F480000

General Info

Members Datasets Scaffolds Average Seq Length
769 367 738 37

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0866875|Ga0453683_0866875_307_441
Length 44
Sequence MEPQGEPVKVRTSVKKICDKCKVIKRNGIVRIICENPKHKQKQG

Samples

Sample ID Description Type Environment
1 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
6 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
7 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
8 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
9 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
10 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
11 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
12 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
13 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
14 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
15 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
16 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
17 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
18 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
19 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
20 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
21 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
22 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
23 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
24 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
25 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
26 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
27 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
28 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
29 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
30 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
104 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
185 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
186 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
187 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
188 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
189 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
204 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
208 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
209 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
224 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
237 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
246 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
247 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
248 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
249 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
250 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
251 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
252 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
253 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
257 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
258 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
259 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
260 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
261 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
262 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
263 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
264 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
265 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
266 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
284 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
366 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
367 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.91
Metatranscriptomes 8.06
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.3
Nodule 0.65
Rhizoplane 2.34
Rhizosphere 87.26
Stem 0
Stem Tuber 0
Unclassified 8.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10177453 3300001990 Bacteria 629
2 JGI24735J21928_10011983 3300002067 Bacteria 2743
3 Ga0068868_102068432 3300005338 Bacteria 541
4 Ga0070660_100066916 3300005339 Bacteria 2798
5 Ga0070672_100082364 3300005543 Bacteria 2581
6 Ga0070672_100120557 3300005543 Bacteria 2146
7 Ga0070672_100136941 3300005543 Bacteria 2017
8 Ga0070672_100361221 3300005543 Bacteria 1239
9 Ga0070672_101022531 3300005543 Bacteria 733
10 Ga0070665_100005852 3300005548 Bacteria 12613
11 Ga0070665_100533295 3300005548 Bacteria 1186
12 Ga0070665_101743623 3300005548 Bacteria 630
13 Ga0068855_100051467 3300005563 Bacteria 4851
14 Ga0068855_100646242 3300005563 Bacteria 1136
15 Ga0068855_101043625 3300005563 Bacteria 857
16 Ga0068855_101653194 3300005563 Bacteria 654
17 Ga0070664_100053940 3300005564 Bacteria 3410
18 Ga0070664_100575500 3300005564 Bacteria 1043
19 Ga0068857_100012717 3300005577 Bacteria 7336
20 Ga0068857_100336166 3300005577 Bacteria 1397
21 Ga0068857_100677378 3300005577 Bacteria 979
22 Ga0068857_101088557 3300005577 Bacteria 771
23 Ga0068854_100007372 3300005578 Bacteria 7030
24 Ga0068854_100161965 3300005578 Bacteria 1733
25 Ga0068854_100353795 3300005578 Bacteria 1203
26 Ga0068856_100032828 3300005614 Bacteria 5083
27 Ga0068856_100046027 3300005614 Bacteria 4297
28 Ga0068856_100095580 3300005614 Bacteria 2959
29 Ga0068856_100179201 3300005614 Bacteria 2132
30 Ga0068856_100887446 3300005614 Bacteria 910
31 Ga0068856_102014232 3300005614 Bacteria 588
32 Ga0068852_100724171 3300005616 Bacteria 1006
33 Ga0068852_101256952 3300005616 Bacteria 762
34 Ga0068859_100006170 3300005617 Bacteria 12179
35 Ga0068859_100015861 3300005617 Bacteria 7571
36 Ga0068859_100051052 3300005617 Bacteria 4156
37 Ga0068859_100307316 3300005617 Bacteria 1679
38 Ga0068859_102207301 3300005617 Bacteria 607
39 Ga0068864_100003967 3300005618 Bacteria 12179
40 Ga0068866_10660196 3300005718 Bacteria 713
41 Ga0068861_100084611 3300005719 Bacteria 2490
42 Ga0068861_100470617 3300005719 Bacteria 1130
43 Ga0068861_100515831 3300005719 Bacteria 1083
44 Ga0068861_100711034 3300005719 Bacteria 934
45 Ga0068861_100815600 3300005719 Unclassified 877
46 Ga0068861_102631146 3300005719 Bacteria 507
47 Ga0068851_10001517 3300005834 Bacteria 10195
48 Ga0068851_10021382 3300005834 Bacteria 3141
49 Ga0068851_10153838 3300005834 Bacteria 1259
50 Ga0068851_10939121 3300005834 Bacteria 543
51 Ga0068870_10229071 3300005840 Bacteria 1141
52 Ga0068870_10810343 3300005840 Bacteria 655
53 Ga0068863_100002985 3300005841 Bacteria 16732
54 Ga0068863_100648692 3300005841 Bacteria 1047
55 Ga0068863_101189063 3300005841 Bacteria 768
56 Ga0068858_100014524 3300005842 Bacteria 7419
57 Ga0068858_100210863 3300005842 Bacteria 1838
58 Ga0068858_100246290 3300005842 Bacteria 1697
59 Ga0068858_100350110 3300005842 Bacteria 1415
60 Ga0068858_100476591 3300005842 Bacteria 1204
61 Ga0068858_101512403 3300005842 Bacteria 662
62 Ga0068860_100039390 3300005843 Bacteria 4520
63 Ga0068860_100153524 3300005843 Bacteria 2218
64 Ga0068860_100321487 3300005843 Bacteria 1519
65 Ga0068860_100668546 3300005843 Bacteria 1047
66 Ga0068862_100190769 3300005844 Bacteria 1844
67 Ga0068862_100323202 3300005844 Bacteria 1425
68 Ga0068862_100708155 3300005844 Bacteria 976
69 Ga0068862_102324973 3300005844 Bacteria 548
70 Ga0070717_11047569 3300006028 Bacteria 743
71 Ga0075364_10375158 3300006051 Bacteria 970
72 Ga0070715_10043359 3300006163 Bacteria 1896
73 Ga0070716_100000006 3300006173 Bacteria 268067
74 Ga0070716_100001339 3300006173 Bacteria 10909
75 Ga0070716_100543179 3300006173 Bacteria 865
76 Ga0070712_100005043 3300006175 Bacteria 8177
77 Ga0075362_10192111 3300006177 Bacteria 992
78 Ga0097621_101121116 3300006237 Bacteria 739
79 Ga0075370_10075298 3300006353 Bacteria 1935
80 Ga0075428_100003062 3300006844 Bacteria 18244
81 Ga0075428_100006341 3300006844 Bacteria 13159
82 Ga0075428_100038426 3300006844 Bacteria 5267
83 Ga0075428_100107185 3300006844 Bacteria 3045
84 Ga0075428_100165799 3300006844 Bacteria 2396
85 Ga0075428_102721038 3300006844 Bacteria 504
86 Ga0075431_100191382 3300006847 Bacteria 2096
87 Ga0075433_10012698 3300006852 Bacteria 6815
88 Ga0075434_100001475 3300006871 Bacteria 19810
89 Ga0075434_100344425 3300006871 Bacteria 1511
90 Ga0075434_100437807 3300006871 Bacteria 1328
91 Ga0075429_100278556 3300006880 Bacteria 1464
92 Ga0075429_100878323 3300006880 Bacteria 785
93 Ga0068865_100355751 3300006881 Bacteria 1187
94 Ga0068865_101154282 3300006881 Bacteria 684
95 Ga0068865_101444153 3300006881 Bacteria 615
96 Ga0075436_101316987 3300006914 Bacteria 547
97 Ga0097620_100006169 3300006931 Bacteria 12179
98 Ga0097620_100015860 3300006931 Bacteria 7571
99 Ga0097620_100051049 3300006931 Bacteria 4156
100 Ga0097620_100307352 3300006931 Bacteria 1679
101 Ga0097620_101284497 3300006931 Bacteria 806
102 Ga0097620_102207265 3300006931 Bacteria 607
103 Ga0079104_1002693 3300006946 Bacteria 9148
104 Ga0075435_100012418 3300007076 Bacteria 6307
105 Ga0075435_100031563 3300007076 Bacteria 4174
106 Ga0075435_100289377 3300007076 Bacteria 1400
107 Ga0105244_10058327 3300009036 Bacteria 1949
108 Ga0105250_10583177 3300009092 Bacteria 516
109 Ga0105240_10009383 3300009093 Bacteria 13863
110 Ga0105240_10048597 3300009093 Bacteria 5361
111 Ga0105240_11310307 3300009093 Bacteria 764
112 Ga0105240_11531772 3300009093 Bacteria 699
113 Ga0105240_11847530 3300009093 Bacteria 629
114 Ga0111539_10011746 3300009094 Bacteria 10987
115 Ga0111539_10014963 3300009094 Bacteria 9671
116 Ga0111539_10198320 3300009094 Bacteria 2341
117 Ga0111539_10302448 3300009094 Bacteria 1862
118 Ga0105245_10042696 3300009098 Bacteria 4045
119 Ga0105245_10405940 3300009098 Bacteria 1363
120 Ga0114129_10042483 3300009147 Bacteria 6402
121 Ga0114129_10211024 3300009147 Bacteria 2625
122 Ga0114129_10255555 3300009147 Bacteria 2350
123 Ga0114129_10258633 3300009147 Bacteria 2335
124 Ga0105243_10295437 3300009148 Bacteria 1466
125 Ga0105243_10763257 3300009148 Bacteria 949
126 Ga0105241_10137383 3300009174 Bacteria 1986
127 Ga0105242_10021951 3300009176 Bacteria 5017
128 Ga0105242_10188055 3300009176 Bacteria 1826
129 Ga0105248_10241168 3300009177 Bacteria 2035
130 Ga0105248_10654246 3300009177 Bacteria 1186
131 Ga0105248_11131652 3300009177 Bacteria 885
132 Ga0105248_11256289 3300009177 Bacteria 837
133 Ga0105237_10000003 3300009545 Bacteria 556908
134 Ga0105237_10000018 3300009545 Bacteria 237291
135 Ga0105237_10101803 3300009545 Bacteria 2864
136 Ga0105238_10000255 3300009551 Bacteria 59531
137 Ga0105238_10018549 3300009551 Bacteria 7083
138 Ga0105238_10058741 3300009551 Bacteria 3855
139 Ga0105238_10073921 3300009551 Bacteria 3402
140 Ga0105238_10207957 3300009551 Bacteria 1933
141 Ga0105249_11028563 3300009553 Bacteria 893
142 Ga0105249_11765687 3300009553 Bacteria 691
143 Ga0099796_10066540 3300010159 Bacteria 1291
144 Ga0105239_10001561 3300010375 Bacteria 30314
145 Ga0105239_10763772 3300010375 Bacteria 1107
146 Ga0105246_10328381 3300011119 Bacteria 1246
147 Ga0105246_11672177 3300011119 Bacteria 604
148 Ga0157313_1021621 3300012503 Bacteria 662
149 Ga0157373_10464664 3300013100 Bacteria 912
150 Ga0157371_10282570 3300013102 Bacteria 1199
151 Ga0157370_10394595 3300013104 Bacteria 1274
152 Ga0157370_10666108 3300013104 Bacteria 951
153 Ga0157370_11448891 3300013104 Bacteria 618
154 Ga0157374_10000565 3300013296 Bacteria 32833
155 Ga0157374_10171084 3300013296 Bacteria 2119
156 Ga0157374_11451744 3300013296 Bacteria 709
157 Ga0157374_11868993 3300013296 Bacteria 626
158 Ga0157378_10415240 3300013297 Bacteria 1329
159 Ga0157378_11909340 3300013297 Bacteria 643
160 Ga0163162_10231885 3300013306 Bacteria 1976
161 Ga0163162_10961964 3300013306 Bacteria 965
162 Ga0163162_11743616 3300013306 Bacteria 711
163 Ga0157372_10023803 3300013307 Bacteria 6644
164 Ga0157372_11549147 3300013307 Bacteria 763
165 Ga0157372_11900300 3300013307 Bacteria 684
166 Ga0157372_12583516 3300013307 Bacteria 583
167 Ga0157372_13376633 3300013307 Bacteria 508
168 Ga0157375_10043964 3300013308 Bacteria 4335
169 Ga0157375_10426876 3300013308 Bacteria 1491
170 Ga0157375_13136060 3300013308 Bacteria 551
171 Ga0163163_10000689 3300014325 Bacteria 28712
172 Ga0163163_11499838 3300014325 Bacteria 736
173 Ga0157380_10057818 3300014326 Bacteria 3090
174 Ga0157380_10173058 3300014326 Bacteria 1889
175 Ga0157380_10255211 3300014326 Bacteria 1589
176 Ga0157380_10588049 3300014326 Bacteria 1099
177 Ga0157377_10091916 3300014745 Bacteria 1793
178 Ga0157379_10021635 3300014968 Bacteria 5695
179 Ga0157379_10727069 3300014968 Bacteria 933
180 Ga0157376_10200736 3300014969 Bacteria 1835
181 Ga0157376_11542577 3300014969 Bacteria 698
182 Ga0157376_11888675 3300014969 Bacteria 634
183 Ga0163161_10500951 3300017792 Bacteria 989
184 Ga0163161_10747660 3300017792 Bacteria 818
185 Ga0197907_10220943 3300020069 Bacteria 1552
186 Ga0197907_10711641 3300020069 Bacteria 4414
187 Ga0197907_11244701 3300020069 Bacteria 904
188 Ga0206356_10044123 3300020070 Bacteria 1197
189 Ga0206356_10421265 3300020070 Bacteria 1925
190 Ga0206356_11631052 3300020070 Bacteria 3090
191 Ga0206356_11659187 3300020070 Bacteria 510
192 Ga0206349_1379836 3300020075 Bacteria 764
193 Ga0206349_1742955 3300020075 Bacteria 2357
194 Ga0206349_1877552 3300020075 Bacteria 632
195 Ga0206355_1134509 3300020076 Bacteria 636
196 Ga0206355_1282490 3300020076 Bacteria 954
197 Ga0206355_1644566 3300020076 Bacteria 667
198 Ga0206351_10148588 3300020077 Bacteria 552
199 Ga0206351_10334049 3300020077 Bacteria 633
200 Ga0206351_11004140 3300020077 Bacteria 1781
201 Ga0206352_10067258 3300020078 Bacteria 1970
202 Ga0206352_10603617 3300020078 Bacteria 979
203 Ga0206352_10675711 3300020078 Bacteria 1445
204 Ga0206352_10965755 3300020078 Bacteria 1654
205 Ga0206350_10495714 3300020080 Bacteria 502
206 Ga0206350_10589595 3300020080 Bacteria 4679
207 Ga0206350_10617597 3300020080 Bacteria 589
208 Ga0206350_11522585 3300020080 Bacteria 1616
209 Ga0206354_10584469 3300020081 Bacteria 2389
210 Ga0206354_11150211 3300020081 Bacteria 1156
211 Ga0206354_11215086 3300020081 Bacteria 591
212 Ga0206354_11538367 3300020081 Bacteria 2506
213 Ga0206353_10705318 3300020082 Bacteria 1476
214 Ga0206353_11282332 3300020082 Bacteria 781
215 Ga0213875_10008240 3300021388 Bacteria 5347
216 Ga0224712_10005496 3300022467 Bacteria 3534
217 Ga0224712_10096658 3300022467 Bacteria 1246
218 Ga0209784_100035 3300025224 Bacteria 299760
219 Ga0209566_100040 3300025225 Bacteria 299760
220 Ga0209674_100057 3300025226 Bacteria 299760
221 Ga0209563_100059 3300025230 Bacteria 299760
222 Ga0209677_100036 3300025253 Bacteria 299760
223 Ga0209233_1007528 3300025261 Bacteria 3444
224 Ga0207697_10379362 3300025315 Bacteria 628
225 Ga0207656_10006493 3300025321 Bacteria 4209
226 Ga0207655_1093612 3300025728 Bacteria 1051
227 Ga0207653_10216535 3300025885 Bacteria 726
228 Ga0207692_10123816 3300025898 Bacteria 1451
229 Ga0207710_10074914 3300025900 Bacteria 1559
230 Ga0207680_10011802 3300025903 Bacteria 4428
231 Ga0207680_11035760 3300025903 Bacteria 587
232 Ga0207647_10529481 3300025904 Bacteria 655
233 Ga0207685_10006968 3300025905 Bacteria 3118
234 Ga0207685_10013875 3300025905 Bacteria 2505
235 Ga0207699_10000308 3300025906 Bacteria 26108
236 Ga0207699_10551424 3300025906 Bacteria 836
237 Ga0207645_10521243 3300025907 Bacteria 805
238 Ga0207643_10112955 3300025908 Bacteria 1602
239 Ga0207643_10327275 3300025908 Bacteria 958
240 Ga0207643_10643446 3300025908 Bacteria 684
241 Ga0207705_10004481 3300025909 Bacteria 10556
242 Ga0207705_10343948 3300025909 Bacteria 1148
243 Ga0207654_11104665 3300025911 Bacteria 578
244 Ga0207707_10004838 3300025912 Bacteria 11811
245 Ga0207695_10001345 3300025913 Bacteria 41663
246 Ga0207695_10035918 3300025913 Bacteria 5364
247 Ga0207695_11224513 3300025913 Bacteria 631
248 Ga0207671_10000012 3300025914 Bacteria 519494
249 Ga0207671_10000714 3300025914 Bacteria 42588
250 Ga0207671_10001558 3300025914 Bacteria 26243
251 Ga0207671_11434308 3300025914 Bacteria 534
252 Ga0207693_10071595 3300025915 Bacteria 2714
253 Ga0207663_10011890 3300025916 Bacteria 4688
254 Ga0207663_11683548 3300025916 Bacteria 510
255 Ga0207660_10086706 3300025917 Bacteria 2312
256 Ga0207662_10130416 3300025918 Bacteria 1584
257 Ga0207657_10047148 3300025919 Bacteria 3770
258 Ga0207657_10068489 3300025919 Bacteria 3015
259 Ga0207657_10132449 3300025919 Bacteria 2042
260 Ga0207652_10021342 3300025921 Bacteria 5346
261 Ga0207652_10174103 3300025921 Bacteria 1932
262 Ga0207681_10031326 3300025923 Bacteria 3473
263 Ga0207681_11148537 3300025923 Bacteria 652
264 Ga0207694_10000193 3300025924 Bacteria 61887
265 Ga0207694_10022816 3300025924 Bacteria 4747
266 Ga0207694_10050367 3300025924 Bacteria 3225
267 Ga0207694_10057611 3300025924 Bacteria 3021
268 Ga0207694_10950533 3300025924 Bacteria 727
269 Ga0207650_10094616 3300025925 Bacteria 2289
270 Ga0207650_11641402 3300025925 Bacteria 545
271 Ga0207659_10338992 3300025926 Bacteria 1245
272 Ga0207659_10731023 3300025926 Bacteria 848
273 Ga0207659_11171147 3300025926 Bacteria 661
274 Ga0207687_10033278 3300025927 Bacteria 3496
275 Ga0207700_10000991 3300025928 Bacteria 16378
276 Ga0207700_10189334 3300025928 Bacteria 1728
277 Ga0207700_11715757 3300025928 Bacteria 554
278 Ga0207664_10020594 3300025929 Bacteria 4891
279 Ga0207664_10062641 3300025929 Bacteria 2971
280 Ga0207644_10003510 3300025931 Bacteria 10149
281 Ga0207644_10561696 3300025931 Bacteria 945
282 Ga0207690_11121402 3300025932 Bacteria 656
283 Ga0207706_10121963 3300025933 Bacteria 2292
284 Ga0207706_10651079 3300025933 Bacteria 902
285 Ga0207709_10211916 3300025935 Bacteria 1391
286 Ga0207709_10715725 3300025935 Bacteria 802
287 Ga0207670_10070912 3300025936 Bacteria 2408
288 Ga0207670_10109669 3300025936 Bacteria 1986
289 Ga0207670_10713476 3300025936 Bacteria 831
290 Ga0207669_10588982 3300025937 Bacteria 902
291 Ga0207704_11214655 3300025938 Bacteria 643
292 Ga0207665_11227829 3300025939 Bacteria 598
293 Ga0207665_11432735 3300025939 Bacteria 550
294 Ga0207691_10381119 3300025940 Bacteria 1204
295 Ga0207691_10475585 3300025940 Bacteria 1062
296 Ga0207711_10000448 3300025941 Bacteria 43007
297 Ga0207711_10247923 3300025941 Bacteria 1634
298 Ga0207711_10977861 3300025941 Bacteria 786
299 Ga0207711_11597954 3300025941 Bacteria 595
300 Ga0207711_11945258 3300025941 Bacteria 531
301 Ga0207689_10072211 3300025942 Bacteria 2835
302 Ga0207689_10096116 3300025942 Bacteria 2433
303 Ga0207689_10328160 3300025942 Bacteria 1270
304 Ga0207679_10044249 3300025945 Bacteria 3211
305 Ga0207679_10118893 3300025945 Bacteria 2100
306 Ga0207667_10006290 3300025949 Bacteria 14403
307 Ga0207667_10093381 3300025949 Bacteria 3107
308 Ga0207667_10743225 3300025949 Bacteria 981
309 Ga0207667_10938184 3300025949 Bacteria 855
310 Ga0207651_10002125 3300025960 Bacteria 9356
311 Ga0207651_10523101 3300025960 Bacteria 1028
312 Ga0207651_10699287 3300025960 Bacteria 893
313 Ga0207651_11340986 3300025960 Bacteria 643
314 Ga0207712_11053041 3300025961 Bacteria 723
315 Ga0207712_11127522 3300025961 Bacteria 699
316 Ga0207712_11374314 3300025961 Bacteria 632
317 Ga0207668_10035020 3300025972 Bacteria 3339
318 Ga0207668_10078777 3300025972 Bacteria 2381
319 Ga0207668_10894439 3300025972 Bacteria 790
320 Ga0207640_10011828 3300025981 Bacteria 4953
321 Ga0207640_11013612 3300025981 Bacteria 731
322 Ga0207658_10082604 3300025986 Bacteria 2467
323 Ga0207658_10515890 3300025986 Bacteria 1066
324 Ga0207658_11091198 3300025986 Bacteria 729
325 Ga0207677_10000253 3300026023 Bacteria 41332
326 Ga0207677_10136423 3300026023 Bacteria 1871
327 Ga0207703_10000517 3300026035 Bacteria 39928
328 Ga0207703_10285608 3300026035 Bacteria 1500
329 Ga0207703_10334329 3300026035 Bacteria 1390
330 Ga0207703_11160314 3300026035 Bacteria 742
331 Ga0207703_11172151 3300026035 Bacteria 738
332 Ga0207639_10840560 3300026041 Bacteria 857
333 Ga0207639_11515419 3300026041 Bacteria 629
334 Ga0207639_11689583 3300026041 Bacteria 593
335 Ga0207678_10647148 3300026067 Bacteria 928
336 Ga0207708_10068366 3300026075 Bacteria 2719
337 Ga0207708_10203657 3300026075 Bacteria 1579
338 Ga0207708_10290653 3300026075 Bacteria 1327
339 Ga0207708_10655378 3300026075 Bacteria 894
340 Ga0207708_11258390 3300026075 Bacteria 648
341 Ga0207702_10117033 3300026078 Bacteria 2379
342 Ga0207702_10227221 3300026078 Bacteria 1742
343 Ga0207702_10687179 3300026078 Bacteria 1008
344 Ga0207648_10342134 3300026089 Bacteria 1347
345 Ga0207648_10400882 3300026089 Bacteria 1243
346 Ga0207648_10648555 3300026089 Bacteria 976
347 Ga0207648_11335037 3300026089 Bacteria 674
348 Ga0207676_10000167 3300026095 Bacteria 57507
349 Ga0207676_10830472 3300026095 Bacteria 903
350 Ga0207676_11616135 3300026095 Bacteria 646
351 Ga0207674_10005520 3300026116 Bacteria 15020
352 Ga0207674_10113606 3300026116 Bacteria 2681
353 Ga0207674_10120228 3300026116 Bacteria 2595
354 Ga0207674_11044975 3300026116 Bacteria 786
355 Ga0207675_100150895 3300026118 Bacteria 2211
356 Ga0207675_100688378 3300026118 Bacteria 1031
357 Ga0207675_101132999 3300026118 Bacteria 802
358 Ga0207675_101816036 3300026118 Bacteria 629
359 Ga0207675_102572156 3300026118 Bacteria 519
360 Ga0207683_10000965 3300026121 Bacteria 26325
361 Ga0207683_10440010 3300026121 Bacteria 1202
362 Ga0207683_10937359 3300026121 Bacteria 804
