F479874
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 766 | 552 | 541 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300049744|Ga0501083_0016520|Ga0501083_0016520_809_1711 |
| Length | 300 |
| Sequence | MLFPPFDPDRAESRRKRFRAIPVRTLVPNLITLLALCAGLTAIRLSIEGKLEWALGAIVFAAILDGIDGRVARLIKGQSRFGAELDSLADFVNFGVAPGLILYFWGLNELGSVGWIAALVFAICAGLRLARFNVMIDDPNQPAWVGNFFVGVPAPAGAITVLLPVYVSLLGGPRPAIVTFLYTLLIAFFMVSRLPVLSGKKLGTRVPPEMVLPIFVVVVLFVALLVSYPWVVLTIGTLAYLAALPLGWASHRNYQRLDVAAAGPVESPVSAQTGRPNDAAPASGRVLDDADAPDRPSRLN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 28 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 29 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 30 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 33 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 34 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 35 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 36 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 37 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 38 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 39 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 40 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 41 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 42 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 43 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 44 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 45 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 46 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 47 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 48 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 49 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 50 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 51 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 52 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 53 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 54 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 55 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 56 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 57 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 58 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 59 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 60 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 61 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 62 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 63 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 64 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 65 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 66 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 67 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 68 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 69 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 70 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 71 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 72 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 73 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 74 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 75 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 76 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 77 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 78 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 79 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 80 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 81 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 82 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 83 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 84 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 85 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 86 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 87 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 88 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 89 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 90 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 91 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 92 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 93 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 94 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 95 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 96 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 97 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 98 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 99 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 100 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 101 | 2904699407 | |||
| 102 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 103 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 104 | 2906610324 | |||
| 105 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 106 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 107 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 108 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 109 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 110 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 111 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 112 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 113 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 114 | 2922368715 | |||
| 115 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 116 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 117 | 2922425934 | |||
| 118 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 119 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 120 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 121 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 122 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 123 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 124 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 125 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 126 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 127 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 128 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 129 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 130 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 131 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 132 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 133 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 134 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 135 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 136 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 137 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 138 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 139 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 140 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 141 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 142 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 143 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 144 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 145 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 146 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 147 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 148 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 149 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 150 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 151 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 152 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 153 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 154 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 155 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 156 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 157 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 158 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 159 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 160 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 161 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 162 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 163 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 164 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 165 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 166 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 167 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 168 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 169 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 170 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 171 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 172 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 173 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 174 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 175 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 176 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 177 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 178 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 179 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 180 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 181 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 182 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 183 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 184 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 185 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 186 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 187 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 188 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 189 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 190 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 191 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 192 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 193 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 194 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 196 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 197 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 198 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 202 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 207 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 208 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 215 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 216 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 219 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 220 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 222 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 223 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 224 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 226 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 227 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 228 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 229 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 230 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 231 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 232 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 233 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 235 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 236 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 237 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 238 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 239 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 240 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 241 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 242 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 243 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 244 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 245 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 246 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 267 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 268 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 269 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 270 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 271 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 276 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 277 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 326 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 327 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 328 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 329 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 330 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 331 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 335 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 336 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 337 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 338 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 339 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 340 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 341 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 342 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 343 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 344 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 345 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 346 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 347 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 348 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 349 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 350 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 351 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 352 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 353 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 354 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 355 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 356 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 357 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 358 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 359 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 360 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 361 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 362 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 363 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 364 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 365 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 366 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 367 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 368 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 369 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 419 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 420 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 421 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 422 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 423 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 424 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 427 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 428 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 429 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 430 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 431 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 432 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 433 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 434 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 435 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 436 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 437 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 438 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 439 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 471 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 477 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 482 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 483 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 484 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 485 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 486 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 487 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 488 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 489 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 490 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 491 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 492 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 493 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 494 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 496 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 497 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 498 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 499 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 501 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 502 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 503 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 505 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 506 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 507 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 508 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 509 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 510 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 511 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 513 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 515 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 516 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 517 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 518 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 519 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 520 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 521 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 522 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 523 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 524 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 525 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 526 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 527 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 528 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 529 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 530 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 531 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 532 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 533 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 534 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 535 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 536 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 537 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 538 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 539 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 540 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 541 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 542 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 543 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 544 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 545 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 546 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 547 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 548 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 549 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 550 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 551 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 552 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71 |
| Metatranscriptomes | 0 |
| Isolates | 29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.36 |
| Nodule | 22.32 |
| Rhizoplane | 4.31 |
| Rhizosphere | 50 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000386 | 3300003215 | Bacteria | 30025 |
| 2 | JGI25153J46596_10007394 | 3300003215 | Bacteria | 5410 |
| 3 | JGI25153J46596_10028188 | 3300003215 | Bacteria | 1953 |
| 4 | JGI25160J50197_1001640 | 3300003354 | Bacteria | 10982 |
| 5 | JGI25160J50197_1002119 | 3300003354 | Bacteria | 9426 |
| 6 | JGI25404J52841_10002404 | 3300003659 | Bacteria | 3534 |
| 7 | JGI25404J52841_10021019 | 3300003659 | Bacteria | 1413 |
| 8 | Ga0055539_1007248 | 3300003752 | Bacteria | 1406 |
| 9 | Ga0065165_1001250 | 3300005262 | Bacteria | 28850 |
| 10 | Ga0070690_100086843 | 3300005330 | Bacteria | 2054 |
| 11 | Ga0070677_10002540 | 3300005333 | Bacteria | 5837 |
| 12 | Ga0068869_100256128 | 3300005334 | Bacteria | 1399 |
| 13 | Ga0068868_100267134 | 3300005338 | Bacteria | 1444 |
| 14 | Ga0070689_100085305 | 3300005340 | Bacteria | 2483 |
| 15 | Ga0070689_100111110 | 3300005340 | Bacteria | 2180 |
| 16 | Ga0070689_100474700 | 3300005340 | Bacteria | 1067 |
| 17 | Ga0070671_100009681 | 3300005355 | Bacteria | 7742 |
| 18 | Ga0070674_100003716 | 3300005356 | Bacteria | 8603 |
| 19 | Ga0070673_100077857 | 3300005364 | Bacteria | 2680 |
| 20 | Ga0070688_100124589 | 3300005365 | Bacteria | 1730 |
| 21 | Ga0070667_100092655 | 3300005367 | Bacteria | 2600 |
| 22 | Ga0070709_10002491 | 3300005434 | Bacteria | 9968 |
| 23 | Ga0070709_10045274 | 3300005434 | Bacteria | 2729 |
| 24 | Ga0070714_100007873 | 3300005435 | Bacteria | 8299 |
| 25 | Ga0070714_100009376 | 3300005435 | Bacteria | 7690 |
| 26 | Ga0070714_100061891 | 3300005435 | Bacteria | 3215 |
| 27 | Ga0070714_100244588 | 3300005435 | Bacteria | 1657 |
| 28 | Ga0070714_100462257 | 3300005435 | Bacteria | 1206 |
| 29 | Ga0070713_100010069 | 3300005436 | Bacteria | 6817 |
| 30 | Ga0070713_100011234 | 3300005436 | Bacteria | 6512 |
| 31 | Ga0070713_100058698 | 3300005436 | Bacteria | 3210 |
| 32 | Ga0070713_100324435 | 3300005436 | Bacteria | 1423 |
| 33 | Ga0070710_10002506 | 3300005437 | Bacteria | 8706 |
| 34 | Ga0070710_10020959 | 3300005437 | Bacteria | 3399 |
| 35 | Ga0070710_10044248 | 3300005437 | Bacteria | 2469 |
| 36 | Ga0070710_10044958 | 3300005437 | Bacteria | 2452 |
| 37 | Ga0070701_10112179 | 3300005438 | Bacteria | 1525 |
| 38 | Ga0070711_100003409 | 3300005439 | Bacteria | 9259 |
| 39 | Ga0070711_100006571 | 3300005439 | Bacteria | 7018 |
| 40 | Ga0070711_100011302 | 3300005439 | Bacteria | 5540 |
| 41 | Ga0070711_100191231 | 3300005439 | Bacteria | 1573 |
| 42 | Ga0070711_100221709 | 3300005439 | Bacteria | 1470 |
| 43 | Ga0070705_100140565 | 3300005440 | Bacteria | 1588 |
| 44 | Ga0070663_100037003 | 3300005455 | Bacteria | 3394 |
| 45 | Ga0070663_100070351 | 3300005455 | Bacteria | 2544 |
| 46 | Ga0070678_100024943 | 3300005456 | Bacteria | 4012 |
| 47 | Ga0070662_100210726 | 3300005457 | Bacteria | 1546 |
| 48 | Ga0070662_100334516 | 3300005457 | Bacteria | 1238 |
| 49 | Ga0070699_100087780 | 3300005518 | Bacteria | 2715 |
| 50 | Ga0070684_100352631 | 3300005535 | Bacteria | 1353 |
| 51 | Ga0068853_100000785 | 3300005539 | Bacteria | 22086 |
| 52 | Ga0068853_100035350 | 3300005539 | Bacteria | 4244 |
| 53 | Ga0070696_100156874 | 3300005546 | Bacteria | 1674 |
| 54 | Ga0070665_100052340 | 3300005548 | Bacteria | 4095 |
| 55 | Ga0070665_100191755 | 3300005548 | Bacteria | 2044 |
| 56 | Ga0070665_100419409 | 3300005548 | Bacteria | 1347 |
| 57 | Ga0070704_100165347 | 3300005549 | Bacteria | 1754 |
| 58 | Ga0068855_100065946 | 3300005563 | Bacteria | 4221 |
| 59 | Ga0070664_100175522 | 3300005564 | Bacteria | 1902 |
| 60 | Ga0068857_100030751 | 3300005577 | Bacteria | 4743 |
| 61 | Ga0068854_100013500 | 3300005578 | Bacteria | 5364 |
| 62 | Ga0068854_100045877 | 3300005578 | Bacteria | 3110 |
| 63 | Ga0068856_100016783 | 3300005614 | Bacteria | 7095 |
| 64 | Ga0070702_100255000 | 3300005615 | Bacteria | 1191 |
| 65 | Ga0068852_100015463 | 3300005616 | Bacteria | 5921 |
| 66 | Ga0068852_100272114 | 3300005616 | Bacteria | 1630 |
| 67 | Ga0068852_100560566 | 3300005616 | Bacteria | 1144 |
| 68 | Ga0068864_100227566 | 3300005618 | Bacteria | 1723 |
| 69 | Ga0068861_100048002 | 3300005719 | Bacteria | 3225 |
| 70 | Ga0068861_100465676 | 3300005719 | Bacteria | 1135 |
| 71 | Ga0068863_100054647 | 3300005841 | Bacteria | 3783 |
| 72 | Ga0068858_100189646 | 3300005842 | Bacteria | 1942 |
| 73 | Ga0068858_100474624 | 3300005842 | Bacteria | 1207 |
| 74 | Ga0068860_100134269 | 3300005843 | Bacteria | 2376 |
| 75 | Ga0068860_100362580 | 3300005843 | Bacteria | 1428 |
| 76 | Ga0081540_1007585 | 3300005983 | Bacteria | 7707 |
| 77 | Ga0081540_1017287 | 3300005983 | Bacteria | 4470 |
| 78 | Ga0081540_1017313 | 3300005983 | Bacteria | 4466 |
| 79 | Ga0081540_1090440 | 3300005983 | Bacteria | 1348 |
| 80 | Ga0081539_10000051 | 3300005985 | Bacteria | 268337 |
| 81 | Ga0081539_10000148 | 3300005985 | Bacteria | 163442 |
| 82 | Ga0070717_10018001 | 3300006028 | Bacteria | 5511 |
| 83 | Ga0070717_10018400 | 3300006028 | Bacteria | 5454 |
| 84 | Ga0075365_10014323 | 3300006038 | Bacteria | 4768 |
| 85 | Ga0075365_10053340 | 3300006038 | Bacteria | 2677 |
| 86 | Ga0075365_10151648 | 3300006038 | Bacteria | 1612 |
| 87 | Ga0075368_10001595 | 3300006042 | Bacteria | 7281 |
| 88 | Ga0075368_10022438 | 3300006042 | Bacteria | 2403 |
| 89 | Ga0070715_10000111 | 3300006163 | Bacteria | 20025 |
| 90 | Ga0070716_100019234 | 3300006173 | Bacteria | 3567 |
| 91 | Ga0070712_100005474 | 3300006175 | Bacteria | 7861 |
| 92 | Ga0070712_100050814 | 3300006175 | Bacteria | 2886 |
| 93 | Ga0070712_100065294 | 3300006175 | Bacteria | 2583 |
| 94 | Ga0075367_10138198 | 3300006178 | Bacteria | 1508 |
| 95 | Ga0075369_10013149 | 3300006186 | Bacteria | 3278 |
| 96 | Ga0075366_10005054 | 3300006195 | Bacteria | 7130 |
| 97 | Ga0075370_10004684 | 3300006353 | Bacteria | 6673 |
| 98 | Ga0075370_10021626 | 3300006353 | Bacteria | 3524 |
| 99 | Ga0075436_100331425 | 3300006914 | Bacteria | 1095 |
| 100 | Ga0099824_1006303 | 3300006942 | Bacteria | 16336 |
| 101 | Ga0099823_1047796 | 3300006944 | Bacteria | 2749 |
| 102 | Ga0105240_10067442 | 3300009093 | Bacteria | 4435 |
| 103 | Ga0111539_10328267 | 3300009094 | Bacteria | 1781 |
| 104 | Ga0105245_10176704 | 3300009098 | Bacteria | 2037 |
| 105 | Ga0105245_10399676 | 3300009098 | Bacteria | 1373 |
| 106 | Ga0105247_10012747 | 3300009101 | Bacteria | 5046 |
| 107 | Ga0105247_10016810 | 3300009101 | Bacteria | 4386 |
| 108 | Ga0105241_10001021 | 3300009174 | Bacteria | 21313 |
| 109 | Ga0105241_10030687 | 3300009174 | Bacteria | 4019 |
| 110 | Ga0105241_10265563 | 3300009174 | Bacteria | 1460 |
| 111 | Ga0105248_10120332 | 3300009177 | Bacteria | 2962 |
| 112 | Ga0105248_10924621 | 3300009177 | Bacteria | 985 |
| 113 | Ga0105237_10009330 | 3300009545 | Bacteria | 10508 |
| 114 | Ga0105237_10103026 | 3300009545 | Bacteria | 2846 |
| 115 | Ga0105237_10105765 | 3300009545 | Bacteria | 2805 |
| 116 | Ga0105237_10433607 | 3300009545 | Bacteria | 1320 |
| 117 | Ga0105237_10597240 | 3300009545 | Bacteria | 1111 |
| 118 | Ga0105238_10002878 | 3300009551 | Bacteria | 17208 |
| 119 | Ga0105238_10154078 | 3300009551 | Bacteria | 2273 |
| 120 | Ga0105239_10038560 | 3300010375 | Bacteria | 5236 |
| 121 | Ga0105239_10086748 | 3300010375 | Bacteria | 3450 |
| 122 | Ga0105239_10330046 | 3300010375 | Bacteria | 1721 |
| 123 | Ga0105239_10444933 | 3300010375 | Bacteria | 1469 |
| 124 | Ga0105246_10009369 | 3300011119 | Bacteria | 6032 |
| 125 | Ga0157369_10014981 | 3300013105 | Bacteria | 8751 |
| 126 | Ga0157374_10408791 | 3300013296 | Bacteria | 1355 |
| 127 | Ga0157378_10130231 | 3300013297 | Bacteria | 2328 |
| 128 | Ga0163162_10510385 | 3300013306 | Bacteria | 1332 |
| 129 | Ga0157372_10132348 | 3300013307 | Bacteria | 2870 |
| 130 | Ga0157372_10254531 | 3300013307 | Bacteria | 2038 |
| 131 | Ga0157375_10416713 | 3300013308 | Bacteria | 1509 |
| 132 | Ga0163163_10000985 | 3300014325 | Bacteria | 24137 |
| 133 | Ga0163163_10175895 | 3300014325 | Bacteria | 2187 |
| 134 | Ga0157380_10074167 | 3300014326 | Bacteria | 2761 |
| 135 | Ga0157380_10078609 | 3300014326 | Bacteria | 2692 |
| 136 | Ga0157377_10079215 | 3300014745 | Bacteria | 1916 |
| 137 | Ga0157376_10127093 | 3300014969 | Bacteria | 2269 |
| 138 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 139 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 140 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 141 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 142 | Ga0213876_10028716 | 3300021384 | Bacteria | 2933 |
| 143 | Ga0209677_105669 | 3300025253 | Bacteria | 3189 |
| 144 | Ga0209148_1000374 | 3300025254 | Bacteria | 54657 |
| 145 | Ga0209233_1003530 | 3300025261 | Bacteria | 5497 |
| 146 | Ga0209455_1005711 | 3300025272 | Bacteria | 3793 |
| 147 | Ga0209673_1029382 | 3300025273 | Bacteria | 1751 |
| 148 | Ga0209564_1023949 | 3300025295 | Bacteria | 2102 |
| 149 | Ga0209564_1036712 | 3300025295 | Bacteria | 1393 |
| 150 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 151 | Ga0209758_1000068 | 3300025297 | Bacteria | 286488 |
| 152 | Ga0209758_1001579 | 3300025297 | Bacteria | 26050 |
| 153 | Ga0209758_1009410 | 3300025297 | Bacteria | 6080 |
| 154 | Ga0209758_1027583 | 3300025297 | Bacteria | 2422 |
| 155 | Ga0207426_1000387 | 3300025302 | Bacteria | 75536 |
| 156 | Ga0207426_1000726 | 3300025302 | Bacteria | 37826 |
| 157 | Ga0207426_1004903 | 3300025302 | Bacteria | 6320 |
| 158 | Ga0207426_1032624 | 3300025302 | Bacteria | 1687 |
| 159 | Ga0207426_1042824 | 3300025302 | Bacteria | 1395 |
| 160 | Ga0209257_1002392 | 3300025304 | Bacteria | 18783 |
| 161 | Ga0209257_1015675 | 3300025304 | Bacteria | 3132 |
| 162 | Ga0209257_1023354 | 3300025304 | Bacteria | 2176 |
| 163 | Ga0207696_1023356 | 3300025711 | Bacteria | 1951 |
| 164 | Ga0207692_10006395 | 3300025898 | Bacteria | 4776 |
| 165 | Ga0207642_10089510 | 3300025899 | Bacteria | 1517 |
| 166 | Ga0207710_10008834 | 3300025900 | Bacteria | 4242 |
| 167 | Ga0207710_10019462 | 3300025900 | Bacteria | 2897 |
| 168 | Ga0207647_10042350 | 3300025904 | Bacteria | 2857 |
| 169 | Ga0207685_10079054 | 3300025905 | Bacteria | 1356 |
| 170 | Ga0207699_10065951 | 3300025906 | Bacteria | 2196 |
| 171 | Ga0207699_10085874 | 3300025906 | Bacteria | 1964 |
| 172 | Ga0207645_10005641 | 3300025907 | Bacteria | 9045 |
| 173 | Ga0207705_10018834 | 3300025909 | Bacteria | 4936 |
| 174 | Ga0207654_10000163 | 3300025911 | Bacteria | 42749 |
| 175 | Ga0207654_10034022 | 3300025911 | Bacteria | 2828 |
| 176 | Ga0207707_10303171 | 3300025912 | Bacteria | 1381 |
| 177 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 178 | Ga0207695_10001547 | 3300025913 | Bacteria | 37828 |
| 179 | Ga0207671_10007503 | 3300025914 | Bacteria | 9459 |
| 180 | Ga0207671_10153686 | 3300025914 | Bacteria | 1779 |
| 181 | Ga0207671_10167852 | 3300025914 | Bacteria | 1703 |
| 182 | Ga0207693_10005244 | 3300025915 | Bacteria | 10845 |
| 183 | Ga0207693_10007171 | 3300025915 | Bacteria | 9182 |
| 184 | Ga0207663_10001290 | 3300025916 | Bacteria | 11612 |
| 185 | Ga0207663_10016823 | 3300025916 | Bacteria | 4066 |
| 186 | Ga0207663_10051853 | 3300025916 | Bacteria | 2557 |
| 187 | Ga0207657_10009208 | 3300025919 | Bacteria | 9954 |
| 188 | Ga0207657_10093341 | 3300025919 | Bacteria | 2507 |
| 189 | Ga0207649_10108479 | 3300025920 | Bacteria | 1850 |
| 190 | Ga0207681_10051162 | 3300025923 | Bacteria | 2798 |
| 191 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 192 | Ga0207694_10010038 | 3300025924 | Bacteria | 7136 |
| 193 | Ga0207694_10273228 | 3300025924 | Bacteria | 1387 |
| 194 | Ga0207659_10088530 | 3300025926 | Bacteria | 2306 |
| 195 | Ga0207700_10023334 | 3300025928 | Bacteria | 4263 |
| 196 | Ga0207700_10025313 | 3300025928 | Bacteria | 4119 |
| 197 | Ga0207700_10117025 | 3300025928 | Bacteria | 2154 |
| 198 | Ga0207700_10291384 | 3300025928 | Bacteria | 1407 |
| 199 | Ga0207664_10003495 | 3300025929 | Bacteria | 10488 |
| 200 | Ga0207664_10143487 | 3300025929 | Bacteria | 2023 |
| 201 | Ga0207644_10014670 | 3300025931 | Bacteria | 5249 |
| 202 | Ga0207644_10131590 | 3300025931 | Bacteria | 1916 |
| 203 | Ga0207706_10066142 | 3300025933 | Bacteria | 3182 |
| 204 | Ga0207706_10190392 | 3300025933 | Bacteria | 1801 |
| 205 | Ga0207706_10280426 | 3300025933 | Bacteria | 1453 |
| 206 | Ga0207706_10335628 | 3300025933 | Bacteria | 1315 |
| 207 | Ga0207709_10052322 | 3300025935 | Bacteria | 2507 |
| 208 | Ga0207670_10068005 | 3300025936 | Bacteria | 2453 |
| 209 | Ga0207670_10096072 | 3300025936 | Bacteria | 2106 |
| 210 | Ga0207669_10014442 | 3300025937 | Bacteria | 3957 |
| 211 | Ga0207665_10000651 | 3300025939 | Bacteria | 23346 |
| 212 | Ga0207691_10004180 | 3300025940 | Bacteria | 14023 |
| 213 | Ga0207679_10181619 | 3300025945 | Bacteria | 1741 |
| 214 | Ga0207667_10013113 | 3300025949 | Bacteria | 9512 |
| 215 | Ga0207667_10178660 | 3300025949 | Bacteria | 2180 |
| 216 | Ga0207667_10414258 | 3300025949 | Bacteria | 1371 |
| 217 | Ga0207712_10129627 | 3300025961 | Bacteria | 1920 |
| 218 | Ga0207668_10014275 | 3300025972 | Bacteria | 4914 |
| 219 | Ga0207640_10015497 | 3300025981 | Bacteria | 4413 |
| 220 | Ga0207640_10356183 | 3300025981 | Bacteria | 1177 |
| 221 | Ga0207677_10161412 | 3300026023 | Bacteria | 1742 |
| 222 | Ga0207639_10003890 | 3300026041 | Bacteria | 10067 |
| 223 | Ga0207639_10090464 | 3300026041 | Bacteria | 2448 |
| 224 | Ga0207678_10040532 | 3300026067 | Bacteria | 4039 |
| 225 | Ga0207678_10056441 | 3300026067 | Bacteria | 3380 |
| 226 | Ga0207708_10154985 | 3300026075 | Bacteria | 1806 |
| 227 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 228 | Ga0207648_10021112 | 3300026089 | Bacteria | 5855 |
| 229 | Ga0207676_10089470 | 3300026095 | Bacteria | 2523 |
| 230 | Ga0207674_10005123 | 3300026116 | Bacteria | 15638 |
| 231 | Ga0207674_10012072 | 3300026116 | Bacteria | 9675 |
| 232 | Ga0207674_10295749 | 3300026116 | Bacteria | 1568 |
| 233 | Ga0207675_100197110 | 3300026118 | Bacteria | 1933 |
| 234 | Ga0207683_10401917 | 3300026121 | Bacteria | 1260 |
| 235 | Ga0207698_10026372 | 3300026142 | Bacteria | 4110 |
| 236 | Ga0207698_10058767 | 3300026142 | Bacteria | 2982 |
| 237 | Ga0207698_10353637 | 3300026142 | Bacteria | 1388 |
| 238 | Ga0209389_1000100 | 3300027296 | Bacteria | 79023 |
| 239 | Ga0209389_1000107 | 3300027296 | Bacteria | 74129 |
| 240 | Ga0209589_1000092 | 3300027357 | Bacteria | 89530 |
| 241 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 242 | Ga0209489_109859 | 3300027361 | Bacteria | 11412 |
| 243 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 244 | Ga0209813_10015348 | 3300027866 | Bacteria | 2074 |
| 245 | Ga0265357_1002291 | 3300028023 | Bacteria | 1546 |
| 246 | Ga0268266_10323522 | 3300028379 | Bacteria | 1444 |
| 247 | Ga0268266_10539093 | 3300028379 | Bacteria | 1117 |
| 248 | Ga0268265_10032816 | 3300028380 | Bacteria | 3767 |
| 249 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 250 | Ga0268264_10068657 | 3300028381 | Bacteria | 2996 |
| 251 | Ga0268264_10213469 | 3300028381 | Bacteria | 1773 |
| 252 | Ga0265320_10015104 | 3300031240 | Bacteria | 4372 |
| 253 | Ga0265325_10074988 | 3300031241 | Bacteria | 1690 |
| 254 | Ga0265340_10029289 | 3300031247 | Bacteria | 2765 |
| 255 | Ga0265340_10096972 | 3300031247 | Bacteria | 1373 |
| 256 | Ga0265331_10070103 | 3300031250 | Bacteria | 1641 |
| 257 | Ga0265331_10165600 | 3300031250 | Bacteria | 1001 |
| 258 | Ga0307513_10136805 | 3300031456 | Bacteria | 2384 |
| 259 | Ga0307509_10039753 | 3300031507 | Bacteria | 5121 |
| 260 | Ga0265342_10114872 | 3300031712 | Bacteria | 1520 |
| 261 | Ga0307406_10221045 | 3300031901 | Bacteria | 1408 |
| 262 | Ga0307412_10012231 | 3300031911 | Bacteria | 4994 |
| 263 | Ga0307510_10016775 | 3300033180 | Bacteria | 8639 |
| 264 | Ga0373955_0003380 | 3300035172 | Bacteria | 7015 |
| 265 | Ga0373935_0027491 | 3300035692 | Bacteria | 3515 |
| 266 | Ga0373927_0008512 | 3300035695 | Bacteria | 6901 |
| 267 | Ga0373927_0009424 | 3300035695 | Bacteria | 6547 |
| 268 | Ga0373933_0101676 | 3300035724 | Bacteria | 1784 |
| 269 | Ga0373937_0207433 | 3300036401 | Bacteria | 1843 |
| 270 | Ga0373937_0506086 | 3300036401 | Bacteria | 1147 |
| 271 | Ga0373925_0005876 | 3300037068 | Bacteria | 9094 |
| 272 | Ga0395899_0021195 | 3300037312 | Bacteria | 4930 |
| 273 | Ga0395900_0112595 | 3300037418 | Bacteria | 2794 |
| 274 | Ga0395898_0150340 | 3300037466 | Bacteria | 2228 |
| 275 | Ga0395898_0281299 | 3300037466 | Bacteria | 1587 |
| 276 | Ga0395905_0001582 | 3300037471 | Bacteria | 27158 |
| 277 | Ga0395901_0057232 | 3300038443 | Bacteria | 4055 |
| 278 | Ga0395901_0095483 | 3300038443 | Bacteria | 3115 |
| 279 | Ga0436365_0338708 | 3300039437 | Bacteria | 1467 |
| 280 | Ga0436365_0392043 | 3300039437 | Bacteria | 7324 |
| 281 | Ga0436365_0919787 | 3300039437 | Bacteria | 3799 |
| 282 | Ga0436363_0292837 | 3300039450 | Bacteria | 3697 |
| 283 | Ga0436363_0967671 | 3300039450 | Bacteria | 7219 |
| 284 | Ga0436362_0009644 | 3300039453 | Bacteria | 7519 |
| 285 | Ga0451791_1826241 | 3300041451 | Bacteria | 1192 |
| 286 | Ga0451849_1036195 | 3300041505 | Bacteria | 1138 |
| 287 | Ga0466972_0040591 | 3300044658 | Bacteria | 2266 |
| 288 | Ga0466972_0054751 | 3300044658 | Bacteria | 1919 |
| 289 | Ga0466966_0000334 | 3300044684 | Bacteria | 30532 |
| 290 | Ga0466961_0000509 | 3300044693 | Bacteria | 24794 |
| 291 | Ga0466963_0013523 | 3300044694 | Bacteria | 5012 |
| 292 | Ga0466963_0056465 | 3300044694 | Bacteria | 2613 |
| 293 | Ga0466968_0012959 | 3300044735 | Bacteria | 3271 |
| 294 | Ga0466970_0091409 | 3300044765 | Bacteria | 1652 |
| 295 | Ga0466957_0212960 | 3300044842 | Bacteria | 1273 |
| 296 | Ga0466959_0004969 | 3300045049 | Bacteria | 9013 |
| 297 | Ga0466967_0070092 | 3300045976 | Bacteria | 3135 |
| 298 | Ga0466967_0141520 | 3300045976 | Bacteria | 2241 |
| 299 | Ga0495603_0061957 | 3300046455 | Bacteria | 2209 |
| 300 | Ga0495638_0005531 | 3300046460 | Bacteria | 9374 |
| 301 | Ga0495638_0011004 | 3300046460 | Bacteria | 6256 |
| 302 | Ga0495653_0046891 | 3300046463 | Bacteria | 3344 |
| 303 | Ga0495664_0021466 | 3300046477 | Bacteria | 3730 |
| 304 | Ga0495664_0082366 | 3300046477 | Bacteria | 1930 |
| 305 | Ga0495664_0156395 | 3300046477 | Bacteria | 1383 |
| 306 | Ga0495594_0091072 | 3300046499 | Bacteria | 1709 |
| 307 | Ga0495606_0051583 | 3300046507 | Bacteria | 2682 |
| 308 | Ga0495608_0065131 | 3300046511 | Bacteria | 2387 |
| 309 | Ga0495608_0165537 | 3300046511 | Bacteria | 1404 |
| 310 | Ga0495610_0014109 | 3300046512 | Bacteria | 4713 |
| 311 | Ga0495616_0021556 | 3300046513 | Bacteria | 3487 |
| 312 | Ga0495618_0017068 | 3300046514 | Bacteria | 4448 |
| 313 | Ga0495628_0058616 | 3300046516 | Bacteria | 3024 |
| 314 | Ga0495628_0283408 | 3300046516 | Bacteria | 1230 |
| 315 | Ga0495630_0267649 | 3300046517 | Bacteria | 1306 |
| 316 | Ga0495631_0101189 | 3300046518 | Bacteria | 1240 |
| 317 | Ga0495632_0072203 | 3300046519 | Bacteria | 1657 |
| 318 | Ga0495643_0003949 | 3300046522 | Bacteria | 10620 |
| 319 | Ga0495648_0033393 | 3300046524 | Bacteria | 3360 |
| 320 | Ga0495652_0108486 | 3300046529 | Bacteria | 2237 |
| 321 | Ga0495652_0121604 | 3300046529 | Bacteria | 2081 |
| 322 | Ga0495640_0016907 | 3300046533 | Bacteria | 5448 |
| 323 | Ga0495640_0021451 | 3300046533 | Bacteria | 4739 |
| 324 | Ga0495640_0028070 | 3300046533 | Bacteria | 4054 |
| 325 | Ga0495586_0113588 | 3300046535 | Bacteria | 1509 |
| 326 | Ga0495587_0024759 | 3300046536 | Bacteria | 3675 |
| 327 | Ga0495598_0012981 | 3300046537 | Bacteria | 2056 |
| 328 | Ga0495597_0029621 | 3300046542 | Bacteria | 2499 |
| 329 | Ga0495645_0029875 | 3300046543 | Bacteria | 3968 |
| 330 | Ga0495645_0056202 | 3300046543 | Bacteria | 2858 |
| 331 | Ga0495622_0007956 | 3300046557 | Bacteria | 4915 |
| 332 | Ga0495622_0053711 | 3300046557 | Bacteria | 1869 |
| 333 | Ga0495622_0177915 | 3300046557 | Bacteria | 955 |
| 334 | Ga0495667_0028180 | 3300046559 | Bacteria | 3781 |
| 335 | Ga0495667_0205780 | 3300046559 | Bacteria | 1258 |
| 336 | Ga0495668_0024031 | 3300046616 | Bacteria | 3469 |
| 337 | Ga0495668_0026081 | 3300046616 | Bacteria | 3318 |
| 338 | Ga0495634_0057933 | 3300046642 | Bacteria | 2584 |
| 339 | Ga0495634_0150964 | 3300046642 | Bacteria | 1469 |
| 340 | Ga0495625_0338569 | 3300046660 | Bacteria | 954 |
| 341 | Ga0495635_0003611 | 3300046663 | Bacteria | 10715 |
| 342 | Ga0495635_0017322 | 3300046663 | Bacteria | 5033 |
| 343 | Ga0495657_0008209 | 3300046675 | Bacteria | 8000 |
| 344 | Ga0495657_0010198 | 3300046675 | Bacteria | 7077 |
| 345 | Ga0495599_0023035 | 3300046678 | Bacteria | 3891 |
| 346 | Ga0495599_0158388 | 3300046678 | Bacteria | 1400 |
| 347 | Ga0495599_0270116 | 3300046678 | Bacteria | 1032 |
| 348 | Ga0495623_0087305 | 3300046679 | Bacteria | 1922 |
| 349 | Ga0495613_0043228 | 3300046689 | Bacteria | 3333 |
| 350 | Ga0495649_0012858 | 3300046694 | Bacteria | 4851 |
| 351 | Ga0495649_0051782 | 3300046694 | Bacteria | 2226 |
| 352 | Ga0495600_0011185 | 3300046809 | Bacteria | 5589 |
| 353 | Ga0495600_0033736 | 3300046809 | Bacteria | 3322 |
| 354 | Ga0495600_0081460 | 3300046809 | Bacteria | 2112 |
| 355 | Ga0495604_0013949 | 3300047317 | Bacteria | 6408 |
| 356 | Ga0495604_0014071 | 3300047317 | Bacteria | 6378 |
| 357 | Ga0495604_0218393 | 3300047317 | Bacteria | 1314 |
| 358 | Ga0495604_0238275 | 3300047317 | Bacteria | 1245 |
| 359 | Ga0495674_0019106 | 3300047319 | Bacteria | 6368 |
| 360 | Ga0495674_0251165 | 3300047319 | Bacteria | 1455 |
| 361 | Ga0495676_0041446 | 3300047321 | Bacteria | 3790 |
| 362 | Ga0495680_0003980 | 3300047322 | Bacteria | 14272 |
| 363 | Ga0495680_0111047 | 3300047322 | Bacteria | 2031 |
| 364 | Ga0495687_003324 | 3300047443 | Bacteria | 11781 |
| 365 | Ga0495675_0052062 | 3300047444 | Bacteria | 2599 |
| 366 | Ga0495685_038266 | 3300047447 | Bacteria | 1644 |
| 367 | Ga0495686_0054213 | 3300047472 | Bacteria | 2511 |
| 368 | Ga0495686_0188837 | 3300047472 | Bacteria | 1189 |
| 369 | Ga0495593_0016465 | 3300047673 | Bacteria | 4169 |
| 370 | Ga0495602_0021808 | 3300048088 | Bacteria | 6290 |
| 371 | Ga0495602_0150603 | 3300048088 | Bacteria | 1829 |
| 372 | Ga0495615_0010142 | 3300048090 | Bacteria | 1874 |
| 373 | Ga0495626_0062377 | 3300048091 | Bacteria | 1693 |
| 374 | Ga0496100_0026018 | 3300048903 | Bacteria | 3584 |
| 375 | Ga0496100_0117158 | 3300048903 | Bacteria | 1859 |
| 376 | Ga0496101_0111504 | 3300048904 | Bacteria | 2059 |
| 377 | Ga0496102_0006786 | 3300048905 | Bacteria | 9770 |
| 378 | Ga0496102_0686419 | 3300048905 | Bacteria | 947 |
| 379 | Ga0496103_0005031 | 3300048906 | Bacteria | 7973 |
| 380 | Ga0496104_0018014 | 3300048907 | Bacteria | 6439 |
| 381 | Ga0496104_0078911 | 3300048907 | Bacteria | 3137 |
| 382 | Ga0496104_0084125 | 3300048907 | Bacteria | 3035 |
| 383 | Ga0496104_0183720 | 3300048907 | Bacteria | 2001 |
| 384 | Ga0496105_0000527 | 3300048908 | Bacteria | 25240 |
| 385 | Ga0496105_0028458 | 3300048908 | Bacteria | 4569 |
| 386 | Ga0496106_0033428 | 3300048909 | Bacteria | 3837 |
| 387 | Ga0496106_0080333 | 3300048909 | Bacteria | 2504 |
| 388 | Ga0496107_0081993 | 3300048910 | Bacteria | 2352 |
| 389 | Ga0496107_0103401 | 3300048910 | Bacteria | 2090 |
| 390 | Ga0496108_0214518 | 3300048911 | Bacteria | 1671 |
| 391 | Ga0496109_0043355 | 3300048912 | Bacteria | 4078 |
| 392 | Ga0496109_0055424 | 3300048912 | Bacteria | 3617 |
| 393 | Ga0496109_0088540 | 3300048912 | Bacteria | 2861 |
| 394 | Ga0496111_0232335 | 3300048914 | Bacteria | 1370 |
| 395 | Ga0496112_0003913 | 3300048915 | Bacteria | 12460 |
| 396 | Ga0496112_0013255 | 3300048915 | Bacteria | 7609 |
| 397 | Ga0496112_0037597 | 3300048915 | Bacteria | 4724 |
| 398 | Ga0496112_0412100 | 3300048915 | Bacteria | 1290 |
| 399 | Ga0496113_0030777 | 3300048916 | Bacteria | 3888 |
| 400 | Ga0496113_0054616 | 3300048916 | Bacteria | 2990 |
| 401 | Ga0496114_0408176 | 3300048917 | Bacteria | 1203 |
| 402 | Ga0496115_0141750 | 3300048918 | Bacteria | 1983 |
| 403 | Ga0496115_0209436 | 3300048918 | Bacteria | 1610 |
| 404 | Ga0496118_0011549 | 3300048921 | Bacteria | 8605 |
| 405 | Ga0496119_0008238 | 3300048922 | Bacteria | 9212 |
| 406 | Ga0496119_0031024 | 3300048922 | Bacteria | 3591 |
| 407 | Ga0496120_0032854 | 3300048923 | Bacteria | 3123 |
| 408 | Ga0496120_0107239 | 3300048923 | Bacteria | 1465 |
| 409 | Ga0496121_0002820 | 3300048924 | Bacteria | 25702 |
| 410 | Ga0496121_0003834 | 3300048924 | Bacteria | 20920 |
| 411 | Ga0496121_0055533 | 3300048924 | Bacteria | 3298 |
| 412 | Ga0496123_0121100 | 3300048926 | Bacteria | 1472 |
| 413 | Ga0496123_0227275 | 3300048926 | Bacteria | 937 |
| 414 | Ga0496124_0000722 | 3300048927 | Bacteria | 54175 |
| 415 | Ga0496124_0170077 | 3300048927 | Bacteria | 1689 |
| 416 | Ga0496125_0064166 | 3300048928 | Bacteria | 2921 |
| 417 | Ga0496125_0107093 | 3300048928 | Bacteria | 2038 |
| 418 | Ga0496125_0222766 | 3300048928 | Bacteria | 1214 |
| 419 | Ga0496126_0006670 | 3300048929 | Bacteria | 12833 |
| 420 | Ga0496126_0013918 | 3300048929 | Bacteria | 8162 |
| 421 | Ga0496126_0050907 | 3300048929 | Bacteria | 3773 |
| 422 | Ga0496126_0424094 | 3300048929 | Bacteria | 1075 |
| 423 | Ga0495682_0003678 | 3300049460 | Bacteria | 6761 |
| 424 | Ga0501031_0006773 | 3300049568 | Bacteria | 7476 |
| 425 | Ga0501032_0000216 | 3300049569 | Bacteria | 47842 |
| 426 | Ga0501032_0066523 | 3300049569 | Bacteria | 2408 |
| 427 | Ga0501033_0000344 | 3300049570 | Bacteria | 44238 |
| 428 | Ga0501034_0000100 | 3300049571 | Bacteria | 159536 |
| 429 | Ga0501034_0010590 | 3300049571 | Bacteria | 9594 |
| 430 | Ga0501034_0072954 | 3300049571 | Bacteria | 3441 |
| 431 | Ga0501036_0000010 | 3300049572 | Bacteria | 163304 |
| 432 | Ga0501036_0011080 | 3300049572 | Bacteria | 7457 |
| 433 | Ga0501036_0215789 | 3300049572 | Bacteria | 1612 |
| 434 | Ga0501037_0000704 | 3300049573 | Bacteria | 25447 |
| 435 | Ga0501038_0000350 | 3300049574 | Bacteria | 39547 |
| 436 | Ga0501038_0015829 | 3300049574 | Bacteria | 6852 |
| 437 | Ga0501038_0143843 | 3300049574 | Bacteria | 1949 |
| 438 | Ga0501038_0175504 | 3300049574 | Bacteria | 1732 |
| 439 | Ga0501039_0001013 | 3300049575 | Bacteria | 20468 |
| 440 | Ga0501042_0013287 | 3300049578 | Bacteria | 5601 |
| 441 | Ga0501043_0000106 | 3300049579 | Bacteria | 77699 |
| 442 | Ga0501046_0016704 | 3300049580 | Bacteria | 6139 |
| 443 | Ga0501046_0017100 | 3300049580 | Bacteria | 6059 |
| 444 | Ga0501047_0000493 | 3300049581 | Bacteria | 42827 |
| 445 | Ga0501047_0007800 | 3300049581 | Bacteria | 10076 |
| 446 | Ga0501047_0021416 | 3300049581 | Bacteria | 6206 |
| 447 | Ga0501047_0076360 | 3300049581 | Bacteria | 3224 |
| 448 | Ga0501048_0000233 | 3300049582 | Bacteria | 36758 |
| 449 | Ga0501048_0010185 | 3300049582 | Bacteria | 7031 |
| 450 | Ga0501067_0000098 | 3300049583 | Bacteria | 50026 |
| 451 | Ga0501068_0000987 | 3300049584 | Bacteria | 14955 |
| 452 | Ga0501069_0180711 | 3300049585 | Bacteria | 1219 |
| 453 | Ga0501070_0001419 | 3300049586 | Bacteria | 21462 |
| 454 | Ga0501070_0204606 | 3300049586 | Bacteria | 1621 |
| 455 | Ga0501071_0039319 | 3300049587 | Bacteria | 3384 |
| 456 | Ga0501072_0010044 | 3300049588 | Bacteria | 7202 |
| 457 | Ga0501073_0002056 | 3300049589 | Bacteria | 15034 |
| 458 | Ga0501073_0096321 | 3300049589 | Bacteria | 2055 |
| 459 | Ga0501074_0000382 | 3300049590 | Bacteria | 26289 |
| 460 | Ga0501074_0080844 | 3300049590 | Bacteria | 2331 |
| 461 | Ga0501079_0003159 | 3300049741 | Bacteria | 12078 |
| 462 | Ga0501080_0001033 | 3300049742 | Bacteria | 22925 |
| 463 | Ga0501080_0026811 | 3300049742 | Bacteria | 5356 |
| 464 | Ga0501080_0044807 | 3300049742 | Bacteria | 4117 |
| 465 | Ga0501083_0000116 | 3300049744 | Bacteria | 54656 |
| 466 | Ga0501083_0016520 | 3300049744 | Bacteria | 5163 |
| 467 | Ga0501083_0123940 | 3300049744 | Bacteria | 1694 |
| 468 | Ga0501083_0208937 | 3300049744 | Bacteria | 1273 |
| 469 | Ga0501035_0000496 | 3300049822 | Bacteria | 44296 |
| 470 | Ga0501035_0024371 | 3300049822 | Bacteria | 5549 |
| 471 | Ga0501035_0039064 | 3300049822 | Bacteria | 4297 |
| 472 | Ga0501035_0278395 | 3300049822 | Bacteria | 1415 |
| 473 | Ga0501044_0000857 | 3300049823 | Bacteria | 36575 |
| 474 | Ga0501044_0015502 | 3300049823 | Bacteria | 8208 |
| 475 | Ga0501044_0164966 | 3300049823 | Bacteria | 2190 |
| 476 | Ga0501044_0194513 | 3300049823 | Bacteria | 1989 |
| 477 | Ga0501045_0013445 | 3300049824 | Bacteria | 5782 |
| 478 | nmdc:mga03n38_77881_c1 | 3300050490 | Bacteria | 1550 |
| 479 | nmdc:mga00v17_47723_c1 | 3300050491 | Bacteria | 2594 |
| 480 | nmdc:mga0yw44_131540_c1 | 3300050492 | Bacteria | 1620 |
| 481 | nmdc:mga0yw44_284797_c1 | 3300050492 | Bacteria | 1105 |
| 482 | nmdc:mga0k408_113862_c1 | 3300050493 | Bacteria | 1600 |
| 483 | nmdc:mga06z11_122033_c1 | 3300050494 | Bacteria | 1455 |
| 484 | nmdc:mga06z11_169123_c1 | 3300050494 | Bacteria | 1254 |
| 485 | nmdc:mga04h51_5957_c1 | 3300050495 | Bacteria | 3133 |
| 486 | nmdc:mga07m45_128832_c1 | 3300050496 | Bacteria | 1464 |
| 487 | nmdc:mga07m45_227146_c1 | 3300050496 | Bacteria | 1086 |
| 488 | nmdc:mga08y16_586538_c1 | 3300050511 | Bacteria | 1125 |
| 489 | nmdc:mga08x19_196032_c1 | 3300050514 | Bacteria | 1383 |
| 490 | nmdc:mga0sz30_30512_c1 | 3300050516 | Bacteria | 2227 |
| 491 | Ga0495601_0049779 | 3300053077 | Bacteria | 2643 |
| 492 | Ga0495601_0229142 | 3300053077 | Bacteria | 1213 |
| 493 | Ga0495612_0020030 | 3300053078 | Bacteria | 2680 |
| 494 | Ga0495655_0032481 | 3300053083 | Bacteria | 1277 |
| 495 | Ga0495619_0032984 | 3300053085 | Bacteria | 3362 |
| 496 | Ga0495619_0153507 | 3300053085 | Bacteria | 1588 |
| 497 | Ga0495619_0199144 | 3300053085 | Bacteria | 1386 |
| 498 | Ga0500578_0067421 | 3300053086 | Bacteria | 2282 |
| 499 | Ga0500643_000007 | 3300053087 | Bacteria | 462836 |
| 500 | Ga0500647_0151403 | 3300053091 | Bacteria | 1082 |
| 501 | Ga0500651_0104295 | 3300053093 | Bacteria | 1736 |
| 502 | Ga0500566_0098419 | 3300053094 | Bacteria | 1607 |
| 503 | Ga0500641_0033320 | 3300053096 | Bacteria | 2044 |
| 504 | Ga0500555_011052 | 3300053103 | Bacteria | 2592 |
| 505 | Ga0500557_000300 | 3300053105 | Bacteria | 6669 |
| 506 | Ga0500562_009617 | 3300053108 | Bacteria | 2443 |
| 507 | Ga0500569_012579 | 3300053109 | Bacteria | 2051 |
| 508 | Ga0500572_010981 | 3300053111 | Bacteria | 2180 |
| 509 | Ga0500592_007074 | 3300053116 | Bacteria | 1784 |
| 510 | Ga0500595_067104 | 3300053119 | Bacteria | 1071 |
| 511 | Ga0500597_066245 | 3300053120 | Bacteria | 1557 |
| 512 | Ga0500642_0000274 | 3300053130 | Bacteria | 19303 |
| 513 | Ga0500642_0017476 | 3300053130 | Bacteria | 2750 |
| 514 | Ga0500568_0001071 | 3300053139 | Bacteria | 18517 |
| 515 | Ga0500568_0014314 | 3300053139 | Bacteria | 3585 |
| 516 | Ga0500577_0000233 | 3300053142 | Bacteria | 14734 |
| 517 | Ga0500590_084826 | 3300053148 | Bacteria | 1549 |
| 518 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 519 | Ga0500616_0081419 | 3300053153 | Bacteria | 1626 |
| 520 | Ga0500619_013808 | 3300053154 | Bacteria | 2152 |
| 521 | Ga0500620_019155 | 3300053155 | Bacteria | 2006 |
| 522 | Ga0500638_048394 | 3300053162 | Bacteria | 2057 |
| 523 | Ga0500636_0000042 | 3300053177 | Bacteria | 69412 |
| 524 | Ga0500636_0008791 | 3300053177 | Bacteria | 5859 |
| 525 | Ga0500636_0177009 | 3300053177 | Bacteria | 1148 |
| 526 | Ga0500637_0000291 | 3300053178 | Bacteria | 18816 |
| 527 | Ga0500637_0043214 | 3300053178 | Bacteria | 2549 |
| 528 | Ga0500637_0096666 | 3300053178 | Bacteria | 1712 |
| 529 | Ga0500625_016360 | 3300053729 | Bacteria | 3453 |
| 530 | Ga0500645_010142 | 3300053730 | Bacteria | 3131 |
| 531 | Ga0500609_006486 | 3300053731 | Bacteria | 1594 |
| 532 | Ga0500596_011471 | 3300053735 | Bacteria | 1355 |
| 533 | Ga0500599_001563 | 3300053736 | Bacteria | 2656 |
| 534 | Ga0500601_000124 | 3300053737 | Bacteria | 15930 |
| 535 | Ga0501084_0008700 | 3300054114 | Bacteria | 8395 |
| 536 | Ga0501084_0126582 | 3300054114 | Bacteria | 2150 |
| 537 | Ga0500661_001479 | 3300055283 | Bacteria | 4407 |
| 538 | Ga0501082_0000452 | 3300060353 | Bacteria | 36318 |
| 539 | Ga0501082_0002418 | 3300060353 | Bacteria | 16386 |
| 540 | Ga0501082_0212005 | 3300060353 | Bacteria | 1685 |
| 541 | Ga0466962_0164990 | 3300061719 | Bacteria | 1077 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025923 | Ga0207681_10051162 | Ga0207681_100511622 | 227 |
| 2 | 3300050496 | nmdc:mga07m45_227146_c1 | nmdc:mga07m45_227146_c1_17_856 | 227 |
| 3 | 3300006195 | Ga0075366_10005054 | Ga0075366_100050545 | 228 |
| 4 | 3300005457 | Ga0070662_100210726 | Ga0070662_1002107262 | 232 |
| 5 | 3300005616 | Ga0068852_100272114 | Ga0068852_1002721142 | 232 |
| 6 | 3300025933 | Ga0207706_10066142 | Ga0207706_100661422 | 232 |
| 7 | 3300031456 | Ga0307513_10136805 | Ga0307513_101368052 | 233 |
| 8 | 3300050494 | nmdc:mga06z11_169123_c1 | nmdc:mga06z11_169123_c1_156_1037 | 233 |
| 9 | 3300053096 | Ga0500641_0033320 | Ga0500641_0033320_613_1494 | 233 |
| 10 | 3300031240 | Ga0265320_10015104 | Ga0265320_100151043 | 234 |
| 11 | 3300031241 | Ga0265325_10074988 | Ga0265325_100749882 | 234 |
| 12 | 3300031247 | Ga0265340_10029289 | Ga0265340_100292893 | 234 |
| 13 | 3300031247 | Ga0265340_10096972 | Ga0265340_100969722 | 234 |
| 14 | 3300031250 | Ga0265331_10070103 | Ga0265331_100701032 | 234 |
| 15 | 3300031712 | Ga0265342_10114872 | Ga0265342_101148722 | 234 |
| 16 | 3300046460 | Ga0495638_0005531 | Ga0495638_0005531_5160_6041 | 234 |
| 17 | 3300053130 | Ga0500642_0017476 | Ga0500642_0017476_1747_2628 | 234 |
| 18 | 3300046499 | Ga0495594_0091072 | Ga0495594_0091072_329_1204 | 235 |
| 19 | 3300005365 | Ga0070688_100124589 | Ga0070688_1001245892 | 237 |
| 20 | 3300005330 | Ga0070690_100086843 | Ga0070690_1000868433 | 238 |
| 21 | 3300005333 | Ga0070677_10002540 | Ga0070677_100025402 | 238 |
| 22 | 3300005356 | Ga0070674_100003716 | Ga0070674_1000037165 | 238 |
| 23 | 3300005364 | Ga0070673_100077857 | Ga0070673_1000778572 | 238 |
| 24 | 3300005438 | Ga0070701_10112179 | Ga0070701_101121792 | 238 |
| 25 | 3300005719 | Ga0068861_100465676 | Ga0068861_1004656762 | 238 |
| 26 | 3300014326 | Ga0157380_10074167 | Ga0157380_100741673 | 238 |
| 27 | 3300025899 | Ga0207642_10089510 | Ga0207642_100895102 | 238 |
| 28 | 3300025907 | Ga0207645_10005641 | Ga0207645_100056416 | 238 |
| 29 | 3300025926 | Ga0207659_10088530 | Ga0207659_100885302 | 238 |
| 30 | 3300025931 | Ga0207644_10131590 | Ga0207644_101315902 | 238 |
| 31 | 3300025937 | Ga0207669_10014442 | Ga0207669_100144424 | 238 |
| 32 | 3300025940 | Ga0207691_10004180 | Ga0207691_100041809 | 238 |
| 33 | 3300025981 | Ga0207640_10356183 | Ga0207640_103561832 | 238 |
| 34 | 3300026089 | Ga0207648_10021112 | Ga0207648_100211124 | 238 |
| 35 | 3300026118 | Ga0207675_100197110 | Ga0207675_1001971102 | 238 |
| 36 | 3300047447 | Ga0495685_038266 | Ga0495685_038266_173_1051 | 238 |
| 37 | 3300048090 | Ga0495615_0010142 | Ga0495615_0010142_216_1094 | 238 |
| 38 | 3300048905 | Ga0496102_0686419 | Ga0496102_0686419_24_833 | 240 |
| 39 | 3300009177 | Ga0105248_10120332 | Ga0105248_101203323 | 241 |
| 40 | 3300005436 | Ga0070713_100324435 | Ga0070713_1003244352 | 242 |
| 41 | 3300025928 | Ga0207700_10291384 | Ga0207700_102913842 | 242 |
| 42 | 3300048903 | Ga0496100_0026018 | Ga0496100_0026018_86_991 | 243 |
| 43 | 3300005340 | Ga0070689_100111110 | Ga0070689_1001111103 | 244 |
| 44 | 3300005843 | Ga0068860_100362580 | Ga0068860_1003625802 | 244 |
| 45 | 3300009177 | Ga0105248_10924621 | Ga0105248_109246212 | 244 |
| 46 | 3300013306 | Ga0163162_10510385 | Ga0163162_105103852 | 244 |
| 47 | 3300013308 | Ga0157375_10416713 | Ga0157375_104167132 | 244 |
| 48 | 3300014969 | Ga0157376_10127093 | Ga0157376_101270933 | 244 |
| 49 | 3300025936 | Ga0207670_10096072 | Ga0207670_100960723 | 244 |
| 50 | 3300009094 | Ga0111539_10328267 | Ga0111539_103282671 | 245 |
| 51 | 3300049742 | Ga0501080_0044807 | Ga0501080_0044807_1105_1980 | 245 |
| 52 | 3300050511 | nmdc:mga08y16_586538_c1 | nmdc:mga08y16_586538_c1_123_1007 | 245 |
| 53 | 3300005548 | Ga0070665_100191755 | Ga0070665_1001917552 | 246 |
| 54 | 3300005983 | Ga0081540_1017313 | Ga0081540_10173131 | 246 |
| 55 | 3300005437 | Ga0070710_10044958 | Ga0070710_100449581 | 247 |
| 56 | 3300005548 | Ga0070665_100419409 | Ga0070665_1004194092 | 247 |
| 57 | 3300049571 | Ga0501034_0072954 | Ga0501034_0072954_2151_3062 | 247 |
| 58 | 3300049581 | Ga0501047_0076360 | Ga0501047_0076360_2318_3196 | 247 |
| 59 | 3300049823 | Ga0501044_0194513 | Ga0501044_0194513_1099_1977 | 247 |
| 60 | 3300005334 | Ga0068869_100256128 | Ga0068869_1002561282 | 248 |
| 61 | 3300005518 | Ga0070699_100087780 | Ga0070699_1000877802 | 248 |
| 62 | 3300005535 | Ga0070684_100352631 | Ga0070684_1003526311 | 248 |
| 63 | 3300005546 | Ga0070696_100156874 | Ga0070696_1001568742 | 248 |
| 64 | 3300005549 | Ga0070704_100165347 | Ga0070704_1001653472 | 248 |
| 65 | 3300005719 | Ga0068861_100048002 | Ga0068861_1000480023 | 248 |
| 66 | 3300005843 | Ga0068860_100134269 | Ga0068860_1001342691 | 248 |
| 67 | 3300025711 | Ga0207696_1023356 | Ga0207696_10233562 | 248 |
| 68 | 3300025961 | Ga0207712_10129627 | Ga0207712_101296272 | 248 |
| 69 | 3300025972 | Ga0207668_10014275 | Ga0207668_100142754 | 248 |
| 70 | 3300028380 | Ga0268265_10032816 | Ga0268265_100328162 | 248 |
| 71 | 3300028381 | Ga0268264_10068657 | Ga0268264_100686573 | 248 |
| 72 | 3300048910 | Ga0496107_0081993 | Ga0496107_0081993_196_1068 | 248 |
| 73 | 3300048924 | Ga0496121_0003834 | Ga0496121_0003834_13180_14052 | 248 |
| 74 | 3300049822 | Ga0501035_0278395 | Ga0501035_0278395_185_1063 | 248 |
| 75 | iso_pu_bacteria | 2824704595 | 2824714530 | 248 |
| 76 | 3300005435 | Ga0070714_100007873 | Ga0070714_1000078739 | 249 |
| 77 | 3300005436 | Ga0070713_100058698 | Ga0070713_1000586983 | 249 |
| 78 | 3300005437 | Ga0070710_10002506 | Ga0070710_100025068 | 249 |
| 79 | 3300005439 | Ga0070711_100006571 | Ga0070711_1000065714 | 249 |
| 80 | 3300005456 | Ga0070678_100024943 | Ga0070678_1000249432 | 249 |
| 81 | 3300005983 | Ga0081540_1007585 | Ga0081540_10075853 | 249 |
| 82 | 3300006028 | Ga0070717_10018400 | Ga0070717_100184005 | 249 |
| 83 | 3300025928 | Ga0207700_10023334 | Ga0207700_100233343 | 249 |
| 84 | 3300025929 | Ga0207664_10003495 | Ga0207664_100034954 | 249 |
| 85 | 3300035692 | Ga0373935_0027491 | Ga0373935_0027491_37_858 | 249 |
| 86 | 3300041505 | Ga0451849_1036195 | Ga0451849_1036195_58_927 | 249 |
| 87 | 3300046517 | Ga0495630_0267649 | Ga0495630_0267649_34_855 | 249 |
| 88 | 3300046537 | Ga0495598_0012981 | Ga0495598_0012981_808_1686 | 249 |
| 89 | 3300048929 | Ga0496126_0013918 | Ga0496126_0013918_871_1746 | 249 |
| 90 | 3300021384 | Ga0213876_10028716 | Ga0213876_100287162 | 250 |
| 91 | 3300031507 | Ga0307509_10039753 | Ga0307509_100397532 | 250 |
| 92 | 3300039437 | Ga0436365_0919787 | Ga0436365_0919787_1820_2704 | 250 |
| 93 | 3300039450 | Ga0436363_0292837 | Ga0436363_0292837_739_1623 | 250 |
| 94 | 3300046557 | Ga0495622_0177915 | Ga0495622_0177915_114_929 | 250 |
| 95 | 3300048921 | Ga0496118_0011549 | Ga0496118_0011549_6701_7579 | 250 |
| 96 | 3300048924 | Ga0496121_0002820 | Ga0496121_0002820_21700_22578 | 250 |
| 97 | 3300048927 | Ga0496124_0000722 | Ga0496124_0000722_2917_3795 | 250 |
| 98 | 3300048929 | Ga0496126_0006670 | Ga0496126_0006670_3132_4010 | 250 |
| 99 | 3300003659 | JGI25404J52841_10002404 | JGI25404J52841_100024042 | 251 |
| 100 | 3300003659 | JGI25404J52841_10021019 | JGI25404J52841_100210191 | 251 |
| 101 | 3300005435 | Ga0070714_100462257 | Ga0070714_1004622572 | 251 |
| 102 | 3300005983 | Ga0081540_1017287 | Ga0081540_10172874 | 251 |
| 103 | 3300028379 | Ga0268266_10323522 | Ga0268266_103235222 | 252 |
| 104 | 3300037312 | Ga0395899_0021195 | Ga0395899_0021195_1760_2608 | 253 |
| 105 | 3300037418 | Ga0395900_0112595 | Ga0395900_0112595_1629_2477 | 253 |
| 106 | 3300037466 | Ga0395898_0150340 | Ga0395898_0150340_1322_2170 | 253 |
| 107 | 3300038443 | Ga0395901_0095483 | Ga0395901_0095483_150_998 | 253 |
| 108 | 3300048928 | Ga0496125_0222766 | Ga0496125_0222766_312_1163 | 253 |
| 109 | 3300025914 | Ga0207671_10153686 | Ga0207671_101536862 | 254 |
| 110 | 3300044658 | Ga0466972_0040591 | Ga0466972_0040591_15_893 | 254 |
| 111 | 3300044735 | Ga0466968_0012959 | Ga0466968_0012959_110_988 | 254 |
| 112 | 3300049569 | Ga0501032_0066523 | Ga0501032_0066523_1466_2317 | 254 |
| 113 | 3300049571 | Ga0501034_0010590 | Ga0501034_0010590_4681_5532 | 254 |
| 114 | 3300049574 | Ga0501038_0015829 | Ga0501038_0015829_4605_5456 | 254 |
| 115 | 3300049581 | Ga0501047_0021416 | Ga0501047_0021416_4166_5062 | 254 |
| 116 | 3300049582 | Ga0501048_0010185 | Ga0501048_0010185_2184_3035 | 254 |
| 117 | 3300049823 | Ga0501044_0015502 | Ga0501044_0015502_6099_6950 | 254 |
| 118 | 3300053178 | Ga0500637_0000291 | Ga0500637_0000291_7977_8870 | 254 |
| 119 | 3300055283 | Ga0500661_001479 | Ga0500661_001479_1753_2646 | 254 |
| 120 | 3300060353 | Ga0501082_0212005 | Ga0501082_0212005_675_1526 | 254 |
| 121 | 3300009093 | Ga0105240_10067442 | Ga0105240_100674424 | 255 |
| 122 | 3300025915 | Ga0207693_10007171 | Ga0207693_1000717110 | 255 |
| 123 | 3300025924 | Ga0207694_10010038 | Ga0207694_100100384 | 255 |
| 124 | 3300025924 | Ga0207694_10273228 | Ga0207694_102732281 | 255 |
| 125 | 3300041451 | Ga0451791_1826241 | Ga0451791_1826241_35_892 | 255 |
| 126 | 3300049574 | Ga0501038_0143843 | Ga0501038_0143843_204_1097 | 255 |
| 127 | 3300049822 | Ga0501035_0039064 | Ga0501035_0039064_1247_2140 | 255 |
| 128 | 3300005434 | Ga0070709_10045274 | Ga0070709_100452741 | 256 |
| 129 | 3300005435 | Ga0070714_100244588 | Ga0070714_1002445882 | 256 |
| 130 | 3300009545 | Ga0105237_10433607 | Ga0105237_104336071 | 256 |
| 131 | 3300025906 | Ga0207699_10065951 | Ga0207699_100659513 | 256 |
| 132 | 3300025929 | Ga0207664_10143487 | Ga0207664_101434872 | 256 |
| 133 | 3300044694 | Ga0466963_0056465 | Ga0466963_0056465_803_1675 | 256 |
| 134 | 3300044842 | Ga0466957_0212960 | Ga0466957_0212960_111_983 | 256 |
| 135 | 3300045976 | Ga0466967_0141520 | Ga0466967_0141520_403_1275 | 256 |
| 136 | 3300046477 | Ga0495664_0082366 | Ga0495664_0082366_695_1573 | 256 |
| 137 | 3300046678 | Ga0495599_0158388 | Ga0495599_0158388_64_942 | 256 |
| 138 | 3300049589 | Ga0501073_0096321 | Ga0501073_0096321_798_1688 | 256 |
| 139 | 3300053177 | Ga0500636_0177009 | Ga0500636_0177009_203_1081 | 256 |
| 140 | 3300053735 | Ga0500596_011471 | Ga0500596_011471_184_1062 | 256 |
| 141 | 3300003215 | JGI25153J46596_10007394 | JGI25153J46596_100073945 | 257 |
| 142 | 3300003752 | Ga0055539_1007248 | Ga0055539_10072482 | 257 |
| 143 | 3300005436 | Ga0070713_100011234 | Ga0070713_1000112345 | 257 |
| 144 | 3300005437 | Ga0070710_10020959 | Ga0070710_100209593 | 257 |
| 145 | 3300005439 | Ga0070711_100003409 | Ga0070711_1000034093 | 257 |
| 146 | 3300006175 | Ga0070712_100005474 | Ga0070712_1000054746 | 257 |
| 147 | 3300006914 | Ga0075436_100331425 | Ga0075436_1003314252 | 257 |
| 148 | 3300025253 | Ga0209677_105669 | Ga0209677_1056693 | 257 |
| 149 | 3300025297 | Ga0209758_1009410 | Ga0209758_10094103 | 257 |
| 150 | 3300025915 | Ga0207693_10005244 | Ga0207693_100052447 | 257 |
| 151 | 3300039450 | Ga0436363_0967671 | Ga0436363_0967671_3437_4309 | 257 |
| 152 | 3300050514 | nmdc:mga08x19_196032_c1 | nmdc:mga08x19_196032_c1_41_916 | 257 |
| 153 | 3300053142 | Ga0500577_0000233 | Ga0500577_0000233_3746_4624 | 257 |
| 154 | 3300039437 | Ga0436365_0338708 | Ga0436365_0338708_376_1302 | 258 |
| 155 | 3300005340 | Ga0070689_100474700 | Ga0070689_1004747001 | 259 |
| 156 | 3300005435 | Ga0070714_100009376 | Ga0070714_1000093761 | 259 |
| 157 | 3300005615 | Ga0070702_100255000 | Ga0070702_1002550002 | 259 |
| 158 | 3300006028 | Ga0070717_10018001 | Ga0070717_100180016 | 259 |
| 159 | 3300006163 | Ga0070715_10000111 | Ga0070715_100001115 | 259 |
| 160 | 3300006175 | Ga0070712_100050814 | Ga0070712_1000508142 | 259 |
| 161 | 3300025295 | Ga0209564_1023949 | Ga0209564_10239492 | 259 |
| 162 | 3300025905 | Ga0207685_10079054 | Ga0207685_100790541 | 259 |
| 163 | 3300025916 | Ga0207663_10001290 | Ga0207663_100012902 | 259 |
| 164 | 3300025928 | Ga0207700_10117025 | Ga0207700_101170252 | 259 |
| 165 | 3300026075 | Ga0207708_10154985 | Ga0207708_101549852 | 259 |
| 166 | 3300026121 | Ga0207683_10401917 | Ga0207683_104019172 | 259 |
| 167 | 3300031250 | Ga0265331_10165600 | Ga0265331_101656001 | 259 |
| 168 | 3300053139 | Ga0500568_0001071 | Ga0500568_0001071_7704_8585 | 259 |
| 169 | 3300005434 | Ga0070709_10002491 | Ga0070709_100024913 | 260 |
| 170 | 3300005436 | Ga0070713_100010069 | Ga0070713_1000100696 | 260 |
| 171 | 3300005437 | Ga0070710_10044248 | Ga0070710_100442483 | 260 |
| 172 | 3300005439 | Ga0070711_100011302 | Ga0070711_1000113022 | 260 |
| 173 | 3300006173 | Ga0070716_100019234 | Ga0070716_1000192342 | 260 |
| 174 | 3300025928 | Ga0207700_10025313 | Ga0207700_100253135 | 260 |
| 175 | 3300025933 | Ga0207706_10190392 | Ga0207706_101903922 | 260 |
| 176 | 3300025939 | Ga0207665_10000651 | Ga0207665_100006514 | 260 |
| 177 | 3300028023 | Ga0265357_1002291 | Ga0265357_10022912 | 260 |
| 178 | 3300031911 | Ga0307412_10012231 | Ga0307412_100122313 | 260 |
| 179 | 3300037466 | Ga0395898_0281299 | Ga0395898_0281299_177_1055 | 260 |
| 180 | 3300047317 | Ga0495604_0218393 | Ga0495604_0218393_178_1062 | 260 |
| 181 | 3300047472 | Ga0495686_0054213 | Ga0495686_0054213_497_1381 | 260 |
| 182 | 3300048929 | Ga0496126_0424094 | Ga0496126_0424094_157_1032 | 260 |
| 183 | 3300049581 | Ga0501047_0007800 | Ga0501047_0007800_257_1135 | 260 |
| 184 | 3300049590 | Ga0501074_0080844 | Ga0501074_0080844_860_1738 | 260 |
| 185 | 3300049742 | Ga0501080_0026811 | Ga0501080_0026811_4141_5019 | 260 |
| 186 | 3300053077 | Ga0495601_0049779 | Ga0495601_0049779_1332_2213 | 260 |
| 187 | 3300053093 | Ga0500651_0104295 | Ga0500651_0104295_244_1128 | 260 |
| 188 | 3300053177 | Ga0500636_0008791 | Ga0500636_0008791_4799_5683 | 260 |
| 189 | 3300053178 | Ga0500637_0096666 | Ga0500637_0096666_72_956 | 260 |
| 190 | iso_pu_bacteria | 2508501128 | 2509151460 | 260 |
| 191 | iso_pu_bacteria | 2513237141 | 2513889988 | 260 |
| 192 | 3300005435 | Ga0070714_100061891 | Ga0070714_1000618914 | 261 |
| 193 | 3300005539 | Ga0068853_100035350 | Ga0068853_1000353503 | 261 |
| 194 | 3300005577 | Ga0068857_100030751 | Ga0068857_1000307515 | 261 |
| 195 | 3300005983 | Ga0081540_1090440 | Ga0081540_10904402 | 261 |
| 196 | 3300005985 | Ga0081539_10000051 | Ga0081539_1000005142 | 261 |
| 197 | 3300009545 | Ga0105237_10105765 | Ga0105237_101057653 | 261 |
| 198 | 3300009551 | Ga0105238_10154078 | Ga0105238_101540783 | 261 |
| 199 | 3300013105 | Ga0157369_10014981 | Ga0157369_100149819 | 261 |
| 200 | 3300013307 | Ga0157372_10132348 | Ga0157372_101323483 | 261 |
| 201 | 3300025912 | Ga0207707_10303171 | Ga0207707_103031712 | 261 |
| 202 | 3300025919 | Ga0207657_10009208 | Ga0207657_100092083 | 261 |
| 203 | 3300025920 | Ga0207649_10108479 | Ga0207649_101084792 | 261 |
| 204 | 3300025949 | Ga0207667_10178660 | Ga0207667_101786602 | 261 |
| 205 | 3300025949 | Ga0207667_10414258 | Ga0207667_104142582 | 261 |
| 206 | 3300026116 | Ga0207674_10012072 | Ga0207674_100120721 | 261 |
| 207 | 3300026142 | Ga0207698_10026372 | Ga0207698_100263724 | 261 |
| 208 | 3300031901 | Ga0307406_10221045 | Ga0307406_102210452 | 261 |
| 209 | 3300035172 | Ga0373955_0003380 | Ga0373955_0003380_1574_2464 | 261 |
| 210 | 3300035695 | Ga0373927_0008512 | Ga0373927_0008512_1002_1889 | 261 |
| 211 | 3300035724 | Ga0373933_0101676 | Ga0373933_0101676_187_1074 | 261 |
| 212 | 3300036401 | Ga0373937_0207433 | Ga0373937_0207433_393_1280 | 261 |
| 213 | 3300036401 | Ga0373937_0506086 | Ga0373937_0506086_77_967 | 261 |
| 214 | 3300039437 | Ga0436365_0392043 | Ga0436365_0392043_3652_4539 | 261 |
| 215 | 3300039453 | Ga0436362_0009644 | Ga0436362_0009644_2283_3170 | 261 |
| 216 | 3300046511 | Ga0495608_0165537 | Ga0495608_0165537_329_1219 | 261 |
| 217 | 3300046514 | Ga0495618_0017068 | Ga0495618_0017068_2226_3116 | 261 |
| 218 | 3300046529 | Ga0495652_0121604 | Ga0495652_0121604_603_1487 | 261 |
| 219 | 3300046533 | Ga0495640_0016907 | Ga0495640_0016907_4045_4935 | 261 |
| 220 | 3300046535 | Ga0495586_0113588 | Ga0495586_0113588_460_1350 | 261 |
| 221 | 3300046543 | Ga0495645_0029875 | Ga0495645_0029875_429_1349 | 261 |
| 222 | 3300046559 | Ga0495667_0205780 | Ga0495667_0205780_40_930 | 261 |
| 223 | 3300046642 | Ga0495634_0150964 | Ga0495634_0150964_411_1301 | 261 |
| 224 | 3300046663 | Ga0495635_0017322 | Ga0495635_0017322_1963_2853 | 261 |
| 225 | 3300046678 | Ga0495599_0270116 | Ga0495599_0270116_75_965 | 261 |
| 226 | 3300046809 | Ga0495600_0081460 | Ga0495600_0081460_681_1571 | 261 |
| 227 | 3300047317 | Ga0495604_0013949 | Ga0495604_0013949_3105_3995 | 261 |
| 228 | 3300047319 | Ga0495674_0251165 | Ga0495674_0251165_180_1070 | 261 |
| 229 | 3300047322 | Ga0495680_0111047 | Ga0495680_0111047_915_1805 | 261 |
| 230 | 3300047472 | Ga0495686_0188837 | Ga0495686_0188837_58_939 | 261 |
| 231 | 3300048088 | Ga0495602_0150603 | Ga0495602_0150603_921_1811 | 261 |
| 232 | 3300048915 | Ga0496112_0037597 | Ga0496112_0037597_2041_2961 | 261 |
| 233 | 3300049572 | Ga0501036_0011080 | Ga0501036_0011080_2004_2888 | 261 |
| 234 | 3300049574 | Ga0501038_0175504 | Ga0501038_0175504_168_1049 | 261 |
| 235 | 3300049580 | Ga0501046_0016704 | Ga0501046_0016704_4766_5650 | 261 |
| 236 | 3300049586 | Ga0501070_0204606 | Ga0501070_0204606_443_1324 | 261 |
| 237 | 3300049822 | Ga0501035_0024371 | Ga0501035_0024371_234_1118 | 261 |
| 238 | 3300049823 | Ga0501044_0164966 | Ga0501044_0164966_343_1224 | 261 |
| 239 | 3300053077 | Ga0495601_0229142 | Ga0495601_0229142_89_979 | 261 |
| 240 | 3300053078 | Ga0495612_0020030 | Ga0495612_0020030_1345_2265 | 261 |
| 241 | 3300053085 | Ga0495619_0153507 | Ga0495619_0153507_41_931 | 261 |
| 242 | 3300053153 | Ga0500616_0000034 | Ga0500616_0000034_321214_322083 | 261 |
| 243 | 3300005539 | Ga0068853_100000785 | Ga0068853_10000078516 | 262 |
| 244 | 3300005563 | Ga0068855_100065946 | Ga0068855_1000659462 | 262 |
| 245 | 3300005578 | Ga0068854_100013500 | Ga0068854_1000135003 | 262 |
| 246 | 3300005985 | Ga0081539_10000148 | Ga0081539_10000148105 | 262 |
| 247 | 3300006175 | Ga0070712_100065294 | Ga0070712_1000652942 | 262 |
| 248 | 3300009174 | Ga0105241_10001021 | Ga0105241_100010218 | 262 |
| 249 | 3300009545 | Ga0105237_10103026 | Ga0105237_101030263 | 262 |
| 250 | 3300009551 | Ga0105238_10002878 | Ga0105238_100028782 | 262 |
| 251 | 3300013307 | Ga0157372_10254531 | Ga0157372_102545312 | 262 |
| 252 | 3300025906 | Ga0207699_10085874 | Ga0207699_100858742 | 262 |
| 253 | 3300025911 | Ga0207654_10000163 | Ga0207654_1000016330 | 262 |
| 254 | 3300025913 | Ga0207695_10001547 | Ga0207695_1000154731 | 262 |
| 255 | 3300025916 | Ga0207663_10051853 | Ga0207663_100518533 | 262 |
| 256 | 3300025924 | Ga0207694_10000050 | Ga0207694_1000005080 | 262 |
| 257 | 3300025949 | Ga0207667_10013113 | Ga0207667_100131137 | 262 |
| 258 | 3300025981 | Ga0207640_10015497 | Ga0207640_100154972 | 262 |
| 259 | 3300026041 | Ga0207639_10003890 | Ga0207639_100038903 | 262 |
| 260 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002190 | 262 |
| 261 | 3300026116 | Ga0207674_10005123 | Ga0207674_1000512310 | 262 |
| 262 | 3300049568 | Ga0501031_0006773 | Ga0501031_0006773_2493_3377 | 262 |
| 263 | 3300049569 | Ga0501032_0000216 | Ga0501032_0000216_5227_6111 | 262 |
| 264 | 3300049570 | Ga0501033_0000344 | Ga0501033_0000344_18878_19762 | 262 |
| 265 | 3300049571 | Ga0501034_0000100 | Ga0501034_0000100_77433_78317 | 262 |
| 266 | 3300049572 | Ga0501036_0000010 | Ga0501036_0000010_7554_8438 | 262 |
| 267 | 3300049572 | Ga0501036_0215789 | Ga0501036_0215789_170_1093 | 262 |
| 268 | 3300049573 | Ga0501037_0000704 | Ga0501037_0000704_10202_11086 | 262 |
| 269 | 3300049574 | Ga0501038_0000350 | Ga0501038_0000350_31178_32062 | 262 |
| 270 | 3300049575 | Ga0501039_0001013 | Ga0501039_0001013_19452_20336 | 262 |
| 271 | 3300049578 | Ga0501042_0013287 | Ga0501042_0013287_2107_2991 | 262 |
| 272 | 3300049579 | Ga0501043_0000106 | Ga0501043_0000106_14839_15723 | 262 |
| 273 | 3300049580 | Ga0501046_0017100 | Ga0501046_0017100_3586_4470 | 262 |
| 274 | 3300049581 | Ga0501047_0000493 | Ga0501047_0000493_17595_18479 | 262 |
| 275 | 3300049582 | Ga0501048_0000233 | Ga0501048_0000233_16014_16898 | 262 |
| 276 | 3300049583 | Ga0501067_0000098 | Ga0501067_0000098_4196_5080 | 262 |
| 277 | 3300049584 | Ga0501068_0000987 | Ga0501068_0000987_5127_6011 | 262 |
| 278 | 3300049585 | Ga0501069_0180711 | Ga0501069_0180711_59_943 | 262 |
| 279 | 3300049586 | Ga0501070_0001419 | Ga0501070_0001419_17595_18479 | 262 |
| 280 | 3300049587 | Ga0501071_0039319 | Ga0501071_0039319_1735_2619 | 262 |
| 281 | 3300049588 | Ga0501072_0010044 | Ga0501072_0010044_1273_2157 | 262 |
| 282 | 3300049589 | Ga0501073_0002056 | Ga0501073_0002056_3544_4428 | 262 |
| 283 | 3300049590 | Ga0501074_0000382 | Ga0501074_0000382_15046_15930 | 262 |
| 284 | 3300049741 | Ga0501079_0003159 | Ga0501079_0003159_6404_7288 | 262 |
| 285 | 3300049742 | Ga0501080_0001033 | Ga0501080_0001033_7133_8017 | 262 |
| 286 | 3300049744 | Ga0501083_0000116 | Ga0501083_0000116_12623_13507 | 262 |
| 287 | 3300049744 | Ga0501083_0123940 | Ga0501083_0123940_71_943 | 262 |
| 288 | 3300049822 | Ga0501035_0000496 | Ga0501035_0000496_24623_25507 | 262 |
| 289 | 3300049823 | Ga0501044_0000857 | Ga0501044_0000857_22868_23752 | 262 |
| 290 | 3300049824 | Ga0501045_0013445 | Ga0501045_0013445_2068_2952 | 262 |
| 291 | 3300054114 | Ga0501084_0008700 | Ga0501084_0008700_7042_7926 | 262 |
| 292 | 3300060353 | Ga0501082_0000452 | Ga0501082_0000452_3016_3900 | 262 |
| 293 | 3300060353 | Ga0501082_0002418 | Ga0501082_0002418_1266_2138 | 262 |
| 294 | iso_pu_bacteria | 2721755755 | 2723846584 | 262 |
| 295 | iso_pu_bacteria | 2874604998 | 2874605623 | 262 |
| 296 | iso_pu_bacteria | 8006964411 | 8006969709 | 262 |
| 297 | iso_pu_bacteria | 8056681323 | 8056689263 | 262 |
| 298 | 3300048909 | Ga0496106_0080333 | Ga0496106_0080333_1561_2445 | 263 |
| 299 | 3300048918 | Ga0496115_0141750 | Ga0496115_0141750_714_1598 | 263 |
| 300 | iso_pu_bacteria | 2893066018 | 2893068714 | 263 |
| 301 | iso_pu_bacteria | 2922361189 | 2922365785 | 263 |
| 302 | iso_pu_bacteria | 2935630451 | 2935636397 | 263 |
| 303 | iso_pu_bacteria | 2941507105 | 2941509893 | 263 |
| 304 | iso_pu_bacteria | 2941523033 | 2941525292 | 263 |
| 305 | 3300005340 | Ga0070689_100085305 | Ga0070689_1000853052 | 264 |
| 306 | 3300005439 | Ga0070711_100191231 | Ga0070711_1001912311 | 264 |
| 307 | 3300005440 | Ga0070705_100140565 | Ga0070705_1001405652 | 264 |
| 308 | 3300005564 | Ga0070664_100175522 | Ga0070664_1001755222 | 264 |
| 309 | 3300005618 | Ga0068864_100227566 | Ga0068864_1002275662 | 264 |
| 310 | 3300006038 | Ga0075365_10053340 | Ga0075365_100533403 | 264 |
| 311 | 3300013296 | Ga0157374_10408791 | Ga0157374_104087911 | 264 |
| 312 | 3300014325 | Ga0163163_10000985 | Ga0163163_100009859 | 264 |
| 313 | 3300025916 | Ga0207663_10016823 | Ga0207663_100168234 | 264 |
| 314 | 3300025933 | Ga0207706_10280426 | Ga0207706_102804262 | 264 |
| 315 | 3300025936 | Ga0207670_10068005 | Ga0207670_100680052 | 264 |
| 316 | 3300025945 | Ga0207679_10181619 | Ga0207679_101816192 | 264 |
| 317 | 3300026095 | Ga0207676_10089470 | Ga0207676_100894702 | 264 |
| 318 | 3300048904 | Ga0496101_0111504 | Ga0496101_0111504_836_1786 | 264 |
| 319 | 3300048907 | Ga0496104_0084125 | Ga0496104_0084125_489_1439 | 264 |
| 320 | 3300048909 | Ga0496106_0033428 | Ga0496106_0033428_2028_2978 | 264 |
| 321 | 3300048910 | Ga0496107_0103401 | Ga0496107_0103401_303_1253 | 264 |
| 322 | 3300048911 | Ga0496108_0214518 | Ga0496108_0214518_212_1162 | 264 |
| 323 | 3300048912 | Ga0496109_0043355 | Ga0496109_0043355_1035_1985 | 264 |
| 324 | 3300048915 | Ga0496112_0003913 | Ga0496112_0003913_6477_7427 | 264 |
| 325 | 3300048916 | Ga0496113_0030777 | Ga0496113_0030777_967_1917 | 264 |
| 326 | 3300048918 | Ga0496115_0209436 | Ga0496115_0209436_580_1530 | 264 |
| 327 | iso_pu_bacteria | 2513237098 | 2513676615 | 264 |
| 328 | iso_pu_bacteria | 2524023210 | 2524470393 | 264 |
| 329 | iso_pu_bacteria | 2602042107 | 2603856803 | 264 |
| 330 | iso_pu_bacteria | 2643221651 | 2644288919 | 264 |
| 331 | iso_pu_bacteria | 2857524615 | 2857528281 | 264 |
| 332 | iso_pu_bacteria | 2876808645 | 2876814665 | 264 |
| 333 | iso_pu_bacteria | 2879110137 | 2879115912 | 264 |
| 334 | iso_pu_bacteria | 2885383462 | 2885389430 | 264 |
| 335 | iso_pu_bacteria | 2889033259 | 2889039367 | 264 |
| 336 | iso_pu_bacteria | 2903748898 | 2903751022 | 264 |
| 337 | iso_pu_bacteria | 2903768456 | 2903771890 | 264 |
| 338 | iso_pu_bacteria | 2906610324 | 2906617149 | 264 |
| 339 | iso_pu_bacteria | 2908739725 | 2908742297 | 264 |
| 340 | iso_pu_bacteria | 2919073203 | 2919075705 | 264 |
| 341 | iso_pu_bacteria | 2922386360 | 2922391343 | 264 |
| 342 | iso_pu_bacteria | 2922425934 | 2922430696 | 264 |
| 343 | iso_pu_bacteria | 8006984368 | 8006987848 | 264 |
| 344 | iso_pu_bacteria | 8056673599 | 8056676967 | 264 |
| 345 | 3300006042 | Ga0075368_10022438 | Ga0075368_100224383 | 265 |
| 346 | 3300006178 | Ga0075367_10138198 | Ga0075367_101381982 | 265 |
| 347 | 3300006353 | Ga0075370_10021626 | Ga0075370_100216263 | 265 |
| 348 | 3300050496 | nmdc:mga07m45_128832_c1 | nmdc:mga07m45_128832_c1_14_898 | 265 |
| 349 | iso_pu_bacteria | 2513237137 | 2513855473 | 265 |
| 350 | iso_pu_bacteria | 2728368998 | 2728753038 | 265 |
| 351 | iso_pu_bacteria | 2904699407 | 2904702120 | 265 |
| 352 | iso_pu_bacteria | 3005594810 | 3005599654 | 265 |
| 353 | iso_pu_bacteria | 8019555841 | 8019556150 | 265 |
| 354 | 3300014326 | Ga0157380_10078609 | Ga0157380_100786093 | 266 |
| 355 | 3300025302 | Ga0207426_1000726 | Ga0207426_10007266 | 266 |
| 356 | 3300049744 | Ga0501083_0016520 | Ga0501083_0016520_809_1711 | 266 |
| 357 | 3300049744 | Ga0501083_0208937 | Ga0501083_0208937_369_1259 | 266 |
| 358 | 3300054114 | Ga0501084_0126582 | Ga0501084_0126582_574_1476 | 266 |
| 359 | iso_pu_bacteria | 2791355197 | 2793068904 | 266 |
| 360 | iso_pu_bacteria | 2885374607 | 2885375971 | 266 |
| 361 | iso_pu_bacteria | 2906635258 | 2906639209 | 266 |
| 362 | iso_pu_bacteria | 2906660503 | 2906662409 | 266 |
| 363 | iso_pu_bacteria | 3005474847 | 3005480599 | 266 |
| 364 | iso_pu_bacteria | 8006994254 | 8007000836 | 266 |
| 365 | iso_pu_bacteria | 8019565922 | 8019569157 | 266 |
| 366 | 3300046660 | Ga0495625_0338569 | Ga0495625_0338569_73_942 | 267 |
| 367 | iso_pu_bacteria | 2507262055 | 2507508196 | 267 |
| 368 | iso_pu_bacteria | 2513237104 | 2513718359 | 267 |
| 369 | iso_pu_bacteria | 2824679649 | 2824679897 | 267 |
| 370 | iso_pu_bacteria | 2881364244 | 2881368438 | 267 |
| 371 | iso_pu_bacteria | 2885409591 | 2885417705 | 267 |
| 372 | iso_pu_bacteria | 2906626472 | 2906627134 | 267 |
| 373 | iso_pu_bacteria | 2922393267 | 2922394540 | 267 |
| 374 | iso_pu_bacteria | 2935959822 | 2935960830 | 267 |
| 375 | iso_pu_bacteria | 3005483717 | 3005484691 | 267 |
| 376 | iso_pu_bacteria | 3005587118 | 3005587663 | 267 |
| 377 | iso_pu_bacteria | 8006926726 | 8006930481 | 267 |
| 378 | iso_pu_bacteria | 8016583857 | 8016593309 | 267 |
| 379 | 3300005439 | Ga0070711_100221709 | Ga0070711_1002217092 | 268 |
| 380 | 3300005842 | Ga0068858_100474624 | Ga0068858_1004746242 | 268 |
| 381 | 3300009101 | Ga0105247_10016810 | Ga0105247_100168105 | 268 |
| 382 | 3300025898 | Ga0207692_10006395 | Ga0207692_100063953 | 268 |
| 383 | 3300025900 | Ga0207710_10019462 | Ga0207710_100194621 | 268 |
| 384 | 3300035695 | Ga0373927_0009424 | Ga0373927_0009424_1059_1937 | 268 |
| 385 | 3300037068 | Ga0373925_0005876 | Ga0373925_0005876_1677_2555 | 268 |
| 386 | 3300046557 | Ga0495622_0007956 | Ga0495622_0007956_2016_2894 | 268 |
| 387 | 3300053091 | Ga0500647_0151403 | Ga0500647_0151403_31_909 | 268 |
| 388 | 3300053094 | Ga0500566_0098419 | Ga0500566_0098419_67_945 | 268 |
| 389 | 3300053178 | Ga0500637_0043214 | Ga0500637_0043214_447_1325 | 268 |
| 390 | iso_pu_bacteria | 2508501009 | 2508542263 | 268 |
| 391 | iso_pu_bacteria | 2508501042 | 2508691973 | 268 |
| 392 | iso_pu_bacteria | 2511231028 | 2511398737 | 268 |
| 393 | iso_pu_bacteria | 2513237092 | 2513622324 | 268 |
| 394 | iso_pu_bacteria | 2513237094 | 2513640499 | 268 |
| 395 | iso_pu_bacteria | 2513237095 | 2513645414 | 268 |
| 396 | iso_pu_bacteria | 2513237102 | 2513703411 | 268 |
| 397 | iso_pu_bacteria | 2513237139 | 2513873167 | 268 |
| 398 | iso_pu_bacteria | 2513237161 | 2514016488 | 268 |
| 399 | iso_pu_bacteria | 2515154112 | 2515627297 | 268 |
| 400 | iso_pu_bacteria | 2517093001 | 2517102589 | 268 |
| 401 | iso_pu_bacteria | 2528768022 | 2528848736 | 268 |
| 402 | iso_pu_bacteria | 2617270735 | 2617346966 | 268 |
| 403 | iso_pu_bacteria | 2617270741 | 2617375385 | 268 |
| 404 | iso_pu_bacteria | 2791355196 | 2793062566 | 268 |
| 405 | iso_pu_bacteria | 2802429603 | 2805914843 | 268 |
| 406 | iso_pu_bacteria | 2816332527 | 2818239651 | 268 |
| 407 | iso_pu_bacteria | 2824600985 | 2824602329 | 268 |
| 408 | iso_pu_bacteria | 2824609381 | 2824610577 | 268 |
| 409 | iso_pu_bacteria | 2824617872 | 2824618139 | 268 |
| 410 | iso_pu_bacteria | 2824626560 | 2824626807 | 268 |
| 411 | iso_pu_bacteria | 2824635225 | 2824640094 | 268 |
| 412 | iso_pu_bacteria | 2824644064 | 2824647368 | 268 |
| 413 | iso_pu_bacteria | 2824653114 | 2824654297 | 268 |
| 414 | iso_pu_bacteria | 2824661429 | 2824661624 | 268 |
| 415 | iso_pu_bacteria | 2824671348 | 2824672069 | 268 |
| 416 | iso_pu_bacteria | 2824687955 | 2824688668 | 268 |
| 417 | iso_pu_bacteria | 2824696289 | 2824697094 | 268 |
| 418 | iso_pu_bacteria | 2824714736 | 2824717837 | 268 |
| 419 | iso_pu_bacteria | 2824723954 | 2824728052 | 268 |
| 420 | iso_pu_bacteria | 2824732956 | 2824734575 | 268 |
| 421 | iso_pu_bacteria | 2824746037 | 2824749867 | 268 |
| 422 | iso_pu_bacteria | 2824753945 | 2824754406 | 268 |
| 423 | iso_pu_bacteria | 2824763712 | 2824769173 | 268 |
| 424 | iso_pu_bacteria | 2824773399 | 2824780382 | 268 |
| 425 | iso_pu_bacteria | 2838122688 | 2838123318 | 268 |
| 426 | iso_pu_bacteria | 2841941048 | 2841946610 | 268 |
| 427 | iso_pu_bacteria | 2841949485 | 2841954159 | 268 |
| 428 | iso_pu_bacteria | 2841957949 | 2841961010 | 268 |
| 429 | iso_pu_bacteria | 2841966195 | 2841969533 | 268 |
| 430 | iso_pu_bacteria | 2841974524 | 2841974582 | 268 |
| 431 | iso_pu_bacteria | 2841983080 | 2841983857 | 268 |
| 432 | iso_pu_bacteria | 2842038055 | 2842040211 | 268 |
| 433 | iso_pu_bacteria | 2842045827 | 2842046844 | 268 |
| 434 | iso_pu_bacteria | 2844315083 | 2844319439 | 268 |
| 435 | iso_pu_bacteria | 2847930680 | 2847936609 | 268 |
| 436 | iso_pu_bacteria | 2847939898 | 2847946958 | 268 |
| 437 | iso_pu_bacteria | 2849076700 | 2849078932 | 268 |
| 438 | iso_pu_bacteria | 2857509624 | 2857515939 | 268 |
| 439 | iso_pu_bacteria | 2874590934 | 2874598433 | 268 |
| 440 | iso_pu_bacteria | 2874612657 | 2874619344 | 268 |
| 441 | iso_pu_bacteria | 2874620515 | 2874626435 | 268 |
| 442 | iso_pu_bacteria | 2874645413 | 2874652512 | 268 |
| 443 | iso_pu_bacteria | 2876771140 | 2876778089 | 268 |
| 444 | iso_pu_bacteria | 2876818435 | 2876826042 | 268 |
| 445 | iso_pu_bacteria | 2879074833 | 2879081883 | 268 |
| 446 | iso_pu_bacteria | 2879083081 | 2879088047 | 268 |
| 447 | iso_pu_bacteria | 2879099564 | 2879108379 | 268 |
| 448 | iso_pu_bacteria | 2879127579 | 2879135005 | 268 |
| 449 | iso_pu_bacteria | 2879142872 | 2879149690 | 268 |
| 450 | iso_pu_bacteria | 2881665667 | 2881672503 | 268 |
| 451 | iso_pu_bacteria | 2885366525 | 2885370509 | 268 |
| 452 | iso_pu_bacteria | 2888378607 | 2888384507 | 268 |
| 453 | iso_pu_bacteria | 2888388044 | 2888393403 | 268 |
| 454 | iso_pu_bacteria | 2888419890 | 2888424951 | 268 |
| 455 | iso_pu_bacteria | 2903727486 | 2903734379 | 268 |
| 456 | iso_pu_bacteria | 2904666416 | 2904671775 | 268 |
| 457 | iso_pu_bacteria | 2904711408 | 2904715129 | 268 |
| 458 | iso_pu_bacteria | 2906602504 | 2906609173 | 268 |
| 459 | iso_pu_bacteria | 2906643746 | 2906646166 | 268 |
| 460 | iso_pu_bacteria | 2908775508 | 2908780557 | 268 |
| 461 | iso_pu_bacteria | 2922368715 | 2922374925 | 268 |
| 462 | iso_pu_bacteria | 2929615660 | 2929621965 | 268 |
| 463 | iso_pu_bacteria | 2929624759 | 2929629728 | 268 |
| 464 | iso_pu_bacteria | 2932784394 | 2932788831 | 268 |
| 465 | iso_pu_bacteria | 2932801729 | 2932807189 | 268 |
| 466 | iso_pu_bacteria | 2932809354 | 2932812807 | 268 |
| 467 | iso_pu_bacteria | 2932818245 | 2932819101 | 268 |
| 468 | iso_pu_bacteria | 2932828146 | 2932830497 | 268 |
| 469 | iso_pu_bacteria | 2933577622 | 2933583760 | 268 |
| 470 | iso_pu_bacteria | 2935608549 | 2935609321 | 268 |
| 471 | iso_pu_bacteria | 2935616580 | 2935616792 | 268 |
| 472 | iso_pu_bacteria | 2935638405 | 2935641878 | 268 |
| 473 | iso_pu_bacteria | 2935648319 | 2935650889 | 268 |
| 474 | iso_pu_bacteria | 2935656913 | 2935659070 | 268 |
| 475 | iso_pu_bacteria | 2935665750 | 2935673009 | 268 |
| 476 | iso_pu_bacteria | 2935675223 | 2935675814 | 268 |
| 477 | iso_pu_bacteria | 2935684952 | 2935685803 | 268 |
| 478 | iso_pu_bacteria | 2935694250 | 2935697943 | 268 |
| 479 | iso_pu_bacteria | 2935703347 | 2935705651 | 268 |
| 480 | iso_pu_bacteria | 2935713505 | 2935714355 | 268 |
| 481 | iso_pu_bacteria | 2935722832 | 2935724974 | 268 |
| 482 | iso_pu_bacteria | 2935732158 | 2935732667 | 268 |
| 483 | iso_pu_bacteria | 2935741537 | 2935742046 | 268 |
| 484 | iso_pu_bacteria | 2935750917 | 2935751768 | 268 |
| 485 | iso_pu_bacteria | 2935760218 | 2935765032 | 268 |
| 486 | iso_pu_bacteria | 2935769743 | 2935771652 | 268 |
| 487 | iso_pu_bacteria | 2935777560 | 2935778933 | 268 |
| 488 | iso_pu_bacteria | 2935785616 | 2935791146 | 268 |
| 489 | iso_pu_bacteria | 2935793552 | 2935795525 | 268 |
| 490 | iso_pu_bacteria | 2935801545 | 2935802629 | 268 |
| 491 | iso_pu_bacteria | 2935810662 | 2935813541 | 268 |
| 492 | iso_pu_bacteria | 2935819856 | 2935822481 | 268 |
| 493 | iso_pu_bacteria | 2935827899 | 2935830045 | 268 |
| 494 | iso_pu_bacteria | 2935837841 | 2935837963 | 268 |
| 495 | iso_pu_bacteria | 2935847175 | 2935848064 | 268 |
| 496 | iso_pu_bacteria | 2935855204 | 2935855416 | 268 |
| 497 | iso_pu_bacteria | 2935864058 | 2935867340 | 268 |
| 498 | iso_pu_bacteria | 2935873716 | 2935875841 | 268 |
| 499 | iso_pu_bacteria | 2935883170 | 2935885837 | 268 |
| 500 | iso_pu_bacteria | 2935908558 | 2935908713 | 268 |
| 501 | iso_pu_bacteria | 2935916978 | 2935917859 | 268 |
| 502 | iso_pu_bacteria | 2935926038 | 2935926713 | 268 |
| 503 | iso_pu_bacteria | 2935934488 | 2935935163 | 268 |
| 504 | iso_pu_bacteria | 2935942939 | 2935943613 | 268 |
| 505 | iso_pu_bacteria | 2935951376 | 2935952051 | 268 |
| 506 | iso_pu_bacteria | 2935967501 | 2935968176 | 268 |
| 507 | iso_pu_bacteria | 2935975950 | 2935978791 | 268 |
| 508 | iso_pu_bacteria | 2935984226 | 2935987339 | 268 |
| 509 | iso_pu_bacteria | 2935992306 | 2935996505 | 268 |
| 510 | iso_pu_bacteria | 2936002035 | 2936003785 | 268 |
| 511 | iso_pu_bacteria | 2936011229 | 2936013485 | 268 |
| 512 | iso_pu_bacteria | 2936019824 | 2936022388 | 268 |
| 513 | iso_pu_bacteria | 2936028420 | 2936030834 | 268 |
| 514 | iso_pu_bacteria | 2936037263 | 2936042714 | 268 |
| 515 | iso_pu_bacteria | 2936046547 | 2936048647 | 268 |
| 516 | iso_pu_bacteria | 2936055302 | 2936058861 | 268 |
| 517 | iso_pu_bacteria | 2940556831 | 2940557429 | 268 |
| 518 | iso_pu_bacteria | 2941515067 | 2941520863 | 268 |
| 519 | iso_pu_bacteria | 2941531003 | 2941533214 | 268 |
| 520 | iso_pu_bacteria | 2941538514 | 2941539371 | 268 |
| 521 | iso_pu_bacteria | 3005506211 | 3005510698 | 268 |
| 522 | iso_pu_bacteria | 3005710791 | 3005715304 | 268 |
| 523 | iso_pu_bacteria | 3005718088 | 3005722677 | 268 |
| 524 | iso_pu_bacteria | 8016511872 | 8016521794 | 268 |
| 525 | iso_pu_bacteria | 8016557553 | 8016562871 | 268 |
| 526 | iso_pu_bacteria | 8016566248 | 8016572756 | 268 |
| 527 | iso_pu_bacteria | 8016575299 | 8016576911 | 268 |
| 528 | iso_pu_bacteria | 8016595262 | 8016600646 | 268 |
| 529 | iso_pu_bacteria | 8016603502 | 8016610090 | 268 |
| 530 | iso_pu_bacteria | 8016613128 | 8016614847 | 268 |
| 531 | iso_pu_bacteria | 8016622563 | 8016626131 | 268 |
| 532 | iso_pu_bacteria | 8016630954 | 8016639910 | 268 |
| 533 | iso_pu_bacteria | 8017057580 | 8017063857 | 268 |
| 534 | iso_pu_bacteria | 8019530166 | 8019534177 | 268 |
| 535 | iso_pu_bacteria | 8019538911 | 8019545285 | 268 |
| 536 | iso_pu_bacteria | 8019547302 | 8019553225 | 268 |
| 537 | iso_pu_bacteria | 8019576017 | 8019583208 | 268 |
| 538 | iso_pu_bacteria | 8019586578 | 8019591015 | 268 |
| 539 | iso_pu_bacteria | 8019608314 | 8019618213 | 268 |
| 540 | iso_pu_bacteria | 8019619141 | 8019628601 | 268 |
| 541 | iso_pu_bacteria | 8019629233 | 8019634036 | 268 |
| 542 | iso_pu_bacteria | 8019638758 | 8019645698 | 268 |
| 543 | iso_pu_bacteria | 8019648815 | 8019658966 | 268 |
| 544 | iso_pu_bacteria | 8019659431 | 8019661914 | 268 |
| 545 | iso_pu_bacteria | 8019668869 | 8019671437 | 268 |
| 546 | iso_pu_bacteria | 8019678201 | 8019684749 | 268 |
| 547 | iso_pu_bacteria | 8019687851 | 8019690491 | 268 |
| 548 | iso_pu_bacteria | 8055742211 | 8055745870 | 268 |
| 549 | iso_pu_bacteria | 8056967851 | 8056968428 | 268 |
| 550 | 3300005578 | Ga0068854_100045877 | Ga0068854_1000458771 | 269 |
| 551 | 3300005616 | Ga0068852_100015463 | Ga0068852_1000154636 | 269 |
| 552 | 3300009098 | Ga0105245_10176704 | Ga0105245_101767042 | 269 |
| 553 | 3300009174 | Ga0105241_10030687 | Ga0105241_100306874 | 269 |
| 554 | 3300009545 | Ga0105237_10009330 | Ga0105237_100093303 | 269 |
| 555 | 3300010375 | Ga0105239_10086748 | Ga0105239_100867483 | 269 |
| 556 | 3300021320 | Ga0214544_1000002 | Ga0214544_100000263 | 269 |
| 557 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001413 | 269 |
| 558 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001479 | 269 |
| 559 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001717 | 269 |
| 560 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008191 | 269 |
| 561 | 3300025914 | Ga0207671_10007503 | Ga0207671_100075036 | 269 |
| 562 | 3300026041 | Ga0207639_10090464 | Ga0207639_100904642 | 269 |
| 563 | 3300026142 | Ga0207698_10058767 | Ga0207698_100587673 | 269 |
| 564 | 3300028381 | Ga0268264_10000065 | Ga0268264_10000065151 | 269 |
| 565 | iso_pu_bacteria | 2874628541 | 2874632303 | 269 |
| 566 | iso_pu_bacteria | 2904690495 | 2904694923 | 269 |
| 567 | iso_pu_bacteria | 2908756301 | 2908759937 | 269 |
| 568 | iso_pu_bacteria | 8056689827 | 8056692202 | 269 |
| 569 | 3300038443 | Ga0395901_0057232 | Ga0395901_0057232_381_1262 | 270 |
| 570 | iso_pu_bacteria | 2513237096 | 2513657032 | 270 |
| 571 | iso_pu_bacteria | 2513237145 | 2513918772 | 270 |
| 572 | iso_pu_bacteria | 2517572143 | 2517892021 | 270 |
| 573 | iso_pu_bacteria | 2524023228 | 2524534096 | 270 |
| 574 | iso_pu_bacteria | 8006933436 | 8006940172 | 270 |
| 575 | iso_pu_bacteria | 8006973647 | 8006979953 | 270 |
| 576 | 3300044658 | Ga0466972_0054751 | Ga0466972_0054751_195_1073 | 271 |
| 577 | 3300048915 | Ga0496112_0412100 | Ga0496112_0412100_370_1251 | 271 |
| 578 | iso_pu_bacteria | 2667528175 | 2671121941 | 271 |
| 579 | 3300003215 | JGI25153J46596_10000386 | JGI25153J46596_1000038658 | 272 |
| 580 | 3300003215 | JGI25153J46596_10028188 | JGI25153J46596_100281882 | 272 |
| 581 | 3300003354 | JGI25160J50197_1001640 | JGI25160J50197_10016404 | 272 |
| 582 | 3300003354 | JGI25160J50197_1002119 | JGI25160J50197_10021192 | 272 |
| 583 | 3300005262 | Ga0065165_1001250 | Ga0065165_100125018 | 272 |
| 584 | 3300005338 | Ga0068868_100267134 | Ga0068868_1002671342 | 272 |
| 585 | 3300005355 | Ga0070671_100009681 | Ga0070671_1000096817 | 272 |
| 586 | 3300005367 | Ga0070667_100092655 | Ga0070667_1000926553 | 272 |
| 587 | 3300005455 | Ga0070663_100037003 | Ga0070663_1000370034 | 272 |
| 588 | 3300005455 | Ga0070663_100070351 | Ga0070663_1000703513 | 272 |
| 589 | 3300005457 | Ga0070662_100334516 | Ga0070662_1003345161 | 272 |
| 590 | 3300005548 | Ga0070665_100052340 | Ga0070665_1000523402 | 272 |
| 591 | 3300005614 | Ga0068856_100016783 | Ga0068856_1000167837 | 272 |
| 592 | 3300005616 | Ga0068852_100560566 | Ga0068852_1005605661 | 272 |
| 593 | 3300005841 | Ga0068863_100054647 | Ga0068863_1000546474 | 272 |
| 594 | 3300005842 | Ga0068858_100189646 | Ga0068858_1001896462 | 272 |
| 595 | 3300006038 | Ga0075365_10014323 | Ga0075365_100143231 | 272 |
| 596 | 3300006038 | Ga0075365_10151648 | Ga0075365_101516482 | 272 |
| 597 | 3300006042 | Ga0075368_10001595 | Ga0075368_100015955 | 272 |
| 598 | 3300006186 | Ga0075369_10013149 | Ga0075369_100131492 | 272 |
| 599 | 3300006353 | Ga0075370_10004684 | Ga0075370_100046846 | 272 |
| 600 | 3300006942 | Ga0099824_1006303 | Ga0099824_10063039 | 272 |
| 601 | 3300006944 | Ga0099823_1047796 | Ga0099823_10477962 | 272 |
| 602 | 3300009098 | Ga0105245_10399676 | Ga0105245_103996762 | 272 |
| 603 | 3300009101 | Ga0105247_10012747 | Ga0105247_100127476 | 272 |
| 604 | 3300009174 | Ga0105241_10265563 | Ga0105241_102655631 | 272 |
| 605 | 3300009545 | Ga0105237_10597240 | Ga0105237_105972401 | 272 |
| 606 | 3300010375 | Ga0105239_10038560 | Ga0105239_100385604 | 272 |
| 607 | 3300010375 | Ga0105239_10330046 | Ga0105239_103300461 | 272 |
| 608 | 3300010375 | Ga0105239_10444933 | Ga0105239_104449332 | 272 |
| 609 | 3300011119 | Ga0105246_10009369 | Ga0105246_100093692 | 272 |
| 610 | 3300013297 | Ga0157378_10130231 | Ga0157378_101302312 | 272 |
| 611 | 3300014325 | Ga0163163_10175895 | Ga0163163_101758952 | 272 |
| 612 | 3300014745 | Ga0157377_10079215 | Ga0157377_100792152 | 272 |
| 613 | 3300025254 | Ga0209148_1000374 | Ga0209148_100037421 | 272 |
| 614 | 3300025261 | Ga0209233_1003530 | Ga0209233_10035302 | 272 |
| 615 | 3300025272 | Ga0209455_1005711 | Ga0209455_10057114 | 272 |
| 616 | 3300025273 | Ga0209673_1029382 | Ga0209673_10293822 | 272 |
| 617 | 3300025295 | Ga0209564_1036712 | Ga0209564_10367122 | 272 |
| 618 | 3300025297 | Ga0209758_1000024 | Ga0209758_1000024116 | 272 |
| 619 | 3300025297 | Ga0209758_1000068 | Ga0209758_1000068160 | 272 |
| 620 | 3300025297 | Ga0209758_1001579 | Ga0209758_100157926 | 272 |
| 621 | 3300025297 | Ga0209758_1027583 | Ga0209758_10275833 | 272 |
| 622 | 3300025302 | Ga0207426_1000387 | Ga0207426_100038755 | 272 |
| 623 | 3300025302 | Ga0207426_1004903 | Ga0207426_10049032 | 272 |
| 624 | 3300025302 | Ga0207426_1032624 | Ga0207426_10326242 | 272 |
| 625 | 3300025302 | Ga0207426_1042824 | Ga0207426_10428242 | 272 |
| 626 | 3300025304 | Ga0209257_1002392 | Ga0209257_10023928 | 272 |
| 627 | 3300025304 | Ga0209257_1015675 | Ga0209257_10156752 | 272 |
| 628 | 3300025304 | Ga0209257_1023354 | Ga0209257_10233542 | 272 |
| 629 | 3300025900 | Ga0207710_10008834 | Ga0207710_100088345 | 272 |
| 630 | 3300025904 | Ga0207647_10042350 | Ga0207647_100423502 | 272 |
| 631 | 3300025909 | Ga0207705_10018834 | Ga0207705_100188344 | 272 |
| 632 | 3300025911 | Ga0207654_10034022 | Ga0207654_100340222 | 272 |
| 633 | 3300025914 | Ga0207671_10167852 | Ga0207671_101678522 | 272 |
| 634 | 3300025919 | Ga0207657_10093341 | Ga0207657_100933412 | 272 |
| 635 | 3300025931 | Ga0207644_10014670 | Ga0207644_100146703 | 272 |
| 636 | 3300025933 | Ga0207706_10335628 | Ga0207706_103356281 | 272 |
| 637 | 3300025935 | Ga0207709_10052322 | Ga0207709_100523223 | 272 |
| 638 | 3300026023 | Ga0207677_10161412 | Ga0207677_101614122 | 272 |
| 639 | 3300026067 | Ga0207678_10040532 | Ga0207678_100405324 | 272 |
| 640 | 3300026067 | Ga0207678_10056441 | Ga0207678_100564412 | 272 |
| 641 | 3300026116 | Ga0207674_10295749 | Ga0207674_102957491 | 272 |
| 642 | 3300026142 | Ga0207698_10353637 | Ga0207698_103536372 | 272 |
| 643 | 3300027296 | Ga0209389_1000100 | Ga0209389_100010014 | 272 |
| 644 | 3300027296 | Ga0209389_1000107 | Ga0209389_100010732 | 272 |
| 645 | 3300027357 | Ga0209589_1000092 | Ga0209589_100009225 | 272 |
| 646 | 3300027361 | Ga0209489_100006 | Ga0209489_100006482 | 272 |
| 647 | 3300027361 | Ga0209489_109859 | Ga0209489_1098597 | 272 |
| 648 | 3300027363 | Ga0209700_100005 | Ga0209700_100005347 | 272 |
| 649 | 3300027866 | Ga0209813_10015348 | Ga0209813_100153483 | 272 |
| 650 | 3300028379 | Ga0268266_10539093 | Ga0268266_105390932 | 272 |
| 651 | 3300028381 | Ga0268264_10213469 | Ga0268264_102134692 | 272 |
| 652 | 3300033180 | Ga0307510_10016775 | Ga0307510_100167755 | 272 |
| 653 | 3300037471 | Ga0395905_0001582 | Ga0395905_0001582_19312_20193 | 272 |
| 654 | 3300044684 | Ga0466966_0000334 | Ga0466966_0000334_25604_26485 | 272 |
| 655 | 3300044693 | Ga0466961_0000509 | Ga0466961_0000509_19132_20013 | 272 |
| 656 | 3300044694 | Ga0466963_0013523 | Ga0466963_0013523_177_1058 | 272 |
| 657 | 3300044765 | Ga0466970_0091409 | Ga0466970_0091409_708_1592 | 272 |
| 658 | 3300045049 | Ga0466959_0004969 | Ga0466959_0004969_1024_1905 | 272 |
| 659 | 3300045976 | Ga0466967_0070092 | Ga0466967_0070092_437_1318 | 272 |
| 660 | 3300046455 | Ga0495603_0061957 | Ga0495603_0061957_526_1407 | 272 |
| 661 | 3300046460 | Ga0495638_0011004 | Ga0495638_0011004_4237_5121 | 272 |
| 662 | 3300046463 | Ga0495653_0046891 | Ga0495653_0046891_1668_2549 | 272 |
| 663 | 3300046477 | Ga0495664_0021466 | Ga0495664_0021466_529_1410 | 272 |
| 664 | 3300046477 | Ga0495664_0156395 | Ga0495664_0156395_279_1163 | 272 |
| 665 | 3300046507 | Ga0495606_0051583 | Ga0495606_0051583_542_1423 | 272 |
| 666 | 3300046511 | Ga0495608_0065131 | Ga0495608_0065131_761_1642 | 272 |
| 667 | 3300046512 | Ga0495610_0014109 | Ga0495610_0014109_824_1705 | 272 |
| 668 | 3300046513 | Ga0495616_0021556 | Ga0495616_0021556_2106_2987 | 272 |
| 669 | 3300046516 | Ga0495628_0058616 | Ga0495628_0058616_1594_2475 | 272 |
| 670 | 3300046516 | Ga0495628_0283408 | Ga0495628_0283408_139_1023 | 272 |
| 671 | 3300046518 | Ga0495631_0101189 | Ga0495631_0101189_20_901 | 272 |
| 672 | 3300046519 | Ga0495632_0072203 | Ga0495632_0072203_224_1105 | 272 |
| 673 | 3300046522 | Ga0495643_0003949 | Ga0495643_0003949_5559_6440 | 272 |
| 674 | 3300046524 | Ga0495648_0033393 | Ga0495648_0033393_1120_2001 | 272 |
| 675 | 3300046529 | Ga0495652_0108486 | Ga0495652_0108486_564_1445 | 272 |
| 676 | 3300046533 | Ga0495640_0021451 | Ga0495640_0021451_1617_2501 | 272 |
| 677 | 3300046533 | Ga0495640_0028070 | Ga0495640_0028070_1380_2261 | 272 |
| 678 | 3300046536 | Ga0495587_0024759 | Ga0495587_0024759_1159_2040 | 272 |
| 679 | 3300046542 | Ga0495597_0029621 | Ga0495597_0029621_972_1853 | 272 |
| 680 | 3300046543 | Ga0495645_0056202 | Ga0495645_0056202_1685_2566 | 272 |
| 681 | 3300046557 | Ga0495622_0053711 | Ga0495622_0053711_696_1580 | 272 |
| 682 | 3300046559 | Ga0495667_0028180 | Ga0495667_0028180_1350_2231 | 272 |
| 683 | 3300046616 | Ga0495668_0024031 | Ga0495668_0024031_432_1313 | 272 |
| 684 | 3300046616 | Ga0495668_0026081 | Ga0495668_0026081_431_1312 | 272 |
| 685 | 3300046642 | Ga0495634_0057933 | Ga0495634_0057933_1008_1889 | 272 |
| 686 | 3300046663 | Ga0495635_0003611 | Ga0495635_0003611_7683_8567 | 272 |
| 687 | 3300046675 | Ga0495657_0008209 | Ga0495657_0008209_3720_4601 | 272 |
| 688 | 3300046675 | Ga0495657_0010198 | Ga0495657_0010198_1811_2695 | 272 |
| 689 | 3300046678 | Ga0495599_0023035 | Ga0495599_0023035_2838_3719 | 272 |
| 690 | 3300046679 | Ga0495623_0087305 | Ga0495623_0087305_81_962 | 272 |
| 691 | 3300046689 | Ga0495613_0043228 | Ga0495613_0043228_2151_3035 | 272 |
| 692 | 3300046694 | Ga0495649_0012858 | Ga0495649_0012858_723_1604 | 272 |
| 693 | 3300046694 | Ga0495649_0051782 | Ga0495649_0051782_1081_1962 | 272 |
| 694 | 3300046809 | Ga0495600_0011185 | Ga0495600_0011185_812_1693 | 272 |
| 695 | 3300046809 | Ga0495600_0033736 | Ga0495600_0033736_970_1854 | 272 |
| 696 | 3300047317 | Ga0495604_0014071 | Ga0495604_0014071_4148_5029 | 272 |
| 697 | 3300047317 | Ga0495604_0238275 | Ga0495604_0238275_197_1081 | 272 |
| 698 | 3300047319 | Ga0495674_0019106 | Ga0495674_0019106_1360_2241 | 272 |
| 699 | 3300047321 | Ga0495676_0041446 | Ga0495676_0041446_1753_2637 | 272 |
| 700 | 3300047322 | Ga0495680_0003980 | Ga0495680_0003980_12111_12992 | 272 |
| 701 | 3300047443 | Ga0495687_003324 | Ga0495687_003324_6320_7201 | 272 |
| 702 | 3300047444 | Ga0495675_0052062 | Ga0495675_0052062_204_1085 | 272 |
| 703 | 3300047673 | Ga0495593_0016465 | Ga0495593_0016465_1471_2355 | 272 |
| 704 | 3300048088 | Ga0495602_0021808 | Ga0495602_0021808_789_1670 | 272 |
| 705 | 3300048091 | Ga0495626_0062377 | Ga0495626_0062377_665_1546 | 272 |
| 706 | 3300048903 | Ga0496100_0117158 | Ga0496100_0117158_834_1718 | 272 |
| 707 | 3300048905 | Ga0496102_0006786 | Ga0496102_0006786_3825_4706 | 272 |
| 708 | 3300048906 | Ga0496103_0005031 | Ga0496103_0005031_4792_5673 | 272 |
| 709 | 3300048907 | Ga0496104_0018014 | Ga0496104_0018014_1754_2638 | 272 |
| 710 | 3300048907 | Ga0496104_0078911 | Ga0496104_0078911_663_1544 | 272 |
| 711 | 3300048907 | Ga0496104_0183720 | Ga0496104_0183720_569_1450 | 272 |
| 712 | 3300048908 | Ga0496105_0000527 | Ga0496105_0000527_545_1429 | 272 |
| 713 | 3300048908 | Ga0496105_0028458 | Ga0496105_0028458_1336_2217 | 272 |
| 714 | 3300048912 | Ga0496109_0055424 | Ga0496109_0055424_455_1336 | 272 |
| 715 | 3300048912 | Ga0496109_0088540 | Ga0496109_0088540_1866_2747 | 272 |
| 716 | 3300048914 | Ga0496111_0232335 | Ga0496111_0232335_243_1124 | 272 |
| 717 | 3300048915 | Ga0496112_0013255 | Ga0496112_0013255_1114_1995 | 272 |
| 718 | 3300048916 | Ga0496113_0054616 | Ga0496113_0054616_1856_2737 | 272 |
| 719 | 3300048917 | Ga0496114_0408176 | Ga0496114_0408176_22_906 | 272 |
| 720 | 3300048922 | Ga0496119_0008238 | Ga0496119_0008238_709_1590 | 272 |
| 721 | 3300048922 | Ga0496119_0031024 | Ga0496119_0031024_961_1845 | 272 |
| 722 | 3300048923 | Ga0496120_0032854 | Ga0496120_0032854_730_1614 | 272 |
| 723 | 3300048923 | Ga0496120_0107239 | Ga0496120_0107239_502_1383 | 272 |
| 724 | 3300048924 | Ga0496121_0055533 | Ga0496121_0055533_594_1475 | 272 |
| 725 | 3300048926 | Ga0496123_0121100 | Ga0496123_0121100_563_1444 | 272 |
| 726 | 3300048926 | Ga0496123_0227275 | Ga0496123_0227275_14_898 | 272 |
| 727 | 3300048927 | Ga0496124_0170077 | Ga0496124_0170077_150_1031 | 272 |
| 728 | 3300048928 | Ga0496125_0064166 | Ga0496125_0064166_455_1339 | 272 |
| 729 | 3300048928 | Ga0496125_0107093 | Ga0496125_0107093_585_1466 | 272 |
| 730 | 3300048929 | Ga0496126_0050907 | Ga0496126_0050907_852_1736 | 272 |
| 731 | 3300049460 | Ga0495682_0003678 | Ga0495682_0003678_4565_5446 | 272 |
| 732 | 3300050490 | nmdc:mga03n38_77881_c1 | nmdc:mga03n38_77881_c1_613_1494 | 272 |
| 733 | 3300050491 | nmdc:mga00v17_47723_c1 | nmdc:mga00v17_47723_c1_1178_2059 | 272 |
| 734 | 3300050492 | nmdc:mga0yw44_131540_c1 | nmdc:mga0yw44_131540_c1_541_1422 | 272 |
| 735 | 3300050492 | nmdc:mga0yw44_284797_c1 | nmdc:mga0yw44_284797_c1_47_928 | 272 |
| 736 | 3300050493 | nmdc:mga0k408_113862_c1 | nmdc:mga0k408_113862_c1_68_949 | 272 |
| 737 | 3300050494 | nmdc:mga06z11_122033_c1 | nmdc:mga06z11_122033_c1_490_1371 | 272 |
| 738 | 3300050495 | nmdc:mga04h51_5957_c1 | nmdc:mga04h51_5957_c1_778_1659 | 272 |
| 739 | 3300050516 | nmdc:mga0sz30_30512_c1 | nmdc:mga0sz30_30512_c1_234_1115 | 272 |
| 740 | 3300053083 | Ga0495655_0032481 | Ga0495655_0032481_87_968 | 272 |
| 741 | 3300053085 | Ga0495619_0032984 | Ga0495619_0032984_1860_2741 | 272 |
| 742 | 3300053085 | Ga0495619_0199144 | Ga0495619_0199144_484_1368 | 272 |
| 743 | 3300053086 | Ga0500578_0067421 | Ga0500578_0067421_839_1720 | 272 |
| 744 | 3300053087 | Ga0500643_000007 | Ga0500643_000007_37366_38250 | 272 |
| 745 | 3300053103 | Ga0500555_011052 | Ga0500555_011052_1398_2282 | 272 |
| 746 | 3300053105 | Ga0500557_000300 | Ga0500557_000300_4076_4957 | 272 |
| 747 | 3300053108 | Ga0500562_009617 | Ga0500562_009617_878_1762 | 272 |
| 748 | 3300053109 | Ga0500569_012579 | Ga0500569_012579_510_1397 | 272 |
| 749 | 3300053111 | Ga0500572_010981 | Ga0500572_010981_1183_2070 | 272 |
| 750 | 3300053116 | Ga0500592_007074 | Ga0500592_007074_335_1219 | 272 |
| 751 | 3300053119 | Ga0500595_067104 | Ga0500595_067104_96_980 | 272 |
| 752 | 3300053120 | Ga0500597_066245 | Ga0500597_066245_285_1166 | 272 |
| 753 | 3300053130 | Ga0500642_0000274 | Ga0500642_0000274_3105_3986 | 272 |
| 754 | 3300053139 | Ga0500568_0014314 | Ga0500568_0014314_1361_2245 | 272 |
| 755 | 3300053148 | Ga0500590_084826 | Ga0500590_084826_181_1065 | 272 |
| 756 | 3300053153 | Ga0500616_0081419 | Ga0500616_0081419_332_1216 | 272 |
| 757 | 3300053154 | Ga0500619_013808 | Ga0500619_013808_1050_1940 | 272 |
| 758 | 3300053155 | Ga0500620_019155 | Ga0500620_019155_74_964 | 272 |
| 759 | 3300053162 | Ga0500638_048394 | Ga0500638_048394_559_1443 | 272 |
| 760 | 3300053177 | Ga0500636_0000042 | Ga0500636_0000042_2192_3079 | 272 |
| 761 | 3300053729 | Ga0500625_016360 | Ga0500625_016360_1664_2545 | 272 |
| 762 | 3300053730 | Ga0500645_010142 | Ga0500645_010142_29_913 | 272 |
| 763 | 3300053731 | Ga0500609_006486 | Ga0500609_006486_317_1204 | 272 |
| 764 | 3300053736 | Ga0500599_001563 | Ga0500599_001563_66_947 | 272 |
| 765 | 3300053737 | Ga0500601_000124 | Ga0500601_000124_6307_7191 | 272 |
| 766 | 3300061719 | Ga0466962_0164990 | Ga0466962_0164990_51_932 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar