F479998

General Info

Members Datasets Scaffolds Average Seq Length
769 268 1538 268

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0294246|Ga0436362_0294246_96_908
Length 270
Sequence MAHAPLPLLARRSWGETMRRDAWWVYPLVVFIVLSAFLVYATWAAFQGNNYVYGPYLSPFYSPILFGSAGQFHGWISDNVPGWWPGFLTFSPALLILPFPAFFRFTCYYYRGAYYKGFWQDPTNCAVGEPRNSYLGERYFPLILQNVHRYFWYIAVIFIVILAKDAWDGLWFVGSDGAAHFGMGIGSLVLIANVVLLGGYTFGCHSARHIVGGFRDVLGGKPVSYQTYRCVSCLNRGHQNWAWCSLVMVGFADIYIRLCAMGVWHDFRLF

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
188 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
189 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
207 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
208 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
209 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
210 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
211 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
212 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
213 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
251 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
267 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 4.68
Rhizosphere 94.93
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0294246 3300039453 Bacteria 969
2 JGI25406J46586_10000410 3300003203 Bacteria 19739
3 Ga0065704_10223138 3300005289 Bacteria 1067
4 Ga0065712_10151095 3300005290 Bacteria 1369
5 Ga0065715_10005527 3300005293 Bacteria 3789
6 Ga0065715_10093030 3300005293 Bacteria 4812
7 Ga0065715_10102013 3300005293 Bacteria 3125
8 Ga0065715_10123216 3300005293 Bacteria 2183
9 Ga0065707_10257487 3300005295 Bacteria 1107
10 Ga0070676_10019236 3300005328 Bacteria 3797
11 Ga0070683_100054910 3300005329 Bacteria 3695
12 Ga0070683_100061897 3300005329 Bacteria 3479
13 Ga0070683_100310257 3300005329 Bacteria 1501
14 Ga0070683_100333679 3300005329 Bacteria 1444
15 Ga0070690_100168450 3300005330 Bacteria 1506
16 Ga0070690_100238341 3300005330 Bacteria 1282
17 Ga0070690_100326992 3300005330 Bacteria 1106
18 Ga0070670_100021696 3300005331 Bacteria 5522
19 Ga0070670_100029698 3300005331 Bacteria 4707
20 Ga0070670_100108681 3300005331 Bacteria 2390
21 Ga0070670_100315205 3300005331 Bacteria 1370
22 Ga0070677_10060995 3300005333 Bacteria 1556
23 Ga0068869_100152157 3300005334 Bacteria 1795
24 Ga0068869_100156822 3300005334 Bacteria 1769
25 Ga0068869_100206047 3300005334 Bacteria 1553
26 Ga0068869_100353222 3300005334 Bacteria 1199
27 Ga0070666_10100404 3300005335 Bacteria 1994
28 Ga0070680_100001348 3300005336 Bacteria 17759
29 Ga0070680_100055586 3300005336 Bacteria 3235
30 Ga0070680_100174935 3300005336 Bacteria 1807
31 Ga0070680_100175956 3300005336 Bacteria 1802
32 Ga0070682_100000710 3300005337 Bacteria 19958
33 Ga0068868_100002521 3300005338 Bacteria 12715
34 Ga0068868_100546040 3300005338 Bacteria 1021
35 Ga0070660_100232656 3300005339 Bacteria 1500
36 Ga0070689_100023371 3300005340 Bacteria 4627
37 Ga0070689_100126149 3300005340 Bacteria 2048
38 Ga0070689_100464529 3300005340 Bacteria 1079
39 Ga0070691_10030862 3300005341 Bacteria 2511
40 Ga0070687_100005825 3300005343 Bacteria 5012
41 Ga0070687_100086457 3300005343 Bacteria 1723
42 Ga0070661_100004254 3300005344 Bacteria 9873
43 Ga0070661_100045502 3300005344 Bacteria 3209
44 Ga0070661_100177635 3300005344 Bacteria 1619
45 Ga0070661_100243720 3300005344 Bacteria 1385
46 Ga0070692_10004794 3300005345 Bacteria 5683
47 Ga0070692_10135194 3300005345 Bacteria 1390
48 Ga0070692_10263592 3300005345 Bacteria 1037
49 Ga0070668_100000571 3300005347 Bacteria 24696
50 Ga0070668_100038115 3300005347 Bacteria 3672
51 Ga0070668_100060519 3300005347 Bacteria 2933
52 Ga0070668_100064651 3300005347 Bacteria 2836
53 Ga0070668_100227787 3300005347 Bacteria 1539
54 Ga0070669_100013946 3300005353 Bacteria 5715
55 Ga0070669_100050820 3300005353 Bacteria 3028
56 Ga0070669_100220013 3300005353 Bacteria 1501
57 Ga0070675_100000189 3300005354 Bacteria 38620
58 Ga0070675_100001673 3300005354 Bacteria 16341
59 Ga0070675_100001871 3300005354 Bacteria 15511
60 Ga0070675_100008118 3300005354 Bacteria 8139
61 Ga0070675_100070133 3300005354 Bacteria 2904
62 Ga0070675_100083495 3300005354 Bacteria 2666
63 Ga0070675_100204406 3300005354 Bacteria 1715
64 Ga0070671_100455422 3300005355 Bacteria 1098
65 Ga0070674_100025002 3300005356 Bacteria 3881
66 Ga0070674_100032595 3300005356 Bacteria 3460
67 Ga0070674_100045016 3300005356 Bacteria 3014
68 Ga0070674_100270512 3300005356 Bacteria 1342
69 Ga0070673_100025572 3300005364 Bacteria 4348
70 Ga0070673_100094904 3300005364 Bacteria 2446
71 Ga0070673_100122485 3300005364 Bacteria 2172
72 Ga0070673_100203289 3300005364 Bacteria 1707
73 Ga0070673_100455600 3300005364 Bacteria 1151
74 Ga0070673_100468859 3300005364 Bacteria 1135
75 Ga0070688_100026696 3300005365 Bacteria 3433
76 Ga0070688_100049173 3300005365 Bacteria 2623
77 Ga0070688_100189796 3300005365 Bacteria 1431
78 Ga0070659_100006496 3300005366 Bacteria 8439
79 Ga0070659_100210095 3300005366 Bacteria 1604
80 Ga0070659_100227712 3300005366 Bacteria 1540
81 Ga0070667_100243057 3300005367 Bacteria 1608
82 Ga0070667_100362151 3300005367 Bacteria 1314
83 Ga0070709_10099322 3300005434 Bacteria 1936
84 Ga0070709_10289652 3300005434 Bacteria 1193
85 Ga0070709_10368453 3300005434 Unclassified 1065
86 Ga0070714_100075675 3300005435 Bacteria 2921
87 Ga0070713_100004589 3300005436 Bacteria 9305
88 Ga0070701_10024876 3300005438 Bacteria 2901
89 Ga0070701_10043322 3300005438 Bacteria 2302
90 Ga0070701_10093161 3300005438 Bacteria 1655
91 Ga0070705_100016676 3300005440 Bacteria 3820
92 Ga0070705_100168269 3300005440 Bacteria 1472
93 Ga0070700_100052703 3300005441 Bacteria 2537
94 Ga0070700_100088070 3300005441 Bacteria 2020
95 Ga0070700_100103381 3300005441 Bacteria 1881
96 Ga0070700_100334885 3300005441 Bacteria 1116
97 Ga0070700_100344817 3300005441 Bacteria 1102
98 Ga0070694_100018394 3300005444 Bacteria 4435
99 Ga0070694_100085586 3300005444 Bacteria 2202
100 Ga0070694_100163160 3300005444 Bacteria 1637
101 Ga0070694_100249530 3300005444 Bacteria 1342
102 Ga0070694_100269779 3300005444 Bacteria 1294
103 Ga0070694_100292911 3300005444 Bacteria 1245
104 Ga0070708_100009235 3300005445 Bacteria 7949
105 Ga0070663_100055288 3300005455 Bacteria 2840
106 Ga0070663_100228577 3300005455 Bacteria 1464
107 Ga0070678_100002099 3300005456 Bacteria 10800
108 Ga0070678_100036430 3300005456 Bacteria 3444
109 Ga0070678_100135017 3300005456 Bacteria 1966
110 Ga0070678_100188836 3300005456 Bacteria 1692
111 Ga0070678_100288401 3300005456 Bacteria 1391
112 Ga0070662_100005566 3300005457 Bacteria 8051
113 Ga0070662_100073336 3300005457 Bacteria 2529
114 Ga0070681_10000875 3300005458 Bacteria 25377
115 Ga0070681_10018966 3300005458 Bacteria 6885
116 Ga0070681_10022978 3300005458 Bacteria 6267
117 Ga0070681_10087735 3300005458 Bacteria 3063
118 Ga0068867_100005586 3300005459 Bacteria 8911
119 Ga0068867_100342678 3300005459 Bacteria 1245
120 Ga0068867_100369137 3300005459 Bacteria 1202
121 Ga0070685_10091371 3300005466 Bacteria 1843
122 Ga0070706_100008245 3300005467 Bacteria 9719
123 Ga0070707_100010687 3300005468 Bacteria 8551
124 Ga0070707_100016044 3300005468 Bacteria 7027
125 Ga0070707_100597667 3300005468 Bacteria 1066
126 Ga0070698_100027099 3300005471 Bacteria 5959
127 Ga0070698_100097070 3300005471 Bacteria 2923
128 Ga0070698_100138885 3300005471 Bacteria 2383
129 Ga0070698_100295171 3300005471 Bacteria 1552
130 Ga0070698_100551810 3300005471 Bacteria 1092
131 Ga0070699_100000017 3300005518 Bacteria 201366
132 Ga0070699_100008540 3300005518 Bacteria 8877
133 Ga0070699_100029764 3300005518 Bacteria 4709
134 Ga0070699_100076020 3300005518 Bacteria 2923
135 Ga0070699_100125061 3300005518 Bacteria 2263
136 Ga0070679_100035556 3300005530 Bacteria 4943
137 Ga0070679_100404513 3300005530 Unclassified 1311
138 Ga0070679_100628655 3300005530 Bacteria 1017
139 Ga0070684_100003277 3300005535 Bacteria 12122
140 Ga0070684_100037814 3300005535 Bacteria 4143
141 Ga0070697_100001635 3300005536 Bacteria 17084
142 Ga0070697_100063072 3300005536 Bacteria 3026
143 Ga0070697_100363166 3300005536 Bacteria 1252
144 Ga0070697_100430146 3300005536 Bacteria 1148
145 Ga0070672_100010622 3300005543 Bacteria 6392
146 Ga0070672_100229634 3300005543 Bacteria 1559
147 Ga0070672_100273056 3300005543 Bacteria 1428
148 Ga0070672_100306191 3300005543 Bacteria 1348
149 Ga0070686_100001805 3300005544 Bacteria 11944
150 Ga0070686_100019786 3300005544 Bacteria 3973
151 Ga0070695_100054973 3300005545 Bacteria 2565
152 Ga0070695_100134203 3300005545 Bacteria 1709
153 Ga0070696_100021881 3300005546 Bacteria 4337
154 Ga0070696_100057176 3300005546 Bacteria 2721
155 Ga0070696_100061755 3300005546 Bacteria 2622
156 Ga0070696_100068271 3300005546 Bacteria 2496
157 Ga0070665_100150519 3300005548 Bacteria 2330
158 Ga0070665_100336171 3300005548 Bacteria 1515
159 Ga0070704_100001174 3300005549 Bacteria 13678
160 Ga0070704_100002977 3300005549 Bacteria 9630
161 Ga0070704_100023560 3300005549 Bacteria 4025
162 Ga0070704_100054878 3300005549 Unclassified 2822
163 Ga0070704_100144201 3300005549 Bacteria 1864
164 Ga0070704_100497645 3300005549 Archaea 1057
165 Ga0068855_100065764 3300005563 Bacteria 4227
166 Ga0070664_100009874 3300005564 Bacteria 7735
167 Ga0070664_100011638 3300005564 Bacteria 7139
168 Ga0070664_100104751 3300005564 Bacteria 2463
169 Ga0070664_100185507 3300005564 Bacteria 1851
170 Ga0070664_100244671 3300005564 Bacteria 1611
171 Ga0068857_100020580 3300005577 Bacteria 5805
172 Ga0068857_100023102 3300005577 Bacteria 5469
173 Ga0068857_100031078 3300005577 Bacteria 4719
174 Ga0068857_100365695 3300005577 Bacteria 1338
175 Ga0068854_100005962 3300005578 Bacteria 7718
176 Ga0068852_100003003 3300005616 Bacteria 11730
177 Ga0068852_100444929 3300005616 Bacteria 1282
178 Ga0068859_100054202 3300005617 Bacteria 4032
179 Ga0068859_100059861 3300005617 Bacteria 3837
180 Ga0068859_100106681 3300005617 Bacteria 2860
181 Ga0068859_100147656 3300005617 Bacteria 2426
182 Ga0068864_100053364 3300005618 Bacteria 3487
183 Ga0068864_100082447 3300005618 Bacteria 2822
184 Ga0068864_100342588 3300005618 Bacteria 1409
185 Ga0068864_100506008 3300005618 Bacteria 1163
186 Ga0068866_10013894 3300005718 Bacteria 3542
187 Ga0068861_100000896 3300005719 Bacteria 18082
188 Ga0068861_100040969 3300005719 Bacteria 3467
189 Ga0068861_100058404 3300005719 Bacteria 2950
190 Ga0068861_100063449 3300005719 Bacteria 2840
191 Ga0068861_100119725 3300005719 Bacteria 2122
192 Ga0068861_100188680 3300005719 Bacteria 1722
193 Ga0068851_10052612 3300005834 Bacteria 2071
194 Ga0068870_10000340 3300005840 Bacteria 17487
195 Ga0068870_10086414 3300005840 Bacteria 1745
196 Ga0068870_10086510 3300005840 Bacteria 1744
197 Ga0068863_100002060 3300005841 Bacteria 19927
198 Ga0068863_100024160 3300005841 Bacteria 5798
199 Ga0068858_100009787 3300005842 Bacteria 9124
200 Ga0068858_100473878 3300005842 Bacteria 1208
201 Ga0068858_100502958 3300005842 Bacteria 1171
202 Ga0068860_100105462 3300005843 Bacteria 2692
203 Ga0068862_100002729 3300005844 Bacteria 15500
204 Ga0068862_100008451 3300005844 Bacteria 8516
205 Ga0068862_100013047 3300005844 Bacteria 6874
206 Ga0068862_100020569 3300005844 Bacteria 5513
207 Ga0068862_100093714 3300005844 Bacteria 2619
208 Ga0068862_100097463 3300005844 Bacteria 2567
209 Ga0068862_100493668 3300005844 Bacteria 1161
210 Ga0081455_10151086 3300005937 Bacteria 1791
211 Ga0081539_10001970 3300005985 Bacteria 31273
212 Ga0070717_10015787 3300006028 Bacteria 5837
213 Ga0070715_10276795 3300006163 Bacteria 888
214 Ga0070716_100291989 3300006173 Bacteria 1130
215 Ga0070716_100355212 3300006173 Bacteria 1039
216 Ga0070712_100007770 3300006175 Bacteria 6711
217 Ga0097621_100281134 3300006237 Bacteria 1465
218 Ga0097621_100446308 3300006237 Bacteria 1165
219 Ga0075428_100000377 3300006844 Bacteria 44160
220 Ga0075428_100001137 3300006844 Bacteria 28418
221 Ga0075428_100060581 3300006844 Bacteria 4145
222 Ga0075428_100093651 3300006844 Bacteria 3275
223 Ga0075428_100096090 3300006844 Bacteria 3230
224 Ga0075428_100107740 3300006844 Bacteria 3036
225 Ga0075428_100308838 3300006844 Bacteria 1700
226 Ga0075428_100672576 3300006844 Bacteria 1103
227 Ga0075430_100004721 3300006846 Bacteria 11456
228 Ga0075430_100005791 3300006846 Bacteria 10425
229 Ga0075430_100016292 3300006846 Bacteria 6331
230 Ga0075430_100104742 3300006846 Bacteria 2361
231 Ga0075430_100289508 3300006846 Bacteria 1355
232 Ga0075430_100302937 3300006846 Bacteria 1322
233 Ga0075431_100022752 3300006847 Bacteria 6406
234 Ga0075431_100029038 3300006847 Bacteria 5689
235 Ga0075431_100061557 3300006847 Bacteria 3873
236 Ga0075431_100082738 3300006847 Bacteria 3314
237 Ga0075433_10015222 3300006852 Bacteria 6304
238 Ga0075433_10112497 3300006852 Bacteria 2415
239 Ga0075433_10128973 3300006852 Bacteria 2247
240 Ga0075433_10203582 3300006852 Bacteria 1759
241 Ga0075433_10476813 3300006852 Bacteria 1099
242 Ga0075434_100022658 3300006871 Bacteria 6116
243 Ga0075434_100024614 3300006871 Bacteria 5887
244 Ga0075434_100032342 3300006871 Bacteria 5159
245 Ga0075434_100252938 3300006871 Bacteria 1781
246 Ga0075434_100307522 3300006871 Bacteria 1605
247 Ga0075429_100009457 3300006880 Bacteria 8459
248 Ga0075429_100020308 3300006880 Bacteria 5761
249 Ga0075429_100027082 3300006880 Bacteria 4976
250 Ga0075429_100055805 3300006880 Bacteria 3437
251 Ga0075429_100064234 3300006880 Bacteria 3197
252 Ga0075429_100083166 3300006880 Bacteria 2791
253 Ga0075429_100136388 3300006880 Bacteria 2147
254 Ga0075429_100192056 3300006880 Bacteria 1789
255 Ga0068865_100017026 3300006881 Bacteria 4666
256 Ga0068865_100092681 3300006881 Bacteria 2195
257 Ga0068865_100103096 3300006881 Bacteria 2092
258 Ga0068865_100310677 3300006881 Bacteria 1265
259 Ga0068865_100361737 3300006881 Bacteria 1178
260 Ga0075436_100000775 3300006914 Bacteria 21189
261 Ga0075436_100051094 3300006914 Bacteria 2853
262 Ga0075436_100065583 3300006914 Bacteria 2509
263 Ga0075436_100378342 3300006914 Bacteria 1023
264 Ga0097620_100054201 3300006931 Bacteria 4032
265 Ga0097620_100059861 3300006931 Bacteria 3837
266 Ga0097620_100106685 3300006931 Bacteria 2860
267 Ga0097620_100147661 3300006931 Bacteria 2426
268 Ga0075435_100000212 3300007076 Bacteria 35550
269 Ga0075435_100000568 3300007076 Bacteria 22697
270 Ga0075435_100019073 3300007076 Bacteria 5228
271 Ga0075435_100054299 3300007076 Bacteria 3233
272 Ga0075435_100095092 3300007076 Bacteria 2464
273 Ga0075435_100101054 3300007076 Bacteria 2389
274 Ga0075435_100256208 3300007076 Bacteria 1490
275 Ga0075435_100582829 3300007076 Unclassified 969
276 Ga0099795_10029030 3300007788 Bacteria 1887
277 Ga0105240_10066714 3300009093 Bacteria 4463
278 Ga0105240_10104929 3300009093 Bacteria 3431
279 Ga0105240_10597443 3300009093 Bacteria 1215
280 Ga0111539_10000991 3300009094 Bacteria 37208
281 Ga0111539_10005930 3300009094 Bacteria 15778
282 Ga0111539_10009325 3300009094 Bacteria 12396
283 Ga0111539_10019006 3300009094 Bacteria 8496
284 Ga0111539_10032250 3300009094 Bacteria 6363
285 Ga0111539_10072360 3300009094 Bacteria 4066
286 Ga0111539_10098013 3300009094 Bacteria 3444
287 Ga0111539_10118846 3300009094 Bacteria 3098
288 Ga0111539_10144476 3300009094 Bacteria 2785
289 Ga0111539_10155091 3300009094 Bacteria 2679
290 Ga0111539_10177077 3300009094 Bacteria 2491
291 Ga0111539_10182150 3300009094 Bacteria 2453
292 Ga0111539_10246808 3300009094 Bacteria 2079
293 Ga0111539_10357922 3300009094 Bacteria 1698
294 Ga0111539_10406949 3300009094 Bacteria 1585
295 Ga0111539_10644920 3300009094 Bacteria 1233
296 Ga0111539_10759006 3300009094 Bacteria 1129
297 Ga0105245_10047492 3300009098 Bacteria 3838
298 Ga0105245_10063106 3300009098 Bacteria 3345
299 Ga0105245_10110974 3300009098 Bacteria 2550
300 Ga0105247_10020845 3300009101 Bacteria 3942
301 Ga0114129_10001454 3300009147 Bacteria 31988
302 Ga0114129_10002018 3300009147 Bacteria 27827
303 Ga0114129_10003113 3300009147 Bacteria 23270
304 Ga0114129_10003212 3300009147 Bacteria 22936
305 Ga0114129_10008032 3300009147 Bacteria 15032
306 Ga0114129_10011449 3300009147 Bacteria 12631
307 Ga0114129_10056834 3300009147 Bacteria 5478
308 Ga0114129_10093758 3300009147 Bacteria 4158
309 Ga0114129_10100426 3300009147 Bacteria 4004
310 Ga0114129_10114373 3300009147 Bacteria 3720
311 Ga0114129_10185092 3300009147 Bacteria 2831
312 Ga0114129_10287917 3300009147 Bacteria 2193
313 Ga0114129_10303963 3300009147 Bacteria 2125
314 Ga0114129_10355276 3300009147 Bacteria 1940
315 Ga0114129_10404706 3300009147 Bacteria 1798
316 Ga0114129_10501203 3300009147 Bacteria 1586
317 Ga0105243_10241975 3300009148 Bacteria 1606
318 Ga0105241_10093576 3300009174 Bacteria 2375
319 Ga0105241_10130416 3300009174 Bacteria 2034
320 Ga0105241_10179363 3300009174 Bacteria 1756
321 Ga0105242_10078059 3300009176 Bacteria 2763
322 Ga0105242_10197972 3300009176 Bacteria 1783
323 Ga0105248_10019605 3300009177 Bacteria 7485
324 Ga0105248_10061340 3300009177 Bacteria 4222
325 Ga0105248_10088340 3300009177 Bacteria 3489
326 Ga0105248_10156611 3300009177 Bacteria 2571
327 Ga0105248_10273241 3300009177 Bacteria 1903
328 Ga0105248_10340987 3300009177 Bacteria 1687
329 Ga0105248_10721638 3300009177 Bacteria 1125
330 Ga0105248_10797675 3300009177 Bacteria 1066
331 Ga0105237_10298118 3300009545 Bacteria 1615
332 Ga0105249_10001170 3300009553 Bacteria 23237
333 Ga0105249_10001543 3300009553 Bacteria 20213
334 Ga0105249_10331630 3300009553 Bacteria 1535
335 Ga0105249_10448731 3300009553 Bacteria 1328
336 Ga0105249_10451688 3300009553 Bacteria 1324
337 Ga0105249_10452641 3300009553 Bacteria 1323
338 Ga0105239_10030391 3300010375 Bacteria 5940
339 Ga0105239_10034143 3300010375 Bacteria 5585
340 Ga0105246_10124005 3300011119 Bacteria 1919
341 Ga0157369_10280997 3300013105 Bacteria 1734
342 Ga0157378_10015152 3300013297 Bacteria 6749
343 Ga0157378_10142440 3300013297 Bacteria 2227
344 Ga0157378_10348271 3300013297 Bacteria 1446
345 Ga0157378_10383837 3300013297 Bacteria 1380
346 Ga0163162_10015208 3300013306 Bacteria 7516
347 Ga0163162_10145754 3300013306 Bacteria 2484
348 Ga0163162_10264668 3300013306 Bacteria 1851
349 Ga0163162_10701371 3300013306 Bacteria 1134
350 Ga0157372_10023930 3300013307 Bacteria 6628
351 Ga0157372_10116190 3300013307 Bacteria 3068
352 Ga0157375_10013039 3300013308 Bacteria 7386
353 Ga0157375_10048069 3300013308 Bacteria 4171
354 Ga0163163_10164848 3300014325 Bacteria 2262
355 Ga0157380_10036753 3300014326 Bacteria 3791
356 Ga0157380_10137880 3300014326 Bacteria 2091
357 Ga0157380_10235134 3300014326 Bacteria 1648
358 Ga0157380_10237303 3300014326 Bacteria 1642
359 Ga0157377_10004447 3300014745 Bacteria 6460
360 Ga0157377_10016689 3300014745 Bacteria 3781
361 Ga0157379_10013352 3300014968 Bacteria 7192
362 Ga0157379_10013821 3300014968 Bacteria 7075
363 Ga0157379_10226940 3300014968 Bacteria 1692
364 Ga0157376_10130263 3300014969 Bacteria 2243
365 Ga0157376_10308219 3300014969 Bacteria 1501
366 Ga0157376_10524605 3300014969 Bacteria 1168
367 Ga0182007_10065881 3300015262 Bacteria 1187
368 Ga0163161_10105117 3300017792 Bacteria 2106
369 Ga0163161_10234765 3300017792 Bacteria 1424
370 Ga0207697_10004794 3300025315 Bacteria 6399
371 Ga0207697_10005008 3300025315 Bacteria 6231
372 Ga0207682_10024820 3300025893 Bacteria 2376
373 Ga0207682_10055721 3300025893 Bacteria 1645
374 Ga0207710_10024484 3300025900 Bacteria 2600
375 Ga0207688_10012972 3300025901 Bacteria 4532
376 Ga0207688_10115695 3300025901 Bacteria 1561
377 Ga0207699_10090855 3300025906 Bacteria 1916
378 Ga0207699_10100710 3300025906 Bacteria 1833
379 Ga0207699_10289490 3300025906 Bacteria 1141
380 Ga0207645_10000458 3300025907 Bacteria 33714
381 Ga0207645_10005430 3300025907 Bacteria 9241
382 Ga0207645_10130330 3300025907 Bacteria 1636
383 Ga0207645_10135377 3300025907 Bacteria 1604
384 Ga0207643_10002117 3300025908 Bacteria 10930
385 Ga0207643_10015108 3300025908 Bacteria 4199
386 Ga0207643_10054327 3300025908 Bacteria 2277
387 Ga0207643_10069754 3300025908 Bacteria 2021
388 Ga0207684_10007541 3300025910 Bacteria 9786
389 Ga0207707_10005051 3300025912 Bacteria 11577
390 Ga0207707_10007546 3300025912 Bacteria 9476
391 Ga0207707_10011691 3300025912 Bacteria 7640
392 Ga0207707_10030482 3300025912 Bacteria 4718
393 Ga0207707_10031105 3300025912 Bacteria 4670
394 Ga0207707_10161962 3300025912 Bacteria 1956
395 Ga0207695_10144119 3300025913 Bacteria 2328
396 Ga0207695_10203246 3300025913 Bacteria 1894
397 Ga0207695_10482959 3300025913 Bacteria 1121
398 Ga0207695_10504213 3300025913 Bacteria 1092
399 Ga0207693_10010200 3300025915 Bacteria 7626
400 Ga0207660_10010362 3300025917 Bacteria 6048
401 Ga0207660_10079484 3300025917 Bacteria 2406
402 Ga0207660_10096054 3300025917 Bacteria 2206
403 Ga0207662_10002841 3300025918 Bacteria 8754
404 Ga0207662_10114523 3300025918 Bacteria 1685
405 Ga0207657_10085034 3300025919 Bacteria 2651
406 Ga0207649_10008533 3300025920 Bacteria 5589
407 Ga0207649_10049621 3300025920 Bacteria 2593
408 Ga0207652_10026167 3300025921 Bacteria 4856
409 Ga0207652_10080990 3300025921 Bacteria 2839
410 Ga0207652_10141877 3300025921 Bacteria 2148
411 Ga0207652_10222903 3300025921 Bacteria 1699
412 Ga0207652_10257802 3300025921 Bacteria 1573
413 Ga0207646_10043354 3300025922 Bacteria 4041
414 Ga0207646_10114340 3300025922 Bacteria 2423
415 Ga0207646_10601702 3300025922 Bacteria 987
416 Ga0207681_10022632 3300025923 Bacteria 4011
417 Ga0207681_10026965 3300025923 Bacteria 3710
418 Ga0207681_10037827 3300025923 Bacteria 3192
419 Ga0207681_10050181 3300025923 Bacteria 2823
420 Ga0207681_10066851 3300025923 Bacteria 2489
421 Ga0207681_10131927 3300025923 Bacteria 1848
422 Ga0207681_10332404 3300025923 Unclassified 1212
423 Ga0207681_10519276 3300025923 Bacteria 977
424 Ga0207650_10009739 3300025925 Bacteria 6572
425 Ga0207650_10059226 3300025925 Bacteria 2854
426 Ga0207650_10088786 3300025925 Bacteria 2358
427 Ga0207650_10117959 3300025925 Bacteria 2063
428 Ga0207650_10407056 3300025925 Bacteria 1127
429 Ga0207659_10000084 3300025926 Bacteria 56518
430 Ga0207659_10000145 3300025926 Bacteria 41946
431 Ga0207659_10039441 3300025926 Bacteria 3294
432 Ga0207659_10052050 3300025926 Bacteria 2915
433 Ga0207659_10076972 3300025926 Bacteria 2454
434 Ga0207659_10078413 3300025926 Bacteria 2434
435 Ga0207659_10087528 3300025926 Bacteria 2319
436 Ga0207659_10244977 3300025926 Bacteria 1452
437 Ga0207659_10311903 3300025926 Bacteria 1295
438 Ga0207687_10071094 3300025927 Bacteria 2486
439 Ga0207700_10000992 3300025928 Bacteria 16363
440 Ga0207700_10177260 3300025928 Bacteria 1782
441 Ga0207664_10064297 3300025929 Bacteria 2934
442 Ga0207690_10022088 3300025932 Bacteria 3954
443 Ga0207690_10039720 3300025932 Bacteria 3072
444 Ga0207690_10065229 3300025932 Bacteria 2489
445 Ga0207690_10188578 3300025932 Bacteria 1558
446 Ga0207690_10327189 3300025932 Bacteria 1206
447 Ga0207706_10000589 3300025933 Bacteria 38549
448 Ga0207706_10019175 3300025933 Bacteria 6151
449 Ga0207706_10060199 3300025933 Bacteria 3344
450 Ga0207706_10063312 3300025933 Bacteria 3256
451 Ga0207706_10241564 3300025933 Bacteria 1579
452 Ga0207706_10243355 3300025933 Bacteria 1572
453 Ga0207686_10055347 3300025934 Bacteria 2489
454 Ga0207709_10009774 3300025935 Bacteria 5287
455 Ga0207670_10010393 3300025936 Bacteria 5359
456 Ga0207670_10194271 3300025936 Bacteria 1538
457 Ga0207670_10240884 3300025936 Bacteria 1393
458 Ga0207669_10030633 3300025937 Bacteria 2992
459 Ga0207669_10046582 3300025937 Bacteria 2563
460 Ga0207669_10114086 3300025937 Bacteria 1818
461 Ga0207669_10114149 3300025937 Bacteria 1818
462 Ga0207669_10220486 3300025937 Bacteria 1391
463 Ga0207669_10245040 3300025937 Bacteria 1331
464 Ga0207704_10030906 3300025938 Bacteria 3009
465 Ga0207704_10093288 3300025938 Bacteria 1984
466 Ga0207665_10036009 3300025939 Bacteria 3289
467 Ga0207691_10000704 3300025940 Bacteria 33081
468 Ga0207691_10011452 3300025940 Bacteria 8511
469 Ga0207691_10140160 3300025940 Bacteria 2131
470 Ga0207691_10198973 3300025940 Bacteria 1744
471 Ga0207691_10342693 3300025940 Bacteria 1279
472 Ga0207711_10022962 3300025941 Bacteria 5222
473 Ga0207711_10216489 3300025941 Bacteria 1750
474 Ga0207689_10012469 3300025942 Bacteria 7261
475 Ga0207661_10000775 3300025944 Bacteria 20758
476 Ga0207661_10004579 3300025944 Bacteria 9689
477 Ga0207679_10010830 3300025945 Bacteria 5878
478 Ga0207679_10028209 3300025945 Bacteria 3892
479 Ga0207679_10035393 3300025945 Bacteria 3532
480 Ga0207679_10035692 3300025945 Bacteria 3520
481 Ga0207679_10336584 3300025945 Bacteria 1311
482 Ga0207667_10101296 3300025949 Bacteria 2971
483 Ga0207667_10381268 3300025949 Bacteria 1437
484 Ga0207667_10387463 3300025949 Bacteria 1424
485 Ga0207651_10008786 3300025960 Bacteria 5482
486 Ga0207651_10121122 3300025960 Bacteria 1984
487 Ga0207651_10233182 3300025960 Bacteria 1496
488 Ga0207651_10289047 3300025960 Bacteria 1358
489 Ga0207712_10001442 3300025961 Bacteria 16220
490 Ga0207712_10015681 3300025961 Bacteria 4892
491 Ga0207712_10167799 3300025961 Bacteria 1713
492 Ga0207712_10417507 3300025961 Bacteria 1131
493 Ga0207668_10022334 3300025972 Bacteria 4049
494 Ga0207668_10036477 3300025972 Bacteria 3281
495 Ga0207668_10126850 3300025972 Bacteria 1942
496 Ga0207668_10372640 3300025972 Bacteria 1199
497 Ga0207668_10401284 3300025972 Bacteria 1159
498 Ga0207640_10118275 3300025981 Bacteria 1893
499 Ga0207658_10109443 3300025986 Bacteria 2181
500 Ga0207703_10567429 3300026035 Bacteria 1071
501 Ga0207639_10237801 3300026041 Bacteria 1582
502 Ga0207678_10039606 3300026067 Bacteria 4090
503 Ga0207678_10063115 3300026067 Bacteria 3183
504 Ga0207708_10007077 3300026075 Bacteria 8287
505 Ga0207708_10052648 3300026075 Bacteria 3100
506 Ga0207708_10107314 3300026075 Bacteria 2165
507 Ga0207708_10196228 3300026075 Bacteria 1609
508 Ga0207641_10001258 3300026088 Bacteria 25235
509 Ga0207648_10017448 3300026089 Bacteria 6531
510 Ga0207648_10028889 3300026089 Bacteria 4915
511 Ga0207648_10031449 3300026089 Bacteria 4693
512 Ga0207648_10166577 3300026089 Bacteria 1947
513 Ga0207648_10439216 3300026089 Bacteria 1187
514 Ga0207676_10045426 3300026095 Bacteria 3394
515 Ga0207676_10207315 3300026095 Bacteria 1736
516 Ga0207676_10516821 3300026095 Bacteria 1136
517 Ga0207674_10001445 3300026116 Bacteria 30669
518 Ga0207674_10005071 3300026116 Bacteria 15722
519 Ga0207674_10018419 3300026116 Bacteria 7589
520 Ga0207674_10310126 3300026116 Bacteria 1527
521 Ga0207674_10328646 3300026116 Bacteria 1479
522 Ga0207674_10571313 3300026116 Bacteria 1092
523 Ga0207675_100000720 3300026118 Bacteria 32744
524 Ga0207675_100005564 3300026118 Bacteria 12058
525 Ga0207675_100128354 3300026118 Bacteria 2403
526 Ga0207675_100141840 3300026118 Bacteria 2283
527 Ga0207675_100257360 3300026118 Bacteria 1691
528 Ga0207675_100753835 3300026118 Bacteria 985
529 Ga0207683_10012080 3300026121 Bacteria 7372
530 Ga0207683_10015214 3300026121 Bacteria 6548
531 Ga0207683_10095950 3300026121 Bacteria 2644
532 Ga0207683_10269028 3300026121 Bacteria 1557
533 Ga0207698_10101408 3300026142 Bacteria 2387
534 Ga0209974_10009858 3300027876 Bacteria 3232
535 Ga0207428_10000486 3300027907 Bacteria 47460
536 Ga0207428_10001455 3300027907 Bacteria 24781
537 Ga0207428_10006753 3300027907 Bacteria 10528
538 Ga0207428_10022988 3300027907 Bacteria 5250
539 Ga0207428_10038736 3300027907 Bacteria 3873
540 Ga0207428_10049370 3300027907 Bacteria 3372
541 Ga0207428_10137237 3300027907 Bacteria 1869
542 Ga0207428_10178243 3300027907 Bacteria 1606
543 Ga0207428_10292701 3300027907 Bacteria 1206
544 Ga0207428_10378685 3300027907 Bacteria 1038
545 Ga0268266_10141777 3300028379 Unclassified 2157
546 Ga0268266_10239829 3300028379 Bacteria 1673
547 Ga0268265_10001813 3300028380 Bacteria 17079
548 Ga0268265_10002722 3300028380 Bacteria 13072
549 Ga0268265_10048825 3300028380 Bacteria 3180
550 Ga0268265_10076471 3300028380 Bacteria 2626
551 Ga0268265_10189008 3300028380 Bacteria 1776
552 Ga0268265_10352431 3300028380 Bacteria 1344
553 Ga0268265_10457684 3300028380 Bacteria 1193
554 Ga0268264_10088137 3300028381 Bacteria 2670
555 Ga0268264_10135967 3300028381 Bacteria 2185
556 Ga0268264_10591154 3300028381 Bacteria 1093
557 Ga0268264_10732941 3300028381 Bacteria 984
558 Ga0307408_100000358 3300031548 Bacteria 42523
559 Ga0307408_100010533 3300031548 Bacteria 6097
560 Ga0307408_100040061 3300031548 Bacteria 3316
561 Ga0307408_100482357 3300031548 Bacteria 1082
562 Ga0265314_10096174 3300031711 Bacteria 1916
563 Ga0307405_10039768 3300031731 Bacteria 2845
564 Ga0307405_10080876 3300031731 Bacteria 2122
565 Ga0307405_10187046 3300031731 Bacteria 1492
566 Ga0307405_10197045 3300031731 Bacteria 1460
567 Ga0307413_10009128 3300031824 Bacteria 4729
568 Ga0307413_10145213 3300031824 Bacteria 1646
569 Ga0307413_10293013 3300031824 Bacteria 1230
570 Ga0307410_10008565 3300031852 Bacteria 5682
571 Ga0307410_10282923 3300031852 Bacteria 1302
572 Ga0307406_10003418 3300031901 Bacteria 8649
573 Ga0307406_10025006 3300031901 Bacteria 3571
574 Ga0307406_10295492 3300031901 Bacteria 1242
575 Ga0307412_10034676 3300031911 Bacteria 3218
576 Ga0307409_100044935 3300031995 Bacteria 3331
577 Ga0307409_100223268 3300031995 Bacteria 1702
578 Ga0307416_100009658 3300032002 Bacteria 6330
579 Ga0307416_100676570 3300032002 Bacteria 1119
580 Ga0307416_100933932 3300032002 Bacteria 969
581 Ga0307414_10180784 3300032004 Bacteria 1696
582 Ga0307414_10639231 3300032004 Unclassified 958
583 Ga0307411_10037271 3300032005 Bacteria 3056
584 Ga0307415_100023116 3300032126 Bacteria 3853
585 Ga0307415_100201409 3300032126 Bacteria 1580
586 Ga0373930_0049973 3300034816 Bacteria 911
587 Ga0373950_0000850 3300034818 Bacteria 3836
588 Ga0373959_0003456 3300034820 Bacteria 2512
589 Ga0373928_0011906 3300035084 Bacteria 1729
590 Ga0373929_0000782 3300035085 Bacteria 6200
591 Ga0373940_0016690 3300035088 Bacteria 1822
592 Ga0373949_0001573 3300035090 Bacteria 6436
593 Ga0373949_0032660 3300035090 Unclassified 1247
594 Ga0373952_0000726 3300035092 Bacteria 5885
595 Ga0373932_0001056 3300035112 Bacteria 7935
596 Ga0373939_0000870 3300035114 Bacteria 7476
597 Ga0373939_0018825 3300035114 Bacteria 1856
598 Ga0373941_0001609 3300035115 Bacteria 4801
599 Ga0373941_0035685 3300035115 Bacteria 1508
600 Ga0373960_0000376 3300035121 Bacteria 8647
601 Ga0373942_0000823 3300035207 Bacteria 8568
602 Ga0373961_0000733 3300035241 Bacteria 11390
603 Ga0373961_0084174 3300035241 Bacteria 1005
604 Ga0373961_0093480 3300035241 Bacteria 964
605 Ga0373962_0001038 3300035242 Bacteria 6436
606 Ga0373931_0026927 3300035691 Bacteria 2930
607 Ga0373931_0042390 3300035691 Bacteria 2393
608 Ga0373937_0125742 3300036401 Bacteria 2392
609 Ga0395905_0044393 3300037471 Bacteria 4172
610 Ga0395905_0056361 3300037471 Bacteria 3677
611 Ga0395905_0470137 3300037471 Bacteria 1156
612 Ga0395901_0456154 3300038443 Bacteria 1307
613 Ga0242420_001962 3300038996 Unclassified 2860
614 Ga0439455_0046648 3300042012 Bacteria 1123
615 Ga0439457_045581 3300042014 Bacteria 980
616 Ga0439462_0018349 3300042015 Bacteria 1817
617 Ga0450896_003048 3300042133 Bacteria 2204
618 Ga0439446_0015844 3300042156 Bacteria 2095
619 Ga0439458_0054493 3300042157 Bacteria 991
620 Ga0439440_0007184 3300042993 Bacteria 2257
621 Ga0453683_0038808 3300044673 Bacteria 2994
622 Ga0466964_0040965 3300044706 Bacteria 1872
623 Ga0451576_0184309 3300045051 Bacteria 2180
624 Ga0451576_0211301 3300045051 Bacteria 2026
625 Ga0466958_0163768 3300045836 Bacteria 1406
626 Ga0495603_0055242 3300046455 Unclassified 2353
627 Ga0495582_0152377 3300046473 Bacteria 1313
628 Ga0495639_0089599 3300046475 Bacteria 1442
629 Ga0495621_0034594 3300046539 Bacteria 1746
630 Ga0495621_0062251 3300046539 Bacteria 1357
631 Ga0495621_0081401 3300046539 Bacteria 1208
632 Ga0495669_0183740 3300046684 Unclassified 997
633 Ga0496100_0066911 3300048903 Bacteria 2385
634 Ga0496100_0248092 3300048903 Bacteria 1316
635 Ga0496100_0355760 3300048903 Bacteria 1107
636 Ga0496101_0047452 3300048904 Bacteria 3084
637 Ga0496101_0097952 3300048904 Bacteria 2191
638 Ga0496102_0025872 3300048905 Bacteria 5228
639 Ga0496102_0091029 3300048905 Bacteria 2823
640 Ga0496102_0171729 3300048905 Bacteria 2041
641 Ga0496103_0015498 3300048906 Bacteria 4537
642 Ga0496103_0087592 3300048906 Bacteria 1963
643 Ga0496103_0286970 3300048906 Bacteria 1059
644 Ga0496104_0011192 3300048907 Bacteria 8028
645 Ga0496104_0073139 3300048907 Bacteria 3261
646 Ga0496104_0085719 3300048907 Bacteria 3006
647 Ga0496105_0072544 3300048908 Bacteria 2845
648 Ga0496106_0022503 3300048909 Bacteria 4684
649 Ga0496106_0436014 3300048909 Bacteria 1053
650 Ga0496107_0048087 3300048910 Bacteria 3072
651 Ga0496107_0063042 3300048910 Bacteria 2686
652 Ga0496107_0213880 3300048910 Bacteria 1434
653 Ga0496108_0001699 3300048911 Bacteria 17458
654 Ga0496108_0064440 3300048911 Bacteria 3087
655 Ga0496108_0112485 3300048911 Bacteria 2329
656 Ga0496109_0001520 3300048912 Bacteria 19309
657 Ga0496109_0024278 3300048912 Bacteria 5388
658 Ga0496109_0052363 3300048912 Bacteria 3720
659 Ga0496109_0630110 3300048912 Unclassified 1009
660 Ga0496110_0001345 3300048913 Bacteria 17697
661 Ga0496110_0144641 3300048913 Bacteria 2150
662 Ga0496111_0127858 3300048914 Bacteria 1879
663 Ga0496112_0001744 3300048915 Bacteria 17038
664 Ga0496112_0018884 3300048915 Bacteria 6496
665 Ga0496112_0038427 3300048915 Bacteria 4673
666 Ga0496113_0000045 3300048916 Bacteria 51839
667 Ga0496113_0259039 3300048916 Bacteria 1389
668 Ga0496115_0136272 3300048918 Bacteria 2024
669 Ga0501039_0303215 3300049575 Bacteria 1256
670 Ga0501040_0184219 3300049576 Bacteria 1481
671 Ga0501041_0055470 3300049577 Bacteria 2419
672 Ga0501042_0005919 3300049578 Bacteria 7910
673 Ga0501046_0058760 3300049580 Bacteria 3014
674 Ga0501070_0214157 3300049586 Bacteria 1581
675 Ga0501071_0246782 3300049587 Bacteria 1347
676 Ga0501072_0331894 3300049588 Bacteria 1208
677 Ga0501073_0141502 3300049589 Bacteria 1667
678 Ga0501074_0099996 3300049590 Bacteria 2076
679 Ga0501076_0026701 3300049592 Bacteria 4475
680 Ga0501077_0065391 3300049593 Bacteria 2306
681 Ga0501202_048966 3300049652 Bacteria 932
682 Ga0501249_054148 3300049679 Bacteria 923
683 Ga0501079_0041608 3300049741 Bacteria 3548
684 Ga0501079_0075138 3300049741 Bacteria 2613
685 Ga0501079_0264368 3300049741 Bacteria 1345
686 Ga0501080_0148312 3300049742 Bacteria 2169
687 Ga0501081_0012437 3300049743 Bacteria 5594
688 Ga0501081_0250398 3300049743 Bacteria 1293
689 nmdc:mga05p37_12960_c1 3300050507 Bacteria 9973
690 nmdc:mga05p37_162147_c1 3300050507 Bacteria 2730
691 nmdc:mga05p37_181089_c1 3300050507 Bacteria 2563
692 nmdc:mga05p37_238875_c1 3300050507 Bacteria 2186
693 nmdc:mga05p37_294971_c1 3300050507 Bacteria 1929
694 nmdc:mga05p37_352066_c1 3300050507 Bacteria 1734
695 nmdc:mga05p37_39196_c1 3300050507 Bacteria 5815
696 nmdc:mga05p37_39218_c1 3300050507 Bacteria 5813
697 nmdc:mga05p37_416518_c1 3300050507 Bacteria 1564
698 nmdc:mga05p37_4621_c1 3300050507 Bacteria 8582
699 nmdc:mga05p37_521171_c1 3300050507 Bacteria 1360
700 nmdc:mga05p37_95463_c1 3300050507 Bacteria 3663
701 nmdc:mga09592_10005_c1 3300050508 Bacteria 7713
702 nmdc:mga09592_16920_c1 3300050508 Bacteria 5967
703 nmdc:mga09592_17600_c1 3300050508 Bacteria 5855
704 nmdc:mga09592_259463_c1 3300050508 Bacteria 1507
705 nmdc:mga09592_39043_c1 3300050508 Bacteria 3987
706 nmdc:mga09592_944_c1 3300050508 Bacteria 22853
707 nmdc:mga0qj67_135328_c1 3300050509 Bacteria 1997
708 nmdc:mga0qj67_22110_c1 3300050509 Bacteria 4882
709 nmdc:mga0qj67_274418_c1 3300050509 Bacteria 1367
710 nmdc:mga0qj67_4197_c1 3300050509 Bacteria 10438
711 nmdc:mga0qj67_8085_c1 3300050509 Bacteria 7785
712 nmdc:mga06r32_11505_c1 3300050510 Bacteria 7970
713 nmdc:mga06r32_1402_c1 3300050510 Bacteria 21753
714 nmdc:mga06r32_146057_c1 3300050510 Bacteria 2342
715 nmdc:mga06r32_147982_c1 3300050510 Bacteria 2326
716 nmdc:mga06r32_205246_c1 3300050510 Bacteria 1959
717 nmdc:mga06r32_34145_c1 3300050510 Bacteria 4795
718 nmdc:mga06r32_345371_c1 3300050510 Bacteria 1473
719 nmdc:mga08y16_137973_c1 3300050511 Bacteria 2535
720 nmdc:mga08y16_142859_c1 3300050511 Bacteria 2488
721 nmdc:mga08y16_15056_c1 3300050511 Bacteria 8133
722 nmdc:mga08y16_183242_c1 3300050511 Bacteria 2173
723 nmdc:mga08y16_18370_c1 3300050511 Bacteria 7370
724 nmdc:mga08y16_187645_c1 3300050511 Bacteria 2145
725 nmdc:mga08y16_199947_c1 3300050511 Bacteria 2071
726 nmdc:mga08y16_230406_c1 3300050511 Bacteria 1916
727 nmdc:mga08y16_230655_c1 3300050511 Bacteria 1915
728 nmdc:mga08y16_26197_c1 3300050511 Bacteria 6149
729 nmdc:mga08y16_273_c1 3300050511 Bacteria 47089
730 nmdc:mga08y16_37090_c1 3300050511 Bacteria 5119
731 nmdc:mga08y16_404782_c1 3300050511 Bacteria 1396
732 nmdc:mga08y16_405500_c1 3300050511 Bacteria 1395
733 nmdc:mga08y16_46695_c1 3300050511 Bacteria 4534
734 nmdc:mga08y16_469207_c1 3300050511 Bacteria 1282
735 nmdc:mga08y16_7863_c1 3300050511 Bacteria 11162
736 nmdc:mga08y16_85352_c1 3300050511 Bacteria 3290
737 nmdc:mga0n895_14753_c1 3300050512 Bacteria 7107
738 nmdc:mga0n895_2_c1 3300050512 Bacteria 145967
739 nmdc:mga0n895_350980_c1 3300050512 Bacteria 1494
740 nmdc:mga0n895_420628_c1 3300050512 Bacteria 1351
741 nmdc:mga0n895_423245_c1 3300050512 Bacteria 1346
742 nmdc:mga0n895_5397_c1 3300050512 Bacteria 10672
743 nmdc:mga0n895_572478_c1 3300050512 Bacteria 1134
744 nmdc:mga0n895_6246_c1 3300050512 Bacteria 10089
745 nmdc:mga0n895_688441_c1 3300050512 Unclassified 1019
746 nmdc:mga0rr50_1100_c1 3300050513 Bacteria 14693
747 nmdc:mga0rr50_11961_c1 3300050513 Bacteria 5584
748 nmdc:mga0rr50_322852_c1 3300050513 Bacteria 1294
749 nmdc:mga0rr50_421234_c1 3300050513 Bacteria 1129
750 nmdc:mga0rr50_73036_c1 3300050513 Bacteria 2622
751 nmdc:mga0rr50_9_c1 3300050513 Bacteria 224716
752 nmdc:mga08x19_118773_c1 3300050514 Bacteria 1770
753 nmdc:mga08x19_176133_c1 3300050514 Bacteria 1459
754 nmdc:mga08x19_32396_c1 3300050514 Bacteria 3293
755 nmdc:mga08x19_4396_c2 3300050514 Bacteria 5101
756 nmdc:mga08x19_457_c1 3300050514 Bacteria 27810
757 nmdc:mga0a205_123937_c1 3300050515 Bacteria 2484
758 nmdc:mga0a205_417279_c1 3300050515 Unclassified 1204
759 nmdc:mga0a205_4939_c1 3300050515 Bacteria 11998
760 nmdc:mga0a205_53323_c1 3300050515 Bacteria 3903
761 nmdc:mga0a205_93648_c1 3300050515 Bacteria 2902
762 nmdc:mga0a205_9380_c1 3300050515 Bacteria 8944
763 nmdc:mga0a205_94198_c1 3300050515 Bacteria 2109
764 Ga0495601_0311781 3300053077 Bacteria 1025
765 Ga0500641_0002462 3300053096 Bacteria 6545
766 Ga0500555_000178 3300053103 Bacteria 29196
767 Ga0500645_000293 3300053730 Bacteria 35759
768 Ga0501082_0154237 3300060353 Bacteria 1996
769 Ga0501082_0717708 3300060353 Bacteria 875
770 Ga0436362_0294246
771 JGI25406J46586_10000410
772 Ga0065704_10223138
773 Ga0065712_10151095
774 Ga0065715_10005527
775 Ga0065715_10093030
776 Ga0065715_10102013
777 Ga0065715_10123216
778 Ga0065707_10257487
779 Ga0070676_10019236
780 Ga0070683_100054910
781 Ga0070683_100061897
782 Ga0070683_100310257
783 Ga0070683_100333679
784 Ga0070690_100168450
785 Ga0070690_100238341
786 Ga0070690_100326992
787 Ga0070670_100021696
788 Ga0070670_100029698
789 Ga0070670_100108681
790 Ga0070670_100315205
791 Ga0070677_10060995
792 Ga0068869_100152157
793 Ga0068869_100156822
794 Ga0068869_100206047
795 Ga0068869_100353222
796 Ga0070666_10100404
797 Ga0070680_100001348
798 Ga0070680_100055586
799 Ga0070680_100174935
800 Ga0070680_100175956
801 Ga0070682_100000710
802 Ga0068868_100002521
803 Ga0068868_100546040
804 Ga0070660_100232656
805 Ga0070689_100023371
806 Ga0070689_100126149
807 Ga0070689_100464529
808 Ga0070691_10030862
809 Ga0070687_100005825
810 Ga0070687_100086457
811 Ga0070661_100004254
812 Ga0070661_100045502
813 Ga0070661_100177635
814 Ga0070661_100243720
815 Ga0070692_10004794
816 Ga0070692_10135194
817 Ga0070692_10263592
818 Ga0070668_100000571
819 Ga0070668_100038115
820 Ga0070668_100060519
821 Ga0070668_100064651
822 Ga0070668_100227787
823 Ga0070669_100013946
824 Ga0070669_100050820
825 Ga0070669_100220013
826 Ga0070675_100000189
827 Ga0070675_100001673
828 Ga0070675_100001871
829 Ga0070675_100008118
830 Ga0070675_100070133
831 Ga0070675_100083495
832 Ga0070675_100204406
833 Ga0070671_100455422
834 Ga0070674_100025002
835 Ga0070674_100032595
836 Ga0070674_100045016
837 Ga0070674_100270512
838 Ga0070673_100025572
839 Ga0070673_100094904
840 Ga0070673_100122485
841 Ga0070673_100203289
842 Ga0070673_100455600
843 Ga0070673_100468859
844 Ga0070688_100026696
845 Ga0070688_100049173
846 Ga0070688_100189796
847 Ga0070659_100006496
848 Ga0070659_100210095
849 Ga0070659_100227712
850 Ga0070667_100243057
851 Ga0070667_100362151
852 Ga0070709_10099322
853 Ga0070709_10289652
854 Ga0070709_10368453
855 Ga0070714_100075675
856 Ga0070713_100004589
857 Ga0070701_10024876
858 Ga0070701_10043322
859 Ga0070701_10093161
860 Ga0070705_100016676
861 Ga0070705_100168269
862 Ga0070700_100052703
863 Ga0070700_100088070
864 Ga0070700_100103381
865 Ga0070700_100334885
866 Ga0070700_100344817
867 Ga0070694_100018394
868 Ga0070694_100085586
869 Ga0070694_100163160
870 Ga0070694_100249530
871 Ga0070694_100269779
872 Ga0070694_100292911
873 Ga0070708_100009235
874 Ga0070663_100055288
875 Ga0070663_100228577
876 Ga0070678_100002099
877 Ga0070678_100036430
878 Ga0070678_100135017
879 Ga0070678_100188836
880 Ga0070678_100288401
881 Ga0070662_100005566
882 Ga0070662_100073336
883 Ga0070681_10000875
884 Ga0070681_10018966
885 Ga0070681_10022978
886 Ga0070681_10087735
887 Ga0068867_100005586
888 Ga0068867_100342678
889 Ga0068867_100369137
890 Ga0070685_10091371
891 Ga0070706_100008245
892 Ga0070707_100010687
893 Ga0070707_100016044
894 Ga0070707_100597667
895 Ga0070698_100027099
896 Ga0070698_100097070
897 Ga0070698_100138885
898 Ga0070698_100295171
899 Ga0070698_100551810
900 Ga0070699_100000017
901 Ga0070699_100008540
902 Ga0070699_100029764
903 Ga0070699_100076020
904 Ga0070699_100125061
905 Ga0070679_100035556
906 Ga0070679_100404513
907 Ga0070679_100628655
908 Ga0070684_100003277
909 Ga0070684_100037814
910 Ga0070697_100001635
911 Ga0070697_100063072
912 Ga0070697_100363166
913 Ga0070697_100430146
914 Ga0070672_100010622
915 Ga0070672_100229634
916 Ga0070672_100273056
917 Ga0070672_100306191
918 Ga0070686_100001805
919 Ga0070686_100019786
920 Ga0070695_100054973
921 Ga0070695_100134203
922 Ga0070696_100021881
923 Ga0070696_100057176
924 Ga0070696_100061755
925 Ga0070696_100068271
926 Ga0070665_100150519
927 Ga0070665_100336171
928 Ga0070704_100001174
929 Ga0070704_100002977
930 Ga0070704_100023560
931 Ga0070704_100054878
932 Ga0070704_100144201
933 Ga0070704_100497645
934 Ga0068855_100065764
935 Ga0070664_100009874
936 Ga0070664_100011638
937 Ga0070664_100104751
938 Ga0070664_100185507
939 Ga0070664_100244671
940 Ga0068857_100020580
941 Ga0068857_100023102
942 Ga0068857_100031078
943 Ga0068857_100365695
944 Ga0068854_100005962
945 Ga0068852_100003003
946 Ga0068852_100444929
947 Ga0068859_100054202
948 Ga0068859_100059861
949 Ga0068859_100106681
950 Ga0068859_100147656
951 Ga0068864_100053364
952 Ga0068864_100082447
953 Ga0068864_100342588
954 Ga0068864_100506008
955 Ga0068866_10013894
956 Ga0068861_100000896
957 Ga0068861_100040969
958 Ga0068861_100058404
959 Ga0068861_100063449
960 Ga0068861_100119725
961 Ga0068861_100188680
962 Ga0068851_10052612
963 Ga0068870_10000340
964 Ga0068870_10086414
965 Ga0068870_10086510
966 Ga0068863_100002060
967 Ga0068863_100024160
968 Ga0068858_100009787
969 Ga0068858_100473878
970 Ga0068858_100502958
971 Ga0068860_100105462
972 Ga0068862_100002729
973 Ga0068862_100008451
974 Ga0068862_100013047
975 Ga0068862_100020569
976 Ga0068862_100093714
977 Ga0068862_100097463
978 Ga0068862_100493668
979 Ga0081455_10151086
980 Ga0081539_10001970
981 Ga0070717_10015787
982 Ga0070715_10276795
983 Ga0070716_100291989
984 Ga0070716_100355212
985 Ga0070712_100007770
986 Ga0097621_100281134
987 Ga0097621_100446308
988 Ga0075428_100000377
989 Ga0075428_100001137
990 Ga0075428_100060581
991 Ga0075428_100093651
992 Ga0075428_100096090
993 Ga0075428_100107740
994 Ga0075428_100308838
995 Ga0075428_100672576
996 Ga0075430_100004721
997 Ga0075430_100005791
998 Ga0075430_100016292
999 Ga0075430_100104742
1000 Ga0075430_100289508
1001 Ga0075430_100302937
1002 Ga0075431_100022752
1003 Ga0075431_100029038
1004 Ga0075431_100061557
1005 Ga0075431_100082738
1006 Ga0075433_10015222
1007 Ga0075433_10112497
1008 Ga0075433_10128973
1009 Ga0075433_10203582
1010 Ga0075433_10476813
1011 Ga0075434_100022658
1012 Ga0075434_100024614
1013 Ga0075434_100032342
1014 Ga0075434_100252938
1015 Ga0075434_100307522
1016 Ga0075429_100009457
1017 Ga0075429_100020308
1018 Ga0075429_100027082
1019 Ga0075429_100055805
1020 Ga0075429_100064234
1021 Ga0075429_100083166
1022 Ga0075429_100136388
1023 Ga0075429_100192056
1024 Ga0068865_100017026
1025 Ga0068865_100092681
1026 Ga0068865_100103096
1027 Ga0068865_100310677
1028 Ga0068865_100361737
1029 Ga0075436_100000775
1030 Ga0075436_100051094
1031 Ga0075436_100065583
1032 Ga0075436_100378342
1033 Ga0097620_100054201
1034 Ga0097620_100059861
1035 Ga0097620_100106685
1036 Ga0097620_100147661
1037 Ga0075435_100000212
1038 Ga0075435_100000568
1039 Ga0075435_100019073
1040 Ga0075435_100054299
1041 Ga0075435_100095092
1042 Ga0075435_100101054
1043 Ga0075435_100256208
1044 Ga0075435_100582829
1045 Ga0099795_10029030
1046 Ga0105240_10066714
1047 Ga0105240_10104929
1048 Ga0105240_10597443
1049 Ga0111539_10000991
1050 Ga0111539_10005930
1051 Ga0111539_10009325
1052 Ga0111539_10019006
1053 Ga0111539_10032250
1054 Ga0111539_10072360
1055 Ga0111539_10098013
1056 Ga0111539_10118846
1057 Ga0111539_10144476
1058 Ga0111539_10155091
1059 Ga0111539_10177077
1060 Ga0111539_10182150
1061 Ga0111539_10246808
1062 Ga0111539_10357922
1063 Ga0111539_10406949
1064 Ga0111539_10644920
1065 Ga0111539_10759006
1066 Ga0105245_10047492
1067 Ga0105245_10063106
1068 Ga0105245_10110974
1069 Ga0105247_10020845
1070 Ga0114129_10001454
1071 Ga0114129_10002018
1072 Ga0114129_10003113
1073 Ga0114129_10003212
1074 Ga0114129_10008032
1075 Ga0114129_10011449
1076 Ga0114129_10056834
1077 Ga0114129_10093758
1078 Ga0114129_10100426
1079 Ga0114129_10114373
1080 Ga0114129_10185092
1081 Ga0114129_10287917
1082 Ga0114129_10303963
1083 Ga0114129_10355276
1084 Ga0114129_10404706
1085 Ga0114129_10501203
1086 Ga0105243_10241975
1087 Ga0105241_10093576
1088 Ga0105241_10130416
1089 Ga0105241_10179363
1090 Ga0105242_10078059
1091 Ga0105242_10197972
1092 Ga0105248_10019605
1093 Ga0105248_10061340
1094 Ga0105248_10088340
1095 Ga0105248_10156611
1096 Ga0105248_10273241
1097 Ga0105248_10340987
1098 Ga0105248_10721638
1099 Ga0105248_10797675
1100 Ga0105237_10298118
1101 Ga0105249_10001170
1102 Ga0105249_10001543
1103 Ga0105249_10331630
1104 Ga0105249_10448731
1105 Ga0105249_10451688
1106 Ga0105249_10452641
1107 Ga0105239_10030391
1108 Ga0105239_10034143
1109 Ga0105246_10124005
1110 Ga0157369_10280997
1111 Ga0157378_10015152
1112 Ga0157378_10142440
1113 Ga0157378_10348271
1114 Ga0157378_10383837
1115 Ga0163162_10015208
1116 Ga0163162_10145754
1117 Ga0163162_10264668
1118 Ga0163162_10701371
1119 Ga0157372_10023930
1120 Ga0157372_10116190
1121 Ga0157375_10013039
1122 Ga0157375_10048069
1123 Ga0163163_10164848
1124 Ga0157380_10036753
1125 Ga0157380_10137880
1126 Ga0157380_10235134
1127 Ga0157380_10237303
1128 Ga0157377_10004447
1129 Ga0157377_10016689
1130 Ga0157379_10013352
1131 Ga0157379_10013821
1132 Ga0157379_10226940
1133 Ga0157376_10130263
1134 Ga0157376_10308219
1135 Ga0157376_10524605
1136 Ga0182007_10065881
1137 Ga0163161_10105117
1138 Ga0163161_10234765
1139 Ga0207697_10004794
1140 Ga0207697_10005008
1141 Ga0207682_10024820
1142 Ga0207682_10055721
1143 Ga0207710_10024484
1144 Ga0207688_10012972
1145 Ga0207688_10115695
1146 Ga0207699_10090855
1147 Ga0207699_10100710
1148 Ga0207699_10289490
1149 Ga0207645_10000458
1150 Ga0207645_10005430
1151 Ga0207645_10130330
1152 Ga0207645_10135377
1153 Ga0207643_10002117
1154 Ga0207643_10015108
1155 Ga0207643_10054327
1156 Ga0207643_10069754
1157 Ga0207684_10007541
1158 Ga0207707_10005051
1159 Ga0207707_10007546
1160 Ga0207707_10011691
1161 Ga0207707_10030482
1162 Ga0207707_10031105
1163 Ga0207707_10161962
1164 Ga0207695_10144119
1165 Ga0207695_10203246
1166 Ga0207695_10482959
1167 Ga0207695_10504213
1168 Ga0207693_10010200
1169 Ga0207660_10010362
1170 Ga0207660_10079484
1171 Ga0207660_10096054
1172 Ga0207662_10002841
1173 Ga0207662_10114523
1174 Ga0207657_10085034
1175 Ga0207649_10008533
1176 Ga0207649_10049621
1177 Ga0207652_10026167
1178 Ga0207652_10080990
1179 Ga0207652_10141877
1180 Ga0207652_10222903
1181 Ga0207652_10257802
1182 Ga0207646_10043354
1183 Ga0207646_10114340
1184 Ga0207646_10601702
1185 Ga0207681_10022632
1186 Ga0207681_10026965
1187 Ga0207681_10037827
1188 Ga0207681_10050181
1189 Ga0207681_10066851
1190 Ga0207681_10131927
1191 Ga0207681_10332404
1192 Ga0207681_10519276
1193 Ga0207650_10009739
1194 Ga0207650_10059226
1195 Ga0207650_10088786
1196 Ga0207650_10117959
1197 Ga0207650_10407056
1198 Ga0207659_10000084
1199 Ga0207659_10000145
1200 Ga0207659_10039441
1201 Ga0207659_10052050
1202 Ga0207659_10076972
1203 Ga0207659_10078413
1204 Ga0207659_10087528
1205 Ga0207659_10244977
1206 Ga0207659_10311903
1207 Ga0207687_10071094
1208 Ga0207700_10000992
1209 Ga0207700_10177260
1210 Ga0207664_10064297
1211 Ga0207690_10022088
1212 Ga0207690_10039720
1213 Ga0207690_10065229
1214 Ga0207690_10188578
1215 Ga0207690_10327189
1216 Ga0207706_10000589
1217 Ga0207706_10019175
1218 Ga0207706_10060199
1219 Ga0207706_10063312
1220 Ga0207706_10241564
1221 Ga0207706_10243355
1222 Ga0207686_10055347
1223 Ga0207709_10009774
1224 Ga0207670_10010393
1225 Ga0207670_10194271
1226 Ga0207670_10240884
1227 Ga0207669_10030633
1228 Ga0207669_10046582
1229 Ga0207669_10114086
1230 Ga0207669_10114149
1231 Ga0207669_10220486
1232 Ga0207669_10245040
1233 Ga0207704_10030906
1234 Ga0207704_10093288
1235 Ga0207665_10036009
1236 Ga0207691_10000704
1237 Ga0207691_10011452
1238 Ga0207691_10140160
1239 Ga0207691_10198973
1240 Ga0207691_10342693
1241 Ga0207711_10022962
1242 Ga0207711_10216489
1243 Ga0207689_10012469
1244 Ga0207661_10000775
1245 Ga0207661_10004579
1246 Ga0207679_10010830
1247 Ga0207679_10028209
1248 Ga0207679_10035393
1249 Ga0207679_10035692
1250 Ga0207679_10336584
1251 Ga0207667_10101296
1252 Ga0207667_10381268
1253 Ga0207667_10387463
1254 Ga0207651_10008786
1255 Ga0207651_10121122
1256 Ga0207651_10233182
1257 Ga0207651_10289047
1258 Ga0207712_10001442
1259 Ga0207712_10015681
1260 Ga0207712_10167799
1261 Ga0207712_10417507
1262 Ga0207668_10022334
1263 Ga0207668_10036477
1264 Ga0207668_10126850
1265 Ga0207668_10372640
1266 Ga0207668_10401284
1267 Ga0207640_10118275
1268 Ga0207658_10109443
1269 Ga0207703_10567429
1270 Ga0207639_10237801
1271 Ga0207678_10039606
1272 Ga0207678_10063115
1273 Ga0207708_10007077
1274 Ga0207708_10052648
1275 Ga0207708_10107314
1276 Ga0207708_10196228
1277 Ga0207641_10001258
1278 Ga0207648_10017448
1279 Ga0207648_10028889
1280 Ga0207648_10031449
1281 Ga0207648_10166577
1282 Ga0207648_10439216
1283 Ga0207676_10045426
1284 Ga0207676_10207315
1285 Ga0207676_10516821
1286 Ga0207674_10001445
1287 Ga0207674_10005071
1288 Ga0207674_10018419
1289 Ga0207674_10310126
1290 Ga0207674_10328646
1291 Ga0207674_10571313
1292 Ga0207675_100000720
1293 Ga0207675_100005564
1294 Ga0207675_100128354
1295 Ga0207675_100141840
1296 Ga0207675_100257360
1297 Ga0207675_100753835
1298 Ga0207683_10012080
1299 Ga0207683_10015214
1300 Ga0207683_10095950
1301 Ga0207683_10269028
1302 Ga0207698_10101408
1303 Ga0209974_10009858
1304 Ga0207428_10000486
1305 Ga0207428_10001455
1306 Ga0207428_10006753
1307 Ga0207428_10022988
1308 Ga0207428_10038736
1309 Ga0207428_10049370
1310 Ga0207428_10137237
1311 Ga0207428_10178243
1312 Ga0207428_10292701
1313 Ga0207428_10378685
1314 Ga0268266_10141777
1315 Ga0268266_10239829
1316 Ga0268265_10001813
1317 Ga0268265_10002722
1318 Ga0268265_10048825
1319 Ga0268265_10076471
1320 Ga0268265_10189008
1321 Ga0268265_10352431
1322 Ga0268265_10457684
1323 Ga0268264_10088137
1324 Ga0268264_10135967
1325 Ga0268264_10591154
1326 Ga0268264_10732941
1327 Ga0307408_100000358
1328 Ga0307408_100010533
1329 Ga0307408_100040061
1330 Ga0307408_100482357
1331 Ga0265314_10096174
1332 Ga0307405_10039768
1333 Ga0307405_10080876
1334 Ga0307405_10187046
1335 Ga0307405_10197045
1336 Ga0307413_10009128
1337 Ga0307413_10145213
1338 Ga0307413_10293013
1339 Ga0307410_10008565
1340 Ga0307410_10282923
1341 Ga0307406_10003418
1342 Ga0307406_10025006
1343 Ga0307406_10295492
1344 Ga0307412_10034676
1345 Ga0307409_100044935
1346 Ga0307409_100223268
1347 Ga0307416_100009658
1348 Ga0307416_100676570
1349 Ga0307416_100933932
1350 Ga0307414_10180784
1351 Ga0307414_10639231
1352 Ga0307411_10037271
1353 Ga0307415_100023116
1354 Ga0307415_100201409
1355 Ga0373930_0049973
1356 Ga0373950_0000850
1357 Ga0373959_0003456
1358 Ga0373928_0011906
1359 Ga0373929_0000782
1360 Ga0373940_0016690
1361 Ga0373949_0001573
1362 Ga0373949_0032660
1363 Ga0373952_0000726
1364 Ga0373932_0001056
1365 Ga0373939_0000870
1366 Ga0373939_0018825
1367 Ga0373941_0001609
1368 Ga0373941_0035685
1369 Ga0373960_0000376
1370 Ga0373942_0000823
1371 Ga0373961_0000733
1372 Ga0373961_0084174
1373 Ga0373961_0093480
1374 Ga0373962_0001038
1375 Ga0373931_0026927
1376 Ga0373931_0042390
1377 Ga0373937_0125742
1378 Ga0395905_0044393
1379 Ga0395905_0056361
1380 Ga0395905_0470137
1381 Ga0395901_0456154
1382 Ga0242420_001962
1383 Ga0439455_0046648
1384 Ga0439457_045581
1385 Ga0439462_0018349
1386 Ga0450896_003048
1387 Ga0439446_0015844
1388 Ga0439458_0054493
1389 Ga0439440_0007184
1390 Ga0453683_0038808
1391 Ga0466964_0040965
1392 Ga0451576_0184309
1393 Ga0451576_0211301
1394 Ga0466958_0163768
1395 Ga0495603_0055242
1396 Ga0495582_0152377
1397 Ga0495639_0089599
1398 Ga0495621_0034594
1399 Ga0495621_0062251
1400 Ga0495621_0081401
1401 Ga0495669_0183740
1402 Ga0496100_0066911
1403 Ga0496100_0248092
1404 Ga0496100_0355760
1405 Ga0496101_0047452
1406 Ga0496101_0097952
1407 Ga0496102_0025872
1408 Ga0496102_0091029
1409 Ga0496102_0171729
1410 Ga0496103_0015498
1411 Ga0496103_0087592
1412 Ga0496103_0286970
1413 Ga0496104_0011192
1414 Ga0496104_0073139
1415 Ga0496104_0085719
1416 Ga0496105_0072544
1417 Ga0496106_0022503
1418 Ga0496106_0436014
1419 Ga0496107_0048087
1420 Ga0496107_0063042
1421 Ga0496107_0213880
1422 Ga0496108_0001699
1423 Ga0496108_0064440
1424 Ga0496108_0112485
1425 Ga0496109_0001520
1426 Ga0496109_0024278
1427 Ga0496109_0052363
1428 Ga0496109_0630110
1429 Ga0496110_0001345
1430 Ga0496110_0144641
1431 Ga0496111_0127858
1432 Ga0496112_0001744
1433 Ga0496112_0018884
1434 Ga0496112_0038427
1435 Ga0496113_0000045
1436 Ga0496113_0259039
1437 Ga0496115_0136272
1438 Ga0501039_0303215
1439 Ga0501040_0184219
1440 Ga0501041_0055470
1441 Ga0501042_0005919
1442 Ga0501046_0058760
1443 Ga0501070_0214157
1444 Ga0501071_0246782
1445 Ga0501072_0331894
1446 Ga0501073_0141502
1447 Ga0501074_0099996
1448 Ga0501076_0026701
1449 Ga0501077_0065391
1450 Ga0501202_048966
1451 Ga0501249_054148
1452 Ga0501079_0041608
1453 Ga0501079_0075138
1454 Ga0501079_0264368
1455 Ga0501080_0148312
1456 Ga0501081_0012437
1457 Ga0501081_0250398
1458 nmdc:mga05p37_12960_c1
1459 nmdc:mga05p37_162147_c1
1460 nmdc:mga05p37_181089_c1
1461 nmdc:mga05p37_238875_c1
1462 nmdc:mga05p37_294971_c1
1463 nmdc:mga05p37_352066_c1
1464 nmdc:mga05p37_39196_c1
1465 nmdc:mga05p37_39218_c1
1466 nmdc:mga05p37_416518_c1
1467 nmdc:mga05p37_4621_c1
1468 nmdc:mga05p37_521171_c1
1469 nmdc:mga05p37_95463_c1
1470 nmdc:mga09592_10005_c1
1471 nmdc:mga09592_16920_c1
1472 nmdc:mga09592_17600_c1
1473 nmdc:mga09592_259463_c1
1474 nmdc:mga09592_39043_c1
1475 nmdc:mga09592_944_c1
1476 nmdc:mga0qj67_135328_c1
1477 nmdc:mga0qj67_22110_c1
1478 nmdc:mga0qj67_274418_c1
1479 nmdc:mga0qj67_4197_c1
1480 nmdc:mga0qj67_8085_c1
1481 nmdc:mga06r32_11505_c1
1482 nmdc:mga06r32_1402_c1
1483 nmdc:mga06r32_146057_c1
1484 nmdc:mga06r32_147982_c1
1485 nmdc:mga06r32_205246_c1
1486 nmdc:mga06r32_34145_c1
1487 nmdc:mga06r32_345371_c1
1488 nmdc:mga08y16_137973_c1
1489 nmdc:mga08y16_142859_c1
1490 nmdc:mga08y16_15056_c1
1491 nmdc:mga08y16_183242_c1
1492 nmdc:mga08y16_18370_c1
1493 nmdc:mga08y16_187645_c1
1494 nmdc:mga08y16_199947_c1
1495 nmdc:mga08y16_230406_c1
1496 nmdc:mga08y16_230655_c1
1497 nmdc:mga08y16_26197_c1
1498 nmdc:mga08y16_273_c1
1499 nmdc:mga08y16_37090_c1
1500 nmdc:mga08y16_404782_c1
1501 nmdc:mga08y16_405500_c1
1502 nmdc:mga08y16_46695_c1
1503 nmdc:mga08y16_469207_c1
1504 nmdc:mga08y16_7863_c1
1505 nmdc:mga08y16_85352_c1
1506 nmdc:mga0n895_14753_c1
1507 nmdc:mga0n895_2_c1
1508 nmdc:mga0n895_350980_c1
1509 nmdc:mga0n895_420628_c1
1510 nmdc:mga0n895_423245_c1
1511 nmdc:mga0n895_5397_c1
1512 nmdc:mga0n895_572478_c1
1513 nmdc:mga0n895_6246_c1
1514 nmdc:mga0n895_688441_c1
1515 nmdc:mga0rr50_1100_c1
1516 nmdc:mga0rr50_11961_c1
1517 nmdc:mga0rr50_322852_c1
1518 nmdc:mga0rr50_421234_c1
1519 nmdc:mga0rr50_73036_c1
1520 nmdc:mga0rr50_9_c1
1521 nmdc:mga08x19_118773_c1
1522 nmdc:mga08x19_176133_c1
1523 nmdc:mga08x19_32396_c1
1524 nmdc:mga08x19_4396_c2
1525 nmdc:mga08x19_457_c1
1526 nmdc:mga0a205_123937_c1
1527 nmdc:mga0a205_417279_c1
1528 nmdc:mga0a205_4939_c1
1529 nmdc:mga0a205_53323_c1
1530 nmdc:mga0a205_93648_c1
1531 nmdc:mga0a205_9380_c1
1532 nmdc:mga0a205_94198_c1
1533 Ga0495601_0311781
1534 Ga0500641_0002462
1535 Ga0500555_000178
1536 Ga0500645_000293
1537 Ga0501082_0154237
1538 Ga0501082_0717708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.7904 11 265
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.7588 11 265
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.4918 88 258
2e74-assembly1.cif.gz_A crystal structure of the cytochrome b6f complex from m.laminosus 0.4734 91 252
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.4501 88 258
ID Description Score Start End Superfamily
af_Q9M363_194_379_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5703 90 255 1.20.120.1770
af_Q8K424_423_581_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5537 88 255 1.20.120.350
af_A0A0R0IJL1_639_753_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5008 147 259 1.20.140.150
af_Q8K424_423_581_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4973 88 255 1.20.120.350
4gd3B00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.4918 88 258 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A2V7RLD6-F1-model_v4 Succinate dehydrogenase 0.9664 148 265 GO:0016020
AF-A0A2V7RLD6-F1-model_v4 Succinate dehydrogenase 0.9506 148 265 GO:0016020
AF-A0A6B1FLJ0-F1-model_v4 deleted 0.9335 176 265
AF-A0A6B1FLJ0-F1-model_v4 deleted 0.9237 176 265
AF-A0A2V5ZPF8-F1-model_v4 Succinate dehydrogenase 0.9209 129 265 GO:0016020

Map