363 Ga0207698_10025720 3300026142 Bacteria 4152
364 Ga0209281_1028607 3300027111 Bacteria 1011
365 Ga0209971_1105709 3300027682 Bacteria 690
366 Ga0209966_1040538 3300027695 Bacteria 969
367 Ga0207428_10044112 3300027907 Bacteria 3598
368 Ga0207428_10120599 3300027907 Bacteria 2011
369 Ga0207428_10591014 3300027907 Bacteria 800
370 Ga0268266_10005004 3300028379 Bacteria 12519
371 Ga0268266_10329216 3300028379 Bacteria 1431
372 Ga0268266_10644748 3300028379 Bacteria 1019
373 Ga0268266_11060310 3300028379 Bacteria 784
374 Ga0268265_10141646 3300028380 Bacteria 2014
375 Ga0268265_10279504 3300028380 Bacteria 1493
376 Ga0268265_11494274 3300028380 Bacteria 679
377 Ga0268265_12083714 3300028380 Bacteria 574
378 Ga0268264_10096171 3300028381 Bacteria 2564
379 Ga0268264_10228753 3300028381 Bacteria 1716
380 Ga0268264_10306818 3300028381 Bacteria 1496
381 Ga0268264_11062254 3300028381 Bacteria 817
382 Ga0268264_11274607 3300028381 Bacteria 745
383 Ga0265326_10059715 3300028558 Bacteria 1079
384 Ga0265319_1021197 3300028563 Bacteria 2391
385 Ga0265334_10022641 3300028573 Bacteria 2559
386 Ga0265318_10000384 3300028577 Bacteria 34508
387 Ga0265318_10019144 3300028577 Bacteria 2780
388 Ga0265323_10025795 3300028653 Bacteria 2220
389 Ga0265336_10043926 3300028666 Bacteria 1361
390 Ga0307515_10000015 3300028794 Bacteria 557886
391 Ga0265338_10123565 3300028800 Bacteria 2058
392 Ga0265324_10111600 3300029957 Bacteria 929
393 Ga0265330_10001669 3300031235 Bacteria 12591
394 Ga0265330_10089801 3300031235 Bacteria 1319
395 Ga0265332_10002023 3300031238 Bacteria 10619
396 Ga0265328_10001448 3300031239 Bacteria 10926
397 Ga0265320_10004792 3300031240 Bacteria 8794
398 Ga0265325_10045951 3300031241 Bacteria 2267
399 Ga0265329_10000733 3300031242 Bacteria 16666
400 Ga0265339_10027395 3300031249 Bacteria 3253
401 Ga0265331_10001210 3300031250 Bacteria 19474
402 Ga0265316_10013594 3300031344 Bacteria 7222
403 Ga0265316_10021674 3300031344 Bacteria 5436
404 Ga0265313_10098541 3300031595 Bacteria 1300
405 Ga0316575_10031569 3300031665 Bacteria 2074
406 Ga0316575_10247797 3300031665 Bacteria 747
407 Ga0316579_10206015 3300031691 Bacteria 951
408 Ga0265314_10015705 3300031711 Bacteria 5999
409 Ga0265314_10061333 3300031711 Bacteria 2561
410 Ga0265342_10002136 3300031712 Bacteria 17439
411 Ga0265342_10008211 3300031712 Bacteria 7520
412 Ga0316576_10028305 3300031727 Bacteria 3949
413 Ga0316576_10029824 3300031727 Bacteria 3859
414 Ga0316576_10048859 3300031727 Bacteria 3071
415 Ga0316576_10322013 3300031727 Bacteria 1153
416 Ga0316576_11032611 3300031727 Bacteria 585
417 Ga0316578_10004705 3300031728 Bacteria 6492
418 Ga0316578_10151550 3300031728 Bacteria 1397
419 Ga0316577_10001901 3300031733 Bacteria 10097
420 Ga0316577_10077453 3300031733 Bacteria 1857
421 Ga0307413_11890328 3300031824 Bacteria 536
422 Ga0307409_100222795 3300031995 Bacteria 1704
423 Ga0307415_100734463 3300032126 Bacteria 895
424 Ga0316593_10001600 3300032168 Bacteria 5054
425 Ga0316593_10001816 3300032168 Bacteria 4873
426 Ga0316593_10010408 3300032168 Bacteria 2666
427 Ga0316593_10015184 3300032168 Bacteria 2312
428 Ga0316593_10016431 3300032168 Bacteria 2243
429 Ga0316593_10057021 3300032168 Bacteria 1330
430 Ga0316587_1000999 3300033529 Bacteria 3269
431 Ga0316596_1000468 3300033541 Bacteria 6818
432 Ga0316596_1000731 3300033541 Bacteria 5997
433 Ga0316596_1000881 3300033541 Bacteria 5651
434 Ga0316596_1050135 3300033541 Bacteria 1104
435 Ga0373959_0167930 3300034820 Bacteria 564
436 Ga0373934_0001385 3300035086 Bacteria 8836
437 Ga0373923_0047756 3300035111 Bacteria 1785
438 Ga0373923_0378272 3300035111 Bacteria 679
439 Ga0373939_0398737 3300035114 Bacteria 570
440 Ga0373939_0440593 3300035114 Bacteria 547
441 Ga0373945_0054355 3300035116 Bacteria 1480
442 Ga0373954_0006676 3300035118 Bacteria 5033
443 Ga0373954_0205454 3300035118 Bacteria 968
444 Ga0373954_0258927 3300035118 Bacteria 857
445 Ga0373956_0071216 3300035119 Bacteria 1586
446 Ga0373957_0144986 3300035120 Bacteria 972
447 Ga0373957_0191407 3300035120 Bacteria 850
448 Ga0373957_0301913 3300035120 Bacteria 679
449 Ga0373960_0245584 3300035121 Bacteria 649
450 Ga0373943_0074897 3300035170 Bacteria 1722
451 Ga0373946_0025750 3300035171 Bacteria 2315
452 Ga0373955_0025147 3300035172 Bacteria 3054
453 Ga0373955_0043559 3300035172 Bacteria 2415
454 Ga0316574_0007731 3300035398 Bacteria 5913
455 Ga0316574_0008846 3300035398 Bacteria 5614
456 Ga0316574_0016945 3300035398 Bacteria 4254
457 Ga0316574_0133269 3300035398 Bacteria 1599
458 Ga0316574_0162122 3300035398 Bacteria 1440
459 Ga0316574_0334063 3300035398 Bacteria 961
460 Ga0316574_0400668 3300035398 Bacteria 864
461 Ga0373924_0000835 3300035410 Bacteria 9645
462 Ga0373924_0221830 3300035410 Bacteria 835
463 Ga0373935_0089342 3300035692 Bacteria 2014
464 Ga0373935_0542041 3300035692 Bacteria 847
465 Ga0373927_0091323 3300035695 Bacteria 1977
466 Ga0373933_0025007 3300035724 Bacteria 3421
467 Ga0373933_0300637 3300035724 Bacteria 1039
468 Ga0373947_0008078 3300035725 Bacteria 6068
469 Ga0373937_0089730 3300036401 Bacteria 2846
470 Ga0373937_0382796 3300036401 Bacteria 1334
471 Ga0373937_0518832 3300036401 Bacteria 1132
472 Ga0373937_0547322 3300036401 Bacteria 1099
473 Ga0373937_0763192 3300036401 Bacteria 914
474 Ga0373937_0765285 3300036401 Bacteria 913
475 Ga0373937_1438801 3300036401 Bacteria 637
476 Ga0373937_1701606 3300036401 Bacteria 578
477 Ga0265778_013571 3300036457 Bacteria 955
478 Ga0316582_0048063 3300036647 Bacteria 2696
479 Ga0316582_0089782 3300036647 Bacteria 2021
480 Ga0316582_0114600 3300036647 Bacteria 1798
481 Ga0316584_0017973 3300036712 Bacteria 5095
482 Ga0316584_0036925 3300036712 Bacteria 3627
483 Ga0316584_0037746 3300036712 Bacteria 3591
484 Ga0316584_0047025 3300036712 Bacteria 3223
485 Ga0316584_0420865 3300036712 Bacteria 949
486 Ga0316584_0740546 3300036712 Bacteria 671
487 Ga0373925_0002179 3300037068 Bacteria 15930
488 Ga0373925_0325801 3300037068 Bacteria 1244
489 Ga0373925_0847398 3300037068 Bacteria 753
490 Ga0373925_1081285 3300037068 Bacteria 660
491 Ga0373925_1650948 3300037068 Bacteria 523
492 Ga0395899_0005268 3300037312 Bacteria 10047
493 Ga0395899_0673616 3300037312 Bacteria 651
494 Ga0395900_0011458 3300037418 Bacteria 9076
495 Ga0395900_0375400 3300037418 Bacteria 1391
496 Ga0395900_1628004 3300037418 Bacteria 557
497 Ga0395898_0105030 3300037466 Bacteria 2708
498 Ga0395905_0000127 3300037471 Bacteria 124627
499 Ga0395905_0000938 3300037471 Bacteria 37508
500 Ga0316581_0054133 3300037588 Bacteria 1230
501 Ga0436364_0945409 3300037853 Bacteria 21165
502 Ga0400484_27221 3300038725 Bacteria 11015
503 Ga0400484_44058 3300038725 Bacteria 9517
504 Ga0400490_00204 3300038726 Bacteria 5822
505 Ga0400490_00437 3300038726 Bacteria 17578
506 Ga0400490_07011 3300038726 Bacteria 6579
507 Ga0400490_07361 3300038726 Bacteria 19331
508 Ga0400490_39901 3300038726 Bacteria 15663
509 Ga0400490_57192 3300038726 Bacteria 4135
510 Ga0400491_00552 3300038727 Bacteria 1802
511 Ga0400491_01651 3300038727 Bacteria 1595
512 Ga0400491_18291 3300038727 Bacteria 1034
513 Ga0400485_09439 3300038735 Bacteria 3103
514 Ga0400485_11168 3300038735 Bacteria 3386
515 Ga0400485_11310 3300038735 Bacteria 5254
516 Ga0400485_19181 3300038735 Bacteria 55141
517 Ga0400488_06448 3300038741 Bacteria 3977
518 Ga0400488_07418 3300038741 Bacteria 3446
519 Ga0400488_12334 3300038741 Bacteria 4329
520 Ga0400488_32083 3300038741 Bacteria 3862
521 Ga0400488_40771 3300038741 Bacteria 7929
522 Ga0400488_43096 3300038741 Bacteria 4020
523 Ga0400488_48044 3300038741 Bacteria 2047
524 Ga0400488_51157 3300038741 Bacteria 5303
525 Ga0400486_01341 3300038742 Bacteria 7086
526 Ga0400486_05487 3300038742 Bacteria 2952
527 Ga0400486_18812 3300038742 Bacteria 1650
528 Ga0400486_25543 3300038742 Bacteria 57720
529 Ga0400486_25694 3300038742 Bacteria 15655
530 Ga0400483_020927 3300039062 Bacteria 1733
531 Ga0400483_027826 3300039062 Bacteria 3798
532 Ga0400483_094874 3300039062 Bacteria 2505
533 Ga0400483_140144 3300039062 Bacteria 16717
534 Ga0400483_151841 3300039062 Bacteria 5853
535 Ga0400483_233637 3300039062 Bacteria 29223
536 Ga0400483_256259 3300039062 Bacteria 3671
537 Ga0400489_14975 3300039093 Bacteria 1611
538 Ga0400489_50866 3300039093 Bacteria 3142
539 Ga0400487_00070 3300039110 Bacteria 4044
540 Ga0400487_06498 3300039110 Bacteria 4007
541 Ga0400487_29008 3300039110 Bacteria 14273
542 Ga0400487_33555 3300039110 Bacteria 69184
543 Ga0400487_34004 3300039110 Bacteria 1979
544 Ga0400487_58155 3300039110 Bacteria 32047
545 Ga0400487_60113 3300039110 Bacteria 6486
546 Ga0436365_1189349 3300039437 Bacteria 671
547 Ga0436365_1396723 3300039437 Bacteria 809
548 Ga0436361_0391791 3300039447 Bacteria 42494
549 Ga0439453_0021918 3300041408 Bacteria 1155
550 Ga0451795_1180726 3300041456 Bacteria 618
551 Ga0451807_0006965 3300041486 Bacteria 1015
552 Ga0450923_038197 3300042125 Bacteria 1001
553 Ga0450897_018808 3300042128 Bacteria 727
554 Ga0450894_002033 3300042131 Bacteria 2788
555 Ga0450896_005414 3300042133 Bacteria 1740
556 Ga0450896_037702 3300042133 Bacteria 746
557 Ga0450906_009432 3300042145 Bacteria 1862
558 Ga0450908_020484 3300042184 Bacteria 1162
559 Ga0439434_0133237 3300042435 Bacteria 816
560 Ga0439435_0153989 3300042436 Bacteria 739
561 Ga0439435_0195376 3300042436 Bacteria 665
562 Ga0451577_0000016 3300042876 Bacteria 531002
563 Ga0451577_0000337 3300042876 Bacteria 87564
564 Ga0451577_0083369 3300042876 Bacteria 2852
565 Ga0451577_0129292 3300042876 Bacteria 2265
566 Ga0451577_0160056 3300042876 Bacteria 2027
567 Ga0451577_0417431 3300042876 Bacteria 1218
568 Ga0451577_1789191 3300042876 Bacteria 539
569 Ga0453683_0017367 3300044673 Bacteria 4633
570 Ga0453683_0036858 3300044673 Bacteria 3077
571 Ga0453683_0043820 3300044673 Bacteria 2808
572 Ga0453683_0270063 3300044673 Bacteria 1085
573 Ga0453683_0423433 3300044673 Bacteria 859
574 Ga0453683_0866875 3300044673 Bacteria 596
575 Ga0466961_0460957 3300044693 Bacteria 769
576 Ga0453684_0000197 3300044712 Bacteria 264445
577 Ga0453684_0020865 3300044712 Bacteria 9836
578 Ga0453684_0041859 3300044712 Bacteria 6185
579 Ga0453684_0072448 3300044712 Bacteria 4349
580 Ga0453684_0282064 3300044712 Bacteria 1894
581 Ga0453684_0476020 3300044712 Bacteria 1386
582 Ga0453684_0769933 3300044712 Bacteria 1040
583 Ga0453684_1478571 3300044712 Bacteria 702
584 Ga0453684_1597238 3300044712 Bacteria 669
585 Ga0466959_1178671 3300045049 Bacteria 509
586 Ga0451576_0000971 3300045051 Bacteria 53521
587 Ga0451576_0032619 3300045051 Bacteria 5542
588 Ga0451576_0141552 3300045051 Bacteria 2508
589 Ga0451576_0236352 3300045051 Bacteria 1909
590 Ga0451576_1292967 3300045051 Bacteria 760
591 Ga0451576_1942103 3300045051 Bacteria 607
592 Ga0466967_1730035 3300045976 Bacteria 623
593 Ga0466967_2166614 3300045976 Bacteria 552
594 Ga0495603_0042618 3300046455 Bacteria 2713
595 Ga0495603_0335295 3300046455 Bacteria 868
596 Ga0495629_0000007 3300046459 Bacteria 358693
597 Ga0495629_0000126 3300046459 Bacteria 66833
598 Ga0495629_0017893 3300046459 Bacteria 5079
599 Ga0495580_0222402 3300046472 Bacteria 1297
600 Ga0495582_0021576 3300046473 Bacteria 3523
601 Ga0495582_0034213 3300046473 Bacteria 2794
602 Ga0495639_0000121 3300046475 Bacteria 39571
603 Ga0495639_0002018 3300046475 Bacteria 8984
604 Ga0495639_0012434 3300046475 Bacteria 3670
605 Ga0495662_0015298 3300046476 Bacteria 3728
606 Ga0495662_0484051 3300046476 Bacteria 607
607 Ga0495664_0072557 3300046477 Bacteria 2057
608 Ga0495664_0127669 3300046477 Bacteria 1539
609 Ga0495594_0009365 3300046499 Bacteria 5059
610 Ga0495594_0048874 3300046499 Bacteria 2324
611 Ga0495594_0285119 3300046499 Bacteria 941
612 Ga0495608_0179275 3300046511 Bacteria 1341
613 Ga0495618_0313472 3300046514 Bacteria 973
614 Ga0495663_0364184 3300046525 Bacteria 528
615 Ga0495640_0229383 3300046533 Bacteria 1168
616 Ga0495640_0263194 3300046533 Bacteria 1077
617 Ga0495640_0636877 3300046533 Bacteria 642
618 Ga0495586_0000999 3300046535 Bacteria 16016
619 Ga0495586_0012323 3300046535 Bacteria 4537
620 Ga0495586_0395426 3300046535 Bacteria 795
621 Ga0495587_0174480 3300046536 Bacteria 1220
622 Ga0495587_0180077 3300046536 Bacteria 1199
623 Ga0495645_0135186 3300046543 Bacteria 1725
624 Ga0495622_0002685 3300046557 Bacteria 8531
625 Ga0495622_0023394 3300046557 Bacteria 2880
626 Ga0495633_0308991 3300046558 Unclassified 718
627 Ga0495634_0024544 3300046642 Bacteria 4228
628 Ga0495635_0001790 3300046663 Bacteria 14519
629 Ga0495635_0575039 3300046663 Bacteria 737
630 Ga0495635_0911189 3300046663 Bacteria 562
631 Ga0495588_0135487 3300046674 Bacteria 1300
632 Ga0495657_0373443 3300046675 Bacteria 842
633 Ga0495623_0119350 3300046679 Bacteria 1589
634 Ga0495647_0001519 3300046681 Bacteria 7163
635 Ga0495647_0173245 3300046681 Bacteria 935
636 Ga0495647_0545141 3300046681 Bacteria 542
637 Ga0495658_0000327 3300046683 Bacteria 26569
638 Ga0495658_0004909 3300046683 Bacteria 6562
639 Ga0495658_0007921 3300046683 Bacteria 5260
640 Ga0495658_0900299 3300046683 Bacteria 566
641 Ga0495613_0025308 3300046689 Bacteria 4422
642 Ga0495581_0000280 3300047315 Bacteria 24770
643 Ga0495581_0005862 3300047315 Bacteria 7123
644 Ga0495581_0193636 3300047315 Bacteria 1189
645 Ga0495604_0064977 3300047317 Bacteria 2779
646 Ga0495674_0070838 3300047319 Bacteria 3012
647 Ga0495676_0020676 3300047321 Bacteria 5767
648 Ga0495676_0040130 3300047321 Bacteria 3867
649 Ga0495676_0073506 3300047321 Bacteria 2621
650 Ga0495680_0000838 3300047322 Bacteria 34052
651 Ga0495680_0100618 3300047322 Bacteria 2154
652 Ga0495680_0186512 3300047322 Bacteria 1494
653 Ga0495684_0284558 3300047471 Bacteria 1192
654 Ga0495684_0752522 3300047471 Bacteria 641
655 Ga0495686_0000545 3300047472 Bacteria 53866
656 Ga0495686_0012883 3300047472 Bacteria 5830
657 Ga0495593_0365057 3300047673 Bacteria 722
658 Ga0495614_0111480 3300048089 Bacteria 1201
659 Ga0496100_0178098 3300048903 Bacteria 1536
660 Ga0496100_0663363 3300048903 Bacteria 813
661 Ga0496102_1871623 3300048905 Bacteria 517
662 Ga0496104_0000247 3300048907 Bacteria 47765
663 Ga0496104_0015885 3300048907 Bacteria 6831
664 Ga0496104_1098513 3300048907 Bacteria 699
665 Ga0496105_0230741 3300048908 Bacteria 1504
666 Ga0496106_0227535 3300048909 Bacteria 1488
667 Ga0496106_0396429 3300048909 Bacteria 1109
668 Ga0496107_0132708 3300048910 Bacteria 1839
669 Ga0496107_0808018 3300048910 Bacteria 686
670 Ga0496111_0586178 3300048914 Bacteria 817
671 Ga0496112_0001041 3300048915 Bacteria 20441
672 Ga0496113_1126530 3300048916 Bacteria 615
673 Ga0496114_0140121 3300048917 Bacteria 2093
674 Ga0496126_0000005 3300048929 Bacteria 891906
675 Ga0501033_0151291 3300049570 Bacteria 1674
676 Ga0501033_0755402 3300049570 Bacteria 659
677 Ga0501034_0054360 3300049571 Bacteria 4031
678 Ga0501034_0062111 3300049571 Bacteria 3751
679 Ga0501036_0485778 3300049572 Bacteria 1028
680 Ga0501036_0493094 3300049572 Bacteria 1020
681 Ga0501039_0863844 3300049575 Bacteria 705
682 Ga0501039_1239915 3300049575 Bacteria 576
683 Ga0501042_1443808 3300049578 Bacteria 502
684 Ga0501043_0331939 3300049579 Bacteria 1158
685 Ga0501043_0980992 3300049579 Bacteria 602
686 Ga0501046_0165569 3300049580 Bacteria 1661
687 Ga0501047_0085715 3300049581 Bacteria 3027
688 Ga0501067_0098292 3300049583 Bacteria 1626
689 Ga0501070_0634044 3300049586 Bacteria 850
690 Ga0501071_0349175 3300049587 Bacteria 1126
691 Ga0501071_0711056 3300049587 Bacteria 774
692 Ga0501072_1389825 3300049588 Bacteria 543
693 Ga0501076_0646894 3300049592 Bacteria 872
694 Ga0501079_0177238 3300049741 Bacteria 1663
695 Ga0501081_0365489 3300049743 Bacteria 1065
696 Ga0501035_0388799 3300049822 Bacteria 1162
697 Ga0501035_1346473 3300049822 Bacteria 549
698 Ga0501044_0008030 3300049823 Bacteria 11594
699 nmdc:mga05p37_181505_c1 3300050507 Bacteria 2560
700 nmdc:mga05p37_229395_c1 3300050507 Bacteria 2238
701 nmdc:mga05p37_306274_c2 3300050507 Bacteria 1509
702 nmdc:mga09592_29654_c1 3300050508 Bacteria 4549
703 nmdc:mga09592_322011_c1 3300050508 Bacteria 1339
704 nmdc:mga0qj67_645336_c1 3300050509 Bacteria 845
705 nmdc:mga06r32_381565_c1 3300050510 Bacteria 1392
706 nmdc:mga08y16_140994_c1 3300050511 Bacteria 2506
707 nmdc:mga08y16_175843_c1 3300050511 Bacteria 2223
708 nmdc:mga08y16_1791006_c1 3300050511 Bacteria 567
709 nmdc:mga08y16_8355_c1 3300050511 Bacteria 10832
710 nmdc:mga0n895_108823_c1 3300050512 Bacteria 2786
711 nmdc:mga0n895_203675_c1 3300050512 Bacteria 2009
712 nmdc:mga0rr50_771801_c1 3300050513 Bacteria 820
713 nmdc:mga0rr50_80996_c1 3300050513 Bacteria 2504
714 Ga0495601_0088500 3300053077 Bacteria 1991
715 Ga0495612_0084920 3300053078 Bacteria 1334
716 Ga0495619_0001327 3300053085 Bacteria 16220
717 Ga0495619_0149576 3300053085 Bacteria 1610
718 Ga0500566_0008539 3300053094 Bacteria 6056
719 Ga0501084_0244436 3300054114 Bacteria 1515
720 Ga0587093_062454 3300059478 Bacteria 611
721 Ga0587066_053876 3300059490 Bacteria 801
722 Ga0587066_185908 3300059490 Bacteria 538
723 Ga0587070_064310 3300059491 Bacteria 767
724 Ga0587070_125664 3300059491 Bacteria 618
725 Ga0587077_009783 3300059493 Bacteria 1465
726 Ga0587082_075400 3300059504 Bacteria 693
727 Ga0587085_020207 3300059506 Bacteria 1005
728 Ga0587088_021186 3300059508 Bacteria 1085
729 Ga0587090_084712 3300059510 Bacteria 640
730 Ga0587099_024032 3300059622 Bacteria 706
731 Ga0587069_051252 3300059642 Bacteria 735
732 Ga0587076_117509 3300059645 Bacteria 612
733 Ga0587079_116296 3300059647 Bacteria 656
734 Ga0587100_012481 3300059648 Bacteria 744
735 Ga0587107_107382 3300059652 Bacteria 560
736 Ga0587119_080205 3300059658 Bacteria 531
737 Ga0587111_0063663 3300060346 Bacteria 845
738 Ga0501082_0470562 3300060353 Bacteria 1098

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2510917014 2511099781 33
2 iso_pu_bacteria 2513237150 2513956728 33
3 iso_pu_bacteria 2515154189 2516022233 33
4 iso_pu_bacteria 2551306416 2553007591 33
5 iso_pu_bacteria 2671180115 2671589095 33
6 iso_pu_bacteria 2721755763 2723879665 33
7 iso_pu_bacteria 2765235838 2765567316 33
8 iso_pu_bacteria 2808606386 2808984227 33
9 iso_pu_bacteria 2808606415 2809132031 33
10 iso_pu_bacteria 2808606419 2809151654 33
11 iso_pu_bacteria 2818991449 2819618753 33
12 iso_pu_bacteria 2834641062 2834642601 33
13 iso_pu_bacteria 2839094727 2839095401 33
14 iso_pu_bacteria 2856287931 2856289404 33
15 iso_pu_bacteria 2857357740 2857362276 33
16 iso_pu_bacteria 2858688981 2858698273 33
17 iso_pu_bacteria 2883087390 2883091434 33
18 iso_pu_bacteria 2901300506 2901304185 33
19 iso_pu_bacteria 2904434214 2904438991 33
20 iso_pu_bacteria 2904439833 2904442503 33
21 iso_pu_bacteria 2904530477 2904533761 33
22 iso_pu_bacteria 2904584206 2904589402 33
23 iso_pu_bacteria 2904589729 2904595105 33
24 iso_pu_bacteria 2904601388 2904602393 33
25 iso_pu_bacteria 2919046199 2919050741 33
26 iso_pu_bacteria 2919079590 2919084936 33
27 iso_pu_bacteria 2923510766 2923514723 33
28 iso_pu_bacteria 2928130867 2928135675 33
29 iso_pu_bacteria 8003400568 8003402165 33
30 iso_pu_bacteria 8003955200 8003956817 33
31 iso_pu_bacteria 8055693939 8055697960 33
32 3300001990 JGI24737J22298_10177453 JGI24737J22298_101774531 37
33 3300002067 JGI24735J21928_10011983 JGI24735J21928_100119832 37
34 3300005338 Ga0068868_102068432 Ga0068868_1020684321 37
35 3300005339 Ga0070660_100066916 Ga0070660_1000669162 37
36 3300005543 Ga0070672_100082364 Ga0070672_1000823642 37
37 3300005543 Ga0070672_100120557 Ga0070672_1001205574 37
38 3300005543 Ga0070672_100136941 Ga0070672_1001369415 37
39 3300005543 Ga0070672_100361221 Ga0070672_1003612213 37
40 3300005543 Ga0070672_101022531 Ga0070672_1010225313 37
41 3300005548 Ga0070665_100005852 Ga0070665_1000058523 37
42 3300005548 Ga0070665_100533295 Ga0070665_1005332953 37
43 3300005548 Ga0070665_101743623 Ga0070665_1017436232 37
44 3300005563 Ga0068855_100051467 Ga0068855_1000514676 37
45 3300005563 Ga0068855_100646242 Ga0068855_1006462422 37
46 3300005563 Ga0068855_101043625 Ga0068855_1010436252 37
47 3300005563 Ga0068855_101653194 Ga0068855_1016531941 37
48 3300005564 Ga0070664_100053940 Ga0070664_1000539405 37
49 3300005564 Ga0070664_100575500 Ga0070664_1005755003 37
50 3300005577 Ga0068857_100012717 Ga0068857_1000127179 37
51 3300005577 Ga0068857_100336166 Ga0068857_1003361663 37
52 3300005577 Ga0068857_100677378 Ga0068857_1006773783 37
53 3300005577 Ga0068857_101088557 Ga0068857_1010885572 37
54 3300005578 Ga0068854_100007372 Ga0068854_1000073729 37
55 3300005578 Ga0068854_100161965 Ga0068854_1001619654 37
56 3300005578 Ga0068854_100353795 Ga0068854_1003537952 37
57 3300005614 Ga0068856_100032828 Ga0068856_10003282810 37
58 3300005614 Ga0068856_100046027 Ga0068856_1000460274 37
59 3300005614 Ga0068856_100095580 Ga0068856_1000955803 37
60 3300005614 Ga0068856_100179201 Ga0068856_1001792012 37
61 3300005614 Ga0068856_100887446 Ga0068856_1008874463 37
62 3300005614 Ga0068856_102014232 Ga0068856_1020142322 37
63 3300005616 Ga0068852_100724171 Ga0068852_1007241713 37
64 3300005616 Ga0068852_101256952 Ga0068852_1012569522 37
65 3300005617 Ga0068859_100006170 Ga0068859_10000617025 37
66 3300005617 Ga0068859_100015861 Ga0068859_1000158612 37
67 3300005617 Ga0068859_100051052 Ga0068859_1000510527 37
68 3300005617 Ga0068859_100307316 Ga0068859_1003073163 37
69 3300005617 Ga0068859_102207301 Ga0068859_1022073012 37
70 3300005618 Ga0068864_100003967 Ga0068864_10000396725 37
71 3300005718 Ga0068866_10660196 Ga0068866_106601962 37
72 3300005719 Ga0068861_100084611 Ga0068861_1000846115 37
73 3300005719 Ga0068861_100470617 Ga0068861_1004706173 37
74 3300005719 Ga0068861_100515831 Ga0068861_1005158313 37
75 3300005719 Ga0068861_100711034 Ga0068861_1007110342 37
76 3300005719 Ga0068861_100815600 Ga0068861_1008156002 37
77 3300005719 Ga0068861_102631146 Ga0068861_1026311462 37
78 3300005834 Ga0068851_10001517 Ga0068851_1000151715 37
79 3300005834 Ga0068851_10021382 Ga0068851_100213825 37
80 3300005834 Ga0068851_10153838 Ga0068851_101538383 37
81 3300005834 Ga0068851_10939121 Ga0068851_109391212 37
82 3300005840 Ga0068870_10229071 Ga0068870_102290712 37
83 3300005840 Ga0068870_10810343 Ga0068870_108103432 37
84 3300005841 Ga0068863_100002985 Ga0068863_10000298518 37
85 3300005841 Ga0068863_100648692 Ga0068863_1006486923 37
86 3300005841 Ga0068863_101189063 Ga0068863_1011890633 37
87 3300005842 Ga0068858_100014524 Ga0068858_10001452415 37
88 3300005842 Ga0068858_100210863 Ga0068858_1002108634 37
89 3300005842 Ga0068858_100246290 Ga0068858_1002462902 37
90 3300005842 Ga0068858_100350110 Ga0068858_1003501103 37
91 3300005842 Ga0068858_100476591 Ga0068858_1004765911 37
92 3300005842 Ga0068858_101512403 Ga0068858_1015124032 37
93 3300005843 Ga0068860_100039390 Ga0068860_1000393905 37
94 3300005843 Ga0068860_100153524 Ga0068860_1001535242 37
95 3300005843 Ga0068860_100321487 Ga0068860_1003214873 37
96 3300005843 Ga0068860_100668546 Ga0068860_1006685462 37
97 3300005844 Ga0068862_100190769 Ga0068862_1001907693 37
98 3300005844 Ga0068862_100323202 Ga0068862_1003232022 37
99 3300005844 Ga0068862_100708155 Ga0068862_1007081551 37
100 3300005844 Ga0068862_102324973 Ga0068862_1023249732 37
101 3300006028 Ga0070717_11047569 Ga0070717_110475692 37
102 3300006051 Ga0075364_10375158 Ga0075364_103751583 37
103 3300006163 Ga0070715_10043359 Ga0070715_100433593 37
104 3300006173 Ga0070716_100000006 Ga0070716_100000006228 37
105 3300006173 Ga0070716_100001339 Ga0070716_1000013392 37
106 3300006173 Ga0070716_100543179 Ga0070716_1005431792 37
107 3300006175 Ga0070712_100005043 Ga0070712_10000504311 37
108 3300006177 Ga0075362_10192111 Ga0075362_101921111 37
109 3300006237 Ga0097621_101121116 Ga0097621_1011211163 37
110 3300006353 Ga0075370_10075298 Ga0075370_100752984 37
111 3300006844 Ga0075428_100003062 Ga0075428_1000030627 37
112 3300006844 Ga0075428_100006341 Ga0075428_10000634127 37
113 3300006844 Ga0075428_100038426 Ga0075428_1000384265 37
114 3300006844 Ga0075428_100107185 Ga0075428_1001071853 37
115 3300006844 Ga0075428_100165799 Ga0075428_1001657991 37
116 3300006844 Ga0075428_102721038 Ga0075428_1027210381 37
117 3300006847 Ga0075431_100191382 Ga0075431_1001913823 37
118 3300006852 Ga0075433_10012698 Ga0075433_100126988 37
119 3300006871 Ga0075434_100001475 Ga0075434_10000147527 37
120 3300006871 Ga0075434_100344425 Ga0075434_1003444253 37
121 3300006871 Ga0075434_100437807 Ga0075434_1004378073 37
122 3300006880 Ga0075429_100278556 Ga0075429_1002785562 37
123 3300006880 Ga0075429_100878323 Ga0075429_1008783232 37
124 3300006881 Ga0068865_100355751 Ga0068865_1003557513 37
125 3300006881 Ga0068865_101154282 Ga0068865_1011542822 37
126 3300006881 Ga0068865_101444153 Ga0068865_1014441532 37
127 3300006914 Ga0075436_101316987 Ga0075436_1013169872 37
128 3300006931 Ga0097620_100006169 Ga0097620_10000616925 37
129 3300006931 Ga0097620_100015860 Ga0097620_1000158602 37
130 3300006931 Ga0097620_100051049 Ga0097620_1000510497 37
131 3300006931 Ga0097620_100307352 Ga0097620_1003073523 37
132 3300006931 Ga0097620_101284497 Ga0097620_1012844973 37
133 3300006931 Ga0097620_102207265 Ga0097620_1022072652 37
134 3300006946 Ga0079104_1002693 Ga0079104_10026932 37
135 3300007076 Ga0075435_100012418 Ga0075435_1000124185 37
136 3300007076 Ga0075435_100031563 Ga0075435_1000315633 37
137 3300007076 Ga0075435_100289377 Ga0075435_1002893774 37
138 3300009036 Ga0105244_10058327 Ga0105244_100583273 37
139 3300009092 Ga0105250_10583177 Ga0105250_105831772 37
140 3300009093 Ga0105240_10009383 Ga0105240_1000938325 37
141 3300009093 Ga0105240_10048597 Ga0105240_100485979 37
142 3300009093 Ga0105240_11310307 Ga0105240_113103071 37
143 3300009093 Ga0105240_11531772 Ga0105240_115317722 37
144 3300009093 Ga0105240_11847530 Ga0105240_118475302 37
145 3300009094 Ga0111539_10011746 Ga0111539_1001174612 37
146 3300009094 Ga0111539_10014963 Ga0111539_1001496312 37
147 3300009094 Ga0111539_10198320 Ga0111539_101983205 37
148 3300009094 Ga0111539_10302448 Ga0111539_103024484 37
149 3300009098 Ga0105245_10042696 Ga0105245_100426968 37
150 3300009098 Ga0105245_10405940 Ga0105245_104059404 37
151 3300009147 Ga0114129_10042483 Ga0114129_1004248311 37
152 3300009147 Ga0114129_10211024 Ga0114129_102110244 37
153 3300009147 Ga0114129_10255555 Ga0114129_102555553 37
154 3300009147 Ga0114129_10258633 Ga0114129_102586331 37
155 3300009148 Ga0105243_10295437 Ga0105243_102954373 37
156 3300009148 Ga0105243_10763257 Ga0105243_107632573 37
157 3300009174 Ga0105241_10137383 Ga0105241_101373832 37
158 3300009176 Ga0105242_10021951 Ga0105242_1002195110 37
159 3300009176 Ga0105242_10188055 Ga0105242_101880554 37
160 3300009177 Ga0105248_10241168 Ga0105248_102411684 37
161 3300009177 Ga0105248_10654246 Ga0105248_106542462 37
162 3300009177 Ga0105248_11131652 Ga0105248_111316522 37
163 3300009177 Ga0105248_11256289 Ga0105248_112562893 37
164 3300009545 Ga0105237_10000003 Ga0105237_1000000394 37
165 3300009545 Ga0105237_10000018 Ga0105237_1000001827 37
166 3300009545 Ga0105237_10101803 Ga0105237_101018033 37
167 3300009551 Ga0105238_10000255 Ga0105238_1000025525 37
168 3300009551 Ga0105238_10018549 Ga0105238_1001854910 37
169 3300009551 Ga0105238_10058741 Ga0105238_100587414 37
170 3300009551 Ga0105238_10073921 Ga0105238_100739216 37
171 3300009551 Ga0105238_10207957 Ga0105238_102079573 37
172 3300009553 Ga0105249_11028563 Ga0105249_110285632 37
173 3300009553 Ga0105249_11765687 Ga0105249_117656872 37
174 3300010159 Ga0099796_10066540 Ga0099796_100665402 37
175 3300010375 Ga0105239_10001561 Ga0105239_1000156122 37
176 3300010375 Ga0105239_10763772 Ga0105239_107637722 37
177 3300011119 Ga0105246_10328381 Ga0105246_103283813 37
178 3300011119 Ga0105246_11672177 Ga0105246_116721772 37
179 3300012503 Ga0157313_1021621 Ga0157313_10216211 37
180 3300013100 Ga0157373_10464664 Ga0157373_104646643 37
181 3300013102 Ga0157371_10282570 Ga0157371_102825703 37
182 3300013104 Ga0157370_10394595 Ga0157370_103945953 37
183 3300013104 Ga0157370_10666108 Ga0157370_106661081 37
184 3300013104 Ga0157370_11448891 Ga0157370_114488911 37
185 3300013296 Ga0157374_10000565 Ga0157374_1000056525 37
186 3300013296 Ga0157374_10171084 Ga0157374_101710842 37
187 3300013296 Ga0157374_11451744 Ga0157374_114517442 37
188 3300013296 Ga0157374_11868993 Ga0157374_118689932 37
189 3300013297 Ga0157378_10415240 Ga0157378_104152403 37
190 3300013297 Ga0157378_11909340 Ga0157378_119093402 37
191 3300013306 Ga0163162_10231885 Ga0163162_102318855 37
192 3300013306 Ga0163162_10961964 Ga0163162_109619642 37
193 3300013306 Ga0163162_11743616 Ga0163162_117436162 37
194 3300013307 Ga0157372_10023803 Ga0157372_100238036 37
195 3300013307 Ga0157372_11549147 Ga0157372_115491472 37
196 3300013307 Ga0157372_11900300 Ga0157372_119003002 37
197 3300013307 Ga0157372_12583516 Ga0157372_125835162 37
198 3300013307 Ga0157372_13376633 Ga0157372_133766331 37
199 3300013308 Ga0157375_10043964 Ga0157375_100439643 37
200 3300013308 Ga0157375_10426876 Ga0157375_104268763 37
201 3300013308 Ga0157375_13136060 Ga0157375_131360602 37
202 3300014325 Ga0163163_10000689 Ga0163163_1000068921 37
203 3300014325 Ga0163163_11499838 Ga0163163_114998382 37
204 3300014326 Ga0157380_10057818 Ga0157380_100578184 37
205 3300014326 Ga0157380_10173058 Ga0157380_101730582 37
206 3300014326 Ga0157380_10255211 Ga0157380_102552113 37
207 3300014326 Ga0157380_10588049 Ga0157380_105880492 37
208 3300014745 Ga0157377_10091916 Ga0157377_100919163 37
209 3300014968 Ga0157379_10021635 Ga0157379_1002163510 37
210 3300014968 Ga0157379_10727069 Ga0157379_107270692 37
211 3300014969 Ga0157376_10200736 Ga0157376_102007364 37
212 3300014969 Ga0157376_11542577 Ga0157376_115425772 37
213 3300014969 Ga0157376_11888675 Ga0157376_118886753 37
214 3300017792 Ga0163161_10500951 Ga0163161_105009513 37
215 3300017792 Ga0163161_10747660 Ga0163161_107476602 37
216 3300020069 Ga0197907_10220943 Ga0197907_102209432 37
217 3300020069 Ga0197907_10711641 Ga0197907_107116415 37
218 3300020069 Ga0197907_11244701 Ga0197907_112447012 37
219 3300020070 Ga0206356_10044123 Ga0206356_100441233 37
220 3300020070 Ga0206356_10421265 Ga0206356_104212652 37
221 3300020070 Ga0206356_11631052 Ga0206356_116310524 37
222 3300020070 Ga0206356_11659187 Ga0206356_116591872 37
223 3300020075 Ga0206349_1379836 Ga0206349_13798362 37
224 3300020075 Ga0206349_1742955 Ga0206349_17429552 37
225 3300020075 Ga0206349_1877552 Ga0206349_18775522 37
226 3300020076 Ga0206355_1134509 Ga0206355_11345092 37
227 3300020076 Ga0206355_1282490 Ga0206355_12824902 37
228 3300020076 Ga0206355_1644566 Ga0206355_16445661 37
229 3300020077 Ga0206351_10148588 Ga0206351_101485882 37
230 3300020077 Ga0206351_10334049 Ga0206351_103340493 37
231 3300020077 Ga0206351_11004140 Ga0206351_110041401 37
232 3300020078 Ga0206352_10067258 Ga0206352_100672583 37
233 3300020078 Ga0206352_10603617 Ga0206352_106036172 37
234 3300020078 Ga0206352_10675711 Ga0206352_106757113 37
235 3300020078 Ga0206352_10965755 Ga0206352_109657554 37
236 3300020080 Ga0206350_10495714 Ga0206350_104957142 37
237 3300020080 Ga0206350_10589595 Ga0206350_105895956 37
238 3300020080 Ga0206350_10617597 Ga0206350_106175971 37
239 3300020080 Ga0206350_11522585 Ga0206350_115225852 37
240 3300020081 Ga0206354_10584469 Ga0206354_105844693 37
241 3300020081 Ga0206354_11150211 Ga0206354_111502113 37
242 3300020081 Ga0206354_11215086 Ga0206354_112150862 37
243 3300020081 Ga0206354_11538367 Ga0206354_115383672 37
244 3300020082 Ga0206353_10705318 Ga0206353_107053183 37
245 3300020082 Ga0206353_11282332 Ga0206353_112823323 37
246 3300021388 Ga0213875_10008240 Ga0213875_100082403 37
247 3300022467 Ga0224712_10005496 Ga0224712_100054961 37
248 3300022467 Ga0224712_10096658 Ga0224712_100966582 37
249 3300025224 Ga0209784_100035 Ga0209784_100035156 37
250 3300025225 Ga0209566_100040 Ga0209566_100040156 37
251 3300025226 Ga0209674_100057 Ga0209674_100057156 37
252 3300025230 Ga0209563_100059 Ga0209563_100059156 37
253 3300025253 Ga0209677_100036 Ga0209677_100036156 37
254 3300025261 Ga0209233_1007528 Ga0209233_10075283 37
255 3300025315 Ga0207697_10379362 Ga0207697_103793621 37
256 3300025321 Ga0207656_10006493 Ga0207656_100064934 37
257 3300025728 Ga0207655_1093612 Ga0207655_10936122 37
258 3300025885 Ga0207653_10216535 Ga0207653_102165352 37
259 3300025898 Ga0207692_10123816 Ga0207692_101238163 37
260 3300025900 Ga0207710_10074914 Ga0207710_100749143 37
261 3300025903 Ga0207680_10011802 Ga0207680_100118026 37
262 3300025903 Ga0207680_11035760 Ga0207680_110357601 37
263 3300025904 Ga0207647_10529481 Ga0207647_105294812 37
264 3300025905 Ga0207685_10006968 Ga0207685_100069683 37
265 3300025905 Ga0207685_10013875 Ga0207685_100138753 37
266 3300025906 Ga0207699_10000308 Ga0207699_1000030812 37
267 3300025906 Ga0207699_10551424 Ga0207699_105514242 37
268 3300025907 Ga0207645_10521243 Ga0207645_105212432 37
269 3300025908 Ga0207643_10112955 Ga0207643_101129552 37
270 3300025908 Ga0207643_10327275 Ga0207643_103272753 37
271 3300025908 Ga0207643_10643446 Ga0207643_106434462 37
272 3300025909 Ga0207705_10004481 Ga0207705_100044812 37
273 3300025909 Ga0207705_10343948 Ga0207705_103439482 37
274 3300025911 Ga0207654_11104665 Ga0207654_111046652 37
275 3300025912 Ga0207707_10004838 Ga0207707_1000483822 37
276 3300025913 Ga0207695_10001345 Ga0207695_1000134525 37
277 3300025913 Ga0207695_10035918 Ga0207695_100359183 37
278 3300025913 Ga0207695_11224513 Ga0207695_112245132 37
279 3300025914 Ga0207671_10000012 Ga0207671_10000012410 37
280 3300025914 Ga0207671_10000714 Ga0207671_1000071431 37
281 3300025914 Ga0207671_10001558 Ga0207671_100015584 37
282 3300025914 Ga0207671_11434308 Ga0207671_114343082 37
283 3300025915 Ga0207693_10071595 Ga0207693_100715953 37
284 3300025916 Ga0207663_10011890 Ga0207663_100118905 37
285 3300025916 Ga0207663_11683548 Ga0207663_116835482 37
286 3300025917 Ga0207660_10086706 Ga0207660_100867063 37
287 3300025918 Ga0207662_10130416 Ga0207662_101304163 37
288 3300025919 Ga0207657_10047148 Ga0207657_100471485 37
289 3300025919 Ga0207657_10068489 Ga0207657_100684892 37
290 3300025919 Ga0207657_10132449 Ga0207657_101324494 37
291 3300025921 Ga0207652_10021342 Ga0207652_1002134211 37
292 3300025921 Ga0207652_10174103 Ga0207652_101741034 37
293 3300025923 Ga0207681_10031326 Ga0207681_100313265 37
294 3300025923 Ga0207681_11148537 Ga0207681_111485372 37
295 3300025924 Ga0207694_10000193 Ga0207694_1000019354 37
296 3300025924 Ga0207694_10022816 Ga0207694_100228164 37
297 3300025924 Ga0207694_10050367 Ga0207694_100503673 37
298 3300025924 Ga0207694_10057611 Ga0207694_100576114 37
299 3300025924 Ga0207694_10950533 Ga0207694_109505332 37
300 3300025925 Ga0207650_10094616 Ga0207650_100946163 37
301 3300025925 Ga0207650_11641402 Ga0207650_116414021 37
302 3300025926 Ga0207659_10338992 Ga0207659_103389923 37
303 3300025926 Ga0207659_10731023 Ga0207659_107310232 37
304 3300025926 Ga0207659_11171147 Ga0207659_111711472 37
305 3300025927 Ga0207687_10033278 Ga0207687_100332784 37
306 3300025928 Ga0207700_10000991 Ga0207700_1000099117 37
307 3300025928 Ga0207700_10189334 Ga0207700_101893343 37
308 3300025928 Ga0207700_11715757 Ga0207700_117157572 37
309 3300025929 Ga0207664_10020594 Ga0207664_100205945 37
310 3300025929 Ga0207664_10062641 Ga0207664_100626414 37
311 3300025931 Ga0207644_10003510 Ga0207644_1000351017 37
312 3300025931 Ga0207644_10561696 Ga0207644_105616963 37
313 3300025932 Ga0207690_11121402 Ga0207690_111214022 37
314 3300025933 Ga0207706_10121963 Ga0207706_101219635 37
315 3300025933 Ga0207706_10651079 Ga0207706_106510792 37
316 3300025935 Ga0207709_10211916 Ga0207709_102119163 37
317 3300025935 Ga0207709_10715725 Ga0207709_107157253 37
318 3300025936 Ga0207670_10070912 Ga0207670_100709123 37
319 3300025936 Ga0207670_10109669 Ga0207670_101096693 37
320 3300025936 Ga0207670_10713476 Ga0207670_107134763 37
321 3300025937 Ga0207669_10588982 Ga0207669_105889822 37
322 3300025938 Ga0207704_11214655 Ga0207704_112146552 37
323 3300025939 Ga0207665_11227829 Ga0207665_112278292 37
324 3300025939 Ga0207665_11432735 Ga0207665_114327352 37
325 3300025940 Ga0207691_10381119 Ga0207691_103811192 37
326 3300025940 Ga0207691_10475585 Ga0207691_104755852 37
327 3300025941 Ga0207711_10000448 Ga0207711_100004486 37
328 3300025941 Ga0207711_10247923 Ga0207711_102479234 37
329 3300025941 Ga0207711_10977861 Ga0207711_109778611 37
330 3300025941 Ga0207711_11597954 Ga0207711_115979541 37
331 3300025941 Ga0207711_11945258 Ga0207711_119452581 37
332 3300025942 Ga0207689_10072211 Ga0207689_100722113 37
333 3300025942 Ga0207689_10096116 Ga0207689_100961164 37
334 3300025942 Ga0207689_10328160 Ga0207689_103281603 37
335 3300025945 Ga0207679_10044249 Ga0207679_100442493 37
336 3300025945 Ga0207679_10118893 Ga0207679_101188933 37
337 3300025949 Ga0207667_10006290 Ga0207667_100062905 37
338 3300025949 Ga0207667_10093381 Ga0207667_100933815 37
339 3300025949 Ga0207667_10743225 Ga0207667_107432252 37
340 3300025949 Ga0207667_10938184 Ga0207667_109381842 37
341 3300025960 Ga0207651_10002125 Ga0207651_1000212515 37
342 3300025960 Ga0207651_10523101 Ga0207651_105231013 37
343 3300025960 Ga0207651_10699287 Ga0207651_106992872 37
344 3300025960 Ga0207651_11340986 Ga0207651_113409863 37
345 3300025961 Ga0207712_11053041 Ga0207712_110530412 37
346 3300025961 Ga0207712_11127522 Ga0207712_111275222 37
347 3300025961 Ga0207712_11374314 Ga0207712_113743141 37
348 3300025972 Ga0207668_10035020 Ga0207668_100350203 37
349 3300025972 Ga0207668_10078777 Ga0207668_100787772 37
350 3300025972 Ga0207668_10894439 Ga0207668_108944392 37
351 3300025981 Ga0207640_10011828 Ga0207640_100118285 37
352 3300025981 Ga0207640_11013612 Ga0207640_110136122 37
353 3300025986 Ga0207658_10082604 Ga0207658_100826044 37
354 3300025986 Ga0207658_10515890 Ga0207658_105158903 37
355 3300025986 Ga0207658_11091198 Ga0207658_110911982 37
356 3300026023 Ga0207677_10000253 Ga0207677_100002533 37
357 3300026023 Ga0207677_10136423 Ga0207677_101364232 37
358 3300026035 Ga0207703_10000517 Ga0207703_1000051725 37
359 3300026035 Ga0207703_10285608 Ga0207703_102856083 37
360 3300026035 Ga0207703_10334329 Ga0207703_103343293 37
361 3300026035 Ga0207703_11160314 Ga0207703_111603141 37
362 3300026035 Ga0207703_11172151 Ga0207703_111721512 37
363 3300026041 Ga0207639_10840560 Ga0207639_108405602 37
364 3300026041 Ga0207639_11515419 Ga0207639_115154192 37
365 3300026041 Ga0207639_11689583 Ga0207639_116895832 37
366 3300026067 Ga0207678_10647148 Ga0207678_106471482 37
367 3300026075 Ga0207708_10068366 Ga0207708_100683663 37
368 3300026075 Ga0207708_10203657 Ga0207708_102036572 37
369 3300026075 Ga0207708_10290653 Ga0207708_102906533 37
370 3300026075 Ga0207708_10655378 Ga0207708_106553783 37
371 3300026075 Ga0207708_11258390 Ga0207708_112583903 37
372 3300026078 Ga0207702_10117033 Ga0207702_101170334 37
373 3300026078 Ga0207702_10227221 Ga0207702_102272213 37
374 3300026078 Ga0207702_10687179 Ga0207702_106871792 37
375 3300026089 Ga0207648_10342134 Ga0207648_103421343 37
376 3300026089 Ga0207648_10400882 Ga0207648_104008822 37
377 3300026089 Ga0207648_10648555 Ga0207648_106485553 37
378 3300026089 Ga0207648_11335037 Ga0207648_113350371 37
379 3300026095 Ga0207676_10000167 Ga0207676_1000016738 37
380 3300026095 Ga0207676_10830472 Ga0207676_108304723 37
381 3300026095 Ga0207676_11616135 Ga0207676_116161352 37
382 3300026116 Ga0207674_10005520 Ga0207674_1000552023 37
383 3300026116 Ga0207674_10113606 Ga0207674_101136063 37
384 3300026116 Ga0207674_10120228 Ga0207674_101202283 37
385 3300026116 Ga0207674_11044975 Ga0207674_110449752 37
386 3300026118 Ga0207675_100150895 Ga0207675_1001508952 37
387 3300026118 Ga0207675_100688378 Ga0207675_1006883783 37
388 3300026118 Ga0207675_101132999 Ga0207675_1011329991 37
389 3300026118 Ga0207675_101816036 Ga0207675_1018160361 37
390 3300026118 Ga0207675_102572156 Ga0207675_1025721561 37
391 3300026121 Ga0207683_10000965 Ga0207683_1000096521 37
392 3300026121 Ga0207683_10440010 Ga0207683_104400103 37
393 3300026121 Ga0207683_10937359 Ga0207683_109373593 37
394 3300026142 Ga0207698_10025720 Ga0207698_100257205 37
395 3300027111 Ga0209281_1028607 Ga0209281_10286072 37
396 3300027682 Ga0209971_1105709 Ga0209971_11057092 37
397 3300027695 Ga0209966_1040538 Ga0209966_10405382 37
398 3300027907 Ga0207428_10044112 Ga0207428_100441122 37
399 3300027907 Ga0207428_10120599 Ga0207428_101205992 37
400 3300027907 Ga0207428_10591014 Ga0207428_105910142 37
401 3300028379 Ga0268266_10005004 Ga0268266_1000500417 37
402 3300028379 Ga0268266_10329216 Ga0268266_103292162 37
403 3300028379 Ga0268266_10644748 Ga0268266_106447483 37
404 3300028379 Ga0268266_11060310 Ga0268266_110603102 37
405 3300028380 Ga0268265_10141646 Ga0268265_101416463 37
406 3300028380 Ga0268265_10279504 Ga0268265_102795043 37
407 3300028380 Ga0268265_11494274 Ga0268265_114942741 37
408 3300028380 Ga0268265_12083714 Ga0268265_120837142 37
409 3300028381 Ga0268264_10096171 Ga0268264_100961715 37
410 3300028381 Ga0268264_10228753 Ga0268264_102287533 37
411 3300028381 Ga0268264_10306818 Ga0268264_103068182 37
412 3300028381 Ga0268264_11062254 Ga0268264_110622542 37
413 3300028381 Ga0268264_11274607 Ga0268264_112746072 37
414 3300028558 Ga0265326_10059715 Ga0265326_100597153 37
415 3300028563 Ga0265319_1021197 Ga0265319_10211972 37
416 3300028573 Ga0265334_10022641 Ga0265334_100226413 37
417 3300028577 Ga0265318_10000384 Ga0265318_1000038433 37
418 3300028577 Ga0265318_10019144 Ga0265318_100191443 37
419 3300028653 Ga0265323_10025795 Ga0265323_100257954 37
420 3300028666 Ga0265336_10043926 Ga0265336_100439263 37
421 3300028794 Ga0307515_10000015 Ga0307515_10000015216 37
422 3300028800 Ga0265338_10123565 Ga0265338_101235654 37
423 3300029957 Ga0265324_10111600 Ga0265324_101116002 37
424 3300031235 Ga0265330_10001669 Ga0265330_1000166917 37
425 3300031235 Ga0265330_10089801 Ga0265330_100898012 37
426 3300031238 Ga0265332_10002023 Ga0265332_1000202321 37
427 3300031239 Ga0265328_10001448 Ga0265328_1000144811 37
428 3300031240 Ga0265320_10004792 Ga0265320_100047927 37
429 3300031241 Ga0265325_10045951 Ga0265325_100459513 37
430 3300031242 Ga0265329_10000733 Ga0265329_100007338 37
431 3300031249 Ga0265339_10027395 Ga0265339_100273955 37
432 3300031250 Ga0265331_10001210 Ga0265331_1000121012 37
433 3300031344 Ga0265316_10013594 Ga0265316_100135946 37
434 3300031344 Ga0265316_10021674 Ga0265316_100216749 37
435 3300031595 Ga0265313_10098541 Ga0265313_100985412 37
436 3300031665 Ga0316575_10031569 Ga0316575_100315692 37
437 3300031665 Ga0316575_10247797 Ga0316575_102477971 37
438 3300031691 Ga0316579_10206015 Ga0316579_102060152 37
439 3300031711 Ga0265314_10015705 Ga0265314_100157059 37
440 3300031711 Ga0265314_10061333 Ga0265314_100613332 37
441 3300031712 Ga0265342_10002136 Ga0265342_1000213625 37
442 3300031712 Ga0265342_10008211 Ga0265342_100082112 37
443 3300031727 Ga0316576_10028305 Ga0316576_100283052 37
444 3300031727 Ga0316576_10029824 Ga0316576_100298242 37
445 3300031727 Ga0316576_10048859 Ga0316576_100488591 37
446 3300031727 Ga0316576_10322013 Ga0316576_103220134 37
447 3300031727 Ga0316576_11032611 Ga0316576_110326111 37
448 3300031728 Ga0316578_10004705 Ga0316578_100047059 37
449 3300031728 Ga0316578_10151550 Ga0316578_101515503 37
450 3300031733 Ga0316577_10001901 Ga0316577_1000190116 37
451 3300031733 Ga0316577_10077453 Ga0316577_100774534 37
452 3300031824 Ga0307413_11890328 Ga0307413_118903282 37
453 3300031995 Ga0307409_100222795 Ga0307409_1002227953 37
454 3300032126 Ga0307415_100734463 Ga0307415_1007344632 37
455 3300032168 Ga0316593_10001600 Ga0316593_100016004 37
456 3300032168 Ga0316593_10001816 Ga0316593_1000181610 37
457 3300032168 Ga0316593_10010408 Ga0316593_100104082 37
458 3300032168 Ga0316593_10015184 Ga0316593_100151841 37
459 3300032168 Ga0316593_10016431 Ga0316593_100164313 37
460 3300032168 Ga0316593_10057021 Ga0316593_100570212 37
461 3300033529 Ga0316587_1000999 Ga0316587_10009992 37
462 3300033541 Ga0316596_1000468 Ga0316596_100046810 37
463 3300033541 Ga0316596_1000731 Ga0316596_10007316 37
464 3300033541 Ga0316596_1000881 Ga0316596_10008815 37
465 3300033541 Ga0316596_1050135 Ga0316596_10501353 37
466 3300034820 Ga0373959_0167930 Ga0373959_0167930_350_466 37
467 3300035086 Ga0373934_0001385 Ga0373934_0001385_5410_5523 37
468 3300035111 Ga0373923_0047756 Ga0373923_0047756_761_874 37
469 3300035111 Ga0373923_0378272 Ga0373923_0378272_341_454 37
470 3300035114 Ga0373939_0398737 Ga0373939_0398737_230_343 37
471 3300035114 Ga0373939_0440593 Ga0373939_0440593_68_184 37
472 3300035116 Ga0373945_0054355 Ga0373945_0054355_38_151 37
473 3300035118 Ga0373954_0006676 Ga0373954_0006676_4315_4428 37
474 3300035118 Ga0373954_0205454 Ga0373954_0205454_133_246 37
475 3300035118 Ga0373954_0258927 Ga0373954_0258927_406_519 37
476 3300035119 Ga0373956_0071216 Ga0373956_0071216_747_860 37
477 3300035120 Ga0373957_0144986 Ga0373957_0144986_59_172 37
478 3300035120 Ga0373957_0191407 Ga0373957_0191407_478_591 37
479 3300035120 Ga0373957_0301913 Ga0373957_0301913_393_506 37
480 3300035121 Ga0373960_0245584 Ga0373960_0245584_482_598 37
481 3300035170 Ga0373943_0074897 Ga0373943_0074897_631_744 37
482 3300035171 Ga0373946_0025750 Ga0373946_0025750_629_742 37
483 3300035172 Ga0373955_0025147 Ga0373955_0025147_2208_2321 37
484 3300035172 Ga0373955_0043559 Ga0373955_0043559_2209_2322 37
485 3300035398 Ga0316574_0007731 Ga0316574_0007731_3851_3967 37
486 3300035398 Ga0316574_0008846 Ga0316574_0008846_3652_3765 37
487 3300035398 Ga0316574_0016945 Ga0316574_0016945_3904_4020 37
488 3300035398 Ga0316574_0133269 Ga0316574_0133269_982_1095 37
489 3300035398 Ga0316574_0162122 Ga0316574_0162122_1042_1155 37
490 3300035398 Ga0316574_0334063 Ga0316574_0334063_838_951 37
491 3300035398 Ga0316574_0400668 Ga0316574_0400668_221_334 37
492 3300035410 Ga0373924_0000835 Ga0373924_0000835_5918_6031 37
493 3300035410 Ga0373924_0221830 Ga0373924_0221830_298_411 37
494 3300035692 Ga0373935_0089342 Ga0373935_0089342_455_568 37
495 3300035692 Ga0373935_0542041 Ga0373935_0542041_446_559 37
496 3300035695 Ga0373927_0091323 Ga0373927_0091323_623_736 37
497 3300035724 Ga0373933_0025007 Ga0373933_0025007_1231_1344 37
498 3300035724 Ga0373933_0300637 Ga0373933_0300637_712_825 37
499 3300035725 Ga0373947_0008078 Ga0373947_0008078_4703_4816 37
500 3300036401 Ga0373937_0089730 Ga0373937_0089730_2219_2332 37
501 3300036401 Ga0373937_0382796 Ga0373937_0382796_906_1019 37
502 3300036401 Ga0373937_0518832 Ga0373937_0518832_380_493 37
503 3300036401 Ga0373937_0547322 Ga0373937_0547322_204_317 37
504 3300036401 Ga0373937_0763192 Ga0373937_0763192_82_195 37
505 3300036401 Ga0373937_0765285 Ga0373937_0765285_393_506 37
506 3300036401 Ga0373937_1438801 Ga0373937_1438801_26_139 37
507 3300036401 Ga0373937_1701606 Ga0373937_1701606_369_482 37
508 3300036457 Ga0265778_013571 Ga0265778_013571_629_742 37
509 3300036647 Ga0316582_0048063 Ga0316582_0048063_2357_2470 37
510 3300036647 Ga0316582_0089782 Ga0316582_0089782_1011_1127 37
511 3300036647 Ga0316582_0114600 Ga0316582_0114600_339_452 37
512 3300036712 Ga0316584_0017973 Ga0316584_0017973_1789_1902 37
513 3300036712 Ga0316584_0036925 Ga0316584_0036925_1952_2068 37
514 3300036712 Ga0316584_0037746 Ga0316584_0037746_758_871 37
515 3300036712 Ga0316584_0047025 Ga0316584_0047025_337_453 37
516 3300036712 Ga0316584_0420865 Ga0316584_0420865_774_887 37
517 3300036712 Ga0316584_0740546 Ga0316584_0740546_442_555 37
518 3300037068 Ga0373925_0002179 Ga0373925_0002179_8623_8736 37
519 3300037068 Ga0373925_0325801 Ga0373925_0325801_132_245 37
520 3300037068 Ga0373925_0847398 Ga0373925_0847398_125_238 37
521 3300037068 Ga0373925_1081285 Ga0373925_1081285_431_544 37
522 3300037068 Ga0373925_1650948 Ga0373925_1650948_396_509 37
523 3300037312 Ga0395899_0005268 Ga0395899_0005268_3356_3469 37
524 3300037312 Ga0395899_0673616 Ga0395899_0673616_59_172 37
525 3300037418 Ga0395900_0011458 Ga0395900_0011458_1588_1701 37
526 3300037418 Ga0395900_0375400 Ga0395900_0375400_998_1111 37
527 3300037418 Ga0395900_1628004 Ga0395900_1628004_243_356 37
528 3300037466 Ga0395898_0105030 Ga0395898_0105030_1463_1576 37
529 3300037471 Ga0395905_0000127 Ga0395905_0000127_41630_41743 37
530 3300037471 Ga0395905_0000938 Ga0395905_0000938_16154_16267 37
531 3300037588 Ga0316581_0054133 Ga0316581_0054133_996_1109 37
532 3300037853 Ga0436364_0945409 Ga0436364_0945409_19969_20082 37
533 3300038725 Ga0400484_27221 Ga0400484_27221_7694_7807 37
534 3300038725 Ga0400484_44058 Ga0400484_44058_7800_7913 37
535 3300038726 Ga0400490_00204 Ga0400490_00204_1644_1757 37
536 3300038726 Ga0400490_00437 Ga0400490_00437_10627_10740 37
537 3300038726 Ga0400490_07011 Ga0400490_07011_5141_5254 37
538 3300038726 Ga0400490_07361 Ga0400490_07361_11452_11565 37
539 3300038726 Ga0400490_39901 Ga0400490_39901_10716_10829 37
540 3300038726 Ga0400490_57192 Ga0400490_57192_1052_1165 37
541 3300038727 Ga0400491_00552 Ga0400491_00552_1517_1630 37
542 3300038727 Ga0400491_01651 Ga0400491_01651_1143_1256 37
543 3300038727 Ga0400491_18291 Ga0400491_18291_20_133 37
544 3300038735 Ga0400485_09439 Ga0400485_09439_2203_2316 37
545 3300038735 Ga0400485_11168 Ga0400485_11168_1692_1805 37
546 3300038735 Ga0400485_11310 Ga0400485_11310_1053_1166 37
547 3300038735 Ga0400485_19181 Ga0400485_19181_44359_44472 37
548 3300038741 Ga0400488_06448 Ga0400488_06448_2146_2259 37
549 3300038741 Ga0400488_07418 Ga0400488_07418_2968_3081 37
550 3300038741 Ga0400488_12334 Ga0400488_12334_4153_4266 37
551 3300038741 Ga0400488_32083 Ga0400488_32083_2214_2327 37
552 3300038741 Ga0400488_40771 Ga0400488_40771_535_648 37
553 3300038741 Ga0400488_43096 Ga0400488_43096_1458_1571 37
554 3300038741 Ga0400488_48044 Ga0400488_48044_349_462 37
555 3300038741 Ga0400488_51157 Ga0400488_51157_4262_4375 37
556 3300038742 Ga0400486_01341 Ga0400486_01341_4404_4517 37
557 3300038742 Ga0400486_05487 Ga0400486_05487_978_1091 37
558 3300038742 Ga0400486_18812 Ga0400486_18812_650_763 37
559 3300038742 Ga0400486_25543 Ga0400486_25543_46938_47051 37
560 3300038742 Ga0400486_25694 Ga0400486_25694_3487_3600 37
561 3300039062 Ga0400483_020927 Ga0400483_020927_70_183 37
562 3300039062 Ga0400483_027826 Ga0400483_027826_458_571 37
563 3300039062 Ga0400483_094874 Ga0400483_094874_1790_1903 37
564 3300039062 Ga0400483_140144 Ga0400483_140144_11273_11386 37
565 3300039062 Ga0400483_151841 Ga0400483_151841_599_712 37
566 3300039062 Ga0400483_233637 Ga0400483_233637_5479_5592 37
567 3300039062 Ga0400483_256259 Ga0400483_256259_578_691 37
568 3300039093 Ga0400489_14975 Ga0400489_14975_895_1008 37
569 3300039093 Ga0400489_50866 Ga0400489_50866_99_212 37
570 3300039110 Ga0400487_00070 Ga0400487_00070_1923_2036 37
571 3300039110 Ga0400487_06498 Ga0400487_06498_2898_3011 37
572 3300039110 Ga0400487_29008 Ga0400487_29008_10656_10769 37
573 3300039110 Ga0400487_33555 Ga0400487_33555_64262_64375 37
574 3300039110 Ga0400487_34004 Ga0400487_34004_1048_1161 37
575 3300039110 Ga0400487_58155 Ga0400487_58155_5019_5132 37
576 3300039110 Ga0400487_60113 Ga0400487_60113_2286_2399 37
577 3300039437 Ga0436365_1189349 Ga0436365_1189349_67_180 37
578 3300039437 Ga0436365_1396723 Ga0436365_1396723_66_179 37
579 3300039447 Ga0436361_0391791 Ga0436361_0391791_11398_11511 37
580 3300041408 Ga0439453_0021918 Ga0439453_0021918_732_845 37
581 3300041456 Ga0451795_1180726 Ga0451795_1180726_259_372 37
582 3300041486 Ga0451807_0006965 Ga0451807_0006965_854_967 37
583 3300042125 Ga0450923_038197 Ga0450923_038197_733_846 37
584 3300042128 Ga0450897_018808 Ga0450897_018808_425_538 37
585 3300042131 Ga0450894_002033 Ga0450894_002033_1550_1663 37
586 3300042133 Ga0450896_005414 Ga0450896_005414_1575_1688 37
587 3300042133 Ga0450896_037702 Ga0450896_037702_454_567 37
588 3300042145 Ga0450906_009432 Ga0450906_009432_289_402 37
589 3300042184 Ga0450908_020484 Ga0450908_020484_490_603 37
590 3300042435 Ga0439434_0133237 Ga0439434_0133237_634_747 37
591 3300042436 Ga0439435_0153989 Ga0439435_0153989_586_699 37
592 3300042436 Ga0439435_0195376 Ga0439435_0195376_515_628 37
593 3300042876 Ga0451577_0000016 Ga0451577_0000016_446521_446637 37
594 3300042876 Ga0451577_0000337 Ga0451577_0000337_82525_82638 37
595 3300042876 Ga0451577_0083369 Ga0451577_0083369_1055_1168 37
596 3300042876 Ga0451577_0129292 Ga0451577_0129292_495_608 37
597 3300042876 Ga0451577_0160056 Ga0451577_0160056_409_522 37
598 3300042876 Ga0451577_0417431 Ga0451577_0417431_440_556 37
599 3300042876 Ga0451577_1789191 Ga0451577_1789191_413_526 37
600 3300044673 Ga0453683_0017367 Ga0453683_0017367_2410_2523 37
601 3300044673 Ga0453683_0036858 Ga0453683_0036858_2596_2709 37
602 3300044673 Ga0453683_0043820 Ga0453683_0043820_1779_1892 37
603 3300044673 Ga0453683_0270063 Ga0453683_0270063_519_683 37
604 3300044673 Ga0453683_0423433 Ga0453683_0423433_279_392 37
605 3300044673 Ga0453683_0866875 Ga0453683_0866875_307_441 37
606 3300044693 Ga0466961_0460957 Ga0466961_0460957_553_666 37
607 3300044712 Ga0453684_0000197 Ga0453684_0000197_123053_123166 37
608 3300044712 Ga0453684_0020865 Ga0453684_0020865_7425_7538 37
609 3300044712 Ga0453684_0041859 Ga0453684_0041859_3782_3895 37
610 3300044712 Ga0453684_0072448 Ga0453684_0072448_2754_2867 37
611 3300044712 Ga0453684_0282064 Ga0453684_0282064_919_1032 37
612 3300044712 Ga0453684_0476020 Ga0453684_0476020_1117_1230 37
613 3300044712 Ga0453684_0769933 Ga0453684_0769933_633_746 37
614 3300044712 Ga0453684_1478571 Ga0453684_1478571_92_205 37
615 3300044712 Ga0453684_1597238 Ga0453684_1597238_262_375 37
616 3300045049 Ga0466959_1178671 Ga0466959_1178671_372_485 37
617 3300045051 Ga0451576_0000971 Ga0451576_0000971_13896_14009 37
618 3300045051 Ga0451576_0032619 Ga0451576_0032619_3376_3489 37
619 3300045051 Ga0451576_0141552 Ga0451576_0141552_2330_2443 37
620 3300045051 Ga0451576_0236352 Ga0451576_0236352_1108_1224 37
621 3300045051 Ga0451576_1292967 Ga0451576_1292967_162_275 37
622 3300045051 Ga0451576_1942103 Ga0451576_1942103_370_483 37
623 3300045976 Ga0466967_1730035 Ga0466967_1730035_59_175 37
624 3300045976 Ga0466967_2166614 Ga0466967_2166614_404_520 37
625 3300046455 Ga0495603_0042618 Ga0495603_0042618_353_466 37
626 3300046455 Ga0495603_0335295 Ga0495603_0335295_684_797 37
627 3300046459 Ga0495629_0000007 Ga0495629_0000007_292352_292465 37
628 3300046459 Ga0495629_0000126 Ga0495629_0000126_58738_58851 37
629 3300046459 Ga0495629_0017893 Ga0495629_0017893_995_1108 37
630 3300046472 Ga0495580_0222402 Ga0495580_0222402_279_392 37
631 3300046473 Ga0495582_0021576 Ga0495582_0021576_54_167 37
632 3300046473 Ga0495582_0034213 Ga0495582_0034213_1882_1995 37
633 3300046475 Ga0495639_0000121 Ga0495639_0000121_10200_10313 37
634 3300046475 Ga0495639_0002018 Ga0495639_0002018_3796_3909 37
635 3300046475 Ga0495639_0012434 Ga0495639_0012434_1066_1179 37
636 3300046476 Ga0495662_0015298 Ga0495662_0015298_2364_2477 37
637 3300046476 Ga0495662_0484051 Ga0495662_0484051_344_457 37
638 3300046477 Ga0495664_0072557 Ga0495664_0072557_344_457 37
639 3300046477 Ga0495664_0127669 Ga0495664_0127669_638_751 37
640 3300046499 Ga0495594_0009365 Ga0495594_0009365_2372_2485 37
641 3300046499 Ga0495594_0048874 Ga0495594_0048874_370_483 37
642 3300046499 Ga0495594_0285119 Ga0495594_0285119_692_805 37
643 3300046511 Ga0495608_0179275 Ga0495608_0179275_796_909 37
644 3300046514 Ga0495618_0313472 Ga0495618_0313472_309_422 37
645 3300046525 Ga0495663_0364184 Ga0495663_0364184_28_141 37
646 3300046533 Ga0495640_0229383 Ga0495640_0229383_98_211 37
647 3300046533 Ga0495640_0263194 Ga0495640_0263194_912_1025 37
648 3300046533 Ga0495640_0636877 Ga0495640_0636877_31_144 37
649 3300046535 Ga0495586_0000999 Ga0495586_0000999_1501_1614 37
650 3300046535 Ga0495586_0012323 Ga0495586_0012323_4353_4466 37
651 3300046535 Ga0495586_0395426 Ga0495586_0395426_200_313 37
652 3300046536 Ga0495587_0174480 Ga0495587_0174480_455_568 37
653 3300046536 Ga0495587_0180077 Ga0495587_0180077_199_312 37
654 3300046543 Ga0495645_0135186 Ga0495645_0135186_1080_1193 37
655 3300046557 Ga0495622_0002685 Ga0495622_0002685_424_537 37
656 3300046557 Ga0495622_0023394 Ga0495622_0023394_2270_2383 37
657 3300046558 Ga0495633_0308991 Ga0495633_0308991_248_361 37
658 3300046642 Ga0495634_0024544 Ga0495634_0024544_1693_1806 37
659 3300046663 Ga0495635_0001790 Ga0495635_0001790_2391_2504 37
660 3300046663 Ga0495635_0575039 Ga0495635_0575039_185_298 37
661 3300046663 Ga0495635_0911189 Ga0495635_0911189_58_171 37
662 3300046674 Ga0495588_0135487 Ga0495588_0135487_545_658 37
663 3300046675 Ga0495657_0373443 Ga0495657_0373443_413_526 37
664 3300046679 Ga0495623_0119350 Ga0495623_0119350_647_760 37
665 3300046681 Ga0495647_0001519 Ga0495647_0001519_5880_5993 37
666 3300046681 Ga0495647_0173245 Ga0495647_0173245_389_502 37
667 3300046681 Ga0495647_0545141 Ga0495647_0545141_322_435 37
668 3300046683 Ga0495658_0000327 Ga0495658_0000327_12846_12959 37
669 3300046683 Ga0495658_0004909 Ga0495658_0004909_4558_4671 37
670 3300046683 Ga0495658_0007921 Ga0495658_0007921_649_762 37
671 3300046683 Ga0495658_0900299 Ga0495658_0900299_295_408 37
672 3300046689 Ga0495613_0025308 Ga0495613_0025308_1767_1880 37
673 3300047315 Ga0495581_0000280 Ga0495581_0000280_16046_16159 37
674 3300047315 Ga0495581_0005862 Ga0495581_0005862_6233_6346 37
675 3300047315 Ga0495581_0193636 Ga0495581_0193636_713_826 37
676 3300047317 Ga0495604_0064977 Ga0495604_0064977_247_360 37
677 3300047319 Ga0495674_0070838 Ga0495674_0070838_1068_1181 37
678 3300047321 Ga0495676_0020676 Ga0495676_0020676_3048_3161 37
679 3300047321 Ga0495676_0040130 Ga0495676_0040130_2561_2674 37
680 3300047321 Ga0495676_0073506 Ga0495676_0073506_874_987 37
681 3300047322 Ga0495680_0000838 Ga0495680_0000838_15566_15679 37
682 3300047322 Ga0495680_0100618 Ga0495680_0100618_1138_1251 37
683 3300047322 Ga0495680_0186512 Ga0495680_0186512_1338_1451 37
684 3300047471 Ga0495684_0284558 Ga0495684_0284558_771_884 37
685 3300047471 Ga0495684_0752522 Ga0495684_0752522_409_522 37
686 3300047472 Ga0495686_0000545 Ga0495686_0000545_17371_17484 37
687 3300047472 Ga0495686_0012883 Ga0495686_0012883_4584_4697 37
688 3300047673 Ga0495593_0365057 Ga0495593_0365057_367_480 37
689 3300048089 Ga0495614_0111480 Ga0495614_0111480_808_921 37
690 3300048903 Ga0496100_0178098 Ga0496100_0178098_574_687 37
691 3300048903 Ga0496100_0663363 Ga0496100_0663363_57_173 37
692 3300048905 Ga0496102_1871623 Ga0496102_1871623_68_184 37
693 3300048907 Ga0496104_0000247 Ga0496104_0000247_39728_39841 37
694 3300048907 Ga0496104_0015885 Ga0496104_0015885_5754_5867 37
695 3300048907 Ga0496104_1098513 Ga0496104_1098513_486_599 37
696 3300048908 Ga0496105_0230741 Ga0496105_0230741_769_882 37
697 3300048909 Ga0496106_0227535 Ga0496106_0227535_980_1093 37
698 3300048909 Ga0496106_0396429 Ga0496106_0396429_207_323 37
699 3300048910 Ga0496107_0132708 Ga0496107_0132708_823_936 37
700 3300048910 Ga0496107_0808018 Ga0496107_0808018_226_342 37
701 3300048914 Ga0496111_0586178 Ga0496111_0586178_127_240 37
702 3300048915 Ga0496112_0001041 Ga0496112_0001041_19996_20109 37
703 3300048916 Ga0496113_1126530 Ga0496113_1126530_133_249 37
704 3300048917 Ga0496114_0140121 Ga0496114_0140121_637_750 37
705 3300048929 Ga0496126_0000005 Ga0496126_0000005_868611_868724 37
706 3300049570 Ga0501033_0151291 Ga0501033_0151291_533_646 37
707 3300049570 Ga0501033_0755402 Ga0501033_0755402_28_141 37
708 3300049571 Ga0501034_0054360 Ga0501034_0054360_1360_1476 37
709 3300049571 Ga0501034_0062111 Ga0501034_0062111_2156_2269 37
710 3300049572 Ga0501036_0485778 Ga0501036_0485778_806_919 37
711 3300049572 Ga0501036_0493094 Ga0501036_0493094_838_951 37
712 3300049575 Ga0501039_0863844 Ga0501039_0863844_235_348 37
713 3300049575 Ga0501039_1239915 Ga0501039_1239915_153_266 37
714 3300049578 Ga0501042_1443808 Ga0501042_1443808_348_461 37
715 3300049579 Ga0501043_0331939 Ga0501043_0331939_810_926 37
716 3300049579 Ga0501043_0980992 Ga0501043_0980992_334_447 37
717 3300049580 Ga0501046_0165569 Ga0501046_0165569_1447_1560 37
718 3300049581 Ga0501047_0085715 Ga0501047_0085715_1785_1898 37
719 3300049583 Ga0501067_0098292 Ga0501067_0098292_495_611 37
720 3300049586 Ga0501070_0634044 Ga0501070_0634044_571_684 37
721 3300049587 Ga0501071_0349175 Ga0501071_0349175_748_861 37
722 3300049587 Ga0501071_0711056 Ga0501071_0711056_283_396 37
723 3300049588 Ga0501072_1389825 Ga0501072_1389825_416_529 37
724 3300049592 Ga0501076_0646894 Ga0501076_0646894_36_149 37
725 3300049741 Ga0501079_0177238 Ga0501079_0177238_684_797 37
726 3300049743 Ga0501081_0365489 Ga0501081_0365489_913_1026 37
727 3300049822 Ga0501035_0388799 Ga0501035_0388799_949_1062 37
728 3300049822 Ga0501035_1346473 Ga0501035_1346473_423_536 37
729 3300049823 Ga0501044_0008030 Ga0501044_0008030_68_181 37
730 3300050507 nmdc:mga05p37_181505_c1 nmdc:mga05p37_181505_c1_1498_1611 37
731 3300050507 nmdc:mga05p37_229395_c1 nmdc:mga05p37_229395_c1_1252_1365 37
732 3300050507 nmdc:mga05p37_306274_c2 nmdc:mga05p37_306274_c2_1357_1470 37
733 3300050508 nmdc:mga09592_29654_c1 nmdc:mga09592_29654_c1_560_688 37
734 3300050508 nmdc:mga09592_322011_c1 nmdc:mga09592_322011_c1_958_1071 37
735 3300050509 nmdc:mga0qj67_645336_c1 nmdc:mga0qj67_645336_c1_22_135 37
736 3300050510 nmdc:mga06r32_381565_c1 nmdc:mga06r32_381565_c1_397_510 37
737 3300050511 nmdc:mga08y16_140994_c1 nmdc:mga08y16_140994_c1_417_530 37
738 3300050511 nmdc:mga08y16_175843_c1 nmdc:mga08y16_175843_c1_1883_1996 37
739 3300050511 nmdc:mga08y16_1791006_c1 nmdc:mga08y16_1791006_c1_341_454 37
740 3300050511 nmdc:mga08y16_8355_c1 nmdc:mga08y16_8355_c1_2059_2172 37
741 3300050512 nmdc:mga0n895_108823_c1 nmdc:mga0n895_108823_c1_1960_2076 37
742 3300050512 nmdc:mga0n895_203675_c1 nmdc:mga0n895_203675_c1_1225_1338 37
743 3300050513 nmdc:mga0rr50_771801_c1 nmdc:mga0rr50_771801_c1_302_418 37
744 3300050513 nmdc:mga0rr50_80996_c1 nmdc:mga0rr50_80996_c1_2069_2182 37
745 3300053077 Ga0495601_0088500 Ga0495601_0088500_495_608 37
746 3300053078 Ga0495612_0084920 Ga0495612_0084920_746_859 37
747 3300053085 Ga0495619_0001327 Ga0495619_0001327_7543_7656 37
748 3300053085 Ga0495619_0149576 Ga0495619_0149576_538_651 37
749 3300053094 Ga0500566_0008539 Ga0500566_0008539_2738_2851 37
750 3300054114 Ga0501084_0244436 Ga0501084_0244436_1096_1209 37
751 3300059478 Ga0587093_062454 Ga0587093_062454_345_458 37
752 3300059490 Ga0587066_053876 Ga0587066_053876_534_647 37
753 3300059490 Ga0587066_185908 Ga0587066_185908_84_200 37
754 3300059491 Ga0587070_064310 Ga0587070_064310_516_629 37
755 3300059491 Ga0587070_125664 Ga0587070_125664_375_488 37
756 3300059493 Ga0587077_009783 Ga0587077_009783_223_336 37
757 3300059504 Ga0587082_075400 Ga0587082_075400_451_564 37
758 3300059506 Ga0587085_020207 Ga0587085_020207_349_462 37
759 3300059508 Ga0587088_021186 Ga0587088_021186_912_1025 37
760 3300059510 Ga0587090_084712 Ga0587090_084712_492_608 37
761 3300059622 Ga0587099_024032 Ga0587099_024032_537_650 37
762 3300059642 Ga0587069_051252 Ga0587069_051252_52_165 37
763 3300059645 Ga0587076_117509 Ga0587076_117509_373_486 37
764 3300059647 Ga0587079_116296 Ga0587079_116296_444_557 37
765 3300059648 Ga0587100_012481 Ga0587100_012481_510_623 37
766 3300059652 Ga0587107_107382 Ga0587107_107382_78_191 37
767 3300059658 Ga0587119_080205 Ga0587119_080205_148_261 37
768 3300060346 Ga0587111_0063663 Ga0587111_0063663_340_453 37
769 3300060353 Ga0501082_0470562 Ga0501082_0470562_316_429 37

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00444

Ribosomal_L36

Ribosomal protein L36

8

44

0.99

Feature Viewer

pLDDT pTM Quality
84.62 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map