | 3300017792 | Bacteria | 989 |
| 184 | Ga0163161_10747660 | 3300017792 | Bacteria | 818 |
| 185 | Ga0197907_10220943 | 3300020069 | Bacteria | 1552 |
| 186 | Ga0197907_10711641 | 3300020069 | Bacteria | 4414 |
| 187 | Ga0197907_11244701 | 3300020069 | Bacteria | 904 |
| 188 | Ga0206356_10044123 | 3300020070 | Bacteria | 1197 |
| 189 | Ga0206356_10421265 | 3300020070 | Bacteria | 1925 |
| 190 | Ga0206356_11631052 | 3300020070 | Bacteria | 3090 |
| 191 | Ga0206356_11659187 | 3300020070 | Bacteria | 510 |
| 192 | Ga0206349_1379836 | 3300020075 | Bacteria | 764 |
| 193 | Ga0206349_1742955 | 3300020075 | Bacteria | 2357 |
| 194 | Ga0206349_1877552 | 3300020075 | Bacteria | 632 |
| 195 | Ga0206355_1134509 | 3300020076 | Bacteria | 636 |
| 196 | Ga0206355_1282490 | 3300020076 | Bacteria | 954 |
| 197 | Ga0206355_1644566 | 3300020076 | Bacteria | 667 |
| 198 | Ga0206351_10148588 | 3300020077 | Bacteria | 552 |
| 199 | Ga0206351_10334049 | 3300020077 | Bacteria | 633 |
| 200 | Ga0206351_11004140 | 3300020077 | Bacteria | 1781 |
| 201 | Ga0206352_10067258 | 3300020078 | Bacteria | 1970 |
| 202 | Ga0206352_10603617 | 3300020078 | Bacteria | 979 |
| 203 | Ga0206352_10675711 | 3300020078 | Bacteria | 1445 |
| 204 | Ga0206352_10965755 | 3300020078 | Bacteria | 1654 |
| 205 | Ga0206350_10495714 | 3300020080 | Bacteria | 502 |
| 206 | Ga0206350_10589595 | 3300020080 | Bacteria | 4679 |
| 207 | Ga0206350_10617597 | 3300020080 | Bacteria | 589 |
| 208 | Ga0206350_11522585 | 3300020080 | Bacteria | 1616 |
| 209 | Ga0206354_10584469 | 3300020081 | Bacteria | 2389 |
| 210 | Ga0206354_11150211 | 3300020081 | Bacteria | 1156 |
| 211 | Ga0206354_11215086 | 3300020081 | Bacteria | 591 |
| 212 | Ga0206354_11538367 | 3300020081 | Bacteria | 2506 |
| 213 | Ga0206353_10705318 | 3300020082 | Bacteria | 1476 |
| 214 | Ga0206353_11282332 | 3300020082 | Bacteria | 781 |
| 215 | Ga0213875_10008240 | 3300021388 | Bacteria | 5347 |
| 216 | Ga0224712_10005496 | 3300022467 | Bacteria | 3534 |
| 217 | Ga0224712_10096658 | 3300022467 | Bacteria | 1246 |
| 218 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 219 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 220 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 221 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 222 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 223 | Ga0209233_1007528 | 3300025261 | Bacteria | 3444 |
| 224 | Ga0207697_10379362 | 3300025315 | Bacteria | 628 |
| 225 | Ga0207656_10006493 | 3300025321 | Bacteria | 4209 |
| 226 | Ga0207655_1093612 | 3300025728 | Bacteria | 1051 |
| 227 | Ga0207653_10216535 | 3300025885 | Bacteria | 726 |
| 228 | Ga0207692_10123816 | 3300025898 | Bacteria | 1451 |
| 229 | Ga0207710_10074914 | 3300025900 | Bacteria | 1559 |
| 230 | Ga0207680_10011802 | 3300025903 | Bacteria | 4428 |
| 231 | Ga0207680_11035760 | 3300025903 | Bacteria | 587 |
| 232 | Ga0207647_10529481 | 3300025904 | Bacteria | 655 |
| 233 | Ga0207685_10006968 | 3300025905 | Bacteria | 3118 |
| 234 | Ga0207685_10013875 | 3300025905 | Bacteria | 2505 |
| 235 | Ga0207699_10000308 | 3300025906 | Bacteria | 26108 |
| 236 | Ga0207699_10551424 | 3300025906 | Bacteria | 836 |
| 237 | Ga0207645_10521243 | 3300025907 | Bacteria | 805 |
| 238 | Ga0207643_10112955 | 3300025908 | Bacteria | 1602 |
| 239 | Ga0207643_10327275 | 3300025908 | Bacteria | 958 |
| 240 | Ga0207643_10643446 | 3300025908 | Bacteria | 684 |
| 241 | Ga0207705_10004481 | 3300025909 | Bacteria | 10556 |
| 242 | Ga0207705_10343948 | 3300025909 | Bacteria | 1148 |
| 243 | Ga0207654_11104665 | 3300025911 | Bacteria | 578 |
| 244 | Ga0207707_10004838 | 3300025912 | Bacteria | 11811 |
| 245 | Ga0207695_10001345 | 3300025913 | Bacteria | 41663 |
| 246 | Ga0207695_10035918 | 3300025913 | Bacteria | 5364 |
| 247 | Ga0207695_11224513 | 3300025913 | Bacteria | 631 |
| 248 | Ga0207671_10000012 | 3300025914 | Bacteria | 519494 |
| 249 | Ga0207671_10000714 | 3300025914 | Bacteria | 42588 |
| 250 | Ga0207671_10001558 | 3300025914 | Bacteria | 26243 |
| 251 | Ga0207671_11434308 | 3300025914 | Bacteria | 534 |
| 252 | Ga0207693_10071595 | 3300025915 | Bacteria | 2714 |
| 253 | Ga0207663_10011890 | 3300025916 | Bacteria | 4688 |
| 254 | Ga0207663_11683548 | 3300025916 | Bacteria | 510 |
| 255 | Ga0207660_10086706 | 3300025917 | Bacteria | 2312 |
| 256 | Ga0207662_10130416 | 3300025918 | Bacteria | 1584 |
| 257 | Ga0207657_10047148 | 3300025919 | Bacteria | 3770 |
| 258 | Ga0207657_10068489 | 3300025919 | Bacteria | 3015 |
| 259 | Ga0207657_10132449 | 3300025919 | Bacteria | 2042 |
| 260 | Ga0207652_10021342 | 3300025921 | Bacteria | 5346 |
| 261 | Ga0207652_10174103 | 3300025921 | Bacteria | 1932 |
| 262 | Ga0207681_10031326 | 3300025923 | Bacteria | 3473 |
| 263 | Ga0207681_11148537 | 3300025923 | Bacteria | 652 |
| 264 | Ga0207694_10000193 | 3300025924 | Bacteria | 61887 |
| 265 | Ga0207694_10022816 | 3300025924 | Bacteria | 4747 |
| 266 | Ga0207694_10050367 | 3300025924 | Bacteria | 3225 |
| 267 | Ga0207694_10057611 | 3300025924 | Bacteria | 3021 |
| 268 | Ga0207694_10950533 | 3300025924 | Bacteria | 727 |
| 269 | Ga0207650_10094616 | 3300025925 | Bacteria | 2289 |
| 270 | Ga0207650_11641402 | 3300025925 | Bacteria | 545 |
| 271 | Ga0207659_10338992 | 3300025926 | Bacteria | 1245 |
| 272 | Ga0207659_10731023 | 3300025926 | Bacteria | 848 |
| 273 | Ga0207659_11171147 | 3300025926 | Bacteria | 661 |
| 274 | Ga0207687_10033278 | 3300025927 | Bacteria | 3496 |
| 275 | Ga0207700_10000991 | 3300025928 | Bacteria | 16378 |
| 276 | Ga0207700_10189334 | 3300025928 | Bacteria | 1728 |
| 277 | Ga0207700_11715757 | 3300025928 | Bacteria | 554 |
| 278 | Ga0207664_10020594 | 3300025929 | Bacteria | 4891 |
| 279 | Ga0207664_10062641 | 3300025929 | Bacteria | 2971 |
| 280 | Ga0207644_10003510 | 3300025931 | Bacteria | 10149 |
| 281 | Ga0207644_10561696 | 3300025931 | Bacteria | 945 |
| 282 | Ga0207690_11121402 | 3300025932 | Bacteria | 656 |
| 283 | Ga0207706_10121963 | 3300025933 | Bacteria | 2292 |
| 284 | Ga0207706_10651079 | 3300025933 | Bacteria | 902 |
| 285 | Ga0207709_10211916 | 3300025935 | Bacteria | 1391 |
| 286 | Ga0207709_10715725 | 3300025935 | Bacteria | 802 |
| 287 | Ga0207670_10070912 | 3300025936 | Bacteria | 2408 |
| 288 | Ga0207670_10109669 | 3300025936 | Bacteria | 1986 |
| 289 | Ga0207670_10713476 | 3300025936 | Bacteria | 831 |
| 290 | Ga0207669_10588982 | 3300025937 | Bacteria | 902 |
| 291 | Ga0207704_11214655 | 3300025938 | Bacteria | 643 |
| 292 | Ga0207665_11227829 | 3300025939 | Bacteria | 598 |
| 293 | Ga0207665_11432735 | 3300025939 | Bacteria | 550 |
| 294 | Ga0207691_10381119 | 3300025940 | Bacteria | 1204 |
| 295 | Ga0207691_10475585 | 3300025940 | Bacteria | 1062 |
| 296 | Ga0207711_10000448 | 3300025941 | Bacteria | 43007 |
| 297 | Ga0207711_10247923 | 3300025941 | Bacteria | 1634 |
| 298 | Ga0207711_10977861 | 3300025941 | Bacteria | 786 |
| 299 | Ga0207711_11597954 | 3300025941 | Bacteria | 595 |
| 300 | Ga0207711_11945258 | 3300025941 | Bacteria | 531 |
| 301 | Ga0207689_10072211 | 3300025942 | Bacteria | 2835 |
| 302 | Ga0207689_10096116 | 3300025942 | Bacteria | 2433 |
| 303 | Ga0207689_10328160 | 3300025942 | Bacteria | 1270 |
| 304 | Ga0207679_10044249 | 3300025945 | Bacteria | 3211 |
| 305 | Ga0207679_10118893 | 3300025945 | Bacteria | 2100 |
| 306 | Ga0207667_10006290 | 3300025949 | Bacteria | 14403 |
| 307 | Ga0207667_10093381 | 3300025949 | Bacteria | 3107 |
| 308 | Ga0207667_10743225 | 3300025949 | Bacteria | 981 |
| 309 | Ga0207667_10938184 | 3300025949 | Bacteria | 855 |
| 310 | Ga0207651_10002125 | 3300025960 | Bacteria | 9356 |
| 311 | Ga0207651_10523101 | 3300025960 | Bacteria | 1028 |
| 312 | Ga0207651_10699287 | 3300025960 | Bacteria | 893 |
| 313 | Ga0207651_11340986 | 3300025960 | Bacteria | 643 |
| 314 | Ga0207712_11053041 | 3300025961 | Bacteria | 723 |
| 315 | Ga0207712_11127522 | 3300025961 | Bacteria | 699 |
| 316 | Ga0207712_11374314 | 3300025961 | Bacteria | 632 |
| 317 | Ga0207668_10035020 | 3300025972 | Bacteria | 3339 |
| 318 | Ga0207668_10078777 | 3300025972 | Bacteria | 2381 |
| 319 | Ga0207668_10894439 | 3300025972 | Bacteria | 790 |
| 320 | Ga0207640_10011828 | 3300025981 | Bacteria | 4953 |
| 321 | Ga0207640_11013612 | 3300025981 | Bacteria | 731 |
| 322 | Ga0207658_10082604 | 3300025986 | Bacteria | 2467 |
| 323 | Ga0207658_10515890 | 3300025986 | Bacteria | 1066 |
| 324 | Ga0207658_11091198 | 3300025986 | Bacteria | 729 |
| 325 | Ga0207677_10000253 | 3300026023 | Bacteria | 41332 |
| 326 | Ga0207677_10136423 | 3300026023 | Bacteria | 1871 |
| 327 | Ga0207703_10000517 | 3300026035 | Bacteria | 39928 |
| 328 | Ga0207703_10285608 | 3300026035 | Bacteria | 1500 |
| 329 | Ga0207703_10334329 | 3300026035 | Bacteria | 1390 |
| 330 | Ga0207703_11160314 | 3300026035 | Bacteria | 742 |
| 331 | Ga0207703_11172151 | 3300026035 | Bacteria | 738 |
| 332 | Ga0207639_10840560 | 3300026041 | Bacteria | 857 |
| 333 | Ga0207639_11515419 | 3300026041 | Bacteria | 629 |
| 334 | Ga0207639_11689583 | 3300026041 | Bacteria | 593 |
| 335 | Ga0207678_10647148 | 3300026067 | Bacteria | 928 |
| 336 | Ga0207708_10068366 | 3300026075 | Bacteria | 2719 |
| 337 | Ga0207708_10203657 | 3300026075 | Bacteria | 1579 |
| 338 | Ga0207708_10290653 | 3300026075 | Bacteria | 1327 |
| 339 | Ga0207708_10655378 | 3300026075 | Bacteria | 894 |
| 340 | Ga0207708_11258390 | 3300026075 | Bacteria | 648 |
| 341 | Ga0207702_10117033 | 3300026078 | Bacteria | 2379 |
| 342 | Ga0207702_10227221 | 3300026078 | Bacteria | 1742 |
| 343 | Ga0207702_10687179 | 3300026078 | Bacteria | 1008 |
| 344 | Ga0207648_10342134 | 3300026089 | Bacteria | 1347 |
| 345 | Ga0207648_10400882 | 3300026089 | Bacteria | 1243 |
| 346 | Ga0207648_10648555 | 3300026089 | Bacteria | 976 |
| 347 | Ga0207648_11335037 | 3300026089 | Bacteria | 674 |
| 348 | Ga0207676_10000167 | 3300026095 | Bacteria | 57507 |
| 349 | Ga0207676_10830472 | 3300026095 | Bacteria | 903 |
| 350 | Ga0207676_11616135 | 3300026095 | Bacteria | 646 |
| 351 | Ga0207674_10005520 | 3300026116 | Bacteria | 15020 |
| 352 | Ga0207674_10113606 | 3300026116 | Bacteria | 2681 |
| 353 | Ga0207674_10120228 | 3300026116 | Bacteria | 2595 |
| 354 | Ga0207674_11044975 | 3300026116 | Bacteria | 786 |
| 355 | Ga0207675_100150895 | 3300026118 | Bacteria | 2211 |
| 356 | Ga0207675_100688378 | 3300026118 | Bacteria | 1031 |
| 357 | Ga0207675_101132999 | 3300026118 | Bacteria | 802 |
| 358 | Ga0207675_101816036 | 3300026118 | Bacteria | 629 |
| 359 | Ga0207675_102572156 | 3300026118 | Bacteria | 519 |
| 360 | Ga0207683_10000965 | 3300026121 | Bacteria | 26325 |
| 361 | Ga0207683_10440010 | 3300026121 | Bacteria | 1202 |
| 362 | Ga0207683_10937359 | 3300026121 | Bacteria | 804 |
| 363 | Ga0207698_10025720 | 3300026142 | Bacteria | 4152 |
| 364 | Ga0209281_1028607 | 3300027111 | Bacteria | 1011 |
| 365 | Ga0209971_1105709 | 3300027682 | Bacteria | 690 |
| 366 | Ga0209966_1040538 | 3300027695 | Bacteria | 969 |
| 367 | Ga0207428_10044112 | 3300027907 | Bacteria | 3598 |
| 368 | Ga0207428_10120599 | 3300027907 | Bacteria | 2011 |
| 369 | Ga0207428_10591014 | 3300027907 | Bacteria | 800 |
| 370 | Ga0268266_10005004 | 3300028379 | Bacteria | 12519 |
| 371 | Ga0268266_10329216 | 3300028379 | Bacteria | 1431 |
| 372 | Ga0268266_10644748 | 3300028379 | Bacteria | 1019 |
| 373 | Ga0268266_11060310 | 3300028379 | Bacteria | 784 |
| 374 | Ga0268265_10141646 | 3300028380 | Bacteria | 2014 |
| 375 | Ga0268265_10279504 | 3300028380 | Bacteria | 1493 |
| 376 | Ga0268265_11494274 | 3300028380 | Bacteria | 679 |
| 377 | Ga0268265_12083714 | 3300028380 | Bacteria | 574 |
| 378 | Ga0268264_10096171 | 3300028381 | Bacteria | 2564 |
| 379 | Ga0268264_10228753 | 3300028381 | Bacteria | 1716 |
| 380 | Ga0268264_10306818 | 3300028381 | Bacteria | 1496 |
| 381 | Ga0268264_11062254 | 3300028381 | Bacteria | 817 |
| 382 | Ga0268264_11274607 | 3300028381 | Bacteria | 745 |
| 383 | Ga0265326_10059715 | 3300028558 | Bacteria | 1079 |
| 384 | Ga0265319_1021197 | 3300028563 | Bacteria | 2391 |
| 385 | Ga0265334_10022641 | 3300028573 | Bacteria | 2559 |
| 386 | Ga0265318_10000384 | 3300028577 | Bacteria | 34508 |
| 387 | Ga0265318_10019144 | 3300028577 | Bacteria | 2780 |
| 388 | Ga0265323_10025795 | 3300028653 | Bacteria | 2220 |
| 389 | Ga0265336_10043926 | 3300028666 | Bacteria | 1361 |
| 390 | Ga0307515_10000015 | 3300028794 | Bacteria | 557886 |
| 391 | Ga0265338_10123565 | 3300028800 | Bacteria | 2058 |
| 392 | Ga0265324_10111600 | 3300029957 | Bacteria | 929 |
| 393 | Ga0265330_10001669 | 3300031235 | Bacteria | 12591 |
| 394 | Ga0265330_10089801 | 3300031235 | Bacteria | 1319 |
| 395 | Ga0265332_10002023 | 3300031238 | Bacteria | 10619 |
| 396 | Ga0265328_10001448 | 3300031239 | Bacteria | 10926 |
| 397 | Ga0265320_10004792 | 3300031240 | Bacteria | 8794 |
| 398 | Ga0265325_10045951 | 3300031241 | Bacteria | 2267 |
| 399 | Ga0265329_10000733 | 3300031242 | Bacteria | 16666 |
| 400 | Ga0265339_10027395 | 3300031249 | Bacteria | 3253 |
| 401 | Ga0265331_10001210 | 3300031250 | Bacteria | 19474 |
| 402 | Ga0265316_10013594 | 3300031344 | Bacteria | 7222 |
| 403 | Ga0265316_10021674 | 3300031344 | Bacteria | 5436 |
| 404 | Ga0265313_10098541 | 3300031595 | Bacteria | 1300 |
| 405 | Ga0316575_10031569 | 3300031665 | Bacteria | 2074 |
| 406 | Ga0316575_10247797 | 3300031665 | Bacteria | 747 |
| 407 | Ga0316579_10206015 | 3300031691 | Bacteria | 951 |
| 408 | Ga0265314_10015705 | 3300031711 | Bacteria | 5999 |
| 409 | Ga0265314_10061333 | 3300031711 | Bacteria | 2561 |
| 410 | Ga0265342_10002136 | 3300031712 | Bacteria | 17439 |
| 411 | Ga0265342_10008211 | 3300031712 | Bacteria | 7520 |
| 412 | Ga0316576_10028305 | 3300031727 | Bacteria | 3949 |
| 413 | Ga0316576_10029824 | 3300031727 | Bacteria | 3859 |
| 414 | Ga0316576_10048859 | 3300031727 | Bacteria | 3071 |
| 415 | Ga0316576_10322013 | 3300031727 | Bacteria | 1153 |
| 416 | Ga0316576_11032611 | 3300031727 | Bacteria | 585 |
| 417 | Ga0316578_10004705 | 3300031728 | Bacteria | 6492 |
| 418 | Ga0316578_10151550 | 3300031728 | Bacteria | 1397 |
| 419 | Ga0316577_10001901 | 3300031733 | Bacteria | 10097 |
| 420 | Ga0316577_10077453 | 3300031733 | Bacteria | 1857 |
| 421 | Ga0307413_11890328 | 3300031824 | Bacteria | 536 |
| 422 | Ga0307409_100222795 | 3300031995 | Bacteria | 1704 |
| 423 | Ga0307415_100734463 | 3300032126 | Bacteria | 895 |
| 424 | Ga0316593_10001600 | 3300032168 | Bacteria | 5054 |
| 425 | Ga0316593_10001816 | 3300032168 | Bacteria | 4873 |
| 426 | Ga0316593_10010408 | 3300032168 | Bacteria | 2666 |
| 427 | Ga0316593_10015184 | 3300032168 | Bacteria | 2312 |
| 428 | Ga0316593_10016431 | 3300032168 | Bacteria | 2243 |
| 429 | Ga0316593_10057021 | 3300032168 | Bacteria | 1330 |
| 430 | Ga0316587_1000999 | 3300033529 | Bacteria | 3269 |
| 431 | Ga0316596_1000468 | 3300033541 | Bacteria | 6818 |
| 432 | Ga0316596_1000731 | 3300033541 | Bacteria | 5997 |
| 433 | Ga0316596_1000881 | 3300033541 | Bacteria | 5651 |
| 434 | Ga0316596_1050135 | 3300033541 | Bacteria | 1104 |
| 435 | Ga0373959_0167930 | 3300034820 | Bacteria | 564 |
| 436 | Ga0373934_0001385 | 3300035086 | Bacteria | 8836 |
| 437 | Ga0373923_0047756 | 3300035111 | Bacteria | 1785 |
| 438 | Ga0373923_0378272 | 3300035111 | Bacteria | 679 |
| 439 | Ga0373939_0398737 | 3300035114 | Bacteria | 570 |
| 440 | Ga0373939_0440593 | 3300035114 | Bacteria | 547 |
| 441 | Ga0373945_0054355 | 3300035116 | Bacteria | 1480 |
| 442 | Ga0373954_0006676 | 3300035118 | Bacteria | 5033 |
| 443 | Ga0373954_0205454 | 3300035118 | Bacteria | 968 |
| 444 | Ga0373954_0258927 | 3300035118 | Bacteria | 857 |
| 445 | Ga0373956_0071216 | 3300035119 | Bacteria | 1586 |
| 446 | Ga0373957_0144986 | 3300035120 | Bacteria | 972 |
| 447 | Ga0373957_0191407 | 3300035120 | Bacteria | 850 |
| 448 | Ga0373957_0301913 | 3300035120 | Bacteria | 679 |
| 449 | Ga0373960_0245584 | 3300035121 | Bacteria | 649 |
| 450 | Ga0373943_0074897 | 3300035170 | Bacteria | 1722 |
| 451 | Ga0373946_0025750 | 3300035171 | Bacteria | 2315 |
| 452 | Ga0373955_0025147 | 3300035172 | Bacteria | 3054 |
| 453 | Ga0373955_0043559 | 3300035172 | Bacteria | 2415 |
| 454 | Ga0316574_0007731 | 3300035398 | Bacteria | 5913 |
| 455 | Ga0316574_0008846 | 3300035398 | Bacteria | 5614 |
| 456 | Ga0316574_0016945 | 3300035398 | Bacteria | 4254 |
| 457 | Ga0316574_0133269 | 3300035398 | Bacteria | 1599 |
| 458 | Ga0316574_0162122 | 3300035398 | Bacteria | 1440 |
| 459 | Ga0316574_0334063 | 3300035398 | Bacteria | 961 |
| 460 | Ga0316574_0400668 | 3300035398 | Bacteria | 864 |
| 461 | Ga0373924_0000835 | 3300035410 | Bacteria | 9645 |
| 462 | Ga0373924_0221830 | 3300035410 | Bacteria | 835 |
| 463 | Ga0373935_0089342 | 3300035692 | Bacteria | 2014 |
| 464 | Ga0373935_0542041 | 3300035692 | Bacteria | 847 |
| 465 | Ga0373927_0091323 | 3300035695 | Bacteria | 1977 |
| 466 | Ga0373933_0025007 | 3300035724 | Bacteria | 3421 |
| 467 | Ga0373933_0300637 | 3300035724 | Bacteria | 1039 |
| 468 | Ga0373947_0008078 | 3300035725 | Bacteria | 6068 |
| 469 | Ga0373937_0089730 | 3300036401 | Bacteria | 2846 |
| 470 | Ga0373937_0382796 | 3300036401 | Bacteria | 1334 |
| 471 | Ga0373937_0518832 | 3300036401 | Bacteria | 1132 |
| 472 | Ga0373937_0547322 | 3300036401 | Bacteria | 1099 |
| 473 | Ga0373937_0763192 | 3300036401 | Bacteria | 914 |
| 474 | Ga0373937_0765285 | 3300036401 | Bacteria | 913 |
| 475 | Ga0373937_1438801 | 3300036401 | Bacteria | 637 |
| 476 | Ga0373937_1701606 | 3300036401 | Bacteria | 578 |
| 477 | Ga0265778_013571 | 3300036457 | Bacteria | 955 |
| 478 | Ga0316582_0048063 | 3300036647 | Bacteria | 2696 |
| 479 | Ga0316582_0089782 | 3300036647 | Bacteria | 2021 |
| 480 | Ga0316582_0114600 | 3300036647 | Bacteria | 1798 |
| 481 | Ga0316584_0017973 | 3300036712 | Bacteria | 5095 |
| 482 | Ga0316584_0036925 | 3300036712 | Bacteria | 3627 |
| 483 | Ga0316584_0037746 | 3300036712 | Bacteria | 3591 |
| 484 | Ga0316584_0047025 | 3300036712 | Bacteria | 3223 |
| 485 | Ga0316584_0420865 | 3300036712 | Bacteria | 949 |
| 486 | Ga0316584_0740546 | 3300036712 | Bacteria | 671 |
| 487 | Ga0373925_0002179 | 3300037068 | Bacteria | 15930 |
| 488 | Ga0373925_0325801 | 3300037068 | Bacteria | 1244 |
| 489 | Ga0373925_0847398 | 3300037068 | Bacteria | 753 |
| 490 | Ga0373925_1081285 | 3300037068 | Bacteria | 660 |
| 491 | Ga0373925_1650948 | 3300037068 | Bacteria | 523 |
| 492 | Ga0395899_0005268 | 3300037312 | Bacteria | 10047 |
| 493 | Ga0395899_0673616 | 3300037312 | Bacteria | 651 |
| 494 | Ga0395900_0011458 | 3300037418 | Bacteria | 9076 |
| 495 | Ga0395900_0375400 | 3300037418 | Bacteria | 1391 |
| 496 | Ga0395900_1628004 | 3300037418 | Bacteria | 557 |
| 497 | Ga0395898_0105030 | 3300037466 | Bacteria | 2708 |
| 498 | Ga0395905_0000127 | 3300037471 | Bacteria | 124627 |
| 499 | Ga0395905_0000938 | 3300037471 | Bacteria | 37508 |
| 500 | Ga0316581_0054133 | 3300037588 | Bacteria | 1230 |
| 501 | Ga0436364_0945409 | 3300037853 | Bacteria | 21165 |
| 502 | Ga0400484_27221 | 3300038725 | Bacteria | 11015 |
| 503 | Ga0400484_44058 | 3300038725 | Bacteria | 9517 |
| 504 | Ga0400490_00204 | 3300038726 | Bacteria | 5822 |
| 505 | Ga0400490_00437 | 3300038726 | Bacteria | 17578 |
| 506 | Ga0400490_07011 | 3300038726 | Bacteria | 6579 |
| 507 | Ga0400490_07361 | 3300038726 | Bacteria | 19331 |
| 508 | Ga0400490_39901 | 3300038726 | Bacteria | 15663 |
| 509 | Ga0400490_57192 | 3300038726 | Bacteria | 4135 |
| 510 | Ga0400491_00552 | 3300038727 | Bacteria | 1802 |
| 511 | Ga0400491_01651 | 3300038727 | Bacteria | 1595 |
| 512 | Ga0400491_18291 | 3300038727 | Bacteria | 1034 |
| 513 | Ga0400485_09439 | 3300038735 | Bacteria | 3103 |
| 514 | Ga0400485_11168 | 3300038735 | Bacteria | 3386 |
| 515 | Ga0400485_11310 | 3300038735 | Bacteria | 5254 |
| 516 | Ga0400485_19181 | 3300038735 | Bacteria | 55141 |
| 517 | Ga0400488_06448 | 3300038741 | Bacteria | 3977 |
| 518 | Ga0400488_07418 | 3300038741 | Bacteria | 3446 |
| 519 | Ga0400488_12334 | 3300038741 | Bacteria | 4329 |
| 520 | Ga0400488_32083 | 3300038741 | Bacteria | 3862 |
| 521 | Ga0400488_40771 | 3300038741 | Bacteria | 7929 |
| 522 | Ga0400488_43096 | 3300038741 | Bacteria | 4020 |
| 523 | Ga0400488_48044 | 3300038741 | Bacteria | 2047 |
| 524 | Ga0400488_51157 | 3300038741 | Bacteria | 5303 |
| 525 | Ga0400486_01341 | 3300038742 | Bacteria | 7086 |
| 526 | Ga0400486_05487 | 3300038742 | Bacteria | 2952 |
| 527 | Ga0400486_18812 | 3300038742 | Bacteria | 1650 |
| 528 | Ga0400486_25543 | 3300038742 | Bacteria | 57720 |
| 529 | Ga0400486_25694 | 3300038742 | Bacteria | 15655 |
| 530 | Ga0400483_020927 | 3300039062 | Bacteria | 1733 |
| 531 | Ga0400483_027826 | 3300039062 | Bacteria | 3798 |
| 532 | Ga0400483_094874 | 3300039062 | Bacteria | 2505 |
| 533 | Ga0400483_140144 | 3300039062 | Bacteria | 16717 |
| 534 | Ga0400483_151841 | 3300039062 | Bacteria | 5853 |
| 535 | Ga0400483_233637 | 3300039062 | Bacteria | 29223 |
| 536 | Ga0400483_256259 | 3300039062 | Bacteria | 3671 |
| 537 | Ga0400489_14975 | 3300039093 | Bacteria | 1611 |
| 538 | Ga0400489_50866 | 3300039093 | Bacteria | 3142 |
| 539 | Ga0400487_00070 | 3300039110 | Bacteria | 4044 |
| 540 | Ga0400487_06498 | 3300039110 | Bacteria | 4007 |
| 541 | Ga0400487_29008 | 3300039110 | Bacteria | 14273 |
| 542 | Ga0400487_33555 | 3300039110 | Bacteria | 69184 |
| 543 | Ga0400487_34004 | 3300039110 | Bacteria | 1979 |
| 544 | Ga0400487_58155 | 3300039110 | Bacteria | 32047 |
| 545 | Ga0400487_60113 | 3300039110 | Bacteria | 6486 |
| 546 | Ga0436365_1189349 | 3300039437 | Bacteria | 671 |
| 547 | Ga0436365_1396723 | 3300039437 | Bacteria | 809 |
| 548 | Ga0436361_0391791 | 3300039447 | Bacteria | 42494 |
| 549 | Ga0439453_0021918 | 3300041408 | Bacteria | 1155 |
| 550 | Ga0451795_1180726 | 3300041456 | Bacteria | 618 |
| 551 | Ga0451807_0006965 | 3300041486 | Bacteria | 1015 |
| 552 | Ga0450923_038197 | 3300042125 | Bacteria | 1001 |
| 553 | Ga0450897_018808 | 3300042128 | Bacteria | 727 |
| 554 | Ga0450894_002033 | 3300042131 | Bacteria | 2788 |
| 555 | Ga0450896_005414 | 3300042133 | Bacteria | 1740 |
| 556 | Ga0450896_037702 | 3300042133 | Bacteria | 746 |
| 557 | Ga0450906_009432 | 3300042145 | Bacteria | 1862 |
| 558 | Ga0450908_020484 | 3300042184 | Bacteria | 1162 |
| 559 | Ga0439434_0133237 | 3300042435 | Bacteria | 816 |
| 560 | Ga0439435_0153989 | 3300042436 | Bacteria | 739 |
| 561 | Ga0439435_0195376 | 3300042436 | Bacteria | 665 |
| 562 | Ga0451577_0000016 | 3300042876 | Bacteria | 531002 |
| 563 | Ga0451577_0000337 | 3300042876 | Bacteria | 87564 |
| 564 | Ga0451577_0083369 | 3300042876 | Bacteria | 2852 |
| 565 | Ga0451577_0129292 | 3300042876 | Bacteria | 2265 |
| 566 | Ga0451577_0160056 | 3300042876 | Bacteria | 2027 |
| 567 | Ga0451577_0417431 | 3300042876 | Bacteria | 1218 |
| 568 | Ga0451577_1789191 | 3300042876 | Bacteria | 539 |
| 569 | Ga0453683_0017367 | 3300044673 | Bacteria | 4633 |
| 570 | Ga0453683_0036858 | 3300044673 | Bacteria | 3077 |
| 571 | Ga0453683_0043820 | 3300044673 | Bacteria | 2808 |
| 572 | Ga0453683_0270063 | 3300044673 | Bacteria | 1085 |
| 573 | Ga0453683_0423433 | 3300044673 | Bacteria | 859 |
| 574 | Ga0453683_0866875 | 3300044673 | Bacteria | 596 |
| 575 | Ga0466961_0460957 | 3300044693 | Bacteria | 769 |
| 576 | Ga0453684_0000197 | 3300044712 | Bacteria | 264445 |
| 577 | Ga0453684_0020865 | 3300044712 | Bacteria | 9836 |
| 578 | Ga0453684_0041859 | 3300044712 | Bacteria | 6185 |
| 579 | Ga0453684_0072448 | 3300044712 | Bacteria | 4349 |
| 580 | Ga0453684_0282064 | 3300044712 | Bacteria | 1894 |
| 581 | Ga0453684_0476020 | 3300044712 | Bacteria | 1386 |
| 582 | Ga0453684_0769933 | 3300044712 | Bacteria | 1040 |
| 583 | Ga0453684_1478571 | 3300044712 | Bacteria | 702 |
| 584 | Ga0453684_1597238 | 3300044712 | Bacteria | 669 |
| 585 | Ga0466959_1178671 | 3300045049 | Bacteria | 509 |
| 586 | Ga0451576_0000971 | 3300045051 | Bacteria | 53521 |
| 587 | Ga0451576_0032619 | 3300045051 | Bacteria | 5542 |
| 588 | Ga0451576_0141552 | 3300045051 | Bacteria | 2508 |
| 589 | Ga0451576_0236352 | 3300045051 | Bacteria | 1909 |
| 590 | Ga0451576_1292967 | 3300045051 | Bacteria | 760 |
| 591 | Ga0451576_1942103 | 3300045051 | Bacteria | 607 |
| 592 | Ga0466967_1730035 | 3300045976 | Bacteria | 623 |
| 593 | Ga0466967_2166614 | 3300045976 | Bacteria | 552 |
| 594 | Ga0495603_0042618 | 3300046455 | Bacteria | 2713 |
| 595 | Ga0495603_0335295 | 3300046455 | Bacteria | 868 |
| 596 | Ga0495629_0000007 | 3300046459 | Bacteria | 358693 |
| 597 | Ga0495629_0000126 | 3300046459 | Bacteria | 66833 |
| 598 | Ga0495629_0017893 | 3300046459 | Bacteria | 5079 |
| 599 | Ga0495580_0222402 | 3300046472 | Bacteria | 1297 |
| 600 | Ga0495582_0021576 | 3300046473 | Bacteria | 3523 |
| 601 | Ga0495582_0034213 | 3300046473 | Bacteria | 2794 |
| 602 | Ga0495639_0000121 | 3300046475 | Bacteria | 39571 |
| 603 | Ga0495639_0002018 | 3300046475 | Bacteria | 8984 |
| 604 | Ga0495639_0012434 | 3300046475 | Bacteria | 3670 |
| 605 | Ga0495662_0015298 | 3300046476 | Bacteria | 3728 |
| 606 | Ga0495662_0484051 | 3300046476 | Bacteria | 607 |
| 607 | Ga0495664_0072557 | 3300046477 | Bacteria | 2057 |
| 608 | Ga0495664_0127669 | 3300046477 | Bacteria | 1539 |
| 609 | Ga0495594_0009365 | 3300046499 | Bacteria | 5059 |
| 610 | Ga0495594_0048874 | 3300046499 | Bacteria | 2324 |
| 611 | Ga0495594_0285119 | 3300046499 | Bacteria | 941 |
| 612 | Ga0495608_0179275 | 3300046511 | Bacteria | 1341 |
| 613 | Ga0495618_0313472 | 3300046514 | Bacteria | 973 |
| 614 | Ga0495663_0364184 | 3300046525 | Bacteria | 528 |
| 615 | Ga0495640_0229383 | 3300046533 | Bacteria | 1168 |
| 616 | Ga0495640_0263194 | 3300046533 | Bacteria | 1077 |
| 617 | Ga0495640_0636877 | 3300046533 | Bacteria | 642 |
| 618 | Ga0495586_0000999 | 3300046535 | Bacteria | 16016 |
| 619 | Ga0495586_0012323 | 3300046535 | Bacteria | 4537 |
| 620 | Ga0495586_0395426 | 3300046535 | Bacteria | 795 |
| 621 | Ga0495587_0174480 | 3300046536 | Bacteria | 1220 |
| 622 | Ga0495587_0180077 | 3300046536 | Bacteria | 1199 |
| 623 | Ga0495645_0135186 | 3300046543 | Bacteria | 1725 |
| 624 | Ga0495622_0002685 | 3300046557 | Bacteria | 8531 |
| 625 | Ga0495622_0023394 | 3300046557 | Bacteria | 2880 |
| 626 | Ga0495633_0308991 | 3300046558 | Unclassified | 718 |
| 627 | Ga0495634_0024544 | 3300046642 | Bacteria | 4228 |
| 628 | Ga0495635_0001790 | 3300046663 | Bacteria | 14519 |
| 629 | Ga0495635_0575039 | 3300046663 | Bacteria | 737 |
| 630 | Ga0495635_0911189 | 3300046663 | Bacteria | 562 |
| 631 | Ga0495588_0135487 | 3300046674 | Bacteria | 1300 |
| 632 | Ga0495657_0373443 | 3300046675 | Bacteria | 842 |
| 633 | Ga0495623_0119350 | 3300046679 | Bacteria | 1589 |
| 634 | Ga0495647_0001519 | 3300046681 | Bacteria | 7163 |
| 635 | Ga0495647_0173245 | 3300046681 | Bacteria | 935 |
| 636 | Ga0495647_0545141 | 3300046681 | Bacteria | 542 |
| 637 | Ga0495658_0000327 | 3300046683 | Bacteria | 26569 |
| 638 | Ga0495658_0004909 | 3300046683 | Bacteria | 6562 |
| 639 | Ga0495658_0007921 | 3300046683 | Bacteria | 5260 |
| 640 | Ga0495658_0900299 | 3300046683 | Bacteria | 566 |
| 641 | Ga0495613_0025308 | 3300046689 | Bacteria | 4422 |
| 642 | Ga0495581_0000280 | 3300047315 | Bacteria | 24770 |
| 643 | Ga0495581_0005862 | 3300047315 | Bacteria | 7123 |
| 644 | Ga0495581_0193636 | 3300047315 | Bacteria | 1189 |
| 645 | Ga0495604_0064977 | 3300047317 | Bacteria | 2779 |
| 646 | Ga0495674_0070838 | 3300047319 | Bacteria | 3012 |
| 647 | Ga0495676_0020676 | 3300047321 | Bacteria | 5767 |
| 648 | Ga0495676_0040130 | 3300047321 | Bacteria | 3867 |
| 649 | Ga0495676_0073506 | 3300047321 | Bacteria | 2621 |
| 650 | Ga0495680_0000838 | 3300047322 | Bacteria | 34052 |
| 651 | Ga0495680_0100618 | 3300047322 | Bacteria | 2154 |
| 652 | Ga0495680_0186512 | 3300047322 | Bacteria | 1494 |
| 653 | Ga0495684_0284558 | 3300047471 | Bacteria | 1192 |
| 654 | Ga0495684_0752522 | 3300047471 | Bacteria | 641 |
| 655 | Ga0495686_0000545 | 3300047472 | Bacteria | 53866 |
| 656 | Ga0495686_0012883 | 3300047472 | Bacteria | 5830 |
| 657 | Ga0495593_0365057 | 3300047673 | Bacteria | 722 |
| 658 | Ga0495614_0111480 | 3300048089 | Bacteria | 1201 |
| 659 | Ga0496100_0178098 | 3300048903 | Bacteria | 1536 |
| 660 | Ga0496100_0663363 | 3300048903 | Bacteria | 813 |
| 661 | Ga0496102_1871623 | 3300048905 | Bacteria | 517 |
| 662 | Ga0496104_0000247 | 3300048907 | Bacteria | 47765 |
| 663 | Ga0496104_0015885 | 3300048907 | Bacteria | 6831 |
| 664 | Ga0496104_1098513 | 3300048907 | Bacteria | 699 |
| 665 | Ga0496105_0230741 | 3300048908 | Bacteria | 1504 |
| 666 | Ga0496106_0227535 | 3300048909 | Bacteria | 1488 |
| 667 | Ga0496106_0396429 | 3300048909 | Bacteria | 1109 |
| 668 | Ga0496107_0132708 | 3300048910 | Bacteria | 1839 |
| 669 | Ga0496107_0808018 | 3300048910 | Bacteria | 686 |
| 670 | Ga0496111_0586178 | 3300048914 | Bacteria | 817 |
| 671 | Ga0496112_0001041 | 3300048915 | Bacteria | 20441 |
| 672 | Ga0496113_1126530 | 3300048916 | Bacteria | 615 |
| 673 | Ga0496114_0140121 | 3300048917 | Bacteria | 2093 |
| 674 | Ga0496126_0000005 | 3300048929 | Bacteria | 891906 |
| 675 | Ga0501033_0151291 | 3300049570 | Bacteria | 1674 |
| 676 | Ga0501033_0755402 | 3300049570 | Bacteria | 659 |
| 677 | Ga0501034_0054360 | 3300049571 | Bacteria | 4031 |
| 678 | Ga0501034_0062111 | 3300049571 | Bacteria | 3751 |
| 679 | Ga0501036_0485778 | 3300049572 | Bacteria | 1028 |
| 680 | Ga0501036_0493094 | 3300049572 | Bacteria | 1020 |
| 681 | Ga0501039_0863844 | 3300049575 | Bacteria | 705 |
| 682 | Ga0501039_1239915 | 3300049575 | Bacteria | 576 |
| 683 | Ga0501042_1443808 | 3300049578 | Bacteria | 502 |
| 684 | Ga0501043_0331939 | 3300049579 | Bacteria | 1158 |
| 685 | Ga0501043_0980992 | 3300049579 | Bacteria | 602 |
| 686 | Ga0501046_0165569 | 3300049580 | Bacteria | 1661 |
| 687 | Ga0501047_0085715 | 3300049581 | Bacteria | 3027 |
| 688 | Ga0501067_0098292 | 3300049583 | Bacteria | 1626 |
| 689 | Ga0501070_0634044 | 3300049586 | Bacteria | 850 |
| 690 | Ga0501071_0349175 | 3300049587 | Bacteria | 1126 |
| 691 | Ga0501071_0711056 | 3300049587 | Bacteria | 774 |
| 692 | Ga0501072_1389825 | 3300049588 | Bacteria | 543 |
| 693 | Ga0501076_0646894 | 3300049592 | Bacteria | 872 |
| 694 | Ga0501079_0177238 | 3300049741 | Bacteria | 1663 |
| 695 | Ga0501081_0365489 | 3300049743 | Bacteria | 1065 |
| 696 | Ga0501035_0388799 | 3300049822 | Bacteria | 1162 |
| 697 | Ga0501035_1346473 | 3300049822 | Bacteria | 549 |
| 698 | Ga0501044_0008030 | 3300049823 | Bacteria | 11594 |
| 699 | nmdc:mga05p37_181505_c1 | 3300050507 | Bacteria | 2560 |
| 700 | nmdc:mga05p37_229395_c1 | 3300050507 | Bacteria | 2238 |
| 701 | nmdc:mga05p37_306274_c2 | 3300050507 | Bacteria | 1509 |
| 702 | nmdc:mga09592_29654_c1 | 3300050508 | Bacteria | 4549 |
| 703 | nmdc:mga09592_322011_c1 | 3300050508 | Bacteria | 1339 |
| 704 | nmdc:mga0qj67_645336_c1 | 3300050509 | Bacteria | 845 |
| 705 | nmdc:mga06r32_381565_c1 | 3300050510 | Bacteria | 1392 |
| 706 | nmdc:mga08y16_140994_c1 | 3300050511 | Bacteria | 2506 |
| 707 | nmdc:mga08y16_175843_c1 | 3300050511 | Bacteria | 2223 |
| 708 | nmdc:mga08y16_1791006_c1 | 3300050511 | Bacteria | 567 |
| 709 | nmdc:mga08y16_8355_c1 | 3300050511 | Bacteria | 10832 |
| 710 | nmdc:mga0n895_108823_c1 | 3300050512 | Bacteria | 2786 |
| 711 | nmdc:mga0n895_203675_c1 | 3300050512 | Bacteria | 2009 |
| 712 | nmdc:mga0rr50_771801_c1 | 3300050513 | Bacteria | 820 |
| 713 | nmdc:mga0rr50_80996_c1 | 3300050513 | Bacteria | 2504 |
| 714 | Ga0495601_0088500 | 3300053077 | Bacteria | 1991 |
| 715 | Ga0495612_0084920 | 3300053078 | Bacteria | 1334 |
| 716 | Ga0495619_0001327 | 3300053085 | Bacteria | 16220 |
| 717 | Ga0495619_0149576 | 3300053085 | Bacteria | 1610 |
| 718 | Ga0500566_0008539 | 3300053094 | Bacteria | 6056 |
| 719 | Ga0501084_0244436 | 3300054114 | Bacteria | 1515 |
| 720 | Ga0587093_062454 | 3300059478 | Bacteria | 611 |
| 721 | Ga0587066_053876 | 3300059490 | Bacteria | 801 |
| 722 | Ga0587066_185908 | 3300059490 | Bacteria | 538 |
| 723 | Ga0587070_064310 | 3300059491 | Bacteria | 767 |
| 724 | Ga0587070_125664 | 3300059491 | Bacteria | 618 |
| 725 | Ga0587077_009783 | 3300059493 | Bacteria | 1465 |
| 726 | Ga0587082_075400 | 3300059504 | Bacteria | 693 |
| 727 | Ga0587085_020207 | 3300059506 | Bacteria | 1005 |
| 728 | Ga0587088_021186 | 3300059508 | Bacteria | 1085 |
| 729 | Ga0587090_084712 | 3300059510 | Bacteria | 640 |
| 730 | Ga0587099_024032 | 3300059622 | Bacteria | 706 |
| 731 | Ga0587069_051252 | 3300059642 | Bacteria | 735 |
| 732 | Ga0587076_117509 | 3300059645 | Bacteria | 612 |
| 733 | Ga0587079_116296 | 3300059647 | Bacteria | 656 |
| 734 | Ga0587100_012481 | 3300059648 | Bacteria | 744 |
| 735 | Ga0587107_107382 | 3300059652 | Bacteria | 560 |
| 736 | Ga0587119_080205 | 3300059658 | Bacteria | 531 |
| 737 | Ga0587111_0063663 | 3300060346 | Bacteria | 845 |
| 738 | Ga0501082_0470562 | 3300060353 | Bacteria | 1098 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2510917014 | 2511099781 | 33 |
| 2 | iso_pu_bacteria | 2513237150 | 2513956728 | 33 |
| 3 | iso_pu_bacteria | 2515154189 | 2516022233 | 33 |
| 4 | iso_pu_bacteria | 2551306416 | 2553007591 | 33 |
| 5 | iso_pu_bacteria | 2671180115 | 2671589095 | 33 |
| 6 | iso_pu_bacteria | 2721755763 | 2723879665 | 33 |
| 7 | iso_pu_bacteria | 2765235838 | 2765567316 | 33 |
| 8 | iso_pu_bacteria | 2808606386 | 2808984227 | 33 |
| 9 | iso_pu_bacteria | 2808606415 | 2809132031 | 33 |
| 10 | iso_pu_bacteria | 2808606419 | 2809151654 | 33 |
| 11 | iso_pu_bacteria | 2818991449 | 2819618753 | 33 |
| 12 | iso_pu_bacteria | 2834641062 | 2834642601 | 33 |
| 13 | iso_pu_bacteria | 2839094727 | 2839095401 | 33 |
| 14 | iso_pu_bacteria | 2856287931 | 2856289404 | 33 |
| 15 | iso_pu_bacteria | 2857357740 | 2857362276 | 33 |
| 16 | iso_pu_bacteria | 2858688981 | 2858698273 | 33 |
| 17 | iso_pu_bacteria | 2883087390 | 2883091434 | 33 |
| 18 | iso_pu_bacteria | 2901300506 | 2901304185 | 33 |
| 19 | iso_pu_bacteria | 2904434214 | 2904438991 | 33 |
| 20 | iso_pu_bacteria | 2904439833 | 2904442503 | 33 |
| 21 | iso_pu_bacteria | 2904530477 | 2904533761 | 33 |
| 22 | iso_pu_bacteria | 2904584206 | 2904589402 | 33 |
| 23 | iso_pu_bacteria | 2904589729 | 2904595105 | 33 |
| 24 | iso_pu_bacteria | 2904601388 | 2904602393 | 33 |
| 25 | iso_pu_bacteria | 2919046199 | 2919050741 | 33 |
| 26 | iso_pu_bacteria | 2919079590 | 2919084936 | 33 |
| 27 | iso_pu_bacteria | 2923510766 | 2923514723 | 33 |
| 28 | iso_pu_bacteria | 2928130867 | 2928135675 | 33 |
| 29 | iso_pu_bacteria | 8003400568 | 8003402165 | 33 |
| 30 | iso_pu_bacteria | 8003955200 | 8003956817 | 33 |
| 31 | iso_pu_bacteria | 8055693939 | 8055697960 | 33 |
| 32 | 3300001990 | JGI24737J22298_10177453 | JGI24737J22298_101774531 | 37 |
| 33 | 3300002067 | JGI24735J21928_10011983 | JGI24735J21928_100119832 | 37 |
| 34 | 3300005338 | Ga0068868_102068432 | Ga0068868_1020684321 | 37 |
| 35 | 3300005339 | Ga0070660_100066916 | Ga0070660_1000669162 | 37 |
| 36 | 3300005543 | Ga0070672_100082364 | Ga0070672_1000823642 | 37 |
| 37 | 3300005543 | Ga0070672_100120557 | Ga0070672_1001205574 | 37 |
| 38 | 3300005543 | Ga0070672_100136941 | Ga0070672_1001369415 | 37 |
| 39 | 3300005543 | Ga0070672_100361221 | Ga0070672_1003612213 | 37 |
| 40 | 3300005543 | Ga0070672_101022531 | Ga0070672_1010225313 | 37 |
| 41 | 3300005548 | Ga0070665_100005852 | Ga0070665_1000058523 | 37 |
| 42 | 3300005548 | Ga0070665_100533295 | Ga0070665_1005332953 | 37 |
| 43 | 3300005548 | Ga0070665_101743623 | Ga0070665_1017436232 | 37 |
| 44 | 3300005563 | Ga0068855_100051467 | Ga0068855_1000514676 | 37 |
| 45 | 3300005563 | Ga0068855_100646242 | Ga0068855_1006462422 | 37 |
| 46 | 3300005563 | Ga0068855_101043625 | Ga0068855_1010436252 | 37 |
| 47 | 3300005563 | Ga0068855_101653194 | Ga0068855_1016531941 | 37 |
| 48 | 3300005564 | Ga0070664_100053940 | Ga0070664_1000539405 | 37 |
| 49 | 3300005564 | Ga0070664_100575500 | Ga0070664_1005755003 | 37 |
| 50 | 3300005577 | Ga0068857_100012717 | Ga0068857_1000127179 | 37 |
| 51 | 3300005577 | Ga0068857_100336166 | Ga0068857_1003361663 | 37 |
| 52 | 3300005577 | Ga0068857_100677378 | Ga0068857_1006773783 | 37 |
| 53 | 3300005577 | Ga0068857_101088557 | Ga0068857_1010885572 | 37 |
| 54 | 3300005578 | Ga0068854_100007372 | Ga0068854_1000073729 | 37 |
| 55 | 3300005578 | Ga0068854_100161965 | Ga0068854_1001619654 | 37 |
| 56 | 3300005578 | Ga0068854_100353795 | Ga0068854_1003537952 | 37 |
| 57 | 3300005614 | Ga0068856_100032828 | Ga0068856_10003282810 | 37 |
| 58 | 3300005614 | Ga0068856_100046027 | Ga0068856_1000460274 | 37 |
| 59 | 3300005614 | Ga0068856_100095580 | Ga0068856_1000955803 | 37 |
| 60 | 3300005614 | Ga0068856_100179201 | Ga0068856_1001792012 | 37 |
| 61 | 3300005614 | Ga0068856_100887446 | Ga0068856_1008874463 | 37 |
| 62 | 3300005614 | Ga0068856_102014232 | Ga0068856_1020142322 | 37 |
| 63 | 3300005616 | Ga0068852_100724171 | Ga0068852_1007241713 | 37 |
| 64 | 3300005616 | Ga0068852_101256952 | Ga0068852_1012569522 | 37 |
| 65 | 3300005617 | Ga0068859_100006170 | Ga0068859_10000617025 | 37 |
| 66 | 3300005617 | Ga0068859_100015861 | Ga0068859_1000158612 | 37 |
| 67 | 3300005617 | Ga0068859_100051052 | Ga0068859_1000510527 | 37 |
| 68 | 3300005617 | Ga0068859_100307316 | Ga0068859_1003073163 | 37 |
| 69 | 3300005617 | Ga0068859_102207301 | Ga0068859_1022073012 | 37 |
| 70 | 3300005618 | Ga0068864_100003967 | Ga0068864_10000396725 | 37 |
| 71 | 3300005718 | Ga0068866_10660196 | Ga0068866_106601962 | 37 |
| 72 | 3300005719 | Ga0068861_100084611 | Ga0068861_1000846115 | 37 |
| 73 | 3300005719 | Ga0068861_100470617 | Ga0068861_1004706173 | 37 |
| 74 | 3300005719 | Ga0068861_100515831 | Ga0068861_1005158313 | 37 |
| 75 | 3300005719 | Ga0068861_100711034 | Ga0068861_1007110342 | 37 |
| 76 | 3300005719 | Ga0068861_100815600 | Ga0068861_1008156002 | 37 |
| 77 | 3300005719 | Ga0068861_102631146 | Ga0068861_1026311462 | 37 |
| 78 | 3300005834 | Ga0068851_10001517 | Ga0068851_1000151715 | 37 |
| 79 | 3300005834 | Ga0068851_10021382 | Ga0068851_100213825 | 37 |
| 80 | 3300005834 | Ga0068851_10153838 | Ga0068851_101538383 | 37 |
| 81 | 3300005834 | Ga0068851_10939121 | Ga0068851_109391212 | 37 |
| 82 | 3300005840 | Ga0068870_10229071 | Ga0068870_102290712 | 37 |
| 83 | 3300005840 | Ga0068870_10810343 | Ga0068870_108103432 | 37 |
| 84 | 3300005841 | Ga0068863_100002985 | Ga0068863_10000298518 | 37 |
| 85 | 3300005841 | Ga0068863_100648692 | Ga0068863_1006486923 | 37 |
| 86 | 3300005841 | Ga0068863_101189063 | Ga0068863_1011890633 | 37 |
| 87 | 3300005842 | Ga0068858_100014524 | Ga0068858_10001452415 | 37 |
| 88 | 3300005842 | Ga0068858_100210863 | Ga0068858_1002108634 | 37 |
| 89 | 3300005842 | Ga0068858_100246290 | Ga0068858_1002462902 | 37 |
| 90 | 3300005842 | Ga0068858_100350110 | Ga0068858_1003501103 | 37 |
| 91 | 3300005842 | Ga0068858_100476591 | Ga0068858_1004765911 | 37 |
| 92 | 3300005842 | Ga0068858_101512403 | Ga0068858_1015124032 | 37 |
| 93 | 3300005843 | Ga0068860_100039390 | Ga0068860_1000393905 | 37 |
| 94 | 3300005843 | Ga0068860_100153524 | Ga0068860_1001535242 | 37 |
| 95 | 3300005843 | Ga0068860_100321487 | Ga0068860_1003214873 | 37 |
| 96 | 3300005843 | Ga0068860_100668546 | Ga0068860_1006685462 | 37 |
| 97 | 3300005844 | Ga0068862_100190769 | Ga0068862_1001907693 | 37 |
| 98 | 3300005844 | Ga0068862_100323202 | Ga0068862_1003232022 | 37 |
| 99 | 3300005844 | Ga0068862_100708155 | Ga0068862_1007081551 | 37 |
| 100 | 3300005844 | Ga0068862_102324973 | Ga0068862_1023249732 | 37 |
| 101 | 3300006028 | Ga0070717_11047569 | Ga0070717_110475692 | 37 |
| 102 | 3300006051 | Ga0075364_10375158 | Ga0075364_103751583 | 37 |
| 103 | 3300006163 | Ga0070715_10043359 | Ga0070715_100433593 | 37 |
| 104 | 3300006173 | Ga0070716_100000006 | Ga0070716_100000006228 | 37 |
| 105 | 3300006173 | Ga0070716_100001339 | Ga0070716_1000013392 | 37 |
| 106 | 3300006173 | Ga0070716_100543179 | Ga0070716_1005431792 | 37 |
| 107 | 3300006175 | Ga0070712_100005043 | Ga0070712_10000504311 | 37 |
| 108 | 3300006177 | Ga0075362_10192111 | Ga0075362_101921111 | 37 |
| 109 | 3300006237 | Ga0097621_101121116 | Ga0097621_1011211163 | 37 |
| 110 | 3300006353 | Ga0075370_10075298 | Ga0075370_100752984 | 37 |
| 111 | 3300006844 | Ga0075428_100003062 | Ga0075428_1000030627 | 37 |
| 112 | 3300006844 | Ga0075428_100006341 | Ga0075428_10000634127 | 37 |
| 113 | 3300006844 | Ga0075428_100038426 | Ga0075428_1000384265 | 37 |
| 114 | 3300006844 | Ga0075428_100107185 | Ga0075428_1001071853 | 37 |
| 115 | 3300006844 | Ga0075428_100165799 | Ga0075428_1001657991 | 37 |
| 116 | 3300006844 | Ga0075428_102721038 | Ga0075428_1027210381 | 37 |
| 117 | 3300006847 | Ga0075431_100191382 | Ga0075431_1001913823 | 37 |
| 118 | 3300006852 | Ga0075433_10012698 | Ga0075433_100126988 | 37 |
| 119 | 3300006871 | Ga0075434_100001475 | Ga0075434_10000147527 | 37 |
| 120 | 3300006871 | Ga0075434_100344425 | Ga0075434_1003444253 | 37 |
| 121 | 3300006871 | Ga0075434_100437807 | Ga0075434_1004378073 | 37 |
| 122 | 3300006880 | Ga0075429_100278556 | Ga0075429_1002785562 | 37 |
| 123 | 3300006880 | Ga0075429_100878323 | Ga0075429_1008783232 | 37 |
| 124 | 3300006881 | Ga0068865_100355751 | Ga0068865_1003557513 | 37 |
| 125 | 3300006881 | Ga0068865_101154282 | Ga0068865_1011542822 | 37 |
| 126 | 3300006881 | Ga0068865_101444153 | Ga0068865_1014441532 | 37 |
| 127 | 3300006914 | Ga0075436_101316987 | Ga0075436_1013169872 | 37 |
| 128 | 3300006931 | Ga0097620_100006169 | Ga0097620_10000616925 | 37 |
| 129 | 3300006931 | Ga0097620_100015860 | Ga0097620_1000158602 | 37 |
| 130 | 3300006931 | Ga0097620_100051049 | Ga0097620_1000510497 | 37 |
| 131 | 3300006931 | Ga0097620_100307352 | Ga0097620_1003073523 | 37 |
| 132 | 3300006931 | Ga0097620_101284497 | Ga0097620_1012844973 | 37 |
| 133 | 3300006931 | Ga0097620_102207265 | Ga0097620_1022072652 | 37 |
| 134 | 3300006946 | Ga0079104_1002693 | Ga0079104_10026932 | 37 |
| 135 | 3300007076 | Ga0075435_100012418 | Ga0075435_1000124185 | 37 |
| 136 | 3300007076 | Ga0075435_100031563 | Ga0075435_1000315633 | 37 |
| 137 | 3300007076 | Ga0075435_100289377 | Ga0075435_1002893774 | 37 |
| 138 | 3300009036 | Ga0105244_10058327 | Ga0105244_100583273 | 37 |
| 139 | 3300009092 | Ga0105250_10583177 | Ga0105250_105831772 | 37 |
| 140 | 3300009093 | Ga0105240_10009383 | Ga0105240_1000938325 | 37 |
| 141 | 3300009093 | Ga0105240_10048597 | Ga0105240_100485979 | 37 |
| 142 | 3300009093 | Ga0105240_11310307 | Ga0105240_113103071 | 37 |
| 143 | 3300009093 | Ga0105240_11531772 | Ga0105240_115317722 | 37 |
| 144 | 3300009093 | Ga0105240_11847530 | Ga0105240_118475302 | 37 |
| 145 | 3300009094 | Ga0111539_10011746 | Ga0111539_1001174612 | 37 |
| 146 | 3300009094 | Ga0111539_10014963 | Ga0111539_1001496312 | 37 |
| 147 | 3300009094 | Ga0111539_10198320 | Ga0111539_101983205 | 37 |
| 148 | 3300009094 | Ga0111539_10302448 | Ga0111539_103024484 | 37 |
| 149 | 3300009098 | Ga0105245_10042696 | Ga0105245_100426968 | 37 |
| 150 | 3300009098 | Ga0105245_10405940 | Ga0105245_104059404 | 37 |
| 151 | 3300009147 | Ga0114129_10042483 | Ga0114129_1004248311 | 37 |
| 152 | 3300009147 | Ga0114129_10211024 | Ga0114129_102110244 | 37 |
| 153 | 3300009147 | Ga0114129_10255555 | Ga0114129_102555553 | 37 |
| 154 | 3300009147 | Ga0114129_10258633 | Ga0114129_102586331 | 37 |
| 155 | 3300009148 | Ga0105243_10295437 | Ga0105243_102954373 | 37 |
| 156 | 3300009148 | Ga0105243_10763257 | Ga0105243_107632573 | 37 |
| 157 | 3300009174 | Ga0105241_10137383 | Ga0105241_101373832 | 37 |
| 158 | 3300009176 | Ga0105242_10021951 | Ga0105242_1002195110 | 37 |
| 159 | 3300009176 | Ga0105242_10188055 | Ga0105242_101880554 | 37 |
| 160 | 3300009177 | Ga0105248_10241168 | Ga0105248_102411684 | 37 |
| 161 | 3300009177 | Ga0105248_10654246 | Ga0105248_106542462 | 37 |
| 162 | 3300009177 | Ga0105248_11131652 | Ga0105248_111316522 | 37 |
| 163 | 3300009177 | Ga0105248_11256289 | Ga0105248_112562893 | 37 |
| 164 | 3300009545 | Ga0105237_10000003 | Ga0105237_1000000394 | 37 |
| 165 | 3300009545 | Ga0105237_10000018 | Ga0105237_1000001827 | 37 |
| 166 | 3300009545 | Ga0105237_10101803 | Ga0105237_101018033 | 37 |
| 167 | 3300009551 | Ga0105238_10000255 | Ga0105238_1000025525 | 37 |
| 168 | 3300009551 | Ga0105238_10018549 | Ga0105238_1001854910 | 37 |
| 169 | 3300009551 | Ga0105238_10058741 | Ga0105238_100587414 | 37 |
| 170 | 3300009551 | Ga0105238_10073921 | Ga0105238_100739216 | 37 |
| 171 | 3300009551 | Ga0105238_10207957 | Ga0105238_102079573 | 37 |
| 172 | 3300009553 | Ga0105249_11028563 | Ga0105249_110285632 | 37 |
| 173 | 3300009553 | Ga0105249_11765687 | Ga0105249_117656872 | 37 |
| 174 | 3300010159 | Ga0099796_10066540 | Ga0099796_100665402 | 37 |
| 175 | 3300010375 | Ga0105239_10001561 | Ga0105239_1000156122 | 37 |
| 176 | 3300010375 | Ga0105239_10763772 | Ga0105239_107637722 | 37 |
| 177 | 3300011119 | Ga0105246_10328381 | Ga0105246_103283813 | 37 |
| 178 | 3300011119 | Ga0105246_11672177 | Ga0105246_116721772 | 37 |
| 179 | 3300012503 | Ga0157313_1021621 | Ga0157313_10216211 | 37 |
| 180 | 3300013100 | Ga0157373_10464664 | Ga0157373_104646643 | 37 |
| 181 | 3300013102 | Ga0157371_10282570 | Ga0157371_102825703 | 37 |
| 182 | 3300013104 | Ga0157370_10394595 | Ga0157370_103945953 | 37 |
| 183 | 3300013104 | Ga0157370_10666108 | Ga0157370_106661081 | 37 |
| 184 | 3300013104 | Ga0157370_11448891 | Ga0157370_114488911 | 37 |
| 185 | 3300013296 | Ga0157374_10000565 | Ga0157374_1000056525 | 37 |
| 186 | 3300013296 | Ga0157374_10171084 | Ga0157374_101710842 | 37 |
| 187 | 3300013296 | Ga0157374_11451744 | Ga0157374_114517442 | 37 |
| 188 | 3300013296 | Ga0157374_11868993 | Ga0157374_118689932 | 37 |
| 189 | 3300013297 | Ga0157378_10415240 | Ga0157378_104152403 | 37 |
| 190 | 3300013297 | Ga0157378_11909340 | Ga0157378_119093402 | 37 |
| 191 | 3300013306 | Ga0163162_10231885 | Ga0163162_102318855 | 37 |
| 192 | 3300013306 | Ga0163162_10961964 | Ga0163162_109619642 | 37 |
| 193 | 3300013306 | Ga0163162_11743616 | Ga0163162_117436162 | 37 |
| 194 | 3300013307 | Ga0157372_10023803 | Ga0157372_100238036 | 37 |
| 195 | 3300013307 | Ga0157372_11549147 | Ga0157372_115491472 | 37 |
| 196 | 3300013307 | Ga0157372_11900300 | Ga0157372_119003002 | 37 |
| 197 | 3300013307 | Ga0157372_12583516 | Ga0157372_125835162 | 37 |
| 198 | 3300013307 | Ga0157372_13376633 | Ga0157372_133766331 | 37 |
| 199 | 3300013308 | Ga0157375_10043964 | Ga0157375_100439643 | 37 |
| 200 | 3300013308 | Ga0157375_10426876 | Ga0157375_104268763 | 37 |
| 201 | 3300013308 | Ga0157375_13136060 | Ga0157375_131360602 | 37 |
| 202 | 3300014325 | Ga0163163_10000689 | Ga0163163_1000068921 | 37 |
| 203 | 3300014325 | Ga0163163_11499838 | Ga0163163_114998382 | 37 |
| 204 | 3300014326 | Ga0157380_10057818 | Ga0157380_100578184 | 37 |
| 205 | 3300014326 | Ga0157380_10173058 | Ga0157380_101730582 | 37 |
| 206 | 3300014326 | Ga0157380_10255211 | Ga0157380_102552113 | 37 |
| 207 | 3300014326 | Ga0157380_10588049 | Ga0157380_105880492 | 37 |
| 208 | 3300014745 | Ga0157377_10091916 | Ga0157377_100919163 | 37 |
| 209 | 3300014968 | Ga0157379_10021635 | Ga0157379_1002163510 | 37 |
| 210 | 3300014968 | Ga0157379_10727069 | Ga0157379_107270692 | 37 |
| 211 | 3300014969 | Ga0157376_10200736 | Ga0157376_102007364 | 37 |
| 212 | 3300014969 | Ga0157376_11542577 | Ga0157376_115425772 | 37 |
| 213 | 3300014969 | Ga0157376_11888675 | Ga0157376_118886753 | 37 |
| 214 | 3300017792 | Ga0163161_10500951 | Ga0163161_105009513 | 37 |
| 215 | 3300017792 | Ga0163161_10747660 | Ga0163161_107476602 | 37 |
| 216 | 3300020069 | Ga0197907_10220943 | Ga0197907_102209432 | 37 |
| 217 | 3300020069 | Ga0197907_10711641 | Ga0197907_107116415 | 37 |
| 218 | 3300020069 | Ga0197907_11244701 | Ga0197907_112447012 | 37 |
| 219 | 3300020070 | Ga0206356_10044123 | Ga0206356_100441233 | 37 |
| 220 | 3300020070 | Ga0206356_10421265 | Ga0206356_104212652 | 37 |
| 221 | 3300020070 | Ga0206356_11631052 | Ga0206356_116310524 | 37 |
| 222 | 3300020070 | Ga0206356_11659187 | Ga0206356_116591872 | 37 |
| 223 | 3300020075 | Ga0206349_1379836 | Ga0206349_13798362 | 37 |
| 224 | 3300020075 | Ga0206349_1742955 | Ga0206349_17429552 | 37 |
| 225 | 3300020075 | Ga0206349_1877552 | Ga0206349_18775522 | 37 |
| 226 | 3300020076 | Ga0206355_1134509 | Ga0206355_11345092 | 37 |
| 227 | 3300020076 | Ga0206355_1282490 | Ga0206355_12824902 | 37 |
| 228 | 3300020076 | Ga0206355_1644566 | Ga0206355_16445661 | 37 |
| 229 | 3300020077 | Ga0206351_10148588 | Ga0206351_101485882 | 37 |
| 230 | 3300020077 | Ga0206351_10334049 | Ga0206351_103340493 | 37 |
| 231 | 3300020077 | Ga0206351_11004140 | Ga0206351_110041401 | 37 |
| 232 | 3300020078 | Ga0206352_10067258 | Ga0206352_100672583 | 37 |
| 233 | 3300020078 | Ga0206352_10603617 | Ga0206352_106036172 | 37 |
| 234 | 3300020078 | Ga0206352_10675711 | Ga0206352_106757113 | 37 |
| 235 | 3300020078 | Ga0206352_10965755 | Ga0206352_109657554 | 37 |
| 236 | 3300020080 | Ga0206350_10495714 | Ga0206350_104957142 | 37 |
| 237 | 3300020080 | Ga0206350_10589595 | Ga0206350_105895956 | 37 |
| 238 | 3300020080 | Ga0206350_10617597 | Ga0206350_106175971 | 37 |
| 239 | 3300020080 | Ga0206350_11522585 | Ga0206350_115225852 | 37 |
| 240 | 3300020081 | Ga0206354_10584469 | Ga0206354_105844693 | 37 |
| 241 | 3300020081 | Ga0206354_11150211 | Ga0206354_111502113 | 37 |
| 242 | 3300020081 | Ga0206354_11215086 | Ga0206354_112150862 | 37 |
| 243 | 3300020081 | Ga0206354_11538367 | Ga0206354_115383672 | 37 |
| 244 | 3300020082 | Ga0206353_10705318 | Ga0206353_107053183 | 37 |
| 245 | 3300020082 | Ga0206353_11282332 | Ga0206353_112823323 | 37 |
| 246 | 3300021388 | Ga0213875_10008240 | Ga0213875_100082403 | 37 |
| 247 | 3300022467 | Ga0224712_10005496 | Ga0224712_100054961 | 37 |
| 248 | 3300022467 | Ga0224712_10096658 | Ga0224712_100966582 | 37 |
| 249 | 3300025224 | Ga0209784_100035 | Ga0209784_100035156 | 37 |
| 250 | 3300025225 | Ga0209566_100040 | Ga0209566_100040156 | 37 |
| 251 | 3300025226 | Ga0209674_100057 | Ga0209674_100057156 | 37 |
| 252 | 3300025230 | Ga0209563_100059 | Ga0209563_100059156 | 37 |
| 253 | 3300025253 | Ga0209677_100036 | Ga0209677_100036156 | 37 |
| 254 | 3300025261 | Ga0209233_1007528 | Ga0209233_10075283 | 37 |
| 255 | 3300025315 | Ga0207697_10379362 | Ga0207697_103793621 | 37 |
| 256 | 3300025321 | Ga0207656_10006493 | Ga0207656_100064934 | 37 |
| 257 | 3300025728 | Ga0207655_1093612 | Ga0207655_10936122 | 37 |
| 258 | 3300025885 | Ga0207653_10216535 | Ga0207653_102165352 | 37 |
| 259 | 3300025898 | Ga0207692_10123816 | Ga0207692_101238163 | 37 |
| 260 | 3300025900 | Ga0207710_10074914 | Ga0207710_100749143 | 37 |
| 261 | 3300025903 | Ga0207680_10011802 | Ga0207680_100118026 | 37 |
| 262 | 3300025903 | Ga0207680_11035760 | Ga0207680_110357601 | 37 |
| 263 | 3300025904 | Ga0207647_10529481 | Ga0207647_105294812 | 37 |
| 264 | 3300025905 | Ga0207685_10006968 | Ga0207685_100069683 | 37 |
| 265 | 3300025905 | Ga0207685_10013875 | Ga0207685_100138753 | 37 |
| 266 | 3300025906 | Ga0207699_10000308 | Ga0207699_1000030812 | 37 |
| 267 | 3300025906 | Ga0207699_10551424 | Ga0207699_105514242 | 37 |
| 268 | 3300025907 | Ga0207645_10521243 | Ga0207645_105212432 | 37 |
| 269 | 3300025908 | Ga0207643_10112955 | Ga0207643_101129552 | 37 |
| 270 | 3300025908 | Ga0207643_10327275 | Ga0207643_103272753 | 37 |
| 271 | 3300025908 | Ga0207643_10643446 | Ga0207643_106434462 | 37 |
| 272 | 3300025909 | Ga0207705_10004481 | Ga0207705_100044812 | 37 |
| 273 | 3300025909 | Ga0207705_10343948 | Ga0207705_103439482 | 37 |
| 274 | 3300025911 | Ga0207654_11104665 | Ga0207654_111046652 | 37 |
| 275 | 3300025912 | Ga0207707_10004838 | Ga0207707_1000483822 | 37 |
| 276 | 3300025913 | Ga0207695_10001345 | Ga0207695_1000134525 | 37 |
| 277 | 3300025913 | Ga0207695_10035918 | Ga0207695_100359183 | 37 |
| 278 | 3300025913 | Ga0207695_11224513 | Ga0207695_112245132 | 37 |
| 279 | 3300025914 | Ga0207671_10000012 | Ga0207671_10000012410 | 37 |
| 280 | 3300025914 | Ga0207671_10000714 | Ga0207671_1000071431 | 37 |
| 281 | 3300025914 | Ga0207671_10001558 | Ga0207671_100015584 | 37 |
| 282 | 3300025914 | Ga0207671_11434308 | Ga0207671_114343082 | 37 |
| 283 | 3300025915 | Ga0207693_10071595 | Ga0207693_100715953 | 37 |
| 284 | 3300025916 | Ga0207663_10011890 | Ga0207663_100118905 | 37 |
| 285 | 3300025916 | Ga0207663_11683548 | Ga0207663_116835482 | 37 |
| 286 | 3300025917 | Ga0207660_10086706 | Ga0207660_100867063 | 37 |
| 287 | 3300025918 | Ga0207662_10130416 | Ga0207662_101304163 | 37 |
| 288 | 3300025919 | Ga0207657_10047148 | Ga0207657_100471485 | 37 |
| 289 | 3300025919 | Ga0207657_10068489 | Ga0207657_100684892 | 37 |
| 290 | 3300025919 | Ga0207657_10132449 | Ga0207657_101324494 | 37 |
| 291 | 3300025921 | Ga0207652_10021342 | Ga0207652_1002134211 | 37 |
| 292 | 3300025921 | Ga0207652_10174103 | Ga0207652_101741034 | 37 |
| 293 | 3300025923 | Ga0207681_10031326 | Ga0207681_100313265 | 37 |
| 294 | 3300025923 | Ga0207681_11148537 | Ga0207681_111485372 | 37 |
| 295 | 3300025924 | Ga0207694_10000193 | Ga0207694_1000019354 | 37 |
| 296 | 3300025924 | Ga0207694_10022816 | Ga0207694_100228164 | 37 |
| 297 | 3300025924 | Ga0207694_10050367 | Ga0207694_100503673 | 37 |
| 298 | 3300025924 | Ga0207694_10057611 | Ga0207694_100576114 | 37 |
| 299 | 3300025924 | Ga0207694_10950533 | Ga0207694_109505332 | 37 |
| 300 | 3300025925 | Ga0207650_10094616 | Ga0207650_100946163 | 37 |
| 301 | 3300025925 | Ga0207650_11641402 | Ga0207650_116414021 | 37 |
| 302 | 3300025926 | Ga0207659_10338992 | Ga0207659_103389923 | 37 |
| 303 | 3300025926 | Ga0207659_10731023 | Ga0207659_107310232 | 37 |
| 304 | 3300025926 | Ga0207659_11171147 | Ga0207659_111711472 | 37 |
| 305 | 3300025927 | Ga0207687_10033278 | Ga0207687_100332784 | 37 |
| 306 | 3300025928 | Ga0207700_10000991 | Ga0207700_1000099117 | 37 |
| 307 | 3300025928 | Ga0207700_10189334 | Ga0207700_101893343 | 37 |
| 308 | 3300025928 | Ga0207700_11715757 | Ga0207700_117157572 | 37 |
| 309 | 3300025929 | Ga0207664_10020594 | Ga0207664_100205945 | 37 |
| 310 | 3300025929 | Ga0207664_10062641 | Ga0207664_100626414 | 37 |
| 311 | 3300025931 | Ga0207644_10003510 | Ga0207644_1000351017 | 37 |
| 312 | 3300025931 | Ga0207644_10561696 | Ga0207644_105616963 | 37 |
| 313 | 3300025932 | Ga0207690_11121402 | Ga0207690_111214022 | 37 |
| 314 | 3300025933 | Ga0207706_10121963 | Ga0207706_101219635 | 37 |
| 315 | 3300025933 | Ga0207706_10651079 | Ga0207706_106510792 | 37 |
| 316 | 3300025935 | Ga0207709_10211916 | Ga0207709_102119163 | 37 |
| 317 | 3300025935 | Ga0207709_10715725 | Ga0207709_107157253 | 37 |
| 318 | 3300025936 | Ga0207670_10070912 | Ga0207670_100709123 | 37 |
| 319 | 3300025936 | Ga0207670_10109669 | Ga0207670_101096693 | 37 |
| 320 | 3300025936 | Ga0207670_10713476 | Ga0207670_107134763 | 37 |
