F479874

General Info

Members Datasets Scaffolds Average Seq Length
766 552 541 280

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0016520|Ga0501083_0016520_809_1711
Length 300
Sequence MLFPPFDPDRAESRRKRFRAIPVRTLVPNLITLLALCAGLTAIRLSIEGKLEWALGAIVFAAILDGIDGRVARLIKGQSRFGAELDSLADFVNFGVAPGLILYFWGLNELGSVGWIAALVFAICAGLRLARFNVMIDDPNQPAWVGNFFVGVPAPAGAITVLLPVYVSLLGGPRPAIVTFLYTLLIAFFMVSRLPVLSGKKLGTRVPPEMVLPIFVVVVLFVALLVSYPWVVLTIGTLAYLAALPLGWASHRNYQRLDVAAAGPVESPVSAQTGRPNDAAPASGRVLDDADAPDRPSRLN

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2643221651 Afipia sp. Root123D2 Isolate Unclassified
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
34 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
35 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
36 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
37 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
38 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
39 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
40 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
41 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
42 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
43 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
44 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
45 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
46 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
47 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
48 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
49 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
50 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
51 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
52 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
53 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
54 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
55 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
56 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
57 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
58 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
59 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
60 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
61 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
62 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
63 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
64 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
65 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
66 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
67 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
68 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
69 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
70 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
71 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
72 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
73 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
74 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
75 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
76 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
77 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
78 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
79 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
80 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
83 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
84 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
85 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
86 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
87 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
88 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
89 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
90 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
91 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
92 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
93 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
94 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
95 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
96 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
97 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
98 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
99 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
100 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
101 2904699407
102 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
103 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
104 2906610324
105 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
106 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
107 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
108 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
109 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
110 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
111 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
112 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
113 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
114 2922368715
115 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
116 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
117 2922425934
118 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
119 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
120 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
121 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
122 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
123 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
124 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
125 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
126 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
127 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
128 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
129 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
130 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
131 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
132 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
133 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
134 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
135 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
136 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
137 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
138 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
139 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
140 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
141 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
142 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
143 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
144 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
145 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
146 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
147 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
148 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
149 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
150 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
151 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
152 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
153 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
154 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
155 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
156 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
157 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
158 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
159 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
160 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
161 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
162 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
163 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
164 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
165 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
166 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
167 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
168 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
169 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
170 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
171 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
172 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
173 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
174 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
175 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
176 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
177 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
178 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
179 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
180 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
181 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
182 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
183 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
184 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
185 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
186 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
187 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
188 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
189 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
190 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
191 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
192 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
193 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
194 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
195 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
196 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
197 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
198 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
199 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
200 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
201 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
202 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
203 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
204 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
205 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
206 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
207 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
208 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
209 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
210 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
211 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
212 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
213 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
214 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
215 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
216 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
217 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
218 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
219 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
220 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
221 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
222 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
223 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
224 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
225 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
226 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
227 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
228 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
229 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
230 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
231 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
232 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
233 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
234 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
235 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
236 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
237 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
238 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
239 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
240 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
241 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
242 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
243 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
244 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
245 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
246 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
247 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
248 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
249 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
250 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
251 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
252 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
253 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
254 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
255 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
256 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
257 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
258 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
259 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
260 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
261 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
262 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
263 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
264 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
265 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
266 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
267 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
268 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
269 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
270 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
271 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
274 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
276 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
278 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
279 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
326 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
327 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
328 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
329 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
330 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
331 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
335 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
336 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
337 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
338 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
339 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
340 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
341 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
342 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
343 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
344 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
345 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
346 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
347 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
348 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
349 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
350 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
351 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
352 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
353 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
354 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
355 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
356 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
357 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
358 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
359 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
360 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
361 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
362 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
363 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
364 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
365 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
366 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
367 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
368 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
369 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
370 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
371 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
372 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
373 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
374 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
375 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
376 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
377 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
378 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
379 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
380 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
381 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
382 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
383 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
384 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
385 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
386 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
387 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
388 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
389 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
390 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
391 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
392 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
393 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
394 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
395 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
396 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
397 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
398 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
399 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
400 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
401 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
402 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
403 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
404 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
405 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
406 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
407 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
408 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
409 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
410 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
411 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
412 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
413 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
414 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
415 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
416 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
417 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
418 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
419 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
420 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
421 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
422 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
423 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
424 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
425 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
426 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
427 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
428 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
429 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
430 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
431 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
432 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
433 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
434 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
435 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
436 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
440 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
454 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
455 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
456 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
457 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
458 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
459 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
460 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
461 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
462 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
463 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
464 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
467 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
470 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
471 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
472 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
475 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
478 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
479 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
480 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
481 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
482 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
483 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
484 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
485 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
486 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
487 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
488 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
489 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
490 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
491 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
492 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
493 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
494 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
495 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
496 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
497 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
498 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
499 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
500 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
501 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
502 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
503 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
504 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
505 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
506 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
507 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
508 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
509 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
510 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
511 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
512 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
513 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
514 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
515 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
516 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
517 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
518 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
519 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
520 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
521 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
522 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
523 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
524 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
525 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
526 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
527 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
528 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
529 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
530 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
531 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
532 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
533 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
534 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
535 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
536 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
537 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
538 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
539 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
540 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
541 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
542 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
543 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
544 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
545 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
546 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
547 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
548 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
549 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
550 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
551 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
552 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71
Metatranscriptomes 0
Isolates 29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.36
Nodule 22.32
Rhizoplane 4.31
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 12.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000386 3300003215 Bacteria 30025
2 JGI25153J46596_10007394 3300003215 Bacteria 5410
3 JGI25153J46596_10028188 3300003215 Bacteria 1953
4 JGI25160J50197_1001640 3300003354 Bacteria 10982
5 JGI25160J50197_1002119 3300003354 Bacteria 9426
6 JGI25404J52841_10002404 3300003659 Bacteria 3534
7 JGI25404J52841_10021019 3300003659 Bacteria 1413
8 Ga0055539_1007248 3300003752 Bacteria 1406
9 Ga0065165_1001250 3300005262 Bacteria 28850
10 Ga0070690_100086843 3300005330 Bacteria 2054
11 Ga0070677_10002540 3300005333 Bacteria 5837
12 Ga0068869_100256128 3300005334 Bacteria 1399
13 Ga0068868_100267134 3300005338 Bacteria 1444
14 Ga0070689_100085305 3300005340 Bacteria 2483
15 Ga0070689_100111110 3300005340 Bacteria 2180
16 Ga0070689_100474700 3300005340 Bacteria 1067
17 Ga0070671_100009681 3300005355 Bacteria 7742
18 Ga0070674_100003716 3300005356 Bacteria 8603
19 Ga0070673_100077857 3300005364 Bacteria 2680
20 Ga0070688_100124589 3300005365 Bacteria 1730
21 Ga0070667_100092655 3300005367 Bacteria 2600
22 Ga0070709_10002491 3300005434 Bacteria 9968
23 Ga0070709_10045274 3300005434 Bacteria 2729
24 Ga0070714_100007873 3300005435 Bacteria 8299
25 Ga0070714_100009376 3300005435 Bacteria 7690
26 Ga0070714_100061891 3300005435 Bacteria 3215
27 Ga0070714_100244588 3300005435 Bacteria 1657
28 Ga0070714_100462257 3300005435 Bacteria 1206
29 Ga0070713_100010069 3300005436 Bacteria 6817
30 Ga0070713_100011234 3300005436 Bacteria 6512
31 Ga0070713_100058698 3300005436 Bacteria 3210
32 Ga0070713_100324435 3300005436 Bacteria 1423
33 Ga0070710_10002506 3300005437 Bacteria 8706
34 Ga0070710_10020959 3300005437 Bacteria 3399
35 Ga0070710_10044248 3300005437 Bacteria 2469
36 Ga0070710_10044958 3300005437 Bacteria 2452
37 Ga0070701_10112179 3300005438 Bacteria 1525
38 Ga0070711_100003409 3300005439 Bacteria 9259
39 Ga0070711_100006571 3300005439 Bacteria 7018
40 Ga0070711_100011302 3300005439 Bacteria 5540
41 Ga0070711_100191231 3300005439 Bacteria 1573
42 Ga0070711_100221709 3300005439 Bacteria 1470
43 Ga0070705_100140565 3300005440 Bacteria 1588
44 Ga0070663_100037003 3300005455 Bacteria 3394
45 Ga0070663_100070351 3300005455 Bacteria 2544
46 Ga0070678_100024943 3300005456 Bacteria 4012
47 Ga0070662_100210726 3300005457 Bacteria 1546
48 Ga0070662_100334516 3300005457 Bacteria 1238
49 Ga0070699_100087780 3300005518 Bacteria 2715
50 Ga0070684_100352631 3300005535 Bacteria 1353
51 Ga0068853_100000785 3300005539 Bacteria 22086
52 Ga0068853_100035350 3300005539 Bacteria 4244
53 Ga0070696_100156874 3300005546 Bacteria 1674
54 Ga0070665_100052340 3300005548 Bacteria 4095
55 Ga0070665_100191755 3300005548 Bacteria 2044
56 Ga0070665_100419409 3300005548 Bacteria 1347
57 Ga0070704_100165347 3300005549 Bacteria 1754
58 Ga0068855_100065946 3300005563 Bacteria 4221
59 Ga0070664_100175522 3300005564 Bacteria 1902
60 Ga0068857_100030751 3300005577 Bacteria 4743
61 Ga0068854_100013500 3300005578 Bacteria 5364
62 Ga0068854_100045877 3300005578 Bacteria 3110
63 Ga0068856_100016783 3300005614 Bacteria 7095
64 Ga0070702_100255000 3300005615 Bacteria 1191
65 Ga0068852_100015463 3300005616 Bacteria 5921
66 Ga0068852_100272114 3300005616 Bacteria 1630
67 Ga0068852_100560566 3300005616 Bacteria 1144
68 Ga0068864_100227566 3300005618 Bacteria 1723
69 Ga0068861_100048002 3300005719 Bacteria 3225
70 Ga0068861_100465676 3300005719 Bacteria 1135
71 Ga0068863_100054647 3300005841 Bacteria 3783
72 Ga0068858_100189646 3300005842 Bacteria 1942
73 Ga0068858_100474624 3300005842 Bacteria 1207
74 Ga0068860_100134269 3300005843 Bacteria 2376
75 Ga0068860_100362580 3300005843 Bacteria 1428
76 Ga0081540_1007585 3300005983 Bacteria 7707
77 Ga0081540_1017287 3300005983 Bacteria 4470
78 Ga0081540_1017313 3300005983 Bacteria 4466
79 Ga0081540_1090440 3300005983 Bacteria 1348
80 Ga0081539_10000051 3300005985 Bacteria 268337
81 Ga0081539_10000148 3300005985 Bacteria 163442
82 Ga0070717_10018001 3300006028 Bacteria 5511
83 Ga0070717_10018400 3300006028 Bacteria 5454
84 Ga0075365_10014323 3300006038 Bacteria 4768
85 Ga0075365_10053340 3300006038 Bacteria 2677
86 Ga0075365_10151648 3300006038 Bacteria 1612
87 Ga0075368_10001595 3300006042 Bacteria 7281
88 Ga0075368_10022438 3300006042 Bacteria 2403
89 Ga0070715_10000111 3300006163 Bacteria 20025
90 Ga0070716_100019234 3300006173 Bacteria 3567
91 Ga0070712_100005474 3300006175 Bacteria 7861
92 Ga0070712_100050814 3300006175 Bacteria 2886
93 Ga0070712_100065294 3300006175 Bacteria 2583
94 Ga0075367_10138198 3300006178 Bacteria 1508
95 Ga0075369_10013149 3300006186 Bacteria 3278
96 Ga0075366_10005054 3300006195 Bacteria 7130
97 Ga0075370_10004684 3300006353 Bacteria 6673
98 Ga0075370_10021626 3300006353 Bacteria 3524
99 Ga0075436_100331425 3300006914 Bacteria 1095
100 Ga0099824_1006303 3300006942 Bacteria 16336
101 Ga0099823_1047796 3300006944 Bacteria 2749
102 Ga0105240_10067442 3300009093 Bacteria 4435
103 Ga0111539_10328267 3300009094 Bacteria 1781
104 Ga0105245_10176704 3300009098 Bacteria 2037
105 Ga0105245_10399676 3300009098 Bacteria 1373
106 Ga0105247_10012747 3300009101 Bacteria 5046
107 Ga0105247_10016810 3300009101 Bacteria 4386
108 Ga0105241_10001021 3300009174 Bacteria 21313
109 Ga0105241_10030687 3300009174 Bacteria 4019
110 Ga0105241_10265563 3300009174 Bacteria 1460
111 Ga0105248_10120332 3300009177 Bacteria 2962
112 Ga0105248_10924621 3300009177 Bacteria 985
113 Ga0105237_10009330 3300009545 Bacteria 10508
114 Ga0105237_10103026 3300009545 Bacteria 2846
115 Ga0105237_10105765 3300009545 Bacteria 2805
116 Ga0105237_10433607 3300009545 Bacteria 1320
117 Ga0105237_10597240 3300009545 Bacteria 1111
118 Ga0105238_10002878 3300009551 Bacteria 17208
119 Ga0105238_10154078 3300009551 Bacteria 2273
120 Ga0105239_10038560 3300010375 Bacteria 5236
121 Ga0105239_10086748 3300010375 Bacteria 3450
122 Ga0105239_10330046 3300010375 Bacteria 1721
123 Ga0105239_10444933 3300010375 Bacteria 1469
124 Ga0105246_10009369 3300011119 Bacteria 6032
125 Ga0157369_10014981 3300013105 Bacteria 8751
126 Ga0157374_10408791 3300013296 Bacteria 1355
127 Ga0157378_10130231 3300013297 Bacteria 2328
128 Ga0163162_10510385 3300013306 Bacteria 1332
129 Ga0157372_10132348 3300013307 Bacteria 2870
130 Ga0157372_10254531 3300013307 Bacteria 2038
131 Ga0157375_10416713 3300013308 Bacteria 1509
132 Ga0163163_10000985 3300014325 Bacteria 24137
133 Ga0163163_10175895 3300014325 Bacteria 2187
134 Ga0157380_10074167 3300014326 Bacteria 2761
135 Ga0157380_10078609 3300014326 Bacteria 2692
136 Ga0157377_10079215 3300014745 Bacteria 1916
137 Ga0157376_10127093 3300014969 Bacteria 2269
138 Ga0214544_1000002 3300021320 Bacteria 753857
139 Ga0214542_1000001 3300021321 Bacteria 1018696
140 Ga0214545_1000001 3300021324 Bacteria 1092817
141 Ga0214543_1000001 3300021327 Bacteria 776921
142 Ga0213876_10028716 3300021384 Bacteria 2933
143 Ga0209677_105669 3300025253 Bacteria 3189
144 Ga0209148_1000374 3300025254 Bacteria 54657
145 Ga0209233_1003530 3300025261 Bacteria 5497
146 Ga0209455_1005711 3300025272 Bacteria 3793
147 Ga0209673_1029382 3300025273 Bacteria 1751
148 Ga0209564_1023949 3300025295 Bacteria 2102
149 Ga0209564_1036712 3300025295 Bacteria 1393
150 Ga0209758_1000024 3300025297 Bacteria 591966
151 Ga0209758_1000068 3300025297 Bacteria 286488
152 Ga0209758_1001579 3300025297 Bacteria 26050
153 Ga0209758_1009410 3300025297 Bacteria 6080
154 Ga0209758_1027583 3300025297 Bacteria 2422
155 Ga0207426_1000387 3300025302 Bacteria 75536
156 Ga0207426_1000726 3300025302 Bacteria 37826
157 Ga0207426_1004903 3300025302 Bacteria 6320
158 Ga0207426_1032624 3300025302 Bacteria 1687
159 Ga0207426_1042824 3300025302 Bacteria 1395
160 Ga0209257_1002392 3300025304 Bacteria 18783
161 Ga0209257_1015675 3300025304 Bacteria 3132
162 Ga0209257_1023354 3300025304 Bacteria 2176
163 Ga0207696_1023356 3300025711 Bacteria 1951
164 Ga0207692_10006395 3300025898 Bacteria 4776
165 Ga0207642_10089510 3300025899 Bacteria 1517
166 Ga0207710_10008834 3300025900 Bacteria 4242
167 Ga0207710_10019462 3300025900 Bacteria 2897
168 Ga0207647_10042350 3300025904 Bacteria 2857
169 Ga0207685_10079054 3300025905 Bacteria 1356
170 Ga0207699_10065951 3300025906 Bacteria 2196
171 Ga0207699_10085874 3300025906 Bacteria 1964
172 Ga0207645_10005641 3300025907 Bacteria 9045
173 Ga0207705_10018834 3300025909 Bacteria 4936
174 Ga0207654_10000163 3300025911 Bacteria 42749
175 Ga0207654_10034022 3300025911 Bacteria 2828
176 Ga0207707_10303171 3300025912 Bacteria 1381
177 Ga0207695_10000008 3300025913 Bacteria 1058268
178 Ga0207695_10001547 3300025913 Bacteria 37828
179 Ga0207671_10007503 3300025914 Bacteria 9459
180 Ga0207671_10153686 3300025914 Bacteria 1779
181 Ga0207671_10167852 3300025914 Bacteria 1703
182 Ga0207693_10005244 3300025915 Bacteria 10845
183 Ga0207693_10007171 3300025915 Bacteria 9182
184 Ga0207663_10001290 3300025916 Bacteria 11612
185 Ga0207663_10016823 3300025916 Bacteria 4066
186 Ga0207663_10051853 3300025916 Bacteria 2557
187 Ga0207657_10009208 3300025919 Bacteria 9954
188 Ga0207657_10093341 3300025919 Bacteria 2507
189 Ga0207649_10108479 3300025920 Bacteria 1850
190 Ga0207681_10051162 3300025923 Bacteria 2798
191 Ga0207694_10000050 3300025924 Bacteria 159920
192 Ga0207694_10010038 3300025924 Bacteria 7136
193 Ga0207694_10273228 3300025924 Bacteria 1387
194 Ga0207659_10088530 3300025926 Bacteria 2306
195 Ga0207700_10023334 3300025928 Bacteria 4263
196 Ga0207700_10025313 3300025928 Bacteria 4119
197 Ga0207700_10117025 3300025928 Bacteria 2154
198 Ga0207700_10291384 3300025928 Bacteria 1407
199 Ga0207664_10003495 3300025929 Bacteria 10488
200 Ga0207664_10143487 3300025929 Bacteria 2023
201 Ga0207644_10014670 3300025931 Bacteria 5249
202 Ga0207644_10131590 3300025931 Bacteria 1916
203 Ga0207706_10066142 3300025933 Bacteria 3182
204 Ga0207706_10190392 3300025933 Bacteria 1801
205 Ga0207706_10280426 3300025933 Bacteria 1453
206 Ga0207706_10335628 3300025933 Bacteria 1315
207 Ga0207709_10052322 3300025935 Bacteria 2507
208 Ga0207670_10068005 3300025936 Bacteria 2453
209 Ga0207670_10096072 3300025936 Bacteria 2106
210 Ga0207669_10014442 3300025937 Bacteria 3957
211 Ga0207665_10000651 3300025939 Bacteria 23346
212 Ga0207691_10004180 3300025940 Bacteria 14023
213 Ga0207679_10181619 3300025945 Bacteria 1741
214 Ga0207667_10013113 3300025949 Bacteria 9512
215 Ga0207667_10178660 3300025949 Bacteria 2180
216 Ga0207667_10414258 3300025949 Bacteria 1371
217 Ga0207712_10129627 3300025961 Bacteria 1920
218 Ga0207668_10014275 3300025972 Bacteria 4914
219 Ga0207640_10015497 3300025981 Bacteria 4413
220 Ga0207640_10356183 3300025981 Bacteria 1177
221 Ga0207677_10161412 3300026023 Bacteria 1742
222 Ga0207639_10003890 3300026041 Bacteria 10067
223 Ga0207639_10090464 3300026041 Bacteria 2448
224 Ga0207678_10040532 3300026067 Bacteria 4039
225 Ga0207678_10056441 3300026067 Bacteria 3380
226 Ga0207708_10154985 3300026075 Bacteria 1806
227 Ga0207702_10000002 3300026078 Bacteria 491507
228 Ga0207648_10021112 3300026089 Bacteria 5855
229 Ga0207676_10089470 3300026095 Bacteria 2523
230 Ga0207674_10005123 3300026116 Bacteria 15638
231 Ga0207674_10012072 3300026116 Bacteria 9675
232 Ga0207674_10295749 3300026116 Bacteria 1568
233 Ga0207675_100197110 3300026118 Bacteria 1933
234 Ga0207683_10401917 3300026121 Bacteria 1260
235 Ga0207698_10026372 3300026142 Bacteria 4110
236 Ga0207698_10058767 3300026142 Bacteria 2982
237 Ga0207698_10353637 3300026142 Bacteria 1388
238 Ga0209389_1000100 3300027296 Bacteria 79023
239 Ga0209389_1000107 3300027296 Bacteria 74129
240 Ga0209589_1000092 3300027357 Bacteria 89530
241 Ga0209489_100006 3300027361 Bacteria 475698
242 Ga0209489_109859 3300027361 Bacteria 11412
243 Ga0209700_100005 3300027363 Bacteria 573969
244 Ga0209813_10015348 3300027866 Bacteria 2074
245 Ga0265357_1002291 3300028023 Bacteria 1546
246 Ga0268266_10323522 3300028379 Bacteria 1444
247 Ga0268266_10539093 3300028379 Bacteria 1117
248 Ga0268265_10032816 3300028380 Bacteria 3767
249 Ga0268264_10000065 3300028381 Bacteria 298403
250 Ga0268264_10068657 3300028381 Bacteria 2996
251 Ga0268264_10213469 3300028381 Bacteria 1773
252 Ga0265320_10015104 3300031240 Bacteria 4372
253 Ga0265325_10074988 3300031241 Bacteria 1690
254 Ga0265340_10029289 3300031247 Bacteria 2765
255 Ga0265340_10096972 3300031247 Bacteria 1373
256 Ga0265331_10070103 3300031250 Bacteria 1641
257 Ga0265331_10165600 3300031250 Bacteria 1001
258 Ga0307513_10136805 3300031456 Bacteria 2384
259 Ga0307509_10039753 3300031507 Bacteria 5121
260 Ga0265342_10114872 3300031712 Bacteria 1520
261 Ga0307406_10221045 3300031901 Bacteria 1408
262 Ga0307412_10012231 3300031911 Bacteria 4994
263 Ga0307510_10016775 3300033180 Bacteria 8639
264 Ga0373955_0003380 3300035172 Bacteria 7015
265 Ga0373935_0027491 3300035692 Bacteria 3515
266 Ga0373927_0008512 3300035695 Bacteria 6901
267 Ga0373927_0009424 3300035695 Bacteria 6547
268 Ga0373933_0101676 3300035724 Bacteria 1784
269 Ga0373937_0207433 3300036401 Bacteria 1843
270 Ga0373937_0506086 3300036401 Bacteria 1147
271 Ga0373925_0005876 3300037068 Bacteria 9094
272 Ga0395899_0021195 3300037312 Bacteria 4930
273 Ga0395900_0112595 3300037418 Bacteria 2794
274 Ga0395898_0150340 3300037466 Bacteria 2228
275 Ga0395898_0281299 3300037466 Bacteria 1587
276 Ga0395905_0001582 3300037471 Bacteria 27158
277 Ga0395901_0057232 3300038443 Bacteria 4055
278 Ga0395901_0095483 3300038443 Bacteria 3115
279 Ga0436365_0338708 3300039437 Bacteria 1467
280 Ga0436365_0392043 3300039437 Bacteria 7324
281 Ga0436365_0919787 3300039437 Bacteria 3799
282 Ga0436363_0292837 3300039450 Bacteria 3697
283 Ga0436363_0967671 3300039450 Bacteria 7219
284 Ga0436362_0009644 3300039453 Bacteria 7519
285 Ga0451791_1826241 3300041451 Bacteria 1192
286 Ga0451849_1036195 3300041505 Bacteria 1138
287 Ga0466972_0040591 3300044658 Bacteria 2266
288 Ga0466972_0054751 3300044658 Bacteria 1919
289 Ga0466966_0000334 3300044684 Bacteria 30532
290 Ga0466961_0000509 3300044693 Bacteria 24794
291 Ga0466963_0013523 3300044694 Bacteria 5012
292 Ga0466963_0056465 3300044694 Bacteria 2613
293 Ga0466968_0012959 3300044735 Bacteria 3271
294 Ga0466970_0091409 3300044765 Bacteria 1652
295 Ga0466957_0212960 3300044842 Bacteria 1273
296 Ga0466959_0004969 3300045049 Bacteria 9013
297 Ga0466967_0070092 3300045976 Bacteria 3135
298 Ga0466967_0141520 3300045976 Bacteria 2241
299 Ga0495603_0061957 3300046455 Bacteria 2209
300 Ga0495638_0005531 3300046460 Bacteria 9374
301 Ga0495638_0011004 3300046460 Bacteria 6256
302 Ga0495653_0046891 3300046463 Bacteria 3344
303 Ga0495664_0021466 3300046477 Bacteria 3730
304 Ga0495664_0082366 3300046477 Bacteria 1930
305 Ga0495664_0156395 3300046477 Bacteria 1383
306 Ga0495594_0091072 3300046499 Bacteria 1709
307 Ga0495606_0051583 3300046507 Bacteria 2682
308 Ga0495608_0065131 3300046511 Bacteria 2387
309 Ga0495608_0165537 3300046511 Bacteria 1404
310 Ga0495610_0014109 3300046512 Bacteria 4713
311 Ga0495616_0021556 3300046513 Bacteria 3487
312 Ga0495618_0017068 3300046514 Bacteria 4448
313 Ga0495628_0058616 3300046516 Bacteria 3024
314 Ga0495628_0283408 3300046516 Bacteria 1230
315 Ga0495630_0267649 3300046517 Bacteria 1306
316 Ga0495631_0101189 3300046518 Bacteria 1240
317 Ga0495632_0072203 3300046519 Bacteria 1657
318 Ga0495643_0003949 3300046522 Bacteria 10620
319 Ga0495648_0033393 3300046524 Bacteria 3360
320 Ga0495652_0108486 3300046529 Bacteria 2237
321 Ga0495652_0121604 3300046529 Bacteria 2081
322 Ga0495640_0016907 3300046533 Bacteria 5448
323 Ga0495640_0021451 3300046533 Bacteria 4739
324 Ga0495640_0028070 3300046533 Bacteria 4054
325 Ga0495586_0113588 3300046535 Bacteria 1509
326 Ga0495587_0024759 3300046536 Bacteria 3675
327 Ga0495598_0012981 3300046537 Bacteria 2056
328 Ga0495597_0029621 3300046542 Bacteria 2499
329 Ga0495645_0029875 3300046543 Bacteria 3968
330 Ga0495645_0056202 3300046543 Bacteria 2858
331 Ga0495622_0007956 3300046557 Bacteria 4915
332 Ga0495622_0053711 3300046557 Bacteria 1869
333 Ga0495622_0177915 3300046557 Bacteria 955
334 Ga0495667_0028180 3300046559 Bacteria 3781
335 Ga0495667_0205780 3300046559 Bacteria 1258
336 Ga0495668_0024031 3300046616 Bacteria 3469
337 Ga0495668_0026081 3300046616 Bacteria 3318
338 Ga0495634_0057933 3300046642 Bacteria 2584
339 Ga0495634_0150964 3300046642 Bacteria 1469
340 Ga0495625_0338569 3300046660 Bacteria 954
341 Ga0495635_0003611 3300046663 Bacteria 10715
342 Ga0495635_0017322 3300046663 Bacteria 5033
343 Ga0495657_0008209 3300046675 Bacteria 8000
344 Ga0495657_0010198 3300046675 Bacteria 7077
345 Ga0495599_0023035 3300046678 Bacteria 3891
346 Ga0495599_0158388 3300046678 Bacteria 1400
347 Ga0495599_0270116 3300046678 Bacteria 1032
348 Ga0495623_0087305 3300046679 Bacteria 1922
349 Ga0495613_0043228 3300046689 Bacteria 3333
350 Ga0495649_0012858 3300046694 Bacteria 4851
351 Ga0495649_0051782 3300046694 Bacteria 2226
352 Ga0495600_0011185 3300046809 Bacteria 5589
353 Ga0495600_0033736 3300046809 Bacteria 3322
354 Ga0495600_0081460 3300046809 Bacteria 2112
355 Ga0495604_0013949 3300047317 Bacteria 6408
356 Ga0495604_0014071 3300047317 Bacteria 6378
357 Ga0495604_0218393 3300047317 Bacteria 1314
358 Ga0495604_0238275 3300047317 Bacteria 1245
359 Ga0495674_0019106 3300047319 Bacteria 6368
360 Ga0495674_0251165 3300047319 Bacteria 1455
361 Ga0495676_0041446 3300047321 Bacteria 3790
362 Ga0495680_0003980 3300047322 Bacteria 14272
363 Ga0495680_0111047 3300047322 Bacteria 2031
364 Ga0495687_003324 3300047443 Bacteria 11781
365 Ga0495675_0052062 3300047444 Bacteria 2599
366 Ga0495685_038266 3300047447 Bacteria 1644
367 Ga0495686_0054213 3300047472 Bacteria 2511
368 Ga0495686_0188837 3300047472 Bacteria 1189
369 Ga0495593_0016465 3300047673 Bacteria 4169
370 Ga0495602_0021808 3300048088 Bacteria 6290
371 Ga0495602_0150603 3300048088 Bacteria 1829
372 Ga0495615_0010142 3300048090 Bacteria 1874
373 Ga0495626_0062377 3300048091 Bacteria 1693
374 Ga0496100_0026018 3300048903 Bacteria 3584
375 Ga0496100_0117158 3300048903 Bacteria 1859
376 Ga0496101_0111504 3300048904 Bacteria 2059
377 Ga0496102_0006786 3300048905 Bacteria 9770
378 Ga0496102_0686419 3300048905 Bacteria 947
379 Ga0496103_0005031 3300048906 Bacteria 7973
380 Ga0496104_0018014 3300048907 Bacteria 6439
381 Ga0496104_0078911 3300048907 Bacteria 3137
382 Ga0496104_0084125 3300048907 Bacteria 3035
383 Ga0496104_0183720 3300048907 Bacteria 2001
384 Ga0496105_0000527 3300048908 Bacteria 25240
385 Ga0496105_0028458 3300048908 Bacteria 4569
386 Ga0496106_0033428 3300048909 Bacteria 3837
387 Ga0496106_0080333 3300048909 Bacteria 2504
388 Ga0496107_0081993 3300048910 Bacteria 2352
389 Ga0496107_0103401 3300048910 Bacteria 2090
390 Ga0496108_0214518 3300048911 Bacteria 1671
391 Ga0496109_0043355 3300048912 Bacteria 4078
392 Ga0496109_0055424 3300048912 Bacteria 3617
393 Ga0496109_0088540 3300048912 Bacteria 2861
394 Ga0496111_0232335 3300048914 Bacteria 1370
395 Ga0496112_0003913 3300048915 Bacteria 12460
396 Ga0496112_0013255 3300048915 Bacteria 7609
397 Ga0496112_0037597 3300048915 Bacteria 4724
398 Ga0496112_0412100 3300048915 Bacteria 1290
399 Ga0496113_0030777 3300048916 Bacteria 3888
400 Ga0496113_0054616 3300048916 Bacteria 2990
401 Ga0496114_0408176 3300048917 Bacteria 1203
402 Ga0496115_0141750 3300048918 Bacteria 1983
403 Ga0496115_0209436 3300048918 Bacteria 1610
404 Ga0496118_0011549 3300048921 Bacteria 8605
405 Ga0496119_0008238 3300048922 Bacteria 9212
406 Ga0496119_0031024 3300048922 Bacteria 3591
407 Ga0496120_0032854 3300048923 Bacteria 3123
408 Ga0496120_0107239 3300048923 Bacteria 1465
409 Ga0496121_0002820 3300048924 Bacteria 25702
410 Ga0496121_0003834 3300048924 Bacteria 20920
411 Ga0496121_0055533 3300048924 Bacteria 3298
412 Ga0496123_0121100 3300048926 Bacteria 1472
413 Ga0496123_0227275 3300048926 Bacteria 937
414 Ga0496124_0000722 3300048927 Bacteria 54175
415 Ga0496124_0170077 3300048927 Bacteria 1689
416 Ga0496125_0064166 3300048928 Bacteria 2921
417 Ga0496125_0107093 3300048928 Bacteria 2038
418 Ga0496125_0222766 3300048928 Bacteria 1214
419 Ga0496126_0006670 3300048929 Bacteria 12833
420 Ga0496126_0013918 3300048929 Bacteria 8162
421 Ga0496126_0050907 3300048929 Bacteria 3773
422 Ga0496126_0424094 3300048929 Bacteria 1075
423 Ga0495682_0003678 3300049460 Bacteria 6761
424 Ga0501031_0006773 3300049568 Bacteria 7476
425 Ga0501032_0000216 3300049569 Bacteria 47842
426 Ga0501032_0066523 3300049569 Bacteria 2408
427 Ga0501033_0000344 3300049570 Bacteria 44238
428 Ga0501034_0000100 3300049571 Bacteria 159536
429 Ga0501034_0010590 3300049571 Bacteria 9594
430 Ga0501034_0072954 3300049571 Bacteria 3441
431 Ga0501036_0000010 3300049572 Bacteria 163304
432 Ga0501036_0011080 3300049572 Bacteria 7457
433 Ga0501036_0215789 3300049572 Bacteria 1612
434 Ga0501037_0000704 3300049573 Bacteria 25447
435 Ga0501038_0000350 3300049574 Bacteria 39547
436 Ga0501038_0015829 3300049574 Bacteria 6852
437 Ga0501038_0143843 3300049574 Bacteria 1949
438 Ga0501038_0175504 3300049574 Bacteria 1732
439 Ga0501039_0001013 3300049575 Bacteria 20468
440 Ga0501042_0013287 3300049578 Bacteria 5601
441 Ga0501043_0000106 3300049579 Bacteria 77699
442 Ga0501046_0016704 3300049580 Bacteria 6139
443 Ga0501046_0017100 3300049580 Bacteria 6059
444 Ga0501047_0000493 3300049581 Bacteria 42827
445 Ga0501047_0007800 3300049581 Bacteria 10076
446 Ga0501047_0021416 3300049581 Bacteria 6206
447 Ga0501047_0076360 3300049581 Bacteria 3224
448 Ga0501048_0000233 3300049582 Bacteria 36758
449 Ga0501048_0010185 3300049582 Bacteria 7031
450 Ga0501067_0000098 3300049583 Bacteria 50026
451 Ga0501068_0000987 3300049584 Bacteria 14955
452 Ga0501069_0180711 3300049585 Bacteria 1219
453 Ga0501070_0001419 3300049586 Bacteria 21462
454 Ga0501070_0204606 3300049586 Bacteria 1621
455 Ga0501071_0039319 3300049587 Bacteria 3384
456 Ga0501072_0010044 3300049588 Bacteria 7202
457 Ga0501073_0002056 3300049589 Bacteria 15034
458 Ga0501073_0096321 3300049589 Bacteria 2055
459 Ga0501074_0000382 3300049590 Bacteria 26289
460 Ga0501074_0080844 3300049590 Bacteria 2331
461 Ga0501079_0003159 3300049741 Bacteria 12078
462 Ga0501080_0001033 3300049742 Bacteria 22925
463 Ga0501080_0026811 3300049742 Bacteria 5356
464 Ga0501080_0044807 3300049742 Bacteria 4117
465 Ga0501083_0000116 3300049744 Bacteria 54656
466 Ga0501083_0016520 3300049744 Bacteria 5163
467 Ga0501083_0123940 3300049744 Bacteria 1694
468 Ga0501083_0208937 3300049744 Bacteria 1273
469 Ga0501035_0000496 3300049822 Bacteria 44296
470 Ga0501035_0024371 3300049822 Bacteria 5549
471 Ga0501035_0039064 3300049822 Bacteria 4297
472 Ga0501035_0278395 3300049822 Bacteria 1415
473 Ga0501044_0000857 3300049823 Bacteria 36575
474 Ga0501044_0015502 3300049823 Bacteria 8208
475 Ga0501044_0164966 3300049823 Bacteria 2190
476 Ga0501044_0194513 3300049823 Bacteria 1989
477 Ga0501045_0013445 3300049824 Bacteria 5782
478 nmdc:mga03n38_77881_c1 3300050490 Bacteria 1550
479 nmdc:mga00v17_47723_c1 3300050491 Bacteria 2594
480 nmdc:mga0yw44_131540_c1 3300050492 Bacteria 1620
481 nmdc:mga0yw44_284797_c1 3300050492 Bacteria 1105
482 nmdc:mga0k408_113862_c1 3300050493 Bacteria 1600
483 nmdc:mga06z11_122033_c1 3300050494 Bacteria 1455
484 nmdc:mga06z11_169123_c1 3300050494 Bacteria 1254
485 nmdc:mga04h51_5957_c1 3300050495 Bacteria 3133
486 nmdc:mga07m45_128832_c1 3300050496 Bacteria 1464
487 nmdc:mga07m45_227146_c1 3300050496 Bacteria 1086
488 nmdc:mga08y16_586538_c1 3300050511 Bacteria 1125
489 nmdc:mga08x19_196032_c1 3300050514 Bacteria 1383
490 nmdc:mga0sz30_30512_c1 3300050516 Bacteria 2227
491 Ga0495601_0049779 3300053077 Bacteria 2643
492 Ga0495601_0229142 3300053077 Bacteria 1213
493 Ga0495612_0020030 3300053078 Bacteria 2680
494 Ga0495655_0032481 3300053083 Bacteria 1277
495 Ga0495619_0032984 3300053085 Bacteria 3362
496 Ga0495619_0153507 3300053085 Bacteria 1588
497 Ga0495619_0199144 3300053085 Bacteria 1386
498 Ga0500578_0067421 3300053086 Bacteria 2282
499 Ga0500643_000007 3300053087 Bacteria 462836
500 Ga0500647_0151403 3300053091 Bacteria 1082
501 Ga0500651_0104295 3300053093 Bacteria 1736
502 Ga0500566_0098419 3300053094 Bacteria 1607
503 Ga0500641_0033320 3300053096 Bacteria 2044
504 Ga0500555_011052 3300053103 Bacteria 2592
505 Ga0500557_000300 3300053105 Bacteria 6669
506 Ga0500562_009617 3300053108 Bacteria 2443
507 Ga0500569_012579 3300053109 Bacteria 2051
508 Ga0500572_010981 3300053111 Bacteria 2180
509 Ga0500592_007074 3300053116 Bacteria 1784
510 Ga0500595_067104 3300053119 Bacteria 1071
511 Ga0500597_066245 3300053120 Bacteria 1557
512 Ga0500642_0000274 3300053130 Bacteria 19303
513 Ga0500642_0017476 3300053130 Bacteria 2750
514 Ga0500568_0001071 3300053139 Bacteria 18517
515 Ga0500568_0014314 3300053139 Bacteria 3585
516 Ga0500577_0000233 3300053142 Bacteria 14734
517 Ga0500590_084826 3300053148 Bacteria 1549
518 Ga0500616_0000034 3300053153 Bacteria 396651
519 Ga0500616_0081419 3300053153 Bacteria 1626
520 Ga0500619_013808 3300053154 Bacteria 2152
521 Ga0500620_019155 3300053155 Bacteria 2006
522 Ga0500638_048394 3300053162 Bacteria 2057
523 Ga0500636_0000042 3300053177 Bacteria 69412
524 Ga0500636_0008791 3300053177 Bacteria 5859
525 Ga0500636_0177009 3300053177 Bacteria 1148
526 Ga0500637_0000291 3300053178 Bacteria 18816
527 Ga0500637_0043214 3300053178 Bacteria 2549
528 Ga0500637_0096666 3300053178 Bacteria 1712
529 Ga0500625_016360 3300053729 Bacteria 3453
530 Ga0500645_010142 3300053730 Bacteria 3131
531 Ga0500609_006486 3300053731 Bacteria 1594
532 Ga0500596_011471 3300053735 Bacteria 1355
533 Ga0500599_001563 3300053736 Bacteria 2656
534 Ga0500601_000124 3300053737 Bacteria 15930
535 Ga0501084_0008700 3300054114 Bacteria 8395
536 Ga0501084_0126582 3300054114 Bacteria 2150
537 Ga0500661_001479 3300055283 Bacteria 4407
538 Ga0501082_0000452 3300060353 Bacteria 36318
539 Ga0501082_0002418 3300060353 Bacteria 16386
540 Ga0501082_0212005 3300060353 Bacteria 1685
541 Ga0466962_0164990 3300061719 Bacteria 1077

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025923 Ga0207681_10051162 Ga0207681_100511622 227
2 3300050496 nmdc:mga07m45_227146_c1 nmdc:mga07m45_227146_c1_17_856 227
3 3300006195 Ga0075366_10005054 Ga0075366_100050545 228
4 3300005457 Ga0070662_100210726 Ga0070662_1002107262 232
5 3300005616 Ga0068852_100272114 Ga0068852_1002721142 232
6 3300025933 Ga0207706_10066142 Ga0207706_100661422 232
7 3300031456 Ga0307513_10136805 Ga0307513_101368052 233
8 3300050494 nmdc:mga06z11_169123_c1 nmdc:mga06z11_169123_c1_156_1037 233
9 3300053096 Ga0500641_0033320 Ga0500641_0033320_613_1494 233
10 3300031240 Ga0265320_10015104 Ga0265320_100151043 234
11 3300031241 Ga0265325_10074988 Ga0265325_100749882 234
12 3300031247 Ga0265340_10029289 Ga0265340_100292893 234
13 3300031247 Ga0265340_10096972 Ga0265340_100969722 234
14 3300031250 Ga0265331_10070103 Ga0265331_100701032 234
15 3300031712 Ga0265342_10114872 Ga0265342_101148722 234
16 3300046460 Ga0495638_0005531 Ga0495638_0005531_5160_6041 234
17 3300053130 Ga0500642_0017476 Ga0500642_0017476_1747_2628 234
18 3300046499 Ga0495594_0091072 Ga0495594_0091072_329_1204 235
19 3300005365 Ga0070688_100124589 Ga0070688_1001245892 237
20 3300005330 Ga0070690_100086843 Ga0070690_1000868433 238
21 3300005333 Ga0070677_10002540 Ga0070677_100025402 238
22 3300005356 Ga0070674_100003716 Ga0070674_1000037165 238
23 3300005364 Ga0070673_100077857 Ga0070673_1000778572 238
24 3300005438 Ga0070701_10112179 Ga0070701_101121792 238
25 3300005719 Ga0068861_100465676 Ga0068861_1004656762 238
26 3300014326 Ga0157380_10074167 Ga0157380_100741673 238
27 3300025899 Ga0207642_10089510 Ga0207642_100895102 238
28 3300025907 Ga0207645_10005641 Ga0207645_100056416 238
29 3300025926 Ga0207659_10088530 Ga0207659_100885302 238
30 3300025931 Ga0207644_10131590 Ga0207644_101315902 238
31 3300025937 Ga0207669_10014442 Ga0207669_100144424 238
32 3300025940 Ga0207691_10004180 Ga0207691_100041809 238
33 3300025981 Ga0207640_10356183 Ga0207640_103561832 238
34 3300026089 Ga0207648_10021112 Ga0207648_100211124 238
35 3300026118 Ga0207675_100197110 Ga0207675_1001971102 238
36 3300047447 Ga0495685_038266 Ga0495685_038266_173_1051 238
37 3300048090 Ga0495615_0010142 Ga0495615_0010142_216_1094 238
38 3300048905 Ga0496102_0686419 Ga0496102_0686419_24_833 240
39 3300009177 Ga0105248_10120332 Ga0105248_101203323 241
40 3300005436 Ga0070713_100324435 Ga0070713_1003244352 242
41 3300025928 Ga0207700_10291384 Ga0207700_102913842 242
42 3300048903 Ga0496100_0026018 Ga0496100_0026018_86_991 243
43 3300005340 Ga0070689_100111110 Ga0070689_1001111103 244
44 3300005843 Ga0068860_100362580 Ga0068860_1003625802 244
45 3300009177 Ga0105248_10924621 Ga0105248_109246212 244
46 3300013306 Ga0163162_10510385 Ga0163162_105103852 244
47 3300013308 Ga0157375_10416713 Ga0157375_104167132 244
48 3300014969 Ga0157376_10127093 Ga0157376_101270933 244
49 3300025936 Ga0207670_10096072 Ga0207670_100960723 244
50 3300009094 Ga0111539_10328267 Ga0111539_103282671 245
51 3300049742 Ga0501080_0044807 Ga0501080_0044807_1105_1980 245
52 3300050511 nmdc:mga08y16_586538_c1 nmdc:mga08y16_586538_c1_123_1007 245
53 3300005548 Ga0070665_100191755 Ga0070665_1001917552 246
54 3300005983 Ga0081540_1017313 Ga0081540_10173131 246
55 3300005437 Ga0070710_10044958 Ga0070710_100449581 247
56 3300005548 Ga0070665_100419409 Ga0070665_1004194092 247
57 3300049571 Ga0501034_0072954 Ga0501034_0072954_2151_3062 247
58 3300049581 Ga0501047_0076360 Ga0501047_0076360_2318_3196 247
59 3300049823 Ga0501044_0194513 Ga0501044_0194513_1099_1977 247
60 3300005334 Ga0068869_100256128 Ga0068869_1002561282 248
61 3300005518 Ga0070699_100087780 Ga0070699_1000877802 248
62 3300005535 Ga0070684_100352631 Ga0070684_1003526311 248
63 3300005546 Ga0070696_100156874 Ga0070696_1001568742 248
64 3300005549 Ga0070704_100165347 Ga0070704_1001653472 248
65 3300005719 Ga0068861_100048002 Ga0068861_1000480023 248
66 3300005843 Ga0068860_100134269 Ga0068860_1001342691 248
67 3300025711 Ga0207696_1023356 Ga0207696_10233562 248
68 3300025961 Ga0207712_10129627 Ga0207712_101296272 248
69 3300025972 Ga0207668_10014275 Ga0207668_100142754 248
70 3300028380 Ga0268265_10032816 Ga0268265_100328162 248
71 3300028381 Ga0268264_10068657 Ga0268264_100686573 248
72 3300048910 Ga0496107_0081993 Ga0496107_0081993_196_1068 248
73 3300048924 Ga0496121_0003834 Ga0496121_0003834_13180_14052 248
74 3300049822 Ga0501035_0278395 Ga0501035_0278395_185_1063 248
75 iso_pu_bacteria 2824704595 2824714530 248
76 3300005435 Ga0070714_100007873 Ga0070714_1000078739 249
77 3300005436 Ga0070713_100058698 Ga0070713_1000586983 249
78 3300005437 Ga0070710_10002506 Ga0070710_100025068 249
79 3300005439 Ga0070711_100006571 Ga0070711_1000065714 249
80 3300005456 Ga0070678_100024943 Ga0070678_1000249432 249
81 3300005983 Ga0081540_1007585 Ga0081540_10075853 249
82 3300006028 Ga0070717_10018400 Ga0070717_100184005 249
83 3300025928 Ga0207700_10023334 Ga0207700_100233343 249
84 3300025929 Ga0207664_10003495 Ga0207664_100034954 249
85 3300035692 Ga0373935_0027491 Ga0373935_0027491_37_858 249
86 3300041505 Ga0451849_1036195 Ga0451849_1036195_58_927 249
87 3300046517 Ga0495630_0267649 Ga0495630_0267649_34_855 249
88 3300046537 Ga0495598_0012981 Ga0495598_0012981_808_1686 249
89 3300048929 Ga0496126_0013918 Ga0496126_0013918_871_1746 249
90 3300021384 Ga0213876_10028716 Ga0213876_100287162 250
91 3300031507 Ga0307509_10039753 Ga0307509_100397532 250
92 3300039437 Ga0436365_0919787 Ga0436365_0919787_1820_2704 250
93 3300039450 Ga0436363_0292837 Ga0436363_0292837_739_1623 250
94 3300046557 Ga0495622_0177915 Ga0495622_0177915_114_929 250
95 3300048921 Ga0496118_0011549 Ga0496118_0011549_6701_7579 250
96 3300048924 Ga0496121_0002820 Ga0496121_0002820_21700_22578 250
97 3300048927 Ga0496124_0000722 Ga0496124_0000722_2917_3795 250
98 3300048929 Ga0496126_0006670 Ga0496126_0006670_3132_4010 250
99 3300003659 JGI25404J52841_10002404 JGI25404J52841_100024042 251
100 3300003659 JGI25404J52841_10021019 JGI25404J52841_100210191 251
101 3300005435 Ga0070714_100462257 Ga0070714_1004622572 251
102 3300005983 Ga0081540_1017287 Ga0081540_10172874 251
103 3300028379 Ga0268266_10323522 Ga0268266_103235222 252
104 3300037312 Ga0395899_0021195 Ga0395899_0021195_1760_2608 253
105 3300037418 Ga0395900_0112595 Ga0395900_0112595_1629_2477 253
106 3300037466 Ga0395898_0150340 Ga0395898_0150340_1322_2170 253
107 3300038443 Ga0395901_0095483 Ga0395901_0095483_150_998 253
108 3300048928 Ga0496125_0222766 Ga0496125_0222766_312_1163 253
109 3300025914 Ga0207671_10153686 Ga0207671_101536862 254
110 3300044658 Ga0466972_0040591 Ga0466972_0040591_15_893 254
111 3300044735 Ga0466968_0012959 Ga0466968_0012959_110_988 254
112 3300049569 Ga0501032_0066523 Ga0501032_0066523_1466_2317 254
113 3300049571 Ga0501034_0010590 Ga0501034_0010590_4681_5532 254
114 3300049574 Ga0501038_0015829 Ga0501038_0015829_4605_5456 254
115 3300049581 Ga0501047_0021416 Ga0501047_0021416_4166_5062 254
116 3300049582 Ga0501048_0010185 Ga0501048_0010185_2184_3035 254
117 3300049823 Ga0501044_0015502 Ga0501044_0015502_6099_6950 254
118 3300053178 Ga0500637_0000291 Ga0500637_0000291_7977_8870 254
119 3300055283 Ga0500661_001479 Ga0500661_001479_1753_2646 254
120 3300060353 Ga0501082_0212005 Ga0501082_0212005_675_1526 254
121 3300009093 Ga0105240_10067442 Ga0105240_100674424 255
122 3300025915 Ga0207693_10007171 Ga0207693_1000717110 255
123 3300025924 Ga0207694_10010038 Ga0207694_100100384 255
124 3300025924 Ga0207694_10273228 Ga0207694_102732281 255
125 3300041451 Ga0451791_1826241 Ga0451791_1826241_35_892 255
126 3300049574 Ga0501038_0143843 Ga0501038_0143843_204_1097 255
127 3300049822 Ga0501035_0039064 Ga0501035_0039064_1247_2140 255
128 3300005434 Ga0070709_10045274 Ga0070709_100452741 256
129 3300005435 Ga0070714_100244588 Ga0070714_1002445882 256
130 3300009545 Ga0105237_10433607 Ga0105237_104336071 256
131 3300025906 Ga0207699_10065951 Ga0207699_100659513 256
132 3300025929 Ga0207664_10143487 Ga0207664_101434872 256
133 3300044694 Ga0466963_0056465 Ga0466963_0056465_803_1675 256
134 3300044842 Ga0466957_0212960 Ga0466957_0212960_111_983 256
135 3300045976 Ga0466967_0141520 Ga0466967_0141520_403_1275 256
136 3300046477 Ga0495664_0082366 Ga0495664_0082366_695_1573 256
137 3300046678 Ga0495599_0158388 Ga0495599_0158388_64_942 256
138 3300049589 Ga0501073_0096321 Ga0501073_0096321_798_1688 256
139 3300053177 Ga0500636_0177009 Ga0500636_0177009_203_1081 256
140 3300053735 Ga0500596_011471 Ga0500596_011471_184_1062 256
141 3300003215 JGI25153J46596_10007394 JGI25153J46596_100073945 257
142 3300003752 Ga0055539_1007248 Ga0055539_10072482 257
143 3300005436 Ga0070713_100011234 Ga0070713_1000112345 257
144 3300005437 Ga0070710_10020959 Ga0070710_100209593 257
145 3300005439 Ga0070711_100003409 Ga0070711_1000034093 257
146 3300006175 Ga0070712_100005474 Ga0070712_1000054746 257
147 3300006914 Ga0075436_100331425 Ga0075436_1003314252 257
148 3300025253 Ga0209677_105669 Ga0209677_1056693 257
149 3300025297 Ga0209758_1009410 Ga0209758_10094103 257
150 3300025915 Ga0207693_10005244 Ga0207693_100052447 257
151 3300039450 Ga0436363_0967671 Ga0436363_0967671_3437_4309 257
152 3300050514 nmdc:mga08x19_196032_c1 nmdc:mga08x19_196032_c1_41_916 257
153 3300053142 Ga0500577_0000233 Ga0500577_0000233_3746_4624 257
154 3300039437 Ga0436365_0338708 Ga0436365_0338708_376_1302 258
155 3300005340 Ga0070689_100474700 Ga0070689_1004747001 259
156 3300005435 Ga0070714_100009376 Ga0070714_1000093761 259
157 3300005615 Ga0070702_100255000 Ga0070702_1002550002 259
158 3300006028 Ga0070717_10018001 Ga0070717_100180016 259
159 3300006163 Ga0070715_10000111 Ga0070715_100001115 259
160 3300006175 Ga0070712_100050814 Ga0070712_1000508142 259
161 3300025295 Ga0209564_1023949 Ga0209564_10239492 259
162 3300025905 Ga0207685_10079054 Ga0207685_100790541 259
163 3300025916 Ga0207663_10001290 Ga0207663_100012902 259
164 3300025928 Ga0207700_10117025 Ga0207700_101170252 259
165 3300026075 Ga0207708_10154985 Ga0207708_101549852 259
166 3300026121 Ga0207683_10401917 Ga0207683_104019172 259
167 3300031250 Ga0265331_10165600 Ga0265331_101656001 259
168 3300053139 Ga0500568_0001071 Ga0500568_0001071_7704_8585 259
169 3300005434 Ga0070709_10002491 Ga0070709_100024913 260
170 3300005436 Ga0070713_100010069 Ga0070713_1000100696 260
171 3300005437 Ga0070710_10044248 Ga0070710_100442483 260
172 3300005439 Ga0070711_100011302 Ga0070711_1000113022 260
173 3300006173 Ga0070716_100019234 Ga0070716_1000192342 260
174 3300025928 Ga0207700_10025313 Ga0207700_100253135 260
175 3300025933 Ga0207706_10190392 Ga0207706_101903922 260
176 3300025939 Ga0207665_10000651 Ga0207665_100006514 260
177 3300028023 Ga0265357_1002291 Ga0265357_10022912 260
178 3300031911 Ga0307412_10012231 Ga0307412_100122313 260
179 3300037466 Ga0395898_0281299 Ga0395898_0281299_177_1055 260
180 3300047317 Ga0495604_0218393 Ga0495604_0218393_178_1062 260
181 3300047472 Ga0495686_0054213 Ga0495686_0054213_497_1381 260
182 3300048929 Ga0496126_0424094 Ga0496126_0424094_157_1032 260
183 3300049581 Ga0501047_0007800 Ga0501047_0007800_257_1135 260
184 3300049590 Ga0501074_0080844 Ga0501074_0080844_860_1738 260
185 3300049742 Ga0501080_0026811 Ga0501080_0026811_4141_5019 260
186 3300053077 Ga0495601_0049779 Ga0495601_0049779_1332_2213 260
187 3300053093 Ga0500651_0104295 Ga0500651_0104295_244_1128 260
188 3300053177 Ga0500636_0008791 Ga0500636_0008791_4799_5683 260
189 3300053178 Ga0500637_0096666 Ga0500637_0096666_72_956 260
190 iso_pu_bacteria 2508501128 2509151460 260
191 iso_pu_bacteria 2513237141 2513889988 260
192 3300005435 Ga0070714_100061891 Ga0070714_1000618914 261
193 3300005539 Ga0068853_100035350 Ga0068853_1000353503 261
194 3300005577 Ga0068857_100030751 Ga0068857_1000307515 261
195 3300005983 Ga0081540_1090440 Ga0081540_10904402 261
196 3300005985 Ga0081539_10000051 Ga0081539_1000005142 261
197 3300009545 Ga0105237_10105765 Ga0105237_101057653 261
198 3300009551 Ga0105238_10154078 Ga0105238_101540783 261
199 3300013105 Ga0157369_10014981 Ga0157369_100149819 261
200 3300013307 Ga0157372_10132348 Ga0157372_101323483 261
201 3300025912 Ga0207707_10303171 Ga0207707_103031712 261
202 3300025919 Ga0207657_10009208 Ga0207657_100092083 261
203 3300025920 Ga0207649_10108479 Ga0207649_101084792 261
204 3300025949 Ga0207667_10178660 Ga0207667_101786602 261
205 3300025949 Ga0207667_10414258 Ga0207667_104142582 261
206 3300026116 Ga0207674_10012072 Ga0207674_100120721 261
207 3300026142 Ga0207698_10026372 Ga0207698_100263724 261
208 3300031901 Ga0307406_10221045 Ga0307406_102210452 261
209 3300035172 Ga0373955_0003380 Ga0373955_0003380_1574_2464 261
210 3300035695 Ga0373927_0008512 Ga0373927_0008512_1002_1889 261
211 3300035724 Ga0373933_0101676 Ga0373933_0101676_187_1074 261
212 3300036401 Ga0373937_0207433 Ga0373937_0207433_393_1280 261
213 3300036401 Ga0373937_0506086 Ga0373937_0506086_77_967 261
214 3300039437 Ga0436365_0392043 Ga0436365_0392043_3652_4539 261
215 3300039453 Ga0436362_0009644 Ga0436362_0009644_2283_3170 261
216 3300046511 Ga0495608_0165537 Ga0495608_0165537_329_1219 261
217 3300046514 Ga0495618_0017068 Ga0495618_0017068_2226_3116 261
218 3300046529 Ga0495652_0121604 Ga0495652_0121604_603_1487 261
219 3300046533 Ga0495640_0016907 Ga0495640_0016907_4045_4935 261
220 3300046535 Ga0495586_0113588 Ga0495586_0113588_460_1350 261
221 3300046543 Ga0495645_0029875 Ga0495645_0029875_429_1349 261
222 3300046559 Ga0495667_0205780 Ga0495667_0205780_40_930 261
223 3300046642 Ga0495634_0150964 Ga0495634_0150964_411_1301 261
224 3300046663 Ga0495635_0017322 Ga0495635_0017322_1963_2853 261
225 3300046678 Ga0495599_0270116 Ga0495599_0270116_75_965 261
226 3300046809 Ga0495600_0081460 Ga0495600_0081460_681_1571 261
227 3300047317 Ga0495604_0013949 Ga0495604_0013949_3105_3995 261
228 3300047319 Ga0495674_0251165 Ga0495674_0251165_180_1070 261
229 3300047322 Ga0495680_0111047 Ga0495680_0111047_915_1805 261
230 3300047472 Ga0495686_0188837 Ga0495686_0188837_58_939 261
231 3300048088 Ga0495602_0150603 Ga0495602_0150603_921_1811 261
232 3300048915 Ga0496112_0037597 Ga0496112_0037597_2041_2961 261
233 3300049572 Ga0501036_0011080 Ga0501036_0011080_2004_2888 261
234 3300049574 Ga0501038_0175504 Ga0501038_0175504_168_1049 261
235 3300049580 Ga0501046_0016704 Ga0501046_0016704_4766_5650 261
236 3300049586 Ga0501070_0204606 Ga0501070_0204606_443_1324 261
237 3300049822 Ga0501035_0024371 Ga0501035_0024371_234_1118 261
238 3300049823 Ga0501044_0164966 Ga0501044_0164966_343_1224 261
239 3300053077 Ga0495601_0229142 Ga0495601_0229142_89_979 261
240 3300053078 Ga0495612_0020030 Ga0495612_0020030_1345_2265 261
241 3300053085 Ga0495619_0153507 Ga0495619_0153507_41_931 261
242 3300053153 Ga0500616_0000034 Ga0500616_0000034_321214_322083 261
243 3300005539 Ga0068853_100000785 Ga0068853_10000078516 262
244 3300005563 Ga0068855_100065946 Ga0068855_1000659462 262
245 3300005578 Ga0068854_100013500 Ga0068854_1000135003 262
246 3300005985 Ga0081539_10000148 Ga0081539_10000148105 262
247 3300006175 Ga0070712_100065294 Ga0070712_1000652942 262
248 3300009174 Ga0105241_10001021 Ga0105241_100010218 262
249 3300009545 Ga0105237_10103026 Ga0105237_101030263 262
250 3300009551 Ga0105238_10002878 Ga0105238_100028782 262
251 3300013307 Ga0157372_10254531 Ga0157372_102545312 262
252 3300025906 Ga0207699_10085874 Ga0207699_100858742 262
253 3300025911 Ga0207654_10000163 Ga0207654_1000016330 262
254 3300025913 Ga0207695_10001547 Ga0207695_1000154731 262
255 3300025916 Ga0207663_10051853 Ga0207663_100518533 262
256 3300025924 Ga0207694_10000050 Ga0207694_1000005080 262
257 3300025949 Ga0207667_10013113 Ga0207667_100131137 262
258 3300025981 Ga0207640_10015497 Ga0207640_100154972 262
259 3300026041 Ga0207639_10003890 Ga0207639_100038903 262
260 3300026078 Ga0207702_10000002 Ga0207702_10000002190 262
261 3300026116 Ga0207674_10005123 Ga0207674_1000512310 262
262 3300049568 Ga0501031_0006773 Ga0501031_0006773_2493_3377 262
263 3300049569 Ga0501032_0000216 Ga0501032_0000216_5227_6111 262
264 3300049570 Ga0501033_0000344 Ga0501033_0000344_18878_19762 262
265 3300049571 Ga0501034_0000100 Ga0501034_0000100_77433_78317 262
266 3300049572 Ga0501036_0000010 Ga0501036_0000010_7554_8438 262
267 3300049572 Ga0501036_0215789 Ga0501036_0215789_170_1093 262
268 3300049573 Ga0501037_0000704 Ga0501037_0000704_10202_11086 262
269 3300049574 Ga0501038_0000350 Ga0501038_0000350_31178_32062 262
270 3300049575 Ga0501039_0001013 Ga0501039_0001013_19452_20336 262
271 3300049578 Ga0501042_0013287 Ga0501042_0013287_2107_2991 262
272 3300049579 Ga0501043_0000106 Ga0501043_0000106_14839_15723 262
273 3300049580 Ga0501046_0017100 Ga0501046_0017100_3586_4470 262
274 3300049581 Ga0501047_0000493 Ga0501047_0000493_17595_18479 262
275 3300049582 Ga0501048_0000233 Ga0501048_0000233_16014_16898 262
276 3300049583 Ga0501067_0000098 Ga0501067_0000098_4196_5080 262
277 3300049584 Ga0501068_0000987 Ga0501068_0000987_5127_6011 262
278 3300049585 Ga0501069_0180711 Ga0501069_0180711_59_943 262
279 3300049586 Ga0501070_0001419 Ga0501070_0001419_17595_18479 262
280 3300049587 Ga0501071_0039319 Ga0501071_0039319_1735_2619 262
281 3300049588 Ga0501072_0010044 Ga0501072_0010044_1273_2157 262
282 3300049589 Ga0501073_0002056 Ga0501073_0002056_3544_4428 262
283 3300049590 Ga0501074_0000382 Ga0501074_0000382_15046_15930 262
284 3300049741 Ga0501079_0003159 Ga0501079_0003159_6404_7288 262
285 3300049742 Ga0501080_0001033 Ga0501080_0001033_7133_8017 262
286 3300049744 Ga0501083_0000116 Ga0501083_0000116_12623_13507 262
287 3300049744 Ga0501083_0123940 Ga0501083_0123940_71_943 262
288 3300049822 Ga0501035_0000496 Ga0501035_0000496_24623_25507 262
289 3300049823 Ga0501044_0000857 Ga0501044_0000857_22868_23752 262
290 3300049824 Ga0501045_0013445 Ga0501045_0013445_2068_2952 262
291 3300054114 Ga0501084_0008700 Ga0501084_0008700_7042_7926 262
292 3300060353 Ga0501082_0000452 Ga0501082_0000452_3016_3900 262
293 3300060353 Ga0501082_0002418 Ga0501082_0002418_1266_2138 262
294 iso_pu_bacteria 2721755755 2723846584 262
295 iso_pu_bacteria 2874604998 2874605623 262
296 iso_pu_bacteria 8006964411 8006969709 262
297 iso_pu_bacteria 8056681323 8056689263 262
298 3300048909 Ga0496106_0080333 Ga0496106_0080333_1561_2445 263
299 3300048918 Ga0496115_0141750 Ga0496115_0141750_714_1598 263
300 iso_pu_bacteria 2893066018 2893068714 263
301 iso_pu_bacteria 2922361189 2922365785 263
302 iso_pu_bacteria 2935630451 2935636397 263
303 iso_pu_bacteria 2941507105 2941509893 263
304 iso_pu_bacteria 2941523033 2941525292 263
305 3300005340 Ga0070689_100085305 Ga0070689_1000853052 264
306 3300005439 Ga0070711_100191231 Ga0070711_1001912311 264
307 3300005440 Ga0070705_100140565 Ga0070705_1001405652 264
308 3300005564 Ga0070664_100175522 Ga0070664_1001755222 264
309 3300005618 Ga0068864_100227566 Ga0068864_1002275662 264
310 3300006038 Ga0075365_10053340 Ga0075365_100533403 264
311 3300013296 Ga0157374_10408791 Ga0157374_104087911 264
312 3300014325 Ga0163163_10000985 Ga0163163_100009859 264
313 3300025916 Ga0207663_10016823 Ga0207663_100168234 264
314 3300025933 Ga0207706_10280426 Ga0207706_102804262 264
315 3300025936 Ga0207670_10068005 Ga0207670_100680052 264
316 3300025945 Ga0207679_10181619 Ga0207679_101816192 264
317 3300026095 Ga0207676_10089470 Ga0207676_100894702 264
318 3300048904 Ga0496101_0111504 Ga0496101_0111504_836_1786 264
319 3300048907 Ga0496104_0084125 Ga0496104_0084125_489_1439 264
320 3300048909 Ga0496106_0033428 Ga0496106_0033428_2028_2978 264
321 3300048910 Ga0496107_0103401 Ga0496107_0103401_303_1253 264
322 3300048911 Ga0496108_0214518 Ga0496108_0214518_212_1162 264
323 3300048912 Ga0496109_0043355 Ga0496109_0043355_1035_1985 264
324 3300048915 Ga0496112_0003913 Ga0496112_0003913_6477_7427 264
325 3300048916 Ga0496113_0030777 Ga0496113_0030777_967_1917 264
326 3300048918 Ga0496115_0209436 Ga0496115_0209436_580_1530 264
327 iso_pu_bacteria 2513237098 2513676615 264
328 iso_pu_bacteria 2524023210 2524470393 264
329 iso_pu_bacteria 2602042107 2603856803 264
330 iso_pu_bacteria 2643221651 2644288919 264
331 iso_pu_bacteria 2857524615 2857528281 264
332 iso_pu_bacteria 2876808645 2876814665 264
333 iso_pu_bacteria 2879110137 2879115912 264
334 iso_pu_bacteria 2885383462 2885389430 264
335 iso_pu_bacteria 2889033259 2889039367 264
336 iso_pu_bacteria 2903748898 2903751022 264
337 iso_pu_bacteria 2903768456 2903771890 264
338 iso_pu_bacteria 2906610324 2906617149 264
339 iso_pu_bacteria 2908739725 2908742297 264
340 iso_pu_bacteria 2919073203 2919075705 264
341 iso_pu_bacteria 2922386360 2922391343 264
342 iso_pu_bacteria 2922425934 2922430696 264
343 iso_pu_bacteria 8006984368 8006987848 264
344 iso_pu_bacteria 8056673599 8056676967 264
345 3300006042 Ga0075368_10022438 Ga0075368_100224383 265
346 3300006178 Ga0075367_10138198 Ga0075367_101381982 265
347 3300006353 Ga0075370_10021626 Ga0075370_100216263 265
348 3300050496 nmdc:mga07m45_128832_c1 nmdc:mga07m45_128832_c1_14_898 265
349 iso_pu_bacteria 2513237137 2513855473 265
350 iso_pu_bacteria 2728368998 2728753038 265
351 iso_pu_bacteria 2904699407 2904702120 265
352 iso_pu_bacteria 3005594810 3005599654 265
353 iso_pu_bacteria 8019555841 8019556150 265
354 3300014326 Ga0157380_10078609 Ga0157380_100786093 266
355 3300025302 Ga0207426_1000726 Ga0207426_10007266 266
356 3300049744 Ga0501083_0016520 Ga0501083_0016520_809_1711 266
357 3300049744 Ga0501083_0208937 Ga0501083_0208937_369_1259 266
358 3300054114 Ga0501084_0126582 Ga0501084_0126582_574_1476 266
359 iso_pu_bacteria 2791355197 2793068904 266
360 iso_pu_bacteria 2885374607 2885375971 266
361 iso_pu_bacteria 2906635258 2906639209 266
362 iso_pu_bacteria 2906660503 2906662409 266
363 iso_pu_bacteria 3005474847 3005480599 266
364 iso_pu_bacteria 8006994254 8007000836 266
365 iso_pu_bacteria 8019565922 8019569157 266
366 3300046660 Ga0495625_0338569 Ga0495625_0338569_73_942 267
367 iso_pu_bacteria 2507262055 2507508196 267
368 iso_pu_bacteria 2513237104 2513718359 267
369 iso_pu_bacteria 2824679649 2824679897 267
370 iso_pu_bacteria 2881364244 2881368438 267
371 iso_pu_bacteria 2885409591 2885417705 267
372 iso_pu_bacteria 2906626472 2906627134 267
373 iso_pu_bacteria 2922393267 2922394540 267
374 iso_pu_bacteria 2935959822 2935960830 267
375 iso_pu_bacteria 3005483717 3005484691 267
376 iso_pu_bacteria 3005587118 3005587663 267
377 iso_pu_bacteria 8006926726 8006930481 267
378 iso_pu_bacteria 8016583857 8016593309 267
379 3300005439 Ga0070711_100221709 Ga0070711_1002217092 268
380 3300005842 Ga0068858_100474624 Ga0068858_1004746242 268
381 3300009101 Ga0105247_10016810 Ga0105247_100168105 268
382 3300025898 Ga0207692_10006395 Ga0207692_100063953 268
383 3300025900 Ga0207710_10019462 Ga0207710_100194621 268
384 3300035695 Ga0373927_0009424 Ga0373927_0009424_1059_1937 268
385 3300037068 Ga0373925_0005876 Ga0373925_0005876_1677_2555 268
386 3300046557 Ga0495622_0007956 Ga0495622_0007956_2016_2894 268
387 3300053091 Ga0500647_0151403 Ga0500647_0151403_31_909 268
388 3300053094 Ga0500566_0098419 Ga0500566_0098419_67_945 268
389 3300053178 Ga0500637_0043214 Ga0500637_0043214_447_1325 268
390 iso_pu_bacteria 2508501009 2508542263 268
391 iso_pu_bacteria 2508501042 2508691973 268
392 iso_pu_bacteria 2511231028 2511398737 268
393 iso_pu_bacteria 2513237092 2513622324 268
394 iso_pu_bacteria 2513237094 2513640499 268
395 iso_pu_bacteria 2513237095 2513645414 268
396 iso_pu_bacteria 2513237102 2513703411 268
397 iso_pu_bacteria 2513237139 2513873167 268
398 iso_pu_bacteria 2513237161 2514016488 268
399 iso_pu_bacteria 2515154112 2515627297 268
400 iso_pu_bacteria 2517093001 2517102589 268
401 iso_pu_bacteria 2528768022 2528848736 268
402 iso_pu_bacteria 2617270735 2617346966 268
403 iso_pu_bacteria 2617270741 2617375385 268
404 iso_pu_bacteria 2791355196 2793062566 268
405 iso_pu_bacteria 2802429603 2805914843 268
406 iso_pu_bacteria 2816332527 2818239651 268
407 iso_pu_bacteria 2824600985 2824602329 268
408 iso_pu_bacteria 2824609381 2824610577 268
409 iso_pu_bacteria 2824617872 2824618139 268
410 iso_pu_bacteria 2824626560 2824626807 268
411 iso_pu_bacteria 2824635225 2824640094 268
412 iso_pu_bacteria 2824644064 2824647368 268
413 iso_pu_bacteria 2824653114 2824654297 268
414 iso_pu_bacteria 2824661429 2824661624 268
415 iso_pu_bacteria 2824671348 2824672069 268
416 iso_pu_bacteria 2824687955 2824688668 268
417 iso_pu_bacteria 2824696289 2824697094 268
418 iso_pu_bacteria 2824714736 2824717837 268
419 iso_pu_bacteria 2824723954 2824728052 268
420 iso_pu_bacteria 2824732956 2824734575 268
421 iso_pu_bacteria 2824746037 2824749867 268
422 iso_pu_bacteria 2824753945 2824754406 268
423 iso_pu_bacteria 2824763712 2824769173 268
424 iso_pu_bacteria 2824773399 2824780382 268
425 iso_pu_bacteria 2838122688 2838123318 268
426 iso_pu_bacteria 2841941048 2841946610 268
427 iso_pu_bacteria 2841949485 2841954159 268
428 iso_pu_bacteria 2841957949 2841961010 268
429 iso_pu_bacteria 2841966195 2841969533 268
430 iso_pu_bacteria 2841974524 2841974582 268
431 iso_pu_bacteria 2841983080 2841983857 268
432 iso_pu_bacteria 2842038055 2842040211 268
433 iso_pu_bacteria 2842045827 2842046844 268
434 iso_pu_bacteria 2844315083 2844319439 268
435 iso_pu_bacteria 2847930680 2847936609 268
436 iso_pu_bacteria 2847939898 2847946958 268
437 iso_pu_bacteria 2849076700 2849078932 268
438 iso_pu_bacteria 2857509624 2857515939 268
439 iso_pu_bacteria 2874590934 2874598433 268
440 iso_pu_bacteria 2874612657 2874619344 268
441 iso_pu_bacteria 2874620515 2874626435 268
442 iso_pu_bacteria 2874645413 2874652512 268
443 iso_pu_bacteria 2876771140 2876778089 268
444 iso_pu_bacteria 2876818435 2876826042 268
445 iso_pu_bacteria 2879074833 2879081883 268
446 iso_pu_bacteria 2879083081 2879088047 268
447 iso_pu_bacteria 2879099564 2879108379 268
448 iso_pu_bacteria 2879127579 2879135005 268
449 iso_pu_bacteria 2879142872 2879149690 268
450 iso_pu_bacteria 2881665667 2881672503 268
451 iso_pu_bacteria 2885366525 2885370509 268
452 iso_pu_bacteria 2888378607 2888384507 268
453 iso_pu_bacteria 2888388044 2888393403 268
454 iso_pu_bacteria 2888419890 2888424951 268
455 iso_pu_bacteria 2903727486 2903734379 268
456 iso_pu_bacteria 2904666416 2904671775 268
457 iso_pu_bacteria 2904711408 2904715129 268
458 iso_pu_bacteria 2906602504 2906609173 268
459 iso_pu_bacteria 2906643746 2906646166 268
460 iso_pu_bacteria 2908775508 2908780557 268
461 iso_pu_bacteria 2922368715 2922374925 268
462 iso_pu_bacteria 2929615660 2929621965 268
463 iso_pu_bacteria 2929624759 2929629728 268
464 iso_pu_bacteria 2932784394 2932788831 268
465 iso_pu_bacteria 2932801729 2932807189 268
466 iso_pu_bacteria 2932809354 2932812807 268
467 iso_pu_bacteria 2932818245 2932819101 268
468 iso_pu_bacteria 2932828146 2932830497 268
469 iso_pu_bacteria 2933577622 2933583760 268
470 iso_pu_bacteria 2935608549 2935609321 268
471 iso_pu_bacteria 2935616580 2935616792 268
472 iso_pu_bacteria 2935638405 2935641878 268
473 iso_pu_bacteria 2935648319 2935650889 268
474 iso_pu_bacteria 2935656913 2935659070 268
475 iso_pu_bacteria 2935665750 2935673009 268
476 iso_pu_bacteria 2935675223 2935675814 268
477 iso_pu_bacteria 2935684952 2935685803 268
478 iso_pu_bacteria 2935694250 2935697943 268
479 iso_pu_bacteria 2935703347 2935705651 268
480 iso_pu_bacteria 2935713505 2935714355 268
481 iso_pu_bacteria 2935722832 2935724974 268
482 iso_pu_bacteria 2935732158 2935732667 268
483 iso_pu_bacteria 2935741537 2935742046 268
484 iso_pu_bacteria 2935750917 2935751768 268
485 iso_pu_bacteria 2935760218 2935765032 268
486 iso_pu_bacteria 2935769743 2935771652 268
487 iso_pu_bacteria 2935777560 2935778933 268
488 iso_pu_bacteria 2935785616 2935791146 268
489 iso_pu_bacteria 2935793552 2935795525 268
490 iso_pu_bacteria 2935801545 2935802629 268
491 iso_pu_bacteria 2935810662 2935813541 268
492 iso_pu_bacteria 2935819856 2935822481 268
493 iso_pu_bacteria 2935827899 2935830045 268
494 iso_pu_bacteria 2935837841 2935837963 268
495 iso_pu_bacteria 2935847175 2935848064 268
496 iso_pu_bacteria 2935855204 2935855416 268
497 iso_pu_bacteria 2935864058 2935867340 268
498 iso_pu_bacteria 2935873716 2935875841 268
499 iso_pu_bacteria 2935883170 2935885837 268
500 iso_pu_bacteria 2935908558 2935908713 268
501 iso_pu_bacteria 2935916978 2935917859 268
502 iso_pu_bacteria 2935926038 2935926713 268
503 iso_pu_bacteria 2935934488 2935935163 268
504 iso_pu_bacteria 2935942939 2935943613 268
505 iso_pu_bacteria 2935951376 2935952051 268
506 iso_pu_bacteria 2935967501 2935968176 268
507 iso_pu_bacteria 2935975950 2935978791 268
508 iso_pu_bacteria 2935984226 2935987339 268
509 iso_pu_bacteria 2935992306 2935996505 268
510 iso_pu_bacteria 2936002035 2936003785 268
511 iso_pu_bacteria 2936011229 2936013485 268
512 iso_pu_bacteria 2936019824 2936022388 268
513 iso_pu_bacteria 2936028420 2936030834 268
514 iso_pu_bacteria 2936037263 2936042714 268
515 iso_pu_bacteria 2936046547 2936048647 268
516 iso_pu_bacteria 2936055302 2936058861 268
517 iso_pu_bacteria 2940556831 2940557429 268
518 iso_pu_bacteria 2941515067 2941520863 268
519 iso_pu_bacteria 2941531003 2941533214 268
520 iso_pu_bacteria 2941538514 2941539371 268
521 iso_pu_bacteria 3005506211 3005510698 268
522 iso_pu_bacteria 3005710791 3005715304 268
523 iso_pu_bacteria 3005718088 3005722677 268
524 iso_pu_bacteria 8016511872 8016521794 268
525 iso_pu_bacteria 8016557553 8016562871 268
526 iso_pu_bacteria 8016566248 8016572756 268
527 iso_pu_bacteria 8016575299 8016576911 268
528 iso_pu_bacteria 8016595262 8016600646 268
529 iso_pu_bacteria 8016603502 8016610090 268
530 iso_pu_bacteria 8016613128 8016614847 268
531 iso_pu_bacteria 8016622563 8016626131 268
532 iso_pu_bacteria 8016630954 8016639910 268
533 iso_pu_bacteria 8017057580 8017063857 268
534 iso_pu_bacteria 8019530166 8019534177 268
535 iso_pu_bacteria 8019538911 8019545285 268
536 iso_pu_bacteria 8019547302 8019553225 268
537 iso_pu_bacteria 8019576017 8019583208 268
538 iso_pu_bacteria 8019586578 8019591015 268
539 iso_pu_bacteria 8019608314 8019618213 268
540 iso_pu_bacteria 8019619141 8019628601 268
541 iso_pu_bacteria 8019629233 8019634036 268
542 iso_pu_bacteria 8019638758 8019645698 268
543 iso_pu_bacteria 8019648815 8019658966 268
544 iso_pu_bacteria 8019659431 8019661914 268
545 iso_pu_bacteria 8019668869 8019671437 268
546 iso_pu_bacteria 8019678201 8019684749 268
547 iso_pu_bacteria 8019687851 8019690491 268
548 iso_pu_bacteria 8055742211 8055745870 268
549 iso_pu_bacteria 8056967851 8056968428 268
550 3300005578 Ga0068854_100045877 Ga0068854_1000458771 269
551 3300005616 Ga0068852_100015463 Ga0068852_1000154636 269
552 3300009098 Ga0105245_10176704 Ga0105245_101767042 269
553 3300009174 Ga0105241_10030687 Ga0105241_100306874 269
554 3300009545 Ga0105237_10009330 Ga0105237_100093303 269
555 3300010375 Ga0105239_10086748 Ga0105239_100867483 269
556 3300021320 Ga0214544_1000002 Ga0214544_100000263 269
557 3300021321 Ga0214542_1000001 Ga0214542_1000001413 269
558 3300021324 Ga0214545_1000001 Ga0214545_1000001479 269
559 3300021327 Ga0214543_1000001 Ga0214543_1000001717 269
560 3300025913 Ga0207695_10000008 Ga0207695_10000008191 269
561 3300025914 Ga0207671_10007503 Ga0207671_100075036 269
562 3300026041 Ga0207639_10090464 Ga0207639_100904642 269
563 3300026142 Ga0207698_10058767 Ga0207698_100587673 269
564 3300028381 Ga0268264_10000065 Ga0268264_10000065151 269
565 iso_pu_bacteria 2874628541 2874632303 269
566 iso_pu_bacteria 2904690495 2904694923 269
567 iso_pu_bacteria 2908756301 2908759937 269
568 iso_pu_bacteria 8056689827 8056692202 269
569 3300038443 Ga0395901_0057232 Ga0395901_0057232_381_1262 270
570 iso_pu_bacteria 2513237096 2513657032 270
571 iso_pu_bacteria 2513237145 2513918772 270
572 iso_pu_bacteria 2517572143 2517892021 270
573 iso_pu_bacteria 2524023228 2524534096 270
574 iso_pu_bacteria 8006933436 8006940172 270
575 iso_pu_bacteria 8006973647 8006979953 270
576 3300044658 Ga0466972_0054751 Ga0466972_0054751_195_1073 271
577 3300048915 Ga0496112_0412100 Ga0496112_0412100_370_1251 271
578 iso_pu_bacteria 2667528175 2671121941 271
579 3300003215 JGI25153J46596_10000386 JGI25153J46596_1000038658 272
580 3300003215 JGI25153J46596_10028188 JGI25153J46596_100281882 272
581 3300003354 JGI25160J50197_1001640 JGI25160J50197_10016404 272
582 3300003354 JGI25160J50197_1002119 JGI25160J50197_10021192 272
583 3300005262 Ga0065165_1001250 Ga0065165_100125018 272
584 3300005338 Ga0068868_100267134 Ga0068868_1002671342 272
585 3300005355 Ga0070671_100009681 Ga0070671_1000096817 272
586 3300005367 Ga0070667_100092655 Ga0070667_1000926553 272
587 3300005455 Ga0070663_100037003 Ga0070663_1000370034 272
588 3300005455 Ga0070663_100070351 Ga0070663_1000703513 272
589 3300005457 Ga0070662_100334516 Ga0070662_1003345161 272
590 3300005548 Ga0070665_100052340 Ga0070665_1000523402 272
591 3300005614 Ga0068856_100016783 Ga0068856_1000167837 272
592 3300005616 Ga0068852_100560566 Ga0068852_1005605661 272
593 3300005841 Ga0068863_100054647 Ga0068863_1000546474 272
594 3300005842 Ga0068858_100189646 Ga0068858_1001896462 272
595 3300006038 Ga0075365_10014323 Ga0075365_100143231 272
596 3300006038 Ga0075365_10151648 Ga0075365_101516482 272
597 3300006042 Ga0075368_10001595 Ga0075368_100015955 272
598 3300006186 Ga0075369_10013149 Ga0075369_100131492 272
599 3300006353 Ga0075370_10004684 Ga0075370_100046846 272
600 3300006942 Ga0099824_1006303 Ga0099824_10063039 272
601 3300006944 Ga0099823_1047796 Ga0099823_10477962 272
602 3300009098 Ga0105245_10399676 Ga0105245_103996762 272
603 3300009101 Ga0105247_10012747 Ga0105247_100127476 272
604 3300009174 Ga0105241_10265563 Ga0105241_102655631 272
605 3300009545 Ga0105237_10597240 Ga0105237_105972401 272
606 3300010375 Ga0105239_10038560 Ga0105239_100385604 272
607 3300010375 Ga0105239_10330046 Ga0105239_103300461 272
608 3300010375 Ga0105239_10444933 Ga0105239_104449332 272
609 3300011119 Ga0105246_10009369 Ga0105246_100093692 272
610 3300013297 Ga0157378_10130231 Ga0157378_101302312 272
611 3300014325 Ga0163163_10175895 Ga0163163_101758952 272
612 3300014745 Ga0157377_10079215 Ga0157377_100792152 272
613 3300025254 Ga0209148_1000374 Ga0209148_100037421 272
614 3300025261 Ga0209233_1003530 Ga0209233_10035302 272
615 3300025272 Ga0209455_1005711 Ga0209455_10057114 272
616 3300025273 Ga0209673_1029382 Ga0209673_10293822 272
617 3300025295 Ga0209564_1036712 Ga0209564_10367122 272
618 3300025297 Ga0209758_1000024 Ga0209758_1000024116 272
619 3300025297 Ga0209758_1000068 Ga0209758_1000068160 272
620 3300025297 Ga0209758_1001579 Ga0209758_100157926 272
621 3300025297 Ga0209758_1027583 Ga0209758_10275833 272
622 3300025302 Ga0207426_1000387 Ga0207426_100038755 272
623 3300025302 Ga0207426_1004903 Ga0207426_10049032 272
624 3300025302 Ga0207426_1032624 Ga0207426_10326242 272
625 3300025302 Ga0207426_1042824 Ga0207426_10428242 272
626 3300025304 Ga0209257_1002392 Ga0209257_10023928 272
627 3300025304 Ga0209257_1015675 Ga0209257_10156752 272
628 3300025304 Ga0209257_1023354 Ga0209257_10233542 272
629 3300025900 Ga0207710_10008834 Ga0207710_100088345 272
630 3300025904 Ga0207647_10042350 Ga0207647_100423502 272
631 3300025909 Ga0207705_10018834 Ga0207705_100188344 272
632 3300025911 Ga0207654_10034022 Ga0207654_100340222 272
633 3300025914 Ga0207671_10167852 Ga0207671_101678522 272
634 3300025919 Ga0207657_10093341 Ga0207657_100933412 272
635 3300025931 Ga0207644_10014670 Ga0207644_100146703 272
636 3300025933 Ga0207706_10335628 Ga0207706_103356281 272
637 3300025935 Ga0207709_10052322 Ga0207709_100523223 272
638 3300026023 Ga0207677_10161412 Ga0207677_101614122 272
639 3300026067 Ga0207678_10040532 Ga0207678_100405324 272
640 3300026067 Ga0207678_10056441 Ga0207678_100564412 272
641 3300026116 Ga0207674_10295749 Ga0207674_102957491 272
642 3300026142 Ga0207698_10353637 Ga0207698_103536372 272
643 3300027296 Ga0209389_1000100 Ga0209389_100010014 272
644 3300027296 Ga0209389_1000107 Ga0209389_100010732 272
645 3300027357 Ga0209589_1000092 Ga0209589_100009225 272
646 3300027361 Ga0209489_100006 Ga0209489_100006482 272
647 3300027361 Ga0209489_109859 Ga0209489_1098597 272
648 3300027363 Ga0209700_100005 Ga0209700_100005347 272
649 3300027866 Ga0209813_10015348 Ga0209813_100153483 272
650 3300028379 Ga0268266_10539093 Ga0268266_105390932 272
651 3300028381 Ga0268264_10213469 Ga0268264_102134692 272
652 3300033180 Ga0307510_10016775 Ga0307510_100167755 272
653 3300037471 Ga0395905_0001582 Ga0395905_0001582_19312_20193 272
654 3300044684 Ga0466966_0000334 Ga0466966_0000334_25604_26485 272
655 3300044693 Ga0466961_0000509 Ga0466961_0000509_19132_20013 272
656 3300044694 Ga0466963_0013523 Ga0466963_0013523_177_1058 272
657 3300044765 Ga0466970_0091409 Ga0466970_0091409_708_1592 272
658 3300045049 Ga0466959_0004969 Ga0466959_0004969_1024_1905 272
659 3300045976 Ga0466967_0070092 Ga0466967_0070092_437_1318 272
660 3300046455 Ga0495603_0061957 Ga0495603_0061957_526_1407 272
661 3300046460 Ga0495638_0011004 Ga0495638_0011004_4237_5121 272
662 3300046463 Ga0495653_0046891 Ga0495653_0046891_1668_2549 272
663 3300046477 Ga0495664_0021466 Ga0495664_0021466_529_1410 272
664 3300046477 Ga0495664_0156395 Ga0495664_0156395_279_1163 272
665 3300046507 Ga0495606_0051583 Ga0495606_0051583_542_1423 272
666 3300046511 Ga0495608_0065131 Ga0495608_0065131_761_1642 272
667 3300046512 Ga0495610_0014109 Ga0495610_0014109_824_1705 272
668 3300046513 Ga0495616_0021556 Ga0495616_0021556_2106_2987 272
669 3300046516 Ga0495628_0058616 Ga0495628_0058616_1594_2475 272
670 3300046516 Ga0495628_0283408 Ga0495628_0283408_139_1023 272
671 3300046518 Ga0495631_0101189 Ga0495631_0101189_20_901 272
672 3300046519 Ga0495632_0072203 Ga0495632_0072203_224_1105 272
673 3300046522 Ga0495643_0003949 Ga0495643_0003949_5559_6440 272
674 3300046524 Ga0495648_0033393 Ga0495648_0033393_1120_2001 272
675 3300046529 Ga0495652_0108486 Ga0495652_0108486_564_1445 272
676 3300046533 Ga0495640_0021451 Ga0495640_0021451_1617_2501 272
677 3300046533 Ga0495640_0028070 Ga0495640_0028070_1380_2261 272
678 3300046536 Ga0495587_0024759 Ga0495587_0024759_1159_2040 272
679 3300046542 Ga0495597_0029621 Ga0495597_0029621_972_1853 272
680 3300046543 Ga0495645_0056202 Ga0495645_0056202_1685_2566 272
681 3300046557 Ga0495622_0053711 Ga0495622_0053711_696_1580 272
682 3300046559 Ga0495667_0028180 Ga0495667_0028180_1350_2231 272
683 3300046616 Ga0495668_0024031 Ga0495668_0024031_432_1313 272
684 3300046616 Ga0495668_0026081 Ga0495668_0026081_431_1312 272
685 3300046642 Ga0495634_0057933 Ga0495634_0057933_1008_1889 272
686 3300046663 Ga0495635_0003611 Ga0495635_0003611_7683_8567 272
687 3300046675 Ga0495657_0008209 Ga0495657_0008209_3720_4601 272
688 3300046675 Ga0495657_0010198 Ga0495657_0010198_1811_2695 272
689 3300046678 Ga0495599_0023035 Ga0495599_0023035_2838_3719 272
690 3300046679 Ga0495623_0087305 Ga0495623_0087305_81_962 272
691 3300046689 Ga0495613_0043228 Ga0495613_0043228_2151_3035 272
692 3300046694 Ga0495649_0012858 Ga0495649_0012858_723_1604 272
693 3300046694 Ga0495649_0051782 Ga0495649_0051782_1081_1962 272
694 3300046809 Ga0495600_0011185 Ga0495600_0011185_812_1693 272
695 3300046809 Ga0495600_0033736 Ga0495600_0033736_970_1854 272
696 3300047317 Ga0495604_0014071 Ga0495604_0014071_4148_5029 272
697 3300047317 Ga0495604_0238275 Ga0495604_0238275_197_1081 272
698 3300047319 Ga0495674_0019106 Ga0495674_0019106_1360_2241 272
699 3300047321 Ga0495676_0041446 Ga0495676_0041446_1753_2637 272
700 3300047322 Ga0495680_0003980 Ga0495680_0003980_12111_12992 272
701 3300047443 Ga0495687_003324 Ga0495687_003324_6320_7201 272
702 3300047444 Ga0495675_0052062 Ga0495675_0052062_204_1085 272
703 3300047673 Ga0495593_0016465 Ga0495593_0016465_1471_2355 272
704 3300048088 Ga0495602_0021808 Ga0495602_0021808_789_1670 272
705 3300048091 Ga0495626_0062377 Ga0495626_0062377_665_1546 272
706 3300048903 Ga0496100_0117158 Ga0496100_0117158_834_1718 272
707 3300048905 Ga0496102_0006786 Ga0496102_0006786_3825_4706 272
708 3300048906 Ga0496103_0005031 Ga0496103_0005031_4792_5673 272
709 3300048907 Ga0496104_0018014 Ga0496104_0018014_1754_2638 272
710 3300048907 Ga0496104_0078911 Ga0496104_0078911_663_1544 272
711 3300048907 Ga0496104_0183720 Ga0496104_0183720_569_1450 272
712 3300048908 Ga0496105_0000527 Ga0496105_0000527_545_1429 272
713 3300048908 Ga0496105_0028458 Ga0496105_0028458_1336_2217 272
714 3300048912 Ga0496109_0055424 Ga0496109_0055424_455_1336 272
715 3300048912 Ga0496109_0088540 Ga0496109_0088540_1866_2747 272
716 3300048914 Ga0496111_0232335 Ga0496111_0232335_243_1124 272
717 3300048915 Ga0496112_0013255 Ga0496112_0013255_1114_1995 272
718 3300048916 Ga0496113_0054616 Ga0496113_0054616_1856_2737 272
719 3300048917 Ga0496114_0408176 Ga0496114_0408176_22_906 272
720 3300048922 Ga0496119_0008238 Ga0496119_0008238_709_1590 272
721 3300048922 Ga0496119_0031024 Ga0496119_0031024_961_1845 272
722 3300048923 Ga0496120_0032854 Ga0496120_0032854_730_1614 272
723 3300048923 Ga0496120_0107239 Ga0496120_0107239_502_1383 272
724 3300048924 Ga0496121_0055533 Ga0496121_0055533_594_1475 272
725 3300048926 Ga0496123_0121100 Ga0496123_0121100_563_1444 272
726 3300048926 Ga0496123_0227275 Ga0496123_0227275_14_898 272
727 3300048927 Ga0496124_0170077 Ga0496124_0170077_150_1031 272
728 3300048928 Ga0496125_0064166 Ga0496125_0064166_455_1339 272
729 3300048928 Ga0496125_0107093 Ga0496125_0107093_585_1466 272
730 3300048929 Ga0496126_0050907 Ga0496126_0050907_852_1736 272
731 3300049460 Ga0495682_0003678 Ga0495682_0003678_4565_5446 272
732 3300050490 nmdc:mga03n38_77881_c1 nmdc:mga03n38_77881_c1_613_1494 272
733 3300050491 nmdc:mga00v17_47723_c1 nmdc:mga00v17_47723_c1_1178_2059 272
734 3300050492 nmdc:mga0yw44_131540_c1 nmdc:mga0yw44_131540_c1_541_1422 272
735 3300050492 nmdc:mga0yw44_284797_c1 nmdc:mga0yw44_284797_c1_47_928 272
736 3300050493 nmdc:mga0k408_113862_c1 nmdc:mga0k408_113862_c1_68_949 272
737 3300050494 nmdc:mga06z11_122033_c1 nmdc:mga06z11_122033_c1_490_1371 272
738 3300050495 nmdc:mga04h51_5957_c1 nmdc:mga04h51_5957_c1_778_1659 272
739 3300050516 nmdc:mga0sz30_30512_c1 nmdc:mga0sz30_30512_c1_234_1115 272
740 3300053083 Ga0495655_0032481 Ga0495655_0032481_87_968 272
741 3300053085 Ga0495619_0032984 Ga0495619_0032984_1860_2741 272
742 3300053085 Ga0495619_0199144 Ga0495619_0199144_484_1368 272
743 3300053086 Ga0500578_0067421 Ga0500578_0067421_839_1720 272
744 3300053087 Ga0500643_000007 Ga0500643_000007_37366_38250 272
745 3300053103 Ga0500555_011052 Ga0500555_011052_1398_2282 272
746 3300053105 Ga0500557_000300 Ga0500557_000300_4076_4957 272
747 3300053108 Ga0500562_009617 Ga0500562_009617_878_1762 272
748 3300053109 Ga0500569_012579 Ga0500569_012579_510_1397 272
749 3300053111 Ga0500572_010981 Ga0500572_010981_1183_2070 272
750 3300053116 Ga0500592_007074 Ga0500592_007074_335_1219 272
751 3300053119 Ga0500595_067104 Ga0500595_067104_96_980 272
752 3300053120 Ga0500597_066245 Ga0500597_066245_285_1166 272
753 3300053130 Ga0500642_0000274 Ga0500642_0000274_3105_3986 272
754 3300053139 Ga0500568_0014314 Ga0500568_0014314_1361_2245 272
755 3300053148 Ga0500590_084826 Ga0500590_084826_181_1065 272
756 3300053153 Ga0500616_0081419 Ga0500616_0081419_332_1216 272
757 3300053154 Ga0500619_013808 Ga0500619_013808_1050_1940 272
758 3300053155 Ga0500620_019155 Ga0500620_019155_74_964 272
759 3300053162 Ga0500638_048394 Ga0500638_048394_559_1443 272
760 3300053177 Ga0500636_0000042 Ga0500636_0000042_2192_3079 272
761 3300053729 Ga0500625_016360 Ga0500625_016360_1664_2545 272
762 3300053730 Ga0500645_010142 Ga0500645_010142_29_913 272
763 3300053731 Ga0500609_006486 Ga0500609_006486_317_1204 272
764 3300053736 Ga0500599_001563 Ga0500599_001563_66_947 272
765 3300053737 Ga0500601_000124 Ga0500601_000124_6307_7191 272
766 3300061719 Ga0466962_0164990 Ga0466962_0164990_51_932 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08009

CDP-OH_P_tran_2

CDP-alcohol phosphatidyltransferase 2

209

245

0.99

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

25

192

0.82

Feature Viewer

pLDDT pTM Quality
59.01 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map