| 321 | 3300025937 | Ga0207669_10588982 | Ga0207669_105889822 | 37 |
| 322 | 3300025938 | Ga0207704_11214655 | Ga0207704_112146552 | 37 |
| 323 | 3300025939 | Ga0207665_11227829 | Ga0207665_112278292 | 37 |
| 324 | 3300025939 | Ga0207665_11432735 | Ga0207665_114327352 | 37 |
| 325 | 3300025940 | Ga0207691_10381119 | Ga0207691_103811192 | 37 |
| 326 | 3300025940 | Ga0207691_10475585 | Ga0207691_104755852 | 37 |
| 327 | 3300025941 | Ga0207711_10000448 | Ga0207711_100004486 | 37 |
| 328 | 3300025941 | Ga0207711_10247923 | Ga0207711_102479234 | 37 |
| 329 | 3300025941 | Ga0207711_10977861 | Ga0207711_109778611 | 37 |
| 330 | 3300025941 | Ga0207711_11597954 | Ga0207711_115979541 | 37 |
| 331 | 3300025941 | Ga0207711_11945258 | Ga0207711_119452581 | 37 |
| 332 | 3300025942 | Ga0207689_10072211 | Ga0207689_100722113 | 37 |
| 333 | 3300025942 | Ga0207689_10096116 | Ga0207689_100961164 | 37 |
| 334 | 3300025942 | Ga0207689_10328160 | Ga0207689_103281603 | 37 |
| 335 | 3300025945 | Ga0207679_10044249 | Ga0207679_100442493 | 37 |
| 336 | 3300025945 | Ga0207679_10118893 | Ga0207679_101188933 | 37 |
| 337 | 3300025949 | Ga0207667_10006290 | Ga0207667_100062905 | 37 |
| 338 | 3300025949 | Ga0207667_10093381 | Ga0207667_100933815 | 37 |
| 339 | 3300025949 | Ga0207667_10743225 | Ga0207667_107432252 | 37 |
| 340 | 3300025949 | Ga0207667_10938184 | Ga0207667_109381842 | 37 |
| 341 | 3300025960 | Ga0207651_10002125 | Ga0207651_1000212515 | 37 |
| 342 | 3300025960 | Ga0207651_10523101 | Ga0207651_105231013 | 37 |
| 343 | 3300025960 | Ga0207651_10699287 | Ga0207651_106992872 | 37 |
| 344 | 3300025960 | Ga0207651_11340986 | Ga0207651_113409863 | 37 |
| 345 | 3300025961 | Ga0207712_11053041 | Ga0207712_110530412 | 37 |
| 346 | 3300025961 | Ga0207712_11127522 | Ga0207712_111275222 | 37 |
| 347 | 3300025961 | Ga0207712_11374314 | Ga0207712_113743141 | 37 |
| 348 | 3300025972 | Ga0207668_10035020 | Ga0207668_100350203 | 37 |
| 349 | 3300025972 | Ga0207668_10078777 | Ga0207668_100787772 | 37 |
| 350 | 3300025972 | Ga0207668_10894439 | Ga0207668_108944392 | 37 |
| 351 | 3300025981 | Ga0207640_10011828 | Ga0207640_100118285 | 37 |
| 352 | 3300025981 | Ga0207640_11013612 | Ga0207640_110136122 | 37 |
| 353 | 3300025986 | Ga0207658_10082604 | Ga0207658_100826044 | 37 |
| 354 | 3300025986 | Ga0207658_10515890 | Ga0207658_105158903 | 37 |
| 355 | 3300025986 | Ga0207658_11091198 | Ga0207658_110911982 | 37 |
| 356 | 3300026023 | Ga0207677_10000253 | Ga0207677_100002533 | 37 |
| 357 | 3300026023 | Ga0207677_10136423 | Ga0207677_101364232 | 37 |
| 358 | 3300026035 | Ga0207703_10000517 | Ga0207703_1000051725 | 37 |
| 359 | 3300026035 | Ga0207703_10285608 | Ga0207703_102856083 | 37 |
| 360 | 3300026035 | Ga0207703_10334329 | Ga0207703_103343293 | 37 |
| 361 | 3300026035 | Ga0207703_11160314 | Ga0207703_111603141 | 37 |
| 362 | 3300026035 | Ga0207703_11172151 | Ga0207703_111721512 | 37 |
| 363 | 3300026041 | Ga0207639_10840560 | Ga0207639_108405602 | 37 |
| 364 | 3300026041 | Ga0207639_11515419 | Ga0207639_115154192 | 37 |
| 365 | 3300026041 | Ga0207639_11689583 | Ga0207639_116895832 | 37 |
| 366 | 3300026067 | Ga0207678_10647148 | Ga0207678_106471482 | 37 |
| 367 | 3300026075 | Ga0207708_10068366 | Ga0207708_100683663 | 37 |
| 368 | 3300026075 | Ga0207708_10203657 | Ga0207708_102036572 | 37 |
| 369 | 3300026075 | Ga0207708_10290653 | Ga0207708_102906533 | 37 |
| 370 | 3300026075 | Ga0207708_10655378 | Ga0207708_106553783 | 37 |
| 371 | 3300026075 | Ga0207708_11258390 | Ga0207708_112583903 | 37 |
| 372 | 3300026078 | Ga0207702_10117033 | Ga0207702_101170334 | 37 |
| 373 | 3300026078 | Ga0207702_10227221 | Ga0207702_102272213 | 37 |
| 374 | 3300026078 | Ga0207702_10687179 | Ga0207702_106871792 | 37 |
| 375 | 3300026089 | Ga0207648_10342134 | Ga0207648_103421343 | 37 |
| 376 | 3300026089 | Ga0207648_10400882 | Ga0207648_104008822 | 37 |
| 377 | 3300026089 | Ga0207648_10648555 | Ga0207648_106485553 | 37 |
| 378 | 3300026089 | Ga0207648_11335037 | Ga0207648_113350371 | 37 |
| 379 | 3300026095 | Ga0207676_10000167 | Ga0207676_1000016738 | 37 |
| 380 | 3300026095 | Ga0207676_10830472 | Ga0207676_108304723 | 37 |
| 381 | 3300026095 | Ga0207676_11616135 | Ga0207676_116161352 | 37 |
| 382 | 3300026116 | Ga0207674_10005520 | Ga0207674_1000552023 | 37 |
| 383 | 3300026116 | Ga0207674_10113606 | Ga0207674_101136063 | 37 |
| 384 | 3300026116 | Ga0207674_10120228 | Ga0207674_101202283 | 37 |
| 385 | 3300026116 | Ga0207674_11044975 | Ga0207674_110449752 | 37 |
| 386 | 3300026118 | Ga0207675_100150895 | Ga0207675_1001508952 | 37 |
| 387 | 3300026118 | Ga0207675_100688378 | Ga0207675_1006883783 | 37 |
| 388 | 3300026118 | Ga0207675_101132999 | Ga0207675_1011329991 | 37 |
| 389 | 3300026118 | Ga0207675_101816036 | Ga0207675_1018160361 | 37 |
| 390 | 3300026118 | Ga0207675_102572156 | Ga0207675_1025721561 | 37 |
| 391 | 3300026121 | Ga0207683_10000965 | Ga0207683_1000096521 | 37 |
| 392 | 3300026121 | Ga0207683_10440010 | Ga0207683_104400103 | 37 |
| 393 | 3300026121 | Ga0207683_10937359 | Ga0207683_109373593 | 37 |
| 394 | 3300026142 | Ga0207698_10025720 | Ga0207698_100257205 | 37 |
| 395 | 3300027111 | Ga0209281_1028607 | Ga0209281_10286072 | 37 |
| 396 | 3300027682 | Ga0209971_1105709 | Ga0209971_11057092 | 37 |
| 397 | 3300027695 | Ga0209966_1040538 | Ga0209966_10405382 | 37 |
| 398 | 3300027907 | Ga0207428_10044112 | Ga0207428_100441122 | 37 |
| 399 | 3300027907 | Ga0207428_10120599 | Ga0207428_101205992 | 37 |
| 400 | 3300027907 | Ga0207428_10591014 | Ga0207428_105910142 | 37 |
| 401 | 3300028379 | Ga0268266_10005004 | Ga0268266_1000500417 | 37 |
| 402 | 3300028379 | Ga0268266_10329216 | Ga0268266_103292162 | 37 |
| 403 | 3300028379 | Ga0268266_10644748 | Ga0268266_106447483 | 37 |
| 404 | 3300028379 | Ga0268266_11060310 | Ga0268266_110603102 | 37 |
| 405 | 3300028380 | Ga0268265_10141646 | Ga0268265_101416463 | 37 |
| 406 | 3300028380 | Ga0268265_10279504 | Ga0268265_102795043 | 37 |
| 407 | 3300028380 | Ga0268265_11494274 | Ga0268265_114942741 | 37 |
| 408 | 3300028380 | Ga0268265_12083714 | Ga0268265_120837142 | 37 |
| 409 | 3300028381 | Ga0268264_10096171 | Ga0268264_100961715 | 37 |
| 410 | 3300028381 | Ga0268264_10228753 | Ga0268264_102287533 | 37 |
| 411 | 3300028381 | Ga0268264_10306818 | Ga0268264_103068182 | 37 |
| 412 | 3300028381 | Ga0268264_11062254 | Ga0268264_110622542 | 37 |
| 413 | 3300028381 | Ga0268264_11274607 | Ga0268264_112746072 | 37 |
| 414 | 3300028558 | Ga0265326_10059715 | Ga0265326_100597153 | 37 |
| 415 | 3300028563 | Ga0265319_1021197 | Ga0265319_10211972 | 37 |
| 416 | 3300028573 | Ga0265334_10022641 | Ga0265334_100226413 | 37 |
| 417 | 3300028577 | Ga0265318_10000384 | Ga0265318_1000038433 | 37 |
| 418 | 3300028577 | Ga0265318_10019144 | Ga0265318_100191443 | 37 |
| 419 | 3300028653 | Ga0265323_10025795 | Ga0265323_100257954 | 37 |
| 420 | 3300028666 | Ga0265336_10043926 | Ga0265336_100439263 | 37 |
| 421 | 3300028794 | Ga0307515_10000015 | Ga0307515_10000015216 | 37 |
| 422 | 3300028800 | Ga0265338_10123565 | Ga0265338_101235654 | 37 |
| 423 | 3300029957 | Ga0265324_10111600 | Ga0265324_101116002 | 37 |
| 424 | 3300031235 | Ga0265330_10001669 | Ga0265330_1000166917 | 37 |
| 425 | 3300031235 | Ga0265330_10089801 | Ga0265330_100898012 | 37 |
| 426 | 3300031238 | Ga0265332_10002023 | Ga0265332_1000202321 | 37 |
| 427 | 3300031239 | Ga0265328_10001448 | Ga0265328_1000144811 | 37 |
| 428 | 3300031240 | Ga0265320_10004792 | Ga0265320_100047927 | 37 |
| 429 | 3300031241 | Ga0265325_10045951 | Ga0265325_100459513 | 37 |
| 430 | 3300031242 | Ga0265329_10000733 | Ga0265329_100007338 | 37 |
| 431 | 3300031249 | Ga0265339_10027395 | Ga0265339_100273955 | 37 |
| 432 | 3300031250 | Ga0265331_10001210 | Ga0265331_1000121012 | 37 |
| 433 | 3300031344 | Ga0265316_10013594 | Ga0265316_100135946 | 37 |
| 434 | 3300031344 | Ga0265316_10021674 | Ga0265316_100216749 | 37 |
| 435 | 3300031595 | Ga0265313_10098541 | Ga0265313_100985412 | 37 |
| 436 | 3300031665 | Ga0316575_10031569 | Ga0316575_100315692 | 37 |
| 437 | 3300031665 | Ga0316575_10247797 | Ga0316575_102477971 | 37 |
| 438 | 3300031691 | Ga0316579_10206015 | Ga0316579_102060152 | 37 |
| 439 | 3300031711 | Ga0265314_10015705 | Ga0265314_100157059 | 37 |
| 440 | 3300031711 | Ga0265314_10061333 | Ga0265314_100613332 | 37 |
| 441 | 3300031712 | Ga0265342_10002136 | Ga0265342_1000213625 | 37 |
| 442 | 3300031712 | Ga0265342_10008211 | Ga0265342_100082112 | 37 |
| 443 | 3300031727 | Ga0316576_10028305 | Ga0316576_100283052 | 37 |
| 444 | 3300031727 | Ga0316576_10029824 | Ga0316576_100298242 | 37 |
| 445 | 3300031727 | Ga0316576_10048859 | Ga0316576_100488591 | 37 |
| 446 | 3300031727 | Ga0316576_10322013 | Ga0316576_103220134 | 37 |
| 447 | 3300031727 | Ga0316576_11032611 | Ga0316576_110326111 | 37 |
| 448 | 3300031728 | Ga0316578_10004705 | Ga0316578_100047059 | 37 |
| 449 | 3300031728 | Ga0316578_10151550 | Ga0316578_101515503 | 37 |
| 450 | 3300031733 | Ga0316577_10001901 | Ga0316577_1000190116 | 37 |
| 451 | 3300031733 | Ga0316577_10077453 | Ga0316577_100774534 | 37 |
| 452 | 3300031824 | Ga0307413_11890328 | Ga0307413_118903282 | 37 |
| 453 | 3300031995 | Ga0307409_100222795 | Ga0307409_1002227953 | 37 |
| 454 | 3300032126 | Ga0307415_100734463 | Ga0307415_1007344632 | 37 |
| 455 | 3300032168 | Ga0316593_10001600 | Ga0316593_100016004 | 37 |
| 456 | 3300032168 | Ga0316593_10001816 | Ga0316593_1000181610 | 37 |
| 457 | 3300032168 | Ga0316593_10010408 | Ga0316593_100104082 | 37 |
| 458 | 3300032168 | Ga0316593_10015184 | Ga0316593_100151841 | 37 |
| 459 | 3300032168 | Ga0316593_10016431 | Ga0316593_100164313 | 37 |
| 460 | 3300032168 | Ga0316593_10057021 | Ga0316593_100570212 | 37 |
| 461 | 3300033529 | Ga0316587_1000999 | Ga0316587_10009992 | 37 |
| 462 | 3300033541 | Ga0316596_1000468 | Ga0316596_100046810 | 37 |
| 463 | 3300033541 | Ga0316596_1000731 | Ga0316596_10007316 | 37 |
| 464 | 3300033541 | Ga0316596_1000881 | Ga0316596_10008815 | 37 |
| 465 | 3300033541 | Ga0316596_1050135 | Ga0316596_10501353 | 37 |
| 466 | 3300034820 | Ga0373959_0167930 | Ga0373959_0167930_350_466 | 37 |
| 467 | 3300035086 | Ga0373934_0001385 | Ga0373934_0001385_5410_5523 | 37 |
| 468 | 3300035111 | Ga0373923_0047756 | Ga0373923_0047756_761_874 | 37 |
| 469 | 3300035111 | Ga0373923_0378272 | Ga0373923_0378272_341_454 | 37 |
| 470 | 3300035114 | Ga0373939_0398737 | Ga0373939_0398737_230_343 | 37 |
| 471 | 3300035114 | Ga0373939_0440593 | Ga0373939_0440593_68_184 | 37 |
| 472 | 3300035116 | Ga0373945_0054355 | Ga0373945_0054355_38_151 | 37 |
| 473 | 3300035118 | Ga0373954_0006676 | Ga0373954_0006676_4315_4428 | 37 |
| 474 | 3300035118 | Ga0373954_0205454 | Ga0373954_0205454_133_246 | 37 |
| 475 | 3300035118 | Ga0373954_0258927 | Ga0373954_0258927_406_519 | 37 |
| 476 | 3300035119 | Ga0373956_0071216 | Ga0373956_0071216_747_860 | 37 |
| 477 | 3300035120 | Ga0373957_0144986 | Ga0373957_0144986_59_172 | 37 |
| 478 | 3300035120 | Ga0373957_0191407 | Ga0373957_0191407_478_591 | 37 |
| 479 | 3300035120 | Ga0373957_0301913 | Ga0373957_0301913_393_506 | 37 |
| 480 | 3300035121 | Ga0373960_0245584 | Ga0373960_0245584_482_598 | 37 |
| 481 | 3300035170 | Ga0373943_0074897 | Ga0373943_0074897_631_744 | 37 |
| 482 | 3300035171 | Ga0373946_0025750 | Ga0373946_0025750_629_742 | 37 |
| 483 | 3300035172 | Ga0373955_0025147 | Ga0373955_0025147_2208_2321 | 37 |
| 484 | 3300035172 | Ga0373955_0043559 | Ga0373955_0043559_2209_2322 | 37 |
| 485 | 3300035398 | Ga0316574_0007731 | Ga0316574_0007731_3851_3967 | 37 |
| 486 | 3300035398 | Ga0316574_0008846 | Ga0316574_0008846_3652_3765 | 37 |
| 487 | 3300035398 | Ga0316574_0016945 | Ga0316574_0016945_3904_4020 | 37 |
| 488 | 3300035398 | Ga0316574_0133269 | Ga0316574_0133269_982_1095 | 37 |
| 489 | 3300035398 | Ga0316574_0162122 | Ga0316574_0162122_1042_1155 | 37 |
| 490 | 3300035398 | Ga0316574_0334063 | Ga0316574_0334063_838_951 | 37 |
| 491 | 3300035398 | Ga0316574_0400668 | Ga0316574_0400668_221_334 | 37 |
| 492 | 3300035410 | Ga0373924_0000835 | Ga0373924_0000835_5918_6031 | 37 |
| 493 | 3300035410 | Ga0373924_0221830 | Ga0373924_0221830_298_411 | 37 |
| 494 | 3300035692 | Ga0373935_0089342 | Ga0373935_0089342_455_568 | 37 |
| 495 | 3300035692 | Ga0373935_0542041 | Ga0373935_0542041_446_559 | 37 |
| 496 | 3300035695 | Ga0373927_0091323 | Ga0373927_0091323_623_736 | 37 |
| 497 | 3300035724 | Ga0373933_0025007 | Ga0373933_0025007_1231_1344 | 37 |
| 498 | 3300035724 | Ga0373933_0300637 | Ga0373933_0300637_712_825 | 37 |
| 499 | 3300035725 | Ga0373947_0008078 | Ga0373947_0008078_4703_4816 | 37 |
| 500 | 3300036401 | Ga0373937_0089730 | Ga0373937_0089730_2219_2332 | 37 |
| 501 | 3300036401 | Ga0373937_0382796 | Ga0373937_0382796_906_1019 | 37 |
| 502 | 3300036401 | Ga0373937_0518832 | Ga0373937_0518832_380_493 | 37 |
| 503 | 3300036401 | Ga0373937_0547322 | Ga0373937_0547322_204_317 | 37 |
| 504 | 3300036401 | Ga0373937_0763192 | Ga0373937_0763192_82_195 | 37 |
| 505 | 3300036401 | Ga0373937_0765285 | Ga0373937_0765285_393_506 | 37 |
| 506 | 3300036401 | Ga0373937_1438801 | Ga0373937_1438801_26_139 | 37 |
| 507 | 3300036401 | Ga0373937_1701606 | Ga0373937_1701606_369_482 | 37 |
| 508 | 3300036457 | Ga0265778_013571 | Ga0265778_013571_629_742 | 37 |
| 509 | 3300036647 | Ga0316582_0048063 | Ga0316582_0048063_2357_2470 | 37 |
| 510 | 3300036647 | Ga0316582_0089782 | Ga0316582_0089782_1011_1127 | 37 |
| 511 | 3300036647 | Ga0316582_0114600 | Ga0316582_0114600_339_452 | 37 |
| 512 | 3300036712 | Ga0316584_0017973 | Ga0316584_0017973_1789_1902 | 37 |
| 513 | 3300036712 | Ga0316584_0036925 | Ga0316584_0036925_1952_2068 | 37 |
| 514 | 3300036712 | Ga0316584_0037746 | Ga0316584_0037746_758_871 | 37 |
| 515 | 3300036712 | Ga0316584_0047025 | Ga0316584_0047025_337_453 | 37 |
| 516 | 3300036712 | Ga0316584_0420865 | Ga0316584_0420865_774_887 | 37 |
| 517 | 3300036712 | Ga0316584_0740546 | Ga0316584_0740546_442_555 | 37 |
| 518 | 3300037068 | Ga0373925_0002179 | Ga0373925_0002179_8623_8736 | 37 |
| 519 | 3300037068 | Ga0373925_0325801 | Ga0373925_0325801_132_245 | 37 |
| 520 | 3300037068 | Ga0373925_0847398 | Ga0373925_0847398_125_238 | 37 |
| 521 | 3300037068 | Ga0373925_1081285 | Ga0373925_1081285_431_544 | 37 |
| 522 | 3300037068 | Ga0373925_1650948 | Ga0373925_1650948_396_509 | 37 |
| 523 | 3300037312 | Ga0395899_0005268 | Ga0395899_0005268_3356_3469 | 37 |
| 524 | 3300037312 | Ga0395899_0673616 | Ga0395899_0673616_59_172 | 37 |
| 525 | 3300037418 | Ga0395900_0011458 | Ga0395900_0011458_1588_1701 | 37 |
| 526 | 3300037418 | Ga0395900_0375400 | Ga0395900_0375400_998_1111 | 37 |
| 527 | 3300037418 | Ga0395900_1628004 | Ga0395900_1628004_243_356 | 37 |
| 528 | 3300037466 | Ga0395898_0105030 | Ga0395898_0105030_1463_1576 | 37 |
| 529 | 3300037471 | Ga0395905_0000127 | Ga0395905_0000127_41630_41743 | 37 |
| 530 | 3300037471 | Ga0395905_0000938 | Ga0395905_0000938_16154_16267 | 37 |
| 531 | 3300037588 | Ga0316581_0054133 | Ga0316581_0054133_996_1109 | 37 |
| 532 | 3300037853 | Ga0436364_0945409 | Ga0436364_0945409_19969_20082 | 37 |
| 533 | 3300038725 | Ga0400484_27221 | Ga0400484_27221_7694_7807 | 37 |
| 534 | 3300038725 | Ga0400484_44058 | Ga0400484_44058_7800_7913 | 37 |
| 535 | 3300038726 | Ga0400490_00204 | Ga0400490_00204_1644_1757 | 37 |
| 536 | 3300038726 | Ga0400490_00437 | Ga0400490_00437_10627_10740 | 37 |
| 537 | 3300038726 | Ga0400490_07011 | Ga0400490_07011_5141_5254 | 37 |
| 538 | 3300038726 | Ga0400490_07361 | Ga0400490_07361_11452_11565 | 37 |
| 539 | 3300038726 | Ga0400490_39901 | Ga0400490_39901_10716_10829 | 37 |
| 540 | 3300038726 | Ga0400490_57192 | Ga0400490_57192_1052_1165 | 37 |
| 541 | 3300038727 | Ga0400491_00552 | Ga0400491_00552_1517_1630 | 37 |
| 542 | 3300038727 | Ga0400491_01651 | Ga0400491_01651_1143_1256 | 37 |
| 543 | 3300038727 | Ga0400491_18291 | Ga0400491_18291_20_133 | 37 |
| 544 | 3300038735 | Ga0400485_09439 | Ga0400485_09439_2203_2316 | 37 |
| 545 | 3300038735 | Ga0400485_11168 | Ga0400485_11168_1692_1805 | 37 |
| 546 | 3300038735 | Ga0400485_11310 | Ga0400485_11310_1053_1166 | 37 |
| 547 | 3300038735 | Ga0400485_19181 | Ga0400485_19181_44359_44472 | 37 |
| 548 | 3300038741 | Ga0400488_06448 | Ga0400488_06448_2146_2259 | 37 |
| 549 | 3300038741 | Ga0400488_07418 | Ga0400488_07418_2968_3081 | 37 |
| 550 | 3300038741 | Ga0400488_12334 | Ga0400488_12334_4153_4266 | 37 |
| 551 | 3300038741 | Ga0400488_32083 | Ga0400488_32083_2214_2327 | 37 |
| 552 | 3300038741 | Ga0400488_40771 | Ga0400488_40771_535_648 | 37 |
| 553 | 3300038741 | Ga0400488_43096 | Ga0400488_43096_1458_1571 | 37 |
| 554 | 3300038741 | Ga0400488_48044 | Ga0400488_48044_349_462 | 37 |
| 555 | 3300038741 | Ga0400488_51157 | Ga0400488_51157_4262_4375 | 37 |
| 556 | 3300038742 | Ga0400486_01341 | Ga0400486_01341_4404_4517 | 37 |
| 557 | 3300038742 | Ga0400486_05487 | Ga0400486_05487_978_1091 | 37 |
| 558 | 3300038742 | Ga0400486_18812 | Ga0400486_18812_650_763 | 37 |
| 559 | 3300038742 | Ga0400486_25543 | Ga0400486_25543_46938_47051 | 37 |
| 560 | 3300038742 | Ga0400486_25694 | Ga0400486_25694_3487_3600 | 37 |
| 561 | 3300039062 | Ga0400483_020927 | Ga0400483_020927_70_183 | 37 |
| 562 | 3300039062 | Ga0400483_027826 | Ga0400483_027826_458_571 | 37 |
| 563 | 3300039062 | Ga0400483_094874 | Ga0400483_094874_1790_1903 | 37 |
| 564 | 3300039062 | Ga0400483_140144 | Ga0400483_140144_11273_11386 | 37 |
| 565 | 3300039062 | Ga0400483_151841 | Ga0400483_151841_599_712 | 37 |
| 566 | 3300039062 | Ga0400483_233637 | Ga0400483_233637_5479_5592 | 37 |
| 567 | 3300039062 | Ga0400483_256259 | Ga0400483_256259_578_691 | 37 |
| 568 | 3300039093 | Ga0400489_14975 | Ga0400489_14975_895_1008 | 37 |
| 569 | 3300039093 | Ga0400489_50866 | Ga0400489_50866_99_212 | 37 |
| 570 | 3300039110 | Ga0400487_00070 | Ga0400487_00070_1923_2036 | 37 |
| 571 | 3300039110 | Ga0400487_06498 | Ga0400487_06498_2898_3011 | 37 |
| 572 | 3300039110 | Ga0400487_29008 | Ga0400487_29008_10656_10769 | 37 |
| 573 | 3300039110 | Ga0400487_33555 | Ga0400487_33555_64262_64375 | 37 |
| 574 | 3300039110 | Ga0400487_34004 | Ga0400487_34004_1048_1161 | 37 |
| 575 | 3300039110 | Ga0400487_58155 | Ga0400487_58155_5019_5132 | 37 |
| 576 | 3300039110 | Ga0400487_60113 | Ga0400487_60113_2286_2399 | 37 |
| 577 | 3300039437 | Ga0436365_1189349 | Ga0436365_1189349_67_180 | 37 |
| 578 | 3300039437 | Ga0436365_1396723 | Ga0436365_1396723_66_179 | 37 |
| 579 | 3300039447 | Ga0436361_0391791 | Ga0436361_0391791_11398_11511 | 37 |
| 580 | 3300041408 | Ga0439453_0021918 | Ga0439453_0021918_732_845 | 37 |
| 581 | 3300041456 | Ga0451795_1180726 | Ga0451795_1180726_259_372 | 37 |
| 582 | 3300041486 | Ga0451807_0006965 | Ga0451807_0006965_854_967 | 37 |
| 583 | 3300042125 | Ga0450923_038197 | Ga0450923_038197_733_846 | 37 |
| 584 | 3300042128 | Ga0450897_018808 | Ga0450897_018808_425_538 | 37 |
| 585 | 3300042131 | Ga0450894_002033 | Ga0450894_002033_1550_1663 | 37 |
| 586 | 3300042133 | Ga0450896_005414 | Ga0450896_005414_1575_1688 | 37 |
| 587 | 3300042133 | Ga0450896_037702 | Ga0450896_037702_454_567 | 37 |
| 588 | 3300042145 | Ga0450906_009432 | Ga0450906_009432_289_402 | 37 |
| 589 | 3300042184 | Ga0450908_020484 | Ga0450908_020484_490_603 | 37 |
| 590 | 3300042435 | Ga0439434_0133237 | Ga0439434_0133237_634_747 | 37 |
| 591 | 3300042436 | Ga0439435_0153989 | Ga0439435_0153989_586_699 | 37 |
| 592 | 3300042436 | Ga0439435_0195376 | Ga0439435_0195376_515_628 | 37 |
| 593 | 3300042876 | Ga0451577_0000016 | Ga0451577_0000016_446521_446637 | 37 |
| 594 | 3300042876 | Ga0451577_0000337 | Ga0451577_0000337_82525_82638 | 37 |
| 595 | 3300042876 | Ga0451577_0083369 | Ga0451577_0083369_1055_1168 | 37 |
| 596 | 3300042876 | Ga0451577_0129292 | Ga0451577_0129292_495_608 | 37 |
| 597 | 3300042876 | Ga0451577_0160056 | Ga0451577_0160056_409_522 | 37 |
| 598 | 3300042876 | Ga0451577_0417431 | Ga0451577_0417431_440_556 | 37 |
| 599 | 3300042876 | Ga0451577_1789191 | Ga0451577_1789191_413_526 | 37 |
| 600 | 3300044673 | Ga0453683_0017367 | Ga0453683_0017367_2410_2523 | 37 |
| 601 | 3300044673 | Ga0453683_0036858 | Ga0453683_0036858_2596_2709 | 37 |
| 602 | 3300044673 | Ga0453683_0043820 | Ga0453683_0043820_1779_1892 | 37 |
| 603 | 3300044673 | Ga0453683_0270063 | Ga0453683_0270063_519_683 | 37 |
| 604 | 3300044673 | Ga0453683_0423433 | Ga0453683_0423433_279_392 | 37 |
| 605 | 3300044673 | Ga0453683_0866875 | Ga0453683_0866875_307_441 | 37 |
| 606 | 3300044693 | Ga0466961_0460957 | Ga0466961_0460957_553_666 | 37 |
| 607 | 3300044712 | Ga0453684_0000197 | Ga0453684_0000197_123053_123166 | 37 |
| 608 | 3300044712 | Ga0453684_0020865 | Ga0453684_0020865_7425_7538 | 37 |
| 609 | 3300044712 | Ga0453684_0041859 | Ga0453684_0041859_3782_3895 | 37 |
| 610 | 3300044712 | Ga0453684_0072448 | Ga0453684_0072448_2754_2867 | 37 |
| 611 | 3300044712 | Ga0453684_0282064 | Ga0453684_0282064_919_1032 | 37 |
| 612 | 3300044712 | Ga0453684_0476020 | Ga0453684_0476020_1117_1230 | 37 |
| 613 | 3300044712 | Ga0453684_0769933 | Ga0453684_0769933_633_746 | 37 |
| 614 | 3300044712 | Ga0453684_1478571 | Ga0453684_1478571_92_205 | 37 |
| 615 | 3300044712 | Ga0453684_1597238 | Ga0453684_1597238_262_375 | 37 |
| 616 | 3300045049 | Ga0466959_1178671 | Ga0466959_1178671_372_485 | 37 |
| 617 | 3300045051 | Ga0451576_0000971 | Ga0451576_0000971_13896_14009 | 37 |
| 618 | 3300045051 | Ga0451576_0032619 | Ga0451576_0032619_3376_3489 | 37 |
| 619 | 3300045051 | Ga0451576_0141552 | Ga0451576_0141552_2330_2443 | 37 |
| 620 | 3300045051 | Ga0451576_0236352 | Ga0451576_0236352_1108_1224 | 37 |
| 621 | 3300045051 | Ga0451576_1292967 | Ga0451576_1292967_162_275 | 37 |
| 622 | 3300045051 | Ga0451576_1942103 | Ga0451576_1942103_370_483 | 37 |
| 623 | 3300045976 | Ga0466967_1730035 | Ga0466967_1730035_59_175 | 37 |
| 624 | 3300045976 | Ga0466967_2166614 | Ga0466967_2166614_404_520 | 37 |
| 625 | 3300046455 | Ga0495603_0042618 | Ga0495603_0042618_353_466 | 37 |
| 626 | 3300046455 | Ga0495603_0335295 | Ga0495603_0335295_684_797 | 37 |
| 627 | 3300046459 | Ga0495629_0000007 | Ga0495629_0000007_292352_292465 | 37 |
| 628 | 3300046459 | Ga0495629_0000126 | Ga0495629_0000126_58738_58851 | 37 |
| 629 | 3300046459 | Ga0495629_0017893 | Ga0495629_0017893_995_1108 | 37 |
| 630 | 3300046472 | Ga0495580_0222402 | Ga0495580_0222402_279_392 | 37 |
| 631 | 3300046473 | Ga0495582_0021576 | Ga0495582_0021576_54_167 | 37 |
| 632 | 3300046473 | Ga0495582_0034213 | Ga0495582_0034213_1882_1995 | 37 |
| 633 | 3300046475 | Ga0495639_0000121 | Ga0495639_0000121_10200_10313 | 37 |
| 634 | 3300046475 | Ga0495639_0002018 | Ga0495639_0002018_3796_3909 | 37 |
| 635 | 3300046475 | Ga0495639_0012434 | Ga0495639_0012434_1066_1179 | 37 |
| 636 | 3300046476 | Ga0495662_0015298 | Ga0495662_0015298_2364_2477 | 37 |
| 637 | 3300046476 | Ga0495662_0484051 | Ga0495662_0484051_344_457 | 37 |
| 638 | 3300046477 | Ga0495664_0072557 | Ga0495664_0072557_344_457 | 37 |
| 639 | 3300046477 | Ga0495664_0127669 | Ga0495664_0127669_638_751 | 37 |
| 640 | 3300046499 | Ga0495594_0009365 | Ga0495594_0009365_2372_2485 | 37 |
| 641 | 3300046499 | Ga0495594_0048874 | Ga0495594_0048874_370_483 | 37 |
| 642 | 3300046499 | Ga0495594_0285119 | Ga0495594_0285119_692_805 | 37 |
| 643 | 3300046511 | Ga0495608_0179275 | Ga0495608_0179275_796_909 | 37 |
| 644 | 3300046514 | Ga0495618_0313472 | Ga0495618_0313472_309_422 | 37 |
| 645 | 3300046525 | Ga0495663_0364184 | Ga0495663_0364184_28_141 | 37 |
| 646 | 3300046533 | Ga0495640_0229383 | Ga0495640_0229383_98_211 | 37 |
| 647 | 3300046533 | Ga0495640_0263194 | Ga0495640_0263194_912_1025 | 37 |
| 648 | 3300046533 | Ga0495640_0636877 | Ga0495640_0636877_31_144 | 37 |
| 649 | 3300046535 | Ga0495586_0000999 | Ga0495586_0000999_1501_1614 | 37 |
| 650 | 3300046535 | Ga0495586_0012323 | Ga0495586_0012323_4353_4466 | 37 |
| 651 | 3300046535 | Ga0495586_0395426 | Ga0495586_0395426_200_313 | 37 |
| 652 | 3300046536 | Ga0495587_0174480 | Ga0495587_0174480_455_568 | 37 |
| 653 | 3300046536 | Ga0495587_0180077 | Ga0495587_0180077_199_312 | 37 |
| 654 | 3300046543 | Ga0495645_0135186 | Ga0495645_0135186_1080_1193 | 37 |
| 655 | 3300046557 | Ga0495622_0002685 | Ga0495622_0002685_424_537 | 37 |
| 656 | 3300046557 | Ga0495622_0023394 | Ga0495622_0023394_2270_2383 | 37 |
| 657 | 3300046558 | Ga0495633_0308991 | Ga0495633_0308991_248_361 | 37 |
| 658 | 3300046642 | Ga0495634_0024544 | Ga0495634_0024544_1693_1806 | 37 |
| 659 | 3300046663 | Ga0495635_0001790 | Ga0495635_0001790_2391_2504 | 37 |
| 660 | 3300046663 | Ga0495635_0575039 | Ga0495635_0575039_185_298 | 37 |
| 661 | 3300046663 | Ga0495635_0911189 | Ga0495635_0911189_58_171 | 37 |
| 662 | 3300046674 | Ga0495588_0135487 | Ga0495588_0135487_545_658 | 37 |
| 663 | 3300046675 | Ga0495657_0373443 | Ga0495657_0373443_413_526 | 37 |
| 664 | 3300046679 | Ga0495623_0119350 | Ga0495623_0119350_647_760 | 37 |
| 665 | 3300046681 | Ga0495647_0001519 | Ga0495647_0001519_5880_5993 | 37 |
| 666 | 3300046681 | Ga0495647_0173245 | Ga0495647_0173245_389_502 | 37 |
| 667 | 3300046681 | Ga0495647_0545141 | Ga0495647_0545141_322_435 | 37 |
| 668 | 3300046683 | Ga0495658_0000327 | Ga0495658_0000327_12846_12959 | 37 |
| 669 | 3300046683 | Ga0495658_0004909 | Ga0495658_0004909_4558_4671 | 37 |
| 670 | 3300046683 | Ga0495658_0007921 | Ga0495658_0007921_649_762 | 37 |
| 671 | 3300046683 | Ga0495658_0900299 | Ga0495658_0900299_295_408 | 37 |
| 672 | 3300046689 | Ga0495613_0025308 | Ga0495613_0025308_1767_1880 | 37 |
| 673 | 3300047315 | Ga0495581_0000280 | Ga0495581_0000280_16046_16159 | 37 |
| 674 | 3300047315 | Ga0495581_0005862 | Ga0495581_0005862_6233_6346 | 37 |
| 675 | 3300047315 | Ga0495581_0193636 | Ga0495581_0193636_713_826 | 37 |
| 676 | 3300047317 | Ga0495604_0064977 | Ga0495604_0064977_247_360 | 37 |
| 677 | 3300047319 | Ga0495674_0070838 | Ga0495674_0070838_1068_1181 | 37 |
| 678 | 3300047321 | Ga0495676_0020676 | Ga0495676_0020676_3048_3161 | 37 |
| 679 | 3300047321 | Ga0495676_0040130 | Ga0495676_0040130_2561_2674 | 37 |
| 680 | 3300047321 | Ga0495676_0073506 | Ga0495676_0073506_874_987 | 37 |
| 681 | 3300047322 | Ga0495680_0000838 | Ga0495680_0000838_15566_15679 | 37 |
| 682 | 3300047322 | Ga0495680_0100618 | Ga0495680_0100618_1138_1251 | 37 |
| 683 | 3300047322 | Ga0495680_0186512 | Ga0495680_0186512_1338_1451 | 37 |
| 684 | 3300047471 | Ga0495684_0284558 | Ga0495684_0284558_771_884 | 37 |
| 685 | 3300047471 | Ga0495684_0752522 | Ga0495684_0752522_409_522 | 37 |
| 686 | 3300047472 | Ga0495686_0000545 | Ga0495686_0000545_17371_17484 | 37 |
| 687 | 3300047472 | Ga0495686_0012883 | Ga0495686_0012883_4584_4697 | 37 |
| 688 | 3300047673 | Ga0495593_0365057 | Ga0495593_0365057_367_480 | 37 |
| 689 | 3300048089 | Ga0495614_0111480 | Ga0495614_0111480_808_921 | 37 |
| 690 | 3300048903 | Ga0496100_0178098 | Ga0496100_0178098_574_687 | 37 |
| 691 | 3300048903 | Ga0496100_0663363 | Ga0496100_0663363_57_173 | 37 |
| 692 | 3300048905 | Ga0496102_1871623 | Ga0496102_1871623_68_184 | 37 |
| 693 | 3300048907 | Ga0496104_0000247 | Ga0496104_0000247_39728_39841 | 37 |
| 694 | 3300048907 | Ga0496104_0015885 | Ga0496104_0015885_5754_5867 | 37 |
| 695 | 3300048907 | Ga0496104_1098513 | Ga0496104_1098513_486_599 | 37 |
| 696 | 3300048908 | Ga0496105_0230741 | Ga0496105_0230741_769_882 | 37 |
| 697 | 3300048909 | Ga0496106_0227535 | Ga0496106_0227535_980_1093 | 37 |
| 698 | 3300048909 | Ga0496106_0396429 | Ga0496106_0396429_207_323 | 37 |
| 699 | 3300048910 | Ga0496107_0132708 | Ga0496107_0132708_823_936 | 37 |
| 700 | 3300048910 | Ga0496107_0808018 | Ga0496107_0808018_226_342 | 37 |
| 701 | 3300048914 | Ga0496111_0586178 | Ga0496111_0586178_127_240 | 37 |
| 702 | 3300048915 | Ga0496112_0001041 | Ga0496112_0001041_19996_20109 | 37 |
| 703 | 3300048916 | Ga0496113_1126530 | Ga0496113_1126530_133_249 | 37 |
| 704 | 3300048917 | Ga0496114_0140121 | Ga0496114_0140121_637_750 | 37 |
| 705 | 3300048929 | Ga0496126_0000005 | Ga0496126_0000005_868611_868724 | 37 |
| 706 | 3300049570 | Ga0501033_0151291 | Ga0501033_0151291_533_646 | 37 |
| 707 | 3300049570 | Ga0501033_0755402 | Ga0501033_0755402_28_141 | 37 |
| 708 | 3300049571 | Ga0501034_0054360 | Ga0501034_0054360_1360_1476 | 37 |
| 709 | 3300049571 | Ga0501034_0062111 | Ga0501034_0062111_2156_2269 | 37 |
| 710 | 3300049572 | Ga0501036_0485778 | Ga0501036_0485778_806_919 | 37 |
| 711 | 3300049572 | Ga0501036_0493094 | Ga0501036_0493094_838_951 | 37 |
| 712 | 3300049575 | Ga0501039_0863844 | Ga0501039_0863844_235_348 | 37 |
| 713 | 3300049575 | Ga0501039_1239915 | Ga0501039_1239915_153_266 | 37 |
| 714 | 3300049578 | Ga0501042_1443808 | Ga0501042_1443808_348_461 | 37 |
| 715 | 3300049579 | Ga0501043_0331939 | Ga0501043_0331939_810_926 | 37 |
| 716 | 3300049579 | Ga0501043_0980992 | Ga0501043_0980992_334_447 | 37 |
| 717 | 3300049580 | Ga0501046_0165569 | Ga0501046_0165569_1447_1560 | 37 |
| 718 | 3300049581 | Ga0501047_0085715 | Ga0501047_0085715_1785_1898 | 37 |
| 719 | 3300049583 | Ga0501067_0098292 | Ga0501067_0098292_495_611 | 37 |
| 720 | 3300049586 | Ga0501070_0634044 | Ga0501070_0634044_571_684 | 37 |
| 721 | 3300049587 | Ga0501071_0349175 | Ga0501071_0349175_748_861 | 37 |
| 722 | 3300049587 | Ga0501071_0711056 | Ga0501071_0711056_283_396 | 37 |
| 723 | 3300049588 | Ga0501072_1389825 | Ga0501072_1389825_416_529 | 37 |
| 724 | 3300049592 | Ga0501076_0646894 | Ga0501076_0646894_36_149 | 37 |
| 725 | 3300049741 | Ga0501079_0177238 | Ga0501079_0177238_684_797 | 37 |
| 726 | 3300049743 | Ga0501081_0365489 | Ga0501081_0365489_913_1026 | 37 |
| 727 | 3300049822 | Ga0501035_0388799 | Ga0501035_0388799_949_1062 | 37 |
| 728 | 3300049822 | Ga0501035_1346473 | Ga0501035_1346473_423_536 | 37 |
| 729 | 3300049823 | Ga0501044_0008030 | Ga0501044_0008030_68_181 | 37 |
| 730 | 3300050507 | nmdc:mga05p37_181505_c1 | nmdc:mga05p37_181505_c1_1498_1611 | 37 |
| 731 | 3300050507 | nmdc:mga05p37_229395_c1 | nmdc:mga05p37_229395_c1_1252_1365 | 37 |
| 732 | 3300050507 | nmdc:mga05p37_306274_c2 | nmdc:mga05p37_306274_c2_1357_1470 | 37 |
| 733 | 3300050508 | nmdc:mga09592_29654_c1 | nmdc:mga09592_29654_c1_560_688 | 37 |
| 734 | 3300050508 | nmdc:mga09592_322011_c1 | nmdc:mga09592_322011_c1_958_1071 | 37 |
| 735 | 3300050509 | nmdc:mga0qj67_645336_c1 | nmdc:mga0qj67_645336_c1_22_135 | 37 |
| 736 | 3300050510 | nmdc:mga06r32_381565_c1 | nmdc:mga06r32_381565_c1_397_510 | 37 |
| 737 | 3300050511 | nmdc:mga08y16_140994_c1 | nmdc:mga08y16_140994_c1_417_530 | 37 |
| 738 | 3300050511 | nmdc:mga08y16_175843_c1 | nmdc:mga08y16_175843_c1_1883_1996 | 37 |
| 739 | 3300050511 | nmdc:mga08y16_1791006_c1 | nmdc:mga08y16_1791006_c1_341_454 | 37 |
| 740 | 3300050511 | nmdc:mga08y16_8355_c1 | nmdc:mga08y16_8355_c1_2059_2172 | 37 |
| 741 | 3300050512 | nmdc:mga0n895_108823_c1 | nmdc:mga0n895_108823_c1_1960_2076 | 37 |
| 742 | 3300050512 | nmdc:mga0n895_203675_c1 | nmdc:mga0n895_203675_c1_1225_1338 | 37 |
| 743 | 3300050513 | nmdc:mga0rr50_771801_c1 | nmdc:mga0rr50_771801_c1_302_418 | 37 |
| 744 | 3300050513 | nmdc:mga0rr50_80996_c1 | nmdc:mga0rr50_80996_c1_2069_2182 | 37 |
| 745 | 3300053077 | Ga0495601_0088500 | Ga0495601_0088500_495_608 | 37 |
| 746 | 3300053078 | Ga0495612_0084920 | Ga0495612_0084920_746_859 | 37 |
| 747 | 3300053085 | Ga0495619_0001327 | Ga0495619_0001327_7543_7656 | 37 |
| 748 | 3300053085 | Ga0495619_0149576 | Ga0495619_0149576_538_651 | 37 |
| 749 | 3300053094 | Ga0500566_0008539 | Ga0500566_0008539_2738_2851 | 37 |
| 750 | 3300054114 | Ga0501084_0244436 | Ga0501084_0244436_1096_1209 | 37 |
| 751 | 3300059478 | Ga0587093_062454 | Ga0587093_062454_345_458 | 37 |
| 752 | 3300059490 | Ga0587066_053876 | Ga0587066_053876_534_647 | 37 |
| 753 | 3300059490 | Ga0587066_185908 | Ga0587066_185908_84_200 | 37 |
| 754 | 3300059491 | Ga0587070_064310 | Ga0587070_064310_516_629 | 37 |
| 755 | 3300059491 | Ga0587070_125664 | Ga0587070_125664_375_488 | 37 |
| 756 | 3300059493 | Ga0587077_009783 | Ga0587077_009783_223_336 | 37 |
| 757 | 3300059504 | Ga0587082_075400 | Ga0587082_075400_451_564 | 37 |
| 758 | 3300059506 | Ga0587085_020207 | Ga0587085_020207_349_462 | 37 |
| 759 | 3300059508 | Ga0587088_021186 | Ga0587088_021186_912_1025 | 37 |
| 760 | 3300059510 | Ga0587090_084712 | Ga0587090_084712_492_608 | 37 |
| 761 | 3300059622 | Ga0587099_024032 | Ga0587099_024032_537_650 | 37 |
| 762 | 3300059642 | Ga0587069_051252 | Ga0587069_051252_52_165 | 37 |
| 763 | 3300059645 | Ga0587076_117509 | Ga0587076_117509_373_486 | 37 |
| 764 | 3300059647 | Ga0587079_116296 | Ga0587079_116296_444_557 | 37 |
| 765 | 3300059648 | Ga0587100_012481 | Ga0587100_012481_510_623 | 37 |
| 766 | 3300059652 | Ga0587107_107382 | Ga0587107_107382_78_191 | 37 |
| 767 | 3300059658 | Ga0587119_080205 | Ga0587119_080205_148_261 | 37 |
| 768 | 3300060346 | Ga0587111_0063663 | Ga0587111_0063663_340_453 | 37 |
| 769 | 3300060353 | Ga0501082_0470562 | Ga0501082_0470562_316_429 | 37 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar