F479834
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 766 | 313 | 766 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100103063|Ga0068857_1001030633 |
| Length | 187 |
| Sequence | MFAPMPRVGWPLTSPERGGGEAFAPPPRLPYSRAVITTVPSDFRAVLPEGGRLIGLDVGTKTIGTALCDAGWSFASPAQLIRRTKFTKDKAALVELITAQQVRGMVIGLPLNLDGTDSPRTQSTRAFARNLEDLGLPILMWDERWSTVAVERTLIEQDASRAKRAELIDKMAAAYILQGAIDGLVNT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 70 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 164 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 165 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 188 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 189 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 190 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 191 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 192 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 193 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 194 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 195 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 196 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 197 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 198 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 199 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 200 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 201 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 202 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 203 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 208 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 209 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 210 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 260 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 261 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 262 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 263 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 264 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 265 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 266 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 267 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 274 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 276 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 279 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 280 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 281 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 282 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 283 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 284 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 285 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 286 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 287 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 292 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 293 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 295 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 296 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 298 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 299 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 300 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 301 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 304 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 306 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 309 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 310 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 312 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 313 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.1 |
| Nodule | 0.26 |
| Rhizoplane | 2.74 |
| Rhizosphere | 81.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c004772 | 3300000041 | Bacteria | 1170 |
| 2 | JGI24740J21852_10043438 | 3300001979 | Bacteria | 1340 |
| 3 | JGI24739J22299_10045976 | 3300001989 | Bacteria | 1431 |
| 4 | JGI25150J39212_1000371 | 3300002774 | Bacteria | 21646 |
| 5 | JGI25151J46595_10040622 | 3300003187 | Bacteria | 1701 |
| 6 | JGI25153J46596_10000072 | 3300003215 | Bacteria | 115187 |
| 7 | JGI25153J46596_10000113 | 3300003215 | Bacteria | 92345 |
| 8 | JGI25153J46596_10011776 | 3300003215 | Bacteria | 3838 |
| 9 | JGI25153J46596_10033304 | 3300003215 | Bacteria | 1703 |
| 10 | Ga0055525_1000090 | 3300003759 | Bacteria | 141071 |
| 11 | Ga0055542_1000568 | 3300003762 | Bacteria | 32512 |
| 12 | Ga0055529_1000007 | 3300003763 | Bacteria | 403604 |
| 13 | Ga0055529_1000109 | 3300003763 | Bacteria | 121019 |
| 14 | Ga0055526_1014390 | 3300003771 | Bacteria | 3259 |
| 15 | Ga0055537_1001776 | 3300003773 | Bacteria | 7894 |
| 16 | Ga0055537_1007102 | 3300003773 | Bacteria | 2747 |
| 17 | Ga0055524_1000030 | 3300003775 | Bacteria | 187756 |
| 18 | Ga0055536_1015225 | 3300003781 | Bacteria | 2646 |
| 19 | Ga0055534_1025003 | 3300003784 | Bacteria | 963 |
| 20 | Ga0055530_10002769 | 3300003791 | Bacteria | 10828 |
| 21 | Ga0055530_10007045 | 3300003791 | Bacteria | 4834 |
| 22 | Ga0055530_10037092 | 3300003791 | Bacteria | 1222 |
| 23 | Ga0055540_1001950 | 3300003792 | Bacteria | 11536 |
| 24 | Ga0055531_10011244 | 3300003794 | Bacteria | 4344 |
| 25 | Ga0055531_10016815 | 3300003794 | Bacteria | 3130 |
| 26 | Ga0055543_1038990 | 3300004625 | Bacteria | 807 |
| 27 | Ga0065165_1003301 | 3300005262 | Bacteria | 11598 |
| 28 | Ga0065165_1016642 | 3300005262 | Bacteria | 2744 |
| 29 | Ga0065165_1058829 | 3300005262 | Bacteria | 1060 |
| 30 | Ga0065712_10133692 | 3300005290 | Bacteria | 1520 |
| 31 | Ga0065712_10177419 | 3300005290 | Bacteria | 1210 |
| 32 | Ga0065715_10123474 | 3300005293 | Bacteria | 2177 |
| 33 | Ga0065715_10264084 | 3300005293 | Bacteria | 1129 |
| 34 | Ga0070658_10131111 | 3300005327 | Bacteria | 2089 |
| 35 | Ga0070658_10629296 | 3300005327 | Bacteria | 931 |
| 36 | Ga0070658_10963645 | 3300005327 | Bacteria | 742 |
| 37 | Ga0070676_10046635 | 3300005328 | Bacteria | 2528 |
| 38 | Ga0070676_10148724 | 3300005328 | Bacteria | 1497 |
| 39 | Ga0070676_10611688 | 3300005328 | Bacteria | 787 |
| 40 | Ga0070683_100311548 | 3300005329 | Bacteria | 1498 |
| 41 | Ga0070670_100005458 | 3300005331 | Bacteria | 10724 |
| 42 | Ga0070670_100025761 | 3300005331 | Bacteria | 5061 |
| 43 | Ga0070670_100030479 | 3300005331 | Bacteria | 4645 |
| 44 | Ga0070670_100080462 | 3300005331 | Bacteria | 2800 |
| 45 | Ga0070677_10015159 | 3300005333 | Bacteria | 2727 |
| 46 | Ga0070677_10287692 | 3300005333 | Bacteria | 830 |
| 47 | Ga0070666_10016649 | 3300005335 | Bacteria | 4704 |
| 48 | Ga0070680_100001375 | 3300005336 | Bacteria | 17594 |
| 49 | Ga0070682_100548140 | 3300005337 | Bacteria | 904 |
| 50 | Ga0068868_100049426 | 3300005338 | Bacteria | 3300 |
| 51 | Ga0070660_100000678 | 3300005339 | Bacteria | 22503 |
| 52 | Ga0070660_100010750 | 3300005339 | Bacteria | 6479 |
| 53 | Ga0070660_100090166 | 3300005339 | Bacteria | 2417 |
| 54 | Ga0070661_100036375 | 3300005344 | Bacteria | 3579 |
| 55 | Ga0070661_100103170 | 3300005344 | Bacteria | 2124 |
| 56 | Ga0070661_100132023 | 3300005344 | Bacteria | 1877 |
| 57 | Ga0070661_100953781 | 3300005344 | Bacteria | 710 |
| 58 | Ga0070668_100000866 | 3300005347 | Bacteria | 21035 |
| 59 | Ga0070669_100069166 | 3300005353 | Bacteria | 2607 |
| 60 | Ga0070669_100416180 | 3300005353 | Bacteria | 1102 |
| 61 | Ga0070675_100001861 | 3300005354 | Bacteria | 15546 |
| 62 | Ga0070675_100046035 | 3300005354 | Bacteria | 3572 |
| 63 | Ga0070675_100066444 | 3300005354 | Bacteria | 2983 |
| 64 | Ga0070675_100418332 | 3300005354 | Bacteria | 1198 |
| 65 | Ga0070671_100000229 | 3300005355 | Bacteria | 37462 |
| 66 | Ga0070671_100014846 | 3300005355 | Bacteria | 6292 |
| 67 | Ga0070671_100025732 | 3300005355 | Bacteria | 4831 |
| 68 | Ga0070671_100124793 | 3300005355 | Bacteria | 2167 |
| 69 | Ga0070671_100735937 | 3300005355 | Bacteria | 857 |
| 70 | Ga0070674_100009305 | 3300005356 | Bacteria | 5881 |
| 71 | Ga0070674_100022158 | 3300005356 | Bacteria | 4093 |
| 72 | Ga0070674_100046526 | 3300005356 | Bacteria | 2969 |
| 73 | Ga0070674_100935744 | 3300005356 | Bacteria | 757 |
| 74 | Ga0070673_100172161 | 3300005364 | Bacteria | 1849 |
| 75 | Ga0070673_100606681 | 3300005364 | Bacteria | 999 |
| 76 | Ga0070673_101307105 | 3300005364 | Bacteria | 681 |
| 77 | Ga0070688_101169469 | 3300005365 | Bacteria | 617 |
| 78 | Ga0070659_100052960 | 3300005366 | Bacteria | 3194 |
| 79 | Ga0070659_100508026 | 3300005366 | Bacteria | 1028 |
| 80 | Ga0070659_100812838 | 3300005366 | Bacteria | 813 |
| 81 | Ga0070714_101030431 | 3300005435 | Bacteria | 801 |
| 82 | Ga0070663_100000936 | 3300005455 | Bacteria | 15858 |
| 83 | Ga0070663_100327625 | 3300005455 | Bacteria | 1233 |
| 84 | Ga0070678_100008085 | 3300005456 | Bacteria | 6278 |
| 85 | Ga0070678_100409718 | 3300005456 | Bacteria | 1179 |
| 86 | Ga0070678_101180233 | 3300005456 | Bacteria | 709 |
| 87 | Ga0070662_100158225 | 3300005457 | Bacteria | 1770 |
| 88 | Ga0070662_100370326 | 3300005457 | Bacteria | 1177 |
| 89 | Ga0070662_100392701 | 3300005457 | Bacteria | 1144 |
| 90 | Ga0070662_100678100 | 3300005457 | Bacteria | 871 |
| 91 | Ga0070681_11336455 | 3300005458 | Bacteria | 640 |
| 92 | Ga0070685_10417461 | 3300005466 | Bacteria | 933 |
| 93 | Ga0070679_100001182 | 3300005530 | Bacteria | 22889 |
| 94 | Ga0068853_101021074 | 3300005539 | Bacteria | 796 |
| 95 | Ga0070672_100243695 | 3300005543 | Bacteria | 1512 |
| 96 | Ga0070672_100407577 | 3300005543 | Bacteria | 1166 |
| 97 | Ga0070696_100322340 | 3300005546 | Bacteria | 1189 |
| 98 | Ga0070665_100000044 | 3300005548 | Bacteria | 276702 |
| 99 | Ga0070665_100289401 | 3300005548 | Bacteria | 1641 |
| 100 | Ga0070665_101394001 | 3300005548 | Bacteria | 710 |
| 101 | Ga0070664_100001633 | 3300005564 | Bacteria | 17950 |
| 102 | Ga0070664_100005797 | 3300005564 | Bacteria | 9967 |
| 103 | Ga0070664_100338280 | 3300005564 | Bacteria | 1367 |
| 104 | Ga0070664_100565018 | 3300005564 | Bacteria | 1053 |
| 105 | Ga0070664_101690712 | 3300005564 | Bacteria | 600 |
| 106 | Ga0068857_100103063 | 3300005577 | Bacteria | 2562 |
| 107 | Ga0068854_100016865 | 3300005578 | Bacteria | 4877 |
| 108 | Ga0068854_100159394 | 3300005578 | Bacteria | 1746 |
| 109 | Ga0068854_100177479 | 3300005578 | Bacteria | 1662 |
| 110 | Ga0068854_100300186 | 3300005578 | Bacteria | 1299 |
| 111 | Ga0068854_100517717 | 3300005578 | Bacteria | 1007 |
| 112 | Ga0068852_100093419 | 3300005616 | Bacteria | 2696 |
| 113 | Ga0068864_100017494 | 3300005618 | Bacteria | 5976 |
| 114 | Ga0068864_100086873 | 3300005618 | Bacteria | 2752 |
| 115 | Ga0068864_100327470 | 3300005618 | Bacteria | 1440 |
| 116 | Ga0068864_100409558 | 3300005618 | Bacteria | 1290 |
| 117 | Ga0068861_100000342 | 3300005719 | Bacteria | 26513 |
| 118 | Ga0068870_10290170 | 3300005840 | Bacteria | 1029 |
| 119 | Ga0068863_100000030 | 3300005841 | Bacteria | 176023 |
| 120 | Ga0068863_100026944 | 3300005841 | Bacteria | 5481 |
| 121 | Ga0068858_100018879 | 3300005842 | Bacteria | 6451 |
| 122 | Ga0068860_100013256 | 3300005843 | Bacteria | 8089 |
| 123 | Ga0068860_100231329 | 3300005843 | Bacteria | 1796 |
| 124 | Ga0068862_100000193 | 3300005844 | Bacteria | 67697 |
| 125 | Ga0068862_101299057 | 3300005844 | Bacteria | 729 |
| 126 | Ga0068862_101602987 | 3300005844 | Bacteria | 658 |
| 127 | Ga0081539_10026991 | 3300005985 | Bacteria | 3646 |
| 128 | Ga0081539_10084838 | 3300005985 | Bacteria | 1654 |
| 129 | Ga0097621_100438278 | 3300006237 | Bacteria | 1175 |
| 130 | Ga0097621_100550463 | 3300006237 | Bacteria | 1050 |
| 131 | Ga0075370_10246309 | 3300006353 | Bacteria | 1059 |
| 132 | Ga0068871_100240981 | 3300006358 | Bacteria | 1572 |
| 133 | Ga0068871_100290180 | 3300006358 | Bacteria | 1433 |
| 134 | Ga0068871_100494788 | 3300006358 | Bacteria | 1101 |
| 135 | Ga0075434_101151816 | 3300006871 | Bacteria | 788 |
| 136 | Ga0097620_100007008 | 3300006931 | Bacteria | 11447 |
| 137 | Ga0097620_100253232 | 3300006931 | Bacteria | 1851 |
| 138 | Ga0079104_1037292 | 3300006946 | Bacteria | 1159 |
| 139 | Ga0105251_10375239 | 3300009011 | Bacteria | 651 |
| 140 | Ga0105240_10194992 | 3300009093 | Bacteria | 2379 |
| 141 | Ga0105240_10266083 | 3300009093 | Bacteria | 1976 |
| 142 | Ga0111539_10752068 | 3300009094 | Bacteria | 1134 |
| 143 | Ga0111539_12006472 | 3300009094 | Bacteria | 671 |
| 144 | Ga0105247_10038604 | 3300009101 | Bacteria | 2916 |
| 145 | Ga0105243_10000224 | 3300009148 | Bacteria | 65196 |
| 146 | Ga0105241_10095554 | 3300009174 | Bacteria | 2353 |
| 147 | Ga0105242_10069746 | 3300009176 | Bacteria | 2912 |
| 148 | Ga0105248_10000774 | 3300009177 | Bacteria | 35872 |
| 149 | Ga0105248_10033959 | 3300009177 | Bacteria | 5701 |
| 150 | Ga0105248_10132262 | 3300009177 | Bacteria | 2815 |
| 151 | Ga0105248_10280058 | 3300009177 | Bacteria | 1877 |
| 152 | Ga0105237_10077367 | 3300009545 | Bacteria | 3317 |
| 153 | Ga0105237_10310267 | 3300009545 | Bacteria | 1581 |
| 154 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 155 | Ga0105249_10222561 | 3300009553 | Bacteria | 1858 |
| 156 | Ga0105249_11499678 | 3300009553 | Bacteria | 747 |
| 157 | Ga0105239_12020966 | 3300010375 | Bacteria | 669 |
| 158 | Ga0105239_12389164 | 3300010375 | Bacteria | 616 |
| 159 | Ga0105246_10384876 | 3300011119 | Bacteria | 1160 |
| 160 | Ga0157326_1002610 | 3300012513 | Bacteria | 1919 |
| 161 | Ga0157373_10206341 | 3300013100 | Bacteria | 1385 |
| 162 | Ga0157371_10103514 | 3300013102 | Bacteria | 2020 |
| 163 | Ga0157371_10513931 | 3300013102 | Bacteria | 885 |
| 164 | Ga0157371_10956656 | 3300013102 | Bacteria | 652 |
| 165 | Ga0157370_10033595 | 3300013104 | Bacteria | 5001 |
| 166 | Ga0157370_10074287 | 3300013104 | Bacteria | 3207 |
| 167 | Ga0157370_10492452 | 3300013104 | Bacteria | 1126 |
| 168 | Ga0157369_10050386 | 3300013105 | Bacteria | 4510 |
| 169 | Ga0157369_10253056 | 3300013105 | Bacteria | 1838 |
| 170 | Ga0157369_10421097 | 3300013105 | Bacteria | 1384 |
| 171 | Ga0157369_10498766 | 3300013105 | Bacteria | 1260 |
| 172 | Ga0157374_10008990 | 3300013296 | Bacteria | 8566 |
| 173 | Ga0157374_11001573 | 3300013296 | Bacteria | 855 |
| 174 | Ga0157374_11275575 | 3300013296 | Bacteria | 756 |
| 175 | Ga0163162_11071317 | 3300013306 | Bacteria | 913 |
| 176 | Ga0157372_10277840 | 3300013307 | Bacteria | 1947 |
| 177 | Ga0157372_10478430 | 3300013307 | Bacteria | 1452 |
| 178 | Ga0157372_11187251 | 3300013307 | Bacteria | 882 |
| 179 | Ga0157375_10028876 | 3300013308 | Bacteria | 5207 |
| 180 | Ga0157375_10529705 | 3300013308 | Bacteria | 1341 |
| 181 | Ga0157375_11977275 | 3300013308 | Unclassified | 693 |
| 182 | Ga0163163_10603432 | 3300014325 | Bacteria | 1161 |
| 183 | Ga0163163_10941617 | 3300014325 | Bacteria | 927 |
| 184 | Ga0157380_10128261 | 3300014326 | Bacteria | 2160 |
| 185 | Ga0157380_10374411 | 3300014326 | Bacteria | 1341 |
| 186 | Ga0157380_10951680 | 3300014326 | Bacteria | 889 |
| 187 | Ga0157376_10813324 | 3300014969 | Bacteria | 948 |
| 188 | Ga0206354_11575931 | 3300020081 | Bacteria | 536 |
| 189 | Ga0213873_10000015 | 3300021358 | Bacteria | 131343 |
| 190 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 191 | Ga0213875_10002419 | 3300021388 | Bacteria | 11208 |
| 192 | Ga0209674_112607 | 3300025226 | Bacteria | 818 |
| 193 | Ga0209563_100111 | 3300025230 | Bacteria | 141123 |
| 194 | Ga0207425_1000020 | 3300025245 | Bacteria | 372623 |
| 195 | Ga0207425_1016432 | 3300025245 | Bacteria | 1641 |
| 196 | Ga0209677_110816 | 3300025253 | Bacteria | 1483 |
| 197 | Ga0209148_1000026 | 3300025254 | Bacteria | 629213 |
| 198 | Ga0209129_1002331 | 3300025258 | Bacteria | 9399 |
| 199 | Ga0209565_1000012 | 3300025263 | Bacteria | 606500 |
| 200 | Ga0209565_1000299 | 3300025263 | Bacteria | 47081 |
| 201 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 202 | Ga0209673_1013425 | 3300025273 | Bacteria | 3233 |
| 203 | Ga0209675_1000126 | 3300025291 | Bacteria | 104792 |
| 204 | Ga0209676_1087714 | 3300025292 | Bacteria | 691 |
| 205 | Ga0209025_1000827 | 3300025294 | Bacteria | 49278 |
| 206 | Ga0209025_1006865 | 3300025294 | Bacteria | 8685 |
| 207 | Ga0209564_1002442 | 3300025295 | Bacteria | 14695 |
| 208 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 209 | Ga0209758_1000035 | 3300025297 | Bacteria | 448190 |
| 210 | Ga0209758_1009351 | 3300025297 | Bacteria | 6110 |
| 211 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 212 | Ga0209050_1000014 | 3300025298 | Bacteria | 774327 |
| 213 | Ga0209050_1002854 | 3300025298 | Bacteria | 13698 |
| 214 | Ga0209050_1005539 | 3300025298 | Bacteria | 7887 |
| 215 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 216 | Ga0209051_1000503 | 3300025303 | Bacteria | 49548 |
| 217 | Ga0209257_1000019 | 3300025304 | Bacteria | 774261 |
| 218 | Ga0209257_1005815 | 3300025304 | Bacteria | 8371 |
| 219 | Ga0209257_1023381 | 3300025304 | Bacteria | 2174 |
| 220 | Ga0207682_10015894 | 3300025893 | Bacteria | 2933 |
| 221 | Ga0207682_10185404 | 3300025893 | Bacteria | 952 |
| 222 | Ga0207710_10024739 | 3300025900 | Bacteria | 2588 |
| 223 | Ga0207688_10083694 | 3300025901 | Bacteria | 1825 |
| 224 | Ga0207680_10156457 | 3300025903 | Bacteria | 1524 |
| 225 | Ga0207647_10064331 | 3300025904 | Bacteria | 2229 |
| 226 | Ga0207647_10068236 | 3300025904 | Bacteria | 2153 |
| 227 | Ga0207645_10014446 | 3300025907 | Bacteria | 5283 |
| 228 | Ga0207645_10042259 | 3300025907 | Bacteria | 2916 |
| 229 | Ga0207645_10195466 | 3300025907 | Bacteria | 1330 |
| 230 | Ga0207643_10276558 | 3300025908 | Bacteria | 1040 |
| 231 | Ga0207705_10000205 | 3300025909 | Bacteria | 59773 |
| 232 | Ga0207705_10043699 | 3300025909 | Bacteria | 3219 |
| 233 | Ga0207705_10069560 | 3300025909 | Bacteria | 2550 |
| 234 | Ga0207695_10012103 | 3300025913 | Bacteria | 10370 |
| 235 | Ga0207695_11019262 | 3300025913 | Bacteria | 707 |
| 236 | Ga0207671_10008911 | 3300025914 | Bacteria | 8449 |
| 237 | Ga0207660_10001386 | 3300025917 | Bacteria | 16272 |
| 238 | Ga0207657_10003566 | 3300025919 | Bacteria | 16604 |
| 239 | Ga0207657_10007665 | 3300025919 | Bacteria | 11043 |
| 240 | Ga0207657_10132392 | 3300025919 | Bacteria | 2043 |
| 241 | Ga0207649_10011199 | 3300025920 | Bacteria | 4940 |
| 242 | Ga0207649_10031511 | 3300025920 | Bacteria | 3152 |
| 243 | Ga0207652_10000270 | 3300025921 | Bacteria | 54010 |
| 244 | Ga0207681_10047525 | 3300025923 | Bacteria | 2892 |
| 245 | Ga0207681_10653447 | 3300025923 | Bacteria | 872 |
| 246 | Ga0207650_10011005 | 3300025925 | Bacteria | 6220 |
| 247 | Ga0207650_10021945 | 3300025925 | Bacteria | 4517 |
| 248 | Ga0207650_10028780 | 3300025925 | Bacteria | 3988 |
| 249 | Ga0207650_10081699 | 3300025925 | Bacteria | 2452 |
| 250 | Ga0207650_10123722 | 3300025925 | Bacteria | 2017 |
| 251 | Ga0207650_10806601 | 3300025925 | Bacteria | 796 |
| 252 | Ga0207659_10014204 | 3300025926 | Bacteria | 5127 |
| 253 | Ga0207659_10056813 | 3300025926 | Bacteria | 2804 |
| 254 | Ga0207659_10570309 | 3300025926 | Bacteria | 963 |
| 255 | Ga0207659_11105081 | 3300025926 | Bacteria | 682 |
| 256 | Ga0207644_10000186 | 3300025931 | Bacteria | 44897 |
| 257 | Ga0207644_10006360 | 3300025931 | Bacteria | 7690 |
| 258 | Ga0207644_10091495 | 3300025931 | Bacteria | 2268 |
| 259 | Ga0207644_10129904 | 3300025931 | Bacteria | 1927 |
| 260 | Ga0207644_10428206 | 3300025931 | Bacteria | 1085 |
| 261 | Ga0207690_10062134 | 3300025932 | Bacteria | 2542 |
| 262 | Ga0207706_10055988 | 3300025933 | Bacteria | 3477 |
| 263 | Ga0207706_10084914 | 3300025933 | Bacteria | 2783 |
| 264 | Ga0207706_10178902 | 3300025933 | Bacteria | 1863 |
| 265 | Ga0207706_10188242 | 3300025933 | Bacteria | 1812 |
| 266 | Ga0207706_10192419 | 3300025933 | Bacteria | 1790 |
| 267 | Ga0207706_10375318 | 3300025933 | Bacteria | 1234 |
| 268 | Ga0207706_10390329 | 3300025933 | Bacteria | 1207 |
| 269 | Ga0207709_10000519 | 3300025935 | Bacteria | 33581 |
| 270 | Ga0207669_10000688 | 3300025937 | Bacteria | 14596 |
| 271 | Ga0207669_10001398 | 3300025937 | Bacteria | 10259 |
| 272 | Ga0207691_10092329 | 3300025940 | Bacteria | 2711 |
| 273 | Ga0207691_10178308 | 3300025940 | Bacteria | 1857 |
| 274 | Ga0207691_10568172 | 3300025940 | Bacteria | 961 |
| 275 | Ga0207711_10003926 | 3300025941 | Bacteria | 12797 |
| 276 | Ga0207661_10231324 | 3300025944 | Bacteria | 1637 |
| 277 | Ga0207679_10004650 | 3300025945 | Bacteria | 8546 |
| 278 | Ga0207679_10014032 | 3300025945 | Bacteria | 5256 |
| 279 | Ga0207679_10061085 | 3300025945 | Bacteria | 2804 |
| 280 | Ga0207667_10000010 | 3300025949 | Bacteria | 477432 |
| 281 | Ga0207667_10019200 | 3300025949 | Bacteria | 7644 |
| 282 | Ga0207667_10483655 | 3300025949 | Bacteria | 1257 |
| 283 | Ga0207651_10474834 | 3300025960 | Bacteria | 1077 |
| 284 | Ga0207651_10728239 | 3300025960 | Bacteria | 875 |
| 285 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 286 | Ga0207712_10158317 | 3300025961 | Bacteria | 1757 |
| 287 | Ga0207712_10182787 | 3300025961 | Bacteria | 1648 |
| 288 | Ga0207712_10369324 | 3300025961 | Bacteria | 1197 |
| 289 | Ga0207668_10000095 | 3300025972 | Bacteria | 63349 |
| 290 | Ga0207668_10436003 | 3300025972 | Bacteria | 1115 |
| 291 | Ga0207640_10001098 | 3300025981 | Bacteria | 14946 |
| 292 | Ga0207640_10061049 | 3300025981 | Bacteria | 2495 |
| 293 | Ga0207640_10256164 | 3300025981 | Bacteria | 1361 |
| 294 | Ga0207640_10788341 | 3300025981 | Bacteria | 822 |
| 295 | Ga0207658_10330576 | 3300025986 | Bacteria | 1322 |
| 296 | Ga0207703_10015580 | 3300026035 | Bacteria | 5930 |
| 297 | Ga0207639_10002650 | 3300026041 | Bacteria | 12018 |
| 298 | Ga0207639_10009331 | 3300026041 | Bacteria | 6766 |
| 299 | Ga0207639_11258253 | 3300026041 | Bacteria | 694 |
| 300 | Ga0207639_11473724 | 3300026041 | Bacteria | 639 |
| 301 | Ga0207678_10000766 | 3300026067 | Bacteria | 29323 |
| 302 | Ga0207678_10573659 | 3300026067 | Bacteria | 988 |
| 303 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 304 | Ga0207641_10005020 | 3300026088 | Bacteria | 11346 |
| 305 | Ga0207648_10401092 | 3300026089 | Bacteria | 1243 |
| 306 | Ga0207648_11110912 | 3300026089 | Bacteria | 742 |
| 307 | Ga0207676_10000266 | 3300026095 | Bacteria | 45449 |
| 308 | Ga0207676_10105278 | 3300026095 | Bacteria | 2348 |
| 309 | Ga0207676_10335637 | 3300026095 | Bacteria | 1393 |
| 310 | Ga0207676_10433715 | 3300026095 | Bacteria | 1235 |
| 311 | Ga0207674_11020626 | 3300026116 | Bacteria | 796 |
| 312 | Ga0207675_100000078 | 3300026118 | Bacteria | 75565 |
| 313 | Ga0207675_102091961 | 3300026118 | Bacteria | 583 |
| 314 | Ga0207683_10003319 | 3300026121 | Bacteria | 14028 |
| 315 | Ga0207683_10027360 | 3300026121 | Bacteria | 4927 |
| 316 | Ga0207698_10069323 | 3300026142 | Bacteria | 2788 |
| 317 | Ga0209281_1046605 | 3300027111 | Bacteria | 706 |
| 318 | Ga0209974_10002951 | 3300027876 | Bacteria | 6172 |
| 319 | Ga0209974_10005220 | 3300027876 | Bacteria | 4584 |
| 320 | Ga0209974_10171709 | 3300027876 | Bacteria | 791 |
| 321 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 322 | Ga0268266_10015825 | 3300028379 | Bacteria | 6459 |
| 323 | Ga0268266_10870879 | 3300028379 | Bacteria | 871 |
| 324 | Ga0268266_11224015 | 3300028379 | Bacteria | 726 |
| 325 | Ga0268265_10000048 | 3300028380 | Bacteria | 178523 |
| 326 | Ga0268265_10370022 | 3300028380 | Bacteria | 1315 |
| 327 | Ga0268265_11449638 | 3300028380 | Bacteria | 689 |
| 328 | Ga0268264_10041875 | 3300028381 | Bacteria | 3789 |
| 329 | Ga0268264_10227795 | 3300028381 | Bacteria | 1719 |
| 330 | Ga0307517_10029306 | 3300028786 | Bacteria | 6506 |
| 331 | Ga0307515_10335128 | 3300028794 | Bacteria | 1169 |
| 332 | Ga0307513_10021678 | 3300031456 | Bacteria | 7578 |
| 333 | Ga0307513_10026366 | 3300031456 | Bacteria | 6702 |
| 334 | Ga0307513_10099124 | 3300031456 | Bacteria | 2943 |
| 335 | Ga0307408_100037669 | 3300031548 | Bacteria | 3407 |
| 336 | Ga0307408_100069478 | 3300031548 | Bacteria | 2597 |
| 337 | Ga0307408_100091914 | 3300031548 | Bacteria | 2293 |
| 338 | Ga0307408_100109958 | 3300031548 | Bacteria | 2115 |
| 339 | Ga0307408_100179112 | 3300031548 | Bacteria | 1698 |
| 340 | Ga0307408_100285135 | 3300031548 | Bacteria | 1377 |
| 341 | Ga0307408_100510591 | 3300031548 | Bacteria | 1054 |
| 342 | Ga0307408_100593032 | 3300031548 | Bacteria | 983 |
| 343 | Ga0307408_100630286 | 3300031548 | Bacteria | 956 |
| 344 | Ga0307408_101108284 | 3300031548 | Bacteria | 734 |
| 345 | Ga0307408_101482990 | 3300031548 | Bacteria | 641 |
| 346 | Ga0307408_101772917 | 3300031548 | Bacteria | 589 |
| 347 | Ga0307405_10043911 | 3300031731 | Bacteria | 2730 |
| 348 | Ga0307405_10046362 | 3300031731 | Bacteria | 2670 |
| 349 | Ga0307405_10067136 | 3300031731 | Bacteria | 2290 |
| 350 | Ga0307405_10080688 | 3300031731 | Bacteria | 2124 |
| 351 | Ga0307405_10188254 | 3300031731 | Bacteria | 1488 |
| 352 | Ga0307405_10207289 | 3300031731 | Bacteria | 1428 |
| 353 | Ga0307405_10271451 | 3300031731 | Bacteria | 1272 |
| 354 | Ga0307405_10294315 | 3300031731 | Bacteria | 1228 |
| 355 | Ga0307405_10626227 | 3300031731 | Bacteria | 881 |
| 356 | Ga0307405_10759491 | 3300031731 | Bacteria | 808 |
| 357 | Ga0307405_10760781 | 3300031731 | Bacteria | 808 |
| 358 | Ga0307405_11038382 | 3300031731 | Bacteria | 701 |
| 359 | Ga0307405_11228325 | 3300031731 | Bacteria | 649 |
| 360 | Ga0307405_11515044 | 3300031731 | Bacteria | 589 |
| 361 | Ga0307413_10006703 | 3300031824 | Bacteria | 5285 |
| 362 | Ga0307413_10011908 | 3300031824 | Bacteria | 4302 |
| 363 | Ga0307413_10016281 | 3300031824 | Bacteria | 3836 |
| 364 | Ga0307413_10082788 | 3300031824 | Bacteria | 2062 |
| 365 | Ga0307413_10133190 | 3300031824 | Bacteria | 1704 |
| 366 | Ga0307413_10158822 | 3300031824 | Bacteria | 1585 |
| 367 | Ga0307413_10203583 | 3300031824 | Bacteria | 1431 |
| 368 | Ga0307413_10252451 | 3300031824 | Bacteria | 1309 |
| 369 | Ga0307413_10276044 | 3300031824 | Bacteria | 1261 |
| 370 | Ga0307413_10289949 | 3300031824 | Bacteria | 1235 |
| 371 | Ga0307413_10594900 | 3300031824 | Bacteria | 904 |
| 372 | Ga0307413_10602259 | 3300031824 | Bacteria | 899 |
| 373 | Ga0307413_10646140 | 3300031824 | Bacteria | 872 |
| 374 | Ga0307413_10771391 | 3300031824 | Bacteria | 805 |
| 375 | Ga0307413_11374476 | 3300031824 | Bacteria | 620 |
| 376 | Ga0307413_11559294 | 3300031824 | Bacteria | 585 |
| 377 | Ga0307410_10008260 | 3300031852 | Bacteria | 5762 |
| 378 | Ga0307410_10008363 | 3300031852 | Bacteria | 5733 |
| 379 | Ga0307410_10012900 | 3300031852 | Bacteria | 4853 |
| 380 | Ga0307410_10031725 | 3300031852 | Bacteria | 3394 |
| 381 | Ga0307410_10036234 | 3300031852 | Bacteria | 3210 |
| 382 | Ga0307410_10066858 | 3300031852 | Bacteria | 2478 |
| 383 | Ga0307410_10176499 | 3300031852 | Bacteria | 1614 |
| 384 | Ga0307410_10193727 | 3300031852 | Bacteria | 1547 |
| 385 | Ga0307410_10199811 | 3300031852 | Bacteria | 1525 |
| 386 | Ga0307410_10240114 | 3300031852 | Bacteria | 1403 |
| 387 | Ga0307410_10308023 | 3300031852 | Bacteria | 1252 |
| 388 | Ga0307410_10408558 | 3300031852 | Bacteria | 1098 |
| 389 | Ga0307410_10409007 | 3300031852 | Bacteria | 1098 |
| 390 | Ga0307410_10784723 | 3300031852 | Bacteria | 809 |
| 391 | Ga0307406_10016377 | 3300031901 | Bacteria | 4307 |
| 392 | Ga0307406_10027889 | 3300031901 | Bacteria | 3407 |
| 393 | Ga0307406_10048797 | 3300031901 | Bacteria | 2676 |
| 394 | Ga0307406_10074194 | 3300031901 | Bacteria | 2239 |
| 395 | Ga0307406_10090205 | 3300031901 | Bacteria | 2062 |
| 396 | Ga0307406_10120770 | 3300031901 | Bacteria | 1821 |
| 397 | Ga0307406_10128355 | 3300031901 | Bacteria | 1775 |
| 398 | Ga0307406_10135367 | 3300031901 | Bacteria | 1736 |
| 399 | Ga0307406_11094516 | 3300031901 | Bacteria | 688 |
| 400 | Ga0307406_11378515 | 3300031901 | Bacteria | 617 |
| 401 | Ga0307407_10008202 | 3300031903 | Bacteria | 4779 |
| 402 | Ga0307407_10073983 | 3300031903 | Bacteria | 2037 |
| 403 | Ga0307407_10096050 | 3300031903 | Bacteria | 1828 |
| 404 | Ga0307407_10295409 | 3300031903 | Bacteria | 1127 |
| 405 | Ga0307407_10801828 | 3300031903 | Bacteria | 716 |
| 406 | Ga0307407_10855436 | 3300031903 | Bacteria | 695 |
| 407 | Ga0307407_11074987 | 3300031903 | Bacteria | 624 |
| 408 | Ga0307412_10001209 | 3300031911 | Bacteria | 14667 |
| 409 | Ga0307412_10007860 | 3300031911 | Bacteria | 6073 |
| 410 | Ga0307412_10010257 | 3300031911 | Bacteria | 5393 |
| 411 | Ga0307412_10015383 | 3300031911 | Bacteria | 4536 |
| 412 | Ga0307412_10026639 | 3300031911 | Bacteria | 3596 |
| 413 | Ga0307412_10032354 | 3300031911 | Bacteria | 3313 |
| 414 | Ga0307412_10065901 | 3300031911 | Bacteria | 2453 |
| 415 | Ga0307412_10113538 | 3300031911 | Bacteria | 1938 |
| 416 | Ga0307412_10207187 | 3300031911 | Bacteria | 1493 |
| 417 | Ga0307412_10307418 | 3300031911 | Bacteria | 1256 |
| 418 | Ga0307412_10325664 | 3300031911 | Bacteria | 1224 |
| 419 | Ga0307412_10434442 | 3300031911 | Bacteria | 1077 |
| 420 | Ga0307412_10687872 | 3300031911 | Bacteria | 876 |
| 421 | Ga0307412_10730928 | 3300031911 | Bacteria | 853 |
| 422 | Ga0307412_10892354 | 3300031911 | Bacteria | 778 |
| 423 | Ga0307412_11088650 | 3300031911 | Bacteria | 710 |
| 424 | Ga0307409_100003074 | 3300031995 | Bacteria | 8931 |
| 425 | Ga0307409_100003140 | 3300031995 | Bacteria | 8876 |
| 426 | Ga0307409_100033832 | 3300031995 | Bacteria | 3725 |
| 427 | Ga0307409_100034227 | 3300031995 | Bacteria | 3707 |
| 428 | Ga0307409_100053927 | 3300031995 | Bacteria | 3093 |
| 429 | Ga0307409_100062391 | 3300031995 | Bacteria | 2917 |
| 430 | Ga0307409_100084640 | 3300031995 | Bacteria | 2575 |
| 431 | Ga0307409_100085365 | 3300031995 | Bacteria | 2566 |
| 432 | Ga0307409_100242822 | 3300031995 | Bacteria | 1641 |
| 433 | Ga0307409_100245229 | 3300031995 | Bacteria | 1634 |
| 434 | Ga0307409_100254134 | 3300031995 | Bacteria | 1608 |
| 435 | Ga0307409_100288135 | 3300031995 | Bacteria | 1521 |
| 436 | Ga0307409_100290302 | 3300031995 | Bacteria | 1516 |
| 437 | Ga0307409_100318826 | 3300031995 | Bacteria | 1454 |
| 438 | Ga0307409_100856127 | 3300031995 | Bacteria | 920 |
| 439 | Ga0307409_100869573 | 3300031995 | Bacteria | 913 |
| 440 | Ga0307409_101144123 | 3300031995 | Bacteria | 800 |
| 441 | Ga0307409_101500954 | 3300031995 | Bacteria | 701 |
| 442 | Ga0307409_102062297 | 3300031995 | Bacteria | 600 |
| 443 | Ga0307416_100023508 | 3300032002 | Bacteria | 4474 |
| 444 | Ga0307416_100038353 | 3300032002 | Bacteria | 3696 |
| 445 | Ga0307416_100045203 | 3300032002 | Bacteria | 3466 |
| 446 | Ga0307416_100050168 | 3300032002 | Bacteria | 3325 |
| 447 | Ga0307416_100102973 | 3300032002 | Bacteria | 2491 |
| 448 | Ga0307416_100198942 | 3300032002 | Bacteria | 1899 |
| 449 | Ga0307416_100219543 | 3300032002 | Bacteria | 1821 |
| 450 | Ga0307416_100270708 | 3300032002 | Bacteria | 1667 |
| 451 | Ga0307416_100311353 | 3300032002 | Bacteria | 1571 |
| 452 | Ga0307416_100350612 | 3300032002 | Bacteria | 1493 |
| 453 | Ga0307416_100853736 | 3300032002 | Bacteria | 1008 |
| 454 | Ga0307416_100867352 | 3300032002 | Bacteria | 1001 |
| 455 | Ga0307416_101354408 | 3300032002 | Bacteria | 817 |
| 456 | Ga0307416_101985382 | 3300032002 | Bacteria | 684 |
| 457 | Ga0307416_102370443 | 3300032002 | Bacteria | 630 |
| 458 | Ga0307414_10012107 | 3300032004 | Bacteria | 5090 |
| 459 | Ga0307414_10026751 | 3300032004 | Bacteria | 3717 |
| 460 | Ga0307414_10035547 | 3300032004 | Bacteria | 3316 |
| 461 | Ga0307414_10107358 | 3300032004 | Bacteria | 2115 |
| 462 | Ga0307414_10130273 | 3300032004 | Bacteria | 1951 |
| 463 | Ga0307414_10153299 | 3300032004 | Bacteria | 1821 |
| 464 | Ga0307414_10218778 | 3300032004 | Bacteria | 1562 |
| 465 | Ga0307414_10403095 | 3300032004 | Bacteria | 1188 |
| 466 | Ga0307414_10413963 | 3300032004 | Bacteria | 1174 |
| 467 | Ga0307414_10453188 | 3300032004 | Bacteria | 1125 |
| 468 | Ga0307414_10462305 | 3300032004 | Bacteria | 1115 |
| 469 | Ga0307414_10485717 | 3300032004 | Bacteria | 1090 |
| 470 | Ga0307414_10503155 | 3300032004 | Bacteria | 1072 |
| 471 | Ga0307414_10544697 | 3300032004 | Bacteria | 1033 |
| 472 | Ga0307414_10723269 | 3300032004 | Bacteria | 903 |
| 473 | Ga0307414_11054593 | 3300032004 | Bacteria | 749 |
| 474 | Ga0307414_11109844 | 3300032004 | Bacteria | 730 |
| 475 | Ga0307411_10009509 | 3300032005 | Bacteria | 5116 |
| 476 | Ga0307411_10011602 | 3300032005 | Bacteria | 4766 |
| 477 | Ga0307411_10013960 | 3300032005 | Bacteria | 4454 |
| 478 | Ga0307411_10014385 | 3300032005 | Bacteria | 4400 |
| 479 | Ga0307411_10014534 | 3300032005 | Bacteria | 4384 |
| 480 | Ga0307411_10040110 | 3300032005 | Bacteria | 2967 |
| 481 | Ga0307411_10046371 | 3300032005 | Bacteria | 2801 |
| 482 | Ga0307411_10051238 | 3300032005 | Bacteria | 2692 |
| 483 | Ga0307411_10066346 | 3300032005 | Bacteria | 2424 |
| 484 | Ga0307411_10099859 | 3300032005 | Bacteria | 2050 |
| 485 | Ga0307411_10224941 | 3300032005 | Bacteria | 1458 |
| 486 | Ga0307411_10230035 | 3300032005 | Bacteria | 1444 |
| 487 | Ga0307411_10290366 | 3300032005 | Bacteria | 1306 |
| 488 | Ga0307411_10322739 | 3300032005 | Bacteria | 1247 |
| 489 | Ga0307411_10378027 | 3300032005 | Bacteria | 1164 |
| 490 | Ga0307411_10426121 | 3300032005 | Bacteria | 1103 |
| 491 | Ga0307411_10523850 | 3300032005 | Bacteria | 1006 |
| 492 | Ga0307411_10842497 | 3300032005 | Bacteria | 810 |
| 493 | Ga0307415_100000243 | 3300032126 | Bacteria | 23624 |
| 494 | Ga0307415_100006668 | 3300032126 | Bacteria | 6249 |
| 495 | Ga0307415_100017560 | 3300032126 | Bacteria | 4294 |
| 496 | Ga0307415_100018107 | 3300032126 | Bacteria | 4243 |
| 497 | Ga0307415_100043560 | 3300032126 | Bacteria | 2995 |
| 498 | Ga0307415_100092487 | 3300032126 | Bacteria | 2193 |
| 499 | Ga0307415_100099982 | 3300032126 | Bacteria | 2124 |
| 500 | Ga0307415_100160827 | 3300032126 | Bacteria | 1740 |
| 501 | Ga0307415_100417371 | 3300032126 | Bacteria | 1150 |
| 502 | Ga0307415_100437885 | 3300032126 | Bacteria | 1126 |
| 503 | Ga0307415_100483162 | 3300032126 | Bacteria | 1079 |
| 504 | Ga0307415_100580063 | 3300032126 | Bacteria | 994 |
| 505 | Ga0307415_101243109 | 3300032126 | Bacteria | 703 |
| 506 | Ga0307510_10016431 | 3300033180 | Bacteria | 8735 |
| 507 | Ga0373931_0500898 | 3300035691 | Bacteria | 783 |
| 508 | Ga0395899_0004293 | 3300037312 | Bacteria | 11136 |
| 509 | Ga0395899_0079364 | 3300037312 | Bacteria | 2390 |
| 510 | Ga0395899_0180671 | 3300037312 | Bacteria | 1481 |
| 511 | Ga0395899_0576921 | 3300037312 | Bacteria | 719 |
| 512 | Ga0395899_0763848 | 3300037312 | Bacteria | 600 |
| 513 | Ga0395900_0000572 | 3300037418 | Bacteria | 50991 |
| 514 | Ga0395900_0006142 | 3300037418 | Bacteria | 12535 |
| 515 | Ga0395900_0006337 | 3300037418 | Bacteria | 12335 |
| 516 | Ga0395900_0029277 | 3300037418 | Bacteria | 5650 |
| 517 | Ga0395900_0057885 | 3300037418 | Bacteria | 3990 |
| 518 | Ga0395900_0191604 | 3300037418 | Bacteria | 2073 |
| 519 | Ga0395900_0232001 | 3300037418 | Bacteria | 1855 |
| 520 | Ga0395900_0257820 | 3300037418 | Bacteria | 1742 |
| 521 | Ga0395900_0406941 | 3300037418 | Bacteria | 1323 |
| 522 | Ga0395900_0465352 | 3300037418 | Bacteria | 1218 |
| 523 | Ga0395900_0489616 | 3300037418 | Bacteria | 1181 |
| 524 | Ga0395900_0560852 | 3300037418 | Bacteria | 1086 |
| 525 | Ga0395900_0717705 | 3300037418 | Bacteria | 932 |
| 526 | Ga0395900_1305674 | 3300037418 | Bacteria | 639 |
| 527 | Ga0395900_1769977 | 3300037418 | Bacteria | 528 |
| 528 | Ga0395898_0019268 | 3300037466 | Bacteria | 6946 |
| 529 | Ga0395898_0109262 | 3300037466 | Bacteria | 2651 |
| 530 | Ga0395898_0422397 | 3300037466 | Bacteria | 1270 |
| 531 | Ga0395898_0467827 | 3300037466 | Bacteria | 1200 |
| 532 | Ga0395898_0499082 | 3300037466 | Bacteria | 1157 |
| 533 | Ga0395898_0500766 | 3300037466 | Bacteria | 1155 |
| 534 | Ga0395898_0504124 | 3300037466 | Bacteria | 1151 |
| 535 | Ga0395898_0642573 | 3300037466 | Bacteria | 1003 |
| 536 | Ga0395898_0708193 | 3300037466 | Bacteria | 949 |
| 537 | Ga0395905_0000165 | 3300037471 | Bacteria | 109385 |
| 538 | Ga0395905_0005698 | 3300037471 | Bacteria | 12656 |
| 539 | Ga0395905_0012133 | 3300037471 | Bacteria | 8301 |
| 540 | Ga0395905_0013769 | 3300037471 | Bacteria | 7743 |
| 541 | Ga0395905_0069248 | 3300037471 | Bacteria | 3304 |
| 542 | Ga0395905_0135050 | 3300037471 | Bacteria | 2320 |
| 543 | Ga0395905_0146241 | 3300037471 | Bacteria | 2223 |
| 544 | Ga0395905_0165458 | 3300037471 | Bacteria | 2078 |
| 545 | Ga0395905_0184714 | 3300037471 | Bacteria | 1957 |
| 546 | Ga0395905_0226247 | 3300037471 | Bacteria | 1750 |
| 547 | Ga0395905_0278199 | 3300037471 | Bacteria | 1559 |
| 548 | Ga0395905_0280731 | 3300037471 | Bacteria | 1551 |
| 549 | Ga0395905_0332185 | 3300037471 | Bacteria | 1411 |
| 550 | Ga0395905_0728424 | 3300037471 | Bacteria | 894 |
| 551 | Ga0395905_0787930 | 3300037471 | Bacteria | 853 |
| 552 | Ga0395905_1022457 | 3300037471 | Bacteria | 729 |
| 553 | Ga0395905_1027200 | 3300037471 | Bacteria | 727 |
| 554 | Ga0436364_0383514 | 3300037853 | Bacteria | 1537 |
| 555 | Ga0436364_1265496 | 3300037853 | Bacteria | 15678 |
| 556 | Ga0395901_0006471 | 3300038443 | Bacteria | 11862 |
| 557 | Ga0395901_0008086 | 3300038443 | Bacteria | 10624 |
| 558 | Ga0395901_0012772 | 3300038443 | Bacteria | 8518 |
| 559 | Ga0395901_0106729 | 3300038443 | Bacteria | 2939 |
| 560 | Ga0395901_0197126 | 3300038443 | Bacteria | 2111 |
| 561 | Ga0395901_0332159 | 3300038443 | Bacteria | 1571 |
| 562 | Ga0395901_0447489 | 3300038443 | Bacteria | 1321 |
| 563 | Ga0395901_1397569 | 3300038443 | Bacteria | 658 |
| 564 | Ga0436365_0011005 | 3300039437 | Bacteria | 74317 |
| 565 | Ga0436362_0287059 | 3300039453 | Bacteria | 76995 |
| 566 | Ga0439436_0014215 | 3300041404 | Bacteria | 2405 |
| 567 | Ga0439439_0025555 | 3300041406 | Bacteria | 1487 |
| 568 | Ga0439447_161997 | 3300041407 | Bacteria | 515 |
| 569 | Ga0439461_0002751 | 3300041410 | Bacteria | 2841 |
| 570 | Ga0439465_0000503 | 3300041413 | Bacteria | 11668 |
| 571 | Ga0439465_0038445 | 3300041413 | Bacteria | 1541 |
| 572 | Ga0451849_1365278 | 3300041505 | Bacteria | 609 |
| 573 | Ga0439431_0000032 | 3300041997 | Bacteria | 21299 |
| 574 | Ga0439442_024784 | 3300042002 | Bacteria | 1248 |
| 575 | Ga0439443_084187 | 3300042003 | Bacteria | 594 |
| 576 | Ga0439432_015344 | 3300042006 | Bacteria | 2586 |
| 577 | Ga0439452_016997 | 3300042010 | Bacteria | 1966 |
| 578 | Ga0439462_0005391 | 3300042015 | Bacteria | 3153 |
| 579 | Ga0439462_0114153 | 3300042015 | Bacteria | 749 |
| 580 | Ga0450898_007035 | 3300042134 | Bacteria | 1745 |
| 581 | Ga0450909_019070 | 3300042185 | Bacteria | 1020 |
| 582 | Ga0439434_0000321 | 3300042435 | Bacteria | 13637 |
| 583 | Ga0439434_0033481 | 3300042435 | Bacteria | 1566 |
| 584 | Ga0439434_0058771 | 3300042435 | Bacteria | 1200 |
| 585 | Ga0439460_0224251 | 3300042461 | Bacteria | 645 |
| 586 | Ga0466966_0012606 | 3300044684 | Bacteria | 5603 |
| 587 | Ga0466961_0202435 | 3300044693 | Bacteria | 1227 |
| 588 | Ga0466963_0170187 | 3300044694 | Bacteria | 1518 |
| 589 | Ga0466963_0775724 | 3300044694 | Bacteria | 676 |
| 590 | Ga0453684_0342525 | 3300044712 | Bacteria | 1688 |
| 591 | Ga0466971_0032538 | 3300044719 | Bacteria | 2337 |
| 592 | Ga0466970_0023018 | 3300044765 | Bacteria | 3251 |
| 593 | Ga0466970_0124999 | 3300044765 | Bacteria | 1410 |
| 594 | Ga0466970_0272416 | 3300044765 | Bacteria | 951 |
| 595 | Ga0466960_0041784 | 3300044901 | Bacteria | 2174 |
| 596 | Ga0466960_0954308 | 3300044901 | Bacteria | 525 |
| 597 | Ga0466959_0079138 | 3300045049 | Bacteria | 2370 |
| 598 | Ga0466967_0097276 | 3300045976 | Bacteria | 2686 |
| 599 | Ga0466967_0905879 | 3300045976 | Bacteria | 877 |
| 600 | Ga0466967_1044786 | 3300045976 | Bacteria | 814 |
| 601 | Ga0466967_1471167 | 3300045976 | Bacteria | 678 |
| 602 | Ga0495617_047668 | 3300046452 | Bacteria | 1426 |
| 603 | Ga0495629_0037829 | 3300046459 | Bacteria | 3401 |
| 604 | Ga0495638_0278506 | 3300046460 | Bacteria | 910 |
| 605 | Ga0495650_0000058 | 3300046471 | Bacteria | 302308 |
| 606 | Ga0495584_0321877 | 3300046491 | Bacteria | 785 |
| 607 | Ga0495585_0026323 | 3300046492 | Bacteria | 3322 |
| 608 | Ga0495607_0368119 | 3300046501 | Bacteria | 660 |
| 609 | Ga0495583_0002149 | 3300046506 | Bacteria | 17603 |
| 610 | Ga0495583_0008668 | 3300046506 | Bacteria | 6187 |
| 611 | Ga0495583_0011100 | 3300046506 | Bacteria | 5191 |
| 612 | Ga0495606_0000359 | 3300046507 | Bacteria | 77863 |
| 613 | Ga0495616_0027215 | 3300046513 | Bacteria | 3036 |
| 614 | Ga0495631_0049559 | 3300046518 | Bacteria | 1838 |
| 615 | Ga0495631_0062294 | 3300046518 | Bacteria | 1616 |
| 616 | Ga0495632_0000060 | 3300046519 | Bacteria | 120480 |
| 617 | Ga0495637_0024194 | 3300046520 | Bacteria | 2749 |
| 618 | Ga0495637_0027122 | 3300046520 | Bacteria | 2565 |
| 619 | Ga0495643_0000014 | 3300046522 | Bacteria | 314632 |
| 620 | Ga0495643_0003466 | 3300046522 | Bacteria | 11521 |
| 621 | Ga0495643_0003475 | 3300046522 | Bacteria | 11503 |
| 622 | Ga0495643_0236222 | 3300046522 | Bacteria | 859 |
| 623 | Ga0495648_0192194 | 3300046524 | Bacteria | 1029 |
| 624 | Ga0495663_0000007 | 3300046525 | Bacteria | 262438 |
| 625 | Ga0495663_0003896 | 3300046525 | Bacteria | 4251 |
| 626 | Ga0495663_0067994 | 3300046525 | Bacteria | 1130 |
| 627 | Ga0495642_0029122 | 3300046528 | Bacteria | 2203 |
| 628 | Ga0495587_0116803 | 3300046536 | Bacteria | 1530 |
| 629 | Ga0495609_0105027 | 3300046538 | Bacteria | 1222 |
| 630 | Ga0495622_0033204 | 3300046557 | Bacteria | 2409 |
| 631 | Ga0495633_0000722 | 3300046558 | Bacteria | 30009 |
| 632 | Ga0495633_0001967 | 3300046558 | Bacteria | 14886 |
| 633 | Ga0495633_0033208 | 3300046558 | Bacteria | 2489 |
| 634 | Ga0495633_0085980 | 3300046558 | Bacteria | 1462 |
| 635 | Ga0495633_0397004 | 3300046558 | Bacteria | 624 |
| 636 | Ga0495668_0000163 | 3300046616 | Bacteria | 99607 |
| 637 | Ga0495668_0032485 | 3300046616 | Bacteria | 2937 |
| 638 | Ga0495611_0037145 | 3300046648 | Bacteria | 2164 |
| 639 | Ga0495611_0322776 | 3300046648 | Bacteria | 710 |
| 640 | Ga0495625_0000568 | 3300046660 | Bacteria | 54059 |
| 641 | Ga0495625_0027964 | 3300046660 | Bacteria | 4234 |
| 642 | Ga0495625_0088136 | 3300046660 | Bacteria | 2150 |
| 643 | Ga0495661_0321545 | 3300046665 | Bacteria | 769 |
| 644 | Ga0495661_0400507 | 3300046665 | Bacteria | 667 |
| 645 | Ga0495669_0000096 | 3300046684 | Bacteria | 56184 |
| 646 | Ga0495669_0069883 | 3300046684 | Bacteria | 1599 |
| 647 | Ga0495670_0000002 | 3300046691 | Bacteria | 601814 |
| 648 | Ga0495670_0035919 | 3300046691 | Bacteria | 2469 |
| 649 | Ga0495670_0100073 | 3300046691 | Bacteria | 1492 |
| 650 | Ga0495670_0167230 | 3300046691 | Bacteria | 1157 |
| 651 | Ga0495671_0000032 | 3300046692 | Bacteria | 201185 |
| 652 | Ga0495671_0424699 | 3300046692 | Bacteria | 636 |
| 653 | Ga0495649_0197103 | 3300046694 | Bacteria | 1047 |
| 654 | Ga0495649_0204435 | 3300046694 | Bacteria | 1025 |
| 655 | Ga0495600_0001482 | 3300046809 | Bacteria | 13007 |
| 656 | Ga0495683_0003243 | 3300047323 | Bacteria | 9507 |
| 657 | Ga0495683_0050546 | 3300047323 | Bacteria | 2080 |
| 658 | Ga0495683_0282799 | 3300047323 | Bacteria | 717 |
| 659 | Ga0495687_000378 | 3300047443 | Bacteria | 55453 |
| 660 | Ga0495687_000511 | 3300047443 | Bacteria | 46733 |
| 661 | Ga0495677_0002165 | 3300047445 | Bacteria | 7777 |
| 662 | Ga0495677_0009953 | 3300047445 | Bacteria | 3499 |
| 663 | Ga0495681_0012956 | 3300047470 | Bacteria | 4871 |
| 664 | Ga0495681_0015295 | 3300047470 | Bacteria | 4348 |
| 665 | Ga0495681_0124120 | 3300047470 | Bacteria | 1105 |
| 666 | Ga0495681_0180537 | 3300047470 | Bacteria | 867 |
| 667 | Ga0495686_0000191 | 3300047472 | Bacteria | 114738 |
| 668 | Ga0495686_0006710 | 3300047472 | Bacteria | 8753 |
| 669 | Ga0495686_0098637 | 3300047472 | Bacteria | 1765 |
| 670 | Ga0495686_0162793 | 3300047472 | Bacteria | 1302 |
| 671 | Ga0495686_0341753 | 3300047472 | Bacteria | 816 |
| 672 | Ga0496100_0110081 | 3300048903 | Bacteria | 1912 |
| 673 | Ga0496101_0021750 | 3300048904 | Bacteria | 4409 |
| 674 | Ga0496102_0000069 | 3300048905 | Bacteria | 156067 |
| 675 | Ga0496102_0000281 | 3300048905 | Bacteria | 64939 |
| 676 | Ga0496102_0505399 | 3300048905 | Bacteria | 1131 |
| 677 | Ga0496102_1256428 | 3300048905 | Bacteria | 660 |
| 678 | Ga0496103_0000173 | 3300048906 | Bacteria | 67412 |
| 679 | Ga0496103_0001375 | 3300048906 | Bacteria | 16413 |
| 680 | Ga0496104_0025056 | 3300048907 | Bacteria | 5496 |
| 681 | Ga0496104_0279269 | 3300048907 | Bacteria | 1583 |
| 682 | Ga0496107_0014793 | 3300048910 | Bacteria | 5461 |
| 683 | Ga0496107_0389245 | 3300048910 | Bacteria | 1037 |
| 684 | Ga0496109_0292790 | 3300048912 | Bacteria | 1535 |
| 685 | Ga0496111_0064758 | 3300048914 | Bacteria | 2652 |
| 686 | Ga0496111_0912975 | 3300048914 | Bacteria | 632 |
| 687 | Ga0496112_0009308 | 3300048915 | Bacteria | 8836 |
| 688 | Ga0496112_0009432 | 3300048915 | Bacteria | 8797 |
| 689 | Ga0496112_0236132 | 3300048915 | Bacteria | 1782 |
| 690 | Ga0496114_0014216 | 3300048917 | Bacteria | 6385 |
| 691 | Ga0496115_0000134 | 3300048918 | Bacteria | 67910 |
| 692 | Ga0496115_0001169 | 3300048918 | Bacteria | 18809 |
| 693 | Ga0496116_0000566 | 3300048919 | Bacteria | 49509 |
| 694 | Ga0496116_0006626 | 3300048919 | Bacteria | 10465 |
| 695 | Ga0496117_0000485 | 3300048920 | Bacteria | 65840 |
| 696 | Ga0496117_0002942 | 3300048920 | Bacteria | 20612 |
| 697 | Ga0496118_0000190 | 3300048921 | Bacteria | 108017 |
| 698 | Ga0496118_0000392 | 3300048921 | Bacteria | 74074 |
| 699 | Ga0496119_0090314 | 3300048922 | Bacteria | 1742 |
| 700 | Ga0496119_0092952 | 3300048922 | Bacteria | 1710 |
| 701 | Ga0496119_0166594 | 3300048922 | Bacteria | 1167 |
| 702 | Ga0496120_0007020 | 3300048923 | Bacteria | 8464 |
| 703 | Ga0496121_0000105 | 3300048924 | Bacteria | 191437 |
| 704 | Ga0496121_0000655 | 3300048924 | Bacteria | 64922 |
| 705 | Ga0496122_0048047 | 3300048925 | Bacteria | 3287 |
| 706 | Ga0496123_0004252 | 3300048926 | Bacteria | 15248 |
| 707 | Ga0496123_0060789 | 3300048926 | Bacteria | 2433 |
| 708 | Ga0496124_0000068 | 3300048927 | Bacteria | 221819 |
| 709 | Ga0496124_0000175 | 3300048927 | Bacteria | 128785 |
| 710 | Ga0496124_0000546 | 3300048927 | Bacteria | 63624 |
| 711 | Ga0496124_0001803 | 3300048927 | Bacteria | 29745 |
| 712 | Ga0496124_0050277 | 3300048927 | Bacteria | 3553 |
| 713 | Ga0496125_0056664 | 3300048928 | Bacteria | 3181 |
| 714 | Ga0496126_0000634 | 3300048929 | Bacteria | 65566 |
| 715 | Ga0501033_0262624 | 3300049570 | Bacteria | 1222 |
| 716 | Ga0501034_0707041 | 3300049571 | Bacteria | 906 |
| 717 | Ga0501047_0311038 | 3300049581 | Bacteria | 1416 |
| 718 | Ga0501202_163988 | 3300049652 | Bacteria | 590 |
| 719 | Ga0501233_101302 | 3300049668 | Bacteria | 762 |
| 720 | Ga0501242_020888 | 3300049674 | Bacteria | 843 |
| 721 | Ga0501225_0076567 | 3300049705 | Bacteria | 956 |
| 722 | Ga0501080_0700549 | 3300049742 | Bacteria | 893 |
| 723 | Ga0501232_052611 | 3300049757 | Bacteria | 632 |
| 724 | Ga0501241_018650 | 3300049758 | Bacteria | 1272 |
| 725 | Ga0501262_013677 | 3300049759 | Bacteria | 1049 |
| 726 | Ga0501267_046191 | 3300049764 | Bacteria | 556 |
| 727 | Ga0501268_053067 | 3300049765 | Bacteria | 789 |
| 728 | Ga0501268_055004 | 3300049765 | Bacteria | 778 |
| 729 | Ga0501268_124654 | 3300049765 | Bacteria | 574 |
| 730 | Ga0501280_003226 | 3300049776 | Bacteria | 2541 |
| 731 | Ga0501212_009499 | 3300049851 | Bacteria | 1372 |
| 732 | nmdc:mga03683_197501_c1 | 3300050489 | Bacteria | 922 |
| 733 | nmdc:mga0k408_31120_c1 | 3300050493 | Bacteria | 3045 |
| 734 | nmdc:mga0qj67_182633_c1 | 3300050509 | Bacteria | 1704 |
| 735 | nmdc:mga08y16_1236079_c1 | 3300050511 | Bacteria | 716 |
| 736 | nmdc:mga08y16_982596_c1 | 3300050511 | Bacteria | 825 |
| 737 | nmdc:mga0sz30_242758_c1 | 3300050516 | Bacteria | 802 |
| 738 | Ga0495655_0035620 | 3300053083 | Bacteria | 1239 |
| 739 | Ga0500643_000924 | 3300053087 | Bacteria | 18433 |
| 740 | Ga0500643_007382 | 3300053087 | Bacteria | 4442 |
| 741 | Ga0500646_0207484 | 3300053090 | Bacteria | 675 |
| 742 | Ga0500566_0000374 | 3300053094 | Bacteria | 24596 |
| 743 | Ga0500641_0113535 | 3300053096 | Bacteria | 1166 |
| 744 | Ga0500650_0380821 | 3300053098 | Bacteria | 613 |
| 745 | Ga0500556_0011172 | 3300053104 | Bacteria | 2654 |
| 746 | Ga0500562_016340 | 3300053108 | Bacteria | 1908 |
| 747 | Ga0500592_003670 | 3300053116 | Bacteria | 2446 |
| 748 | Ga0500595_002853 | 3300053119 | Bacteria | 8306 |
| 749 | Ga0500595_033823 | 3300053119 | Bacteria | 1694 |
| 750 | Ga0500597_028503 | 3300053120 | Bacteria | 2278 |
| 751 | Ga0500658_0004231 | 3300053134 | Bacteria | 5385 |
| 752 | Ga0500658_0006024 | 3300053134 | Bacteria | 4507 |
| 753 | Ga0500568_0074951 | 3300053139 | Bacteria | 1291 |
| 754 | Ga0500604_0020991 | 3300053151 | Bacteria | 1843 |
| 755 | Ga0500619_002638 | 3300053154 | Bacteria | 3499 |
| 756 | Ga0500624_000022 | 3300053157 | Bacteria | 116892 |
| 757 | Ga0500627_0000068 | 3300053158 | Bacteria | 44198 |
| 758 | Ga0500627_0301936 | 3300053158 | Bacteria | 699 |
| 759 | Ga0500636_0003684 | 3300053177 | Bacteria | 8639 |
| 760 | Ga0500637_0000095 | 3300053178 | Bacteria | 31675 |
| 761 | Ga0500611_001944 | 3300053727 | Bacteria | 2388 |
| 762 | Ga0500645_000008 | 3300053730 | Bacteria | 212254 |
| 763 | Ga0500645_077934 | 3300053730 | Bacteria | 947 |
| 764 | Ga0500596_003731 | 3300053735 | Bacteria | 2857 |
| 765 | Ga0500661_024634 | 3300055283 | Bacteria | 1064 |
| 766 | Ga0590077_089741 | 3300059426 | Bacteria | 713 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005719 | Ga0068861_100000342 | Ga0068861_1000003425 | 151 |
| 2 | 3300009011 | Ga0105251_10375239 | Ga0105251_103752392 | 151 |
| 3 | 3300026118 | Ga0207675_100000078 | Ga0207675_10000007819 | 151 |
| 4 | 3300031548 | Ga0307408_100109958 | Ga0307408_1001099582 | 151 |
| 5 | 3300031548 | Ga0307408_100593032 | Ga0307408_1005930322 | 151 |
| 6 | 3300031548 | Ga0307408_101482990 | Ga0307408_1014829902 | 151 |
| 7 | 3300031731 | Ga0307405_10080688 | Ga0307405_100806882 | 151 |
| 8 | 3300031824 | Ga0307413_10133190 | Ga0307413_101331902 | 151 |
| 9 | 3300031824 | Ga0307413_10158822 | Ga0307413_101588222 | 151 |
| 10 | 3300031824 | Ga0307413_10252451 | Ga0307413_102524512 | 151 |
| 11 | 3300031824 | Ga0307413_11374476 | Ga0307413_113744762 | 151 |
| 12 | 3300031852 | Ga0307410_10240114 | Ga0307410_102401142 | 151 |
| 13 | 3300031901 | Ga0307406_10027889 | Ga0307406_100278892 | 151 |
| 14 | 3300031901 | Ga0307406_11094516 | Ga0307406_110945161 | 151 |
| 15 | 3300031903 | Ga0307407_10073983 | Ga0307407_100739833 | 151 |
| 16 | 3300031911 | Ga0307412_10207187 | Ga0307412_102071871 | 151 |
| 17 | 3300031911 | Ga0307412_10892354 | Ga0307412_108923542 | 151 |
| 18 | 3300031911 | Ga0307412_11088650 | Ga0307412_110886502 | 151 |
| 19 | 3300032002 | Ga0307416_100350612 | Ga0307416_1003506122 | 151 |
| 20 | 3300032002 | Ga0307416_101985382 | Ga0307416_1019853822 | 151 |
| 21 | 3300032002 | Ga0307416_102370443 | Ga0307416_1023704432 | 151 |
| 22 | 3300032004 | Ga0307414_10035547 | Ga0307414_100355474 | 151 |
| 23 | 3300032004 | Ga0307414_10403095 | Ga0307414_104030952 | 151 |
| 24 | 3300032004 | Ga0307414_10453188 | Ga0307414_104531882 | 151 |
| 25 | 3300032004 | Ga0307414_10503155 | Ga0307414_105031552 | 151 |
| 26 | 3300032005 | Ga0307411_10230035 | Ga0307411_102300352 | 151 |
| 27 | 3300032005 | Ga0307411_10322739 | Ga0307411_103227392 | 151 |
| 28 | 3300032126 | Ga0307415_100092487 | Ga0307415_1000924872 | 151 |
| 29 | 3300032126 | Ga0307415_100099982 | Ga0307415_1000999823 | 151 |
| 30 | 3300032126 | Ga0307415_100437885 | Ga0307415_1004378851 | 151 |
| 31 | 3300032126 | Ga0307415_100483162 | Ga0307415_1004831622 | 151 |
| 32 | 3300032126 | Ga0307415_100580063 | Ga0307415_1005800632 | 151 |
| 33 | 3300049652 | Ga0501202_163988 | Ga0501202_163988_39_500 | 151 |
| 34 | 3300049765 | Ga0501268_053067 | Ga0501268_053067_145_606 | 151 |
| 35 | 3300005290 | Ga0065712_10177419 | Ga0065712_101774191 | 152 |
| 36 | 3300005293 | Ga0065715_10264084 | Ga0065715_102640842 | 152 |
| 37 | 3300005328 | Ga0070676_10148724 | Ga0070676_101487242 | 152 |
| 38 | 3300005328 | Ga0070676_10611688 | Ga0070676_106116882 | 152 |
| 39 | 3300005331 | Ga0070670_100005458 | Ga0070670_1000054589 | 152 |
| 40 | 3300005331 | Ga0070670_100025761 | Ga0070670_1000257616 | 152 |
| 41 | 3300005333 | Ga0070677_10015159 | Ga0070677_100151592 | 152 |
| 42 | 3300005337 | Ga0070682_100548140 | Ga0070682_1005481402 | 152 |
| 43 | 3300005344 | Ga0070661_100103170 | Ga0070661_1001031702 | 152 |
| 44 | 3300005353 | Ga0070669_100069166 | Ga0070669_1000691662 | 152 |
| 45 | 3300005354 | Ga0070675_100001861 | Ga0070675_1000018619 | 152 |
| 46 | 3300005355 | Ga0070671_100025732 | Ga0070671_1000257322 | 152 |
| 47 | 3300005365 | Ga0070688_101169469 | Ga0070688_1011694691 | 152 |
| 48 | 3300005366 | Ga0070659_100508026 | Ga0070659_1005080262 | 152 |
| 49 | 3300005458 | Ga0070681_11336455 | Ga0070681_113364551 | 152 |
| 50 | 3300005539 | Ga0068853_101021074 | Ga0068853_1010210742 | 152 |
| 51 | 3300005548 | Ga0070665_101394001 | Ga0070665_1013940011 | 152 |
| 52 | 3300005564 | Ga0070664_100005797 | Ga0070664_1000057974 | 152 |
| 53 | 3300005564 | Ga0070664_100338280 | Ga0070664_1003382802 | 152 |
| 54 | 3300005564 | Ga0070664_100565018 | Ga0070664_1005650182 | 152 |
| 55 | 3300005578 | Ga0068854_100016865 | Ga0068854_1000168654 | 152 |
| 56 | 3300005618 | Ga0068864_100327470 | Ga0068864_1003274702 | 152 |
| 57 | 3300005618 | Ga0068864_100409558 | Ga0068864_1004095582 | 152 |
| 58 | 3300005840 | Ga0068870_10290170 | Ga0068870_102901702 | 152 |
| 59 | 3300006871 | Ga0075434_101151816 | Ga0075434_1011518161 | 152 |
| 60 | 3300006931 | Ga0097620_100007008 | Ga0097620_1000070089 | 152 |
| 61 | 3300009093 | Ga0105240_10194992 | Ga0105240_101949922 | 152 |
| 62 | 3300009094 | Ga0111539_12006472 | Ga0111539_120064721 | 152 |
| 63 | 3300009177 | Ga0105248_10000774 | Ga0105248_1000077414 | 152 |
| 64 | 3300009545 | Ga0105237_10310267 | Ga0105237_103102672 | 152 |
| 65 | 3300013102 | Ga0157371_10103514 | Ga0157371_101035143 | 152 |
| 66 | 3300013102 | Ga0157371_10513931 | Ga0157371_105139312 | 152 |
| 67 | 3300013105 | Ga0157369_10050386 | Ga0157369_100503862 | 152 |
| 68 | 3300013105 | Ga0157369_10253056 | Ga0157369_102530562 | 152 |
| 69 | 3300013296 | Ga0157374_11001573 | Ga0157374_110015732 | 152 |
| 70 | 3300014325 | Ga0163163_10603432 | Ga0163163_106034322 | 152 |
| 71 | 3300014326 | Ga0157380_10374411 | Ga0157380_103744112 | 152 |
| 72 | 3300020081 | Ga0206354_11575931 | Ga0206354_115759311 | 152 |
| 73 | 3300025893 | Ga0207682_10015894 | Ga0207682_100158942 | 152 |
| 74 | 3300025907 | Ga0207645_10195466 | Ga0207645_101954661 | 152 |
| 75 | 3300025908 | Ga0207643_10276558 | Ga0207643_102765582 | 152 |
| 76 | 3300025913 | Ga0207695_10012103 | Ga0207695_1001210310 | 152 |
| 77 | 3300025920 | Ga0207649_10011199 | Ga0207649_100111996 | 152 |
| 78 | 3300025923 | Ga0207681_10047525 | Ga0207681_100475253 | 152 |
| 79 | 3300025925 | Ga0207650_10021945 | Ga0207650_100219454 | 152 |
| 80 | 3300025925 | Ga0207650_10081699 | Ga0207650_100816992 | 152 |
| 81 | 3300025926 | Ga0207659_10014204 | Ga0207659_100142045 | 152 |
| 82 | 3300025933 | Ga0207706_10084914 | Ga0207706_100849142 | 152 |
| 83 | 3300025941 | Ga0207711_10003926 | Ga0207711_100039262 | 152 |
| 84 | 3300025945 | Ga0207679_10004650 | Ga0207679_100046504 | 152 |
| 85 | 3300025981 | Ga0207640_10001098 | Ga0207640_1000109811 | 152 |
| 86 | 3300026095 | Ga0207676_10335637 | Ga0207676_103356372 | 152 |
| 87 | 3300026095 | Ga0207676_10433715 | Ga0207676_104337152 | 152 |
| 88 | 3300027876 | Ga0209974_10005220 | Ga0209974_100052203 | 152 |
| 89 | 3300027876 | Ga0209974_10171709 | Ga0209974_101717092 | 152 |
| 90 | 3300028379 | Ga0268266_10870879 | Ga0268266_108708792 | 152 |
| 91 | 3300031548 | Ga0307408_100069478 | Ga0307408_1000694782 | 152 |
| 92 | 3300031548 | Ga0307408_100091914 | Ga0307408_1000919142 | 152 |
| 93 | 3300031548 | Ga0307408_100285135 | Ga0307408_1002851352 | 152 |
| 94 | 3300031548 | Ga0307408_100510591 | Ga0307408_1005105912 | 152 |
| 95 | 3300031548 | Ga0307408_100630286 | Ga0307408_1006302862 | 152 |
| 96 | 3300031548 | Ga0307408_101108284 | Ga0307408_1011082841 | 152 |
| 97 | 3300031548 | Ga0307408_101772917 | Ga0307408_1017729172 | 152 |
| 98 | 3300031731 | Ga0307405_10043911 | Ga0307405_100439114 | 152 |
| 99 | 3300031731 | Ga0307405_10067136 | Ga0307405_100671363 | 152 |
| 100 | 3300031731 | Ga0307405_10188254 | Ga0307405_101882542 | 152 |
| 101 | 3300031731 | Ga0307405_10207289 | Ga0307405_102072892 | 152 |
| 102 | 3300031731 | Ga0307405_10271451 | Ga0307405_102714512 | 152 |
| 103 | 3300031731 | Ga0307405_10294315 | Ga0307405_102943152 | 152 |
| 104 | 3300031731 | Ga0307405_10626227 | Ga0307405_106262272 | 152 |
| 105 | 3300031731 | Ga0307405_10759491 | Ga0307405_107594912 | 152 |
| 106 | 3300031731 | Ga0307405_11038382 | Ga0307405_110383822 | 152 |
| 107 | 3300031731 | Ga0307405_11228325 | Ga0307405_112283251 | 152 |
| 108 | 3300031731 | Ga0307405_11515044 | Ga0307405_115150442 | 152 |
| 109 | 3300031824 | Ga0307413_10006703 | Ga0307413_100067033 | 152 |
| 110 | 3300031824 | Ga0307413_10011908 | Ga0307413_100119083 | 152 |
| 111 | 3300031824 | Ga0307413_10016281 | Ga0307413_100162813 | 152 |
| 112 | 3300031824 | Ga0307413_10203583 | Ga0307413_102035832 | 152 |
| 113 | 3300031824 | Ga0307413_10276044 | Ga0307413_102760442 | 152 |
| 114 | 3300031824 | Ga0307413_10289949 | Ga0307413_102899492 | 152 |
| 115 | 3300031824 | Ga0307413_10594900 | Ga0307413_105949002 | 152 |
| 116 | 3300031824 | Ga0307413_10602259 | Ga0307413_106022592 | 152 |
| 117 | 3300031824 | Ga0307413_10771391 | Ga0307413_107713912 | 152 |
| 118 | 3300031824 | Ga0307413_11559294 | Ga0307413_115592941 | 152 |
| 119 | 3300031852 | Ga0307410_10008260 | Ga0307410_100082604 | 152 |
| 120 | 3300031852 | Ga0307410_10008363 | Ga0307410_100083632 | 152 |
| 121 | 3300031852 | Ga0307410_10012900 | Ga0307410_100129003 | 152 |
| 122 | 3300031852 | Ga0307410_10036234 | Ga0307410_100362344 | 152 |
| 123 | 3300031852 | Ga0307410_10176499 | Ga0307410_101764991 | 152 |
| 124 | 3300031852 | Ga0307410_10193727 | Ga0307410_101937272 | 152 |
| 125 | 3300031852 | Ga0307410_10199811 | Ga0307410_101998112 | 152 |
| 126 | 3300031852 | Ga0307410_10308023 | Ga0307410_103080232 | 152 |
| 127 | 3300031852 | Ga0307410_10408558 | Ga0307410_104085582 | 152 |
| 128 | 3300031852 | Ga0307410_10409007 | Ga0307410_104090072 | 152 |
| 129 | 3300031852 | Ga0307410_10784723 | Ga0307410_107847232 | 152 |
| 130 | 3300031901 | Ga0307406_10016377 | Ga0307406_100163774 | 152 |
| 131 | 3300031901 | Ga0307406_10048797 | Ga0307406_100487972 | 152 |
| 132 | 3300031901 | Ga0307406_10074194 | Ga0307406_100741942 | 152 |
| 133 | 3300031901 | Ga0307406_10120770 | Ga0307406_101207702 | 152 |
| 134 | 3300031901 | Ga0307406_10135367 | Ga0307406_101353672 | 152 |
| 135 | 3300031901 | Ga0307406_11378515 | Ga0307406_113785152 | 152 |
| 136 | 3300031903 | Ga0307407_10096050 | Ga0307407_100960502 | 152 |
| 137 | 3300031903 | Ga0307407_10295409 | Ga0307407_102954092 | 152 |
| 138 | 3300031903 | Ga0307407_10801828 | Ga0307407_108018282 | 152 |
| 139 | 3300031903 | Ga0307407_10855436 | Ga0307407_108554361 | 152 |
| 140 | 3300031903 | Ga0307407_11074987 | Ga0307407_110749872 | 152 |
| 141 | 3300031911 | Ga0307412_10007860 | Ga0307412_100078603 | 152 |
| 142 | 3300031911 | Ga0307412_10010257 | Ga0307412_100102573 | 152 |
| 143 | 3300031911 | Ga0307412_10015383 | Ga0307412_100153834 | 152 |
| 144 | 3300031911 | Ga0307412_10026639 | Ga0307412_100266394 | 152 |
| 145 | 3300031911 | Ga0307412_10032354 | Ga0307412_100323541 | 152 |
| 146 | 3300031911 | Ga0307412_10065901 | Ga0307412_100659013 | 152 |
| 147 | 3300031911 | Ga0307412_10113538 | Ga0307412_101135382 | 152 |
| 148 | 3300031911 | Ga0307412_10307418 | Ga0307412_103074182 | 152 |
| 149 | 3300031911 | Ga0307412_10434442 | Ga0307412_104344422 | 152 |
| 150 | 3300031995 | Ga0307409_100003140 | Ga0307409_1000031408 | 152 |
| 151 | 3300031995 | Ga0307409_100034227 | Ga0307409_1000342273 | 152 |
| 152 | 3300031995 | Ga0307409_100053927 | Ga0307409_1000539272 | 152 |
| 153 | 3300031995 | Ga0307409_100062391 | Ga0307409_1000623912 | 152 |
| 154 | 3300031995 | Ga0307409_100084640 | Ga0307409_1000846402 | 152 |
| 155 | 3300031995 | Ga0307409_100085365 | Ga0307409_1000853654 | 152 |
| 156 | 3300031995 | Ga0307409_100242822 | Ga0307409_1002428223 | 152 |
| 157 | 3300031995 | Ga0307409_100288135 | Ga0307409_1002881352 | 152 |
| 158 | 3300031995 | Ga0307409_100290302 | Ga0307409_1002903021 | 152 |
| 159 | 3300031995 | Ga0307409_100318826 | Ga0307409_1003188262 | 152 |
| 160 | 3300031995 | Ga0307409_100856127 | Ga0307409_1008561272 | 152 |
| 161 | 3300031995 | Ga0307409_100869573 | Ga0307409_1008695732 | 152 |
| 162 | 3300031995 | Ga0307409_101500954 | Ga0307409_1015009542 | 152 |
| 163 | 3300032002 | Ga0307416_100023508 | Ga0307416_1000235083 | 152 |
| 164 | 3300032002 | Ga0307416_100038353 | Ga0307416_1000383532 | 152 |
| 165 | 3300032002 | Ga0307416_100045203 | Ga0307416_1000452035 | 152 |
| 166 | 3300032002 | Ga0307416_100102973 | Ga0307416_1001029732 | 152 |
| 167 | 3300032002 | Ga0307416_100198942 | Ga0307416_1001989422 | 152 |
| 168 | 3300032002 | Ga0307416_100219543 | Ga0307416_1002195433 | 152 |
| 169 | 3300032002 | Ga0307416_100270708 | Ga0307416_1002707082 | 152 |
| 170 | 3300032002 | Ga0307416_100311353 | Ga0307416_1003113532 | 152 |
| 171 | 3300032002 | Ga0307416_100867352 | Ga0307416_1008673522 | 152 |
| 172 | 3300032004 | Ga0307414_10012107 | Ga0307414_100121073 | 152 |
| 173 | 3300032004 | Ga0307414_10026751 | Ga0307414_100267514 | 152 |
| 174 | 3300032004 | Ga0307414_10107358 | Ga0307414_101073582 | 152 |
| 175 | 3300032004 | Ga0307414_10130273 | Ga0307414_101302732 | 152 |
| 176 | 3300032004 | Ga0307414_10153299 | Ga0307414_101532992 | 152 |
| 177 | 3300032004 | Ga0307414_10413963 | Ga0307414_104139632 | 152 |
| 178 | 3300032004 | Ga0307414_10462305 | Ga0307414_104623052 | 152 |
| 179 | 3300032004 | Ga0307414_10485717 | Ga0307414_104857172 | 152 |
| 180 | 3300032004 | Ga0307414_10544697 | Ga0307414_105446972 | 152 |
| 181 | 3300032004 | Ga0307414_10723269 | Ga0307414_107232692 | 152 |
| 182 | 3300032004 | Ga0307414_11054593 | Ga0307414_110545932 | 152 |
| 183 | 3300032004 | Ga0307414_11109844 | Ga0307414_111098442 | 152 |
| 184 | 3300032005 | Ga0307411_10009509 | Ga0307411_100095094 | 152 |
| 185 | 3300032005 | Ga0307411_10011602 | Ga0307411_100116025 | 152 |
| 186 | 3300032005 | Ga0307411_10013960 | Ga0307411_100139605 | 152 |
| 187 | 3300032005 | Ga0307411_10014385 | Ga0307411_100143855 | 152 |
| 188 | 3300032005 | Ga0307411_10014534 | Ga0307411_100145342 | 152 |
| 189 | 3300032005 | Ga0307411_10040110 | Ga0307411_100401103 | 152 |
| 190 | 3300032005 | Ga0307411_10046371 | Ga0307411_100463713 | 152 |
| 191 | 3300032005 | Ga0307411_10051238 | Ga0307411_100512383 | 152 |
| 192 | 3300032005 | Ga0307411_10066346 | Ga0307411_100663463 | 152 |
| 193 | 3300032005 | Ga0307411_10099859 | Ga0307411_100998592 | 152 |
| 194 | 3300032005 | Ga0307411_10224941 | Ga0307411_102249412 | 152 |
| 195 | 3300032005 | Ga0307411_10290366 | Ga0307411_102903662 | 152 |
| 196 | 3300032005 | Ga0307411_10378027 | Ga0307411_103780271 | 152 |
| 197 | 3300032005 | Ga0307411_10426121 | Ga0307411_104261212 | 152 |
| 198 | 3300032005 | Ga0307411_10523850 | Ga0307411_105238501 | 152 |
| 199 | 3300032005 | Ga0307411_10842497 | Ga0307411_108424972 | 152 |
| 200 | 3300032126 | Ga0307415_100000243 | Ga0307415_1000002437 | 152 |
| 201 | 3300032126 | Ga0307415_100006668 | Ga0307415_1000066683 | 152 |
| 202 | 3300032126 | Ga0307415_100017560 | Ga0307415_1000175602 | 152 |
| 203 | 3300032126 | Ga0307415_100018107 | Ga0307415_1000181075 | 152 |
| 204 | 3300032126 | Ga0307415_100417371 | Ga0307415_1004173711 | 152 |
| 205 | 3300032126 | Ga0307415_101243109 | Ga0307415_1012431091 | 152 |
| 206 | 3300037312 | Ga0395899_0079364 | Ga0395899_0079364_820_1299 | 152 |
| 207 | 3300037312 | Ga0395899_0180671 | Ga0395899_0180671_208_690 | 152 |
| 208 | 3300037418 | Ga0395900_0000572 | Ga0395900_0000572_19365_19847 | 152 |
| 209 | 3300037418 | Ga0395900_0006337 | Ga0395900_0006337_416_892 | 152 |
| 210 | 3300037418 | Ga0395900_0057885 | Ga0395900_0057885_1080_1559 | 152 |
| 211 | 3300037418 | Ga0395900_0191604 | Ga0395900_0191604_1014_1496 | 152 |
| 212 | 3300037418 | Ga0395900_0257820 | Ga0395900_0257820_1217_1699 | 152 |
| 213 | 3300037418 | Ga0395900_0489616 | Ga0395900_0489616_156_635 | 152 |
| 214 | 3300037466 | Ga0395898_0109262 | Ga0395898_0109262_208_690 | 152 |
| 215 | 3300037466 | Ga0395898_0467827 | Ga0395898_0467827_435_917 | 152 |
| 216 | 3300037466 | Ga0395898_0499082 | Ga0395898_0499082_31_513 | 152 |
| 217 | 3300037471 | Ga0395905_0000165 | Ga0395905_0000165_59363_59845 | 152 |
| 218 | 3300037471 | Ga0395905_0005698 | Ga0395905_0005698_1804_2280 | 152 |
| 219 | 3300037471 | Ga0395905_0069248 | Ga0395905_0069248_2739_3218 | 152 |
| 220 | 3300037471 | Ga0395905_0135050 | Ga0395905_0135050_1592_2071 | 152 |
| 221 | 3300037471 | Ga0395905_0332185 | Ga0395905_0332185_456_926 | 152 |
| 222 | 3300038443 | Ga0395901_0106729 | Ga0395901_0106729_1106_1576 | 152 |
| 223 | 3300038443 | Ga0395901_0197126 | Ga0395901_0197126_1058_1540 | 152 |
| 224 | 3300038443 | Ga0395901_0332159 | Ga0395901_0332159_32_514 | 152 |
| 225 | 3300044712 | Ga0453684_0342525 | Ga0453684_0342525_1059_1529 | 152 |
| 226 | 3300044901 | Ga0466960_0041784 | Ga0466960_0041784_1143_1613 | 152 |
| 227 | 3300044901 | Ga0466960_0954308 | Ga0466960_0954308_19_501 | 152 |
| 228 | 3300046452 | Ga0495617_047668 | Ga0495617_047668_904_1374 | 152 |
| 229 | 3300046525 | Ga0495663_0067994 | Ga0495663_0067994_136_621 | 152 |
| 230 | 3300047472 | Ga0495686_0162793 | Ga0495686_0162793_372_842 | 152 |
| 231 | 3300048912 | Ga0496109_0292790 | Ga0496109_0292790_606_1076 | 152 |
| 232 | 3300048914 | Ga0496111_0912975 | Ga0496111_0912975_14_484 | 152 |
| 233 | 3300049668 | Ga0501233_101302 | Ga0501233_101302_238_714 | 152 |
| 234 | 3300049674 | Ga0501242_020888 | Ga0501242_020888_123_599 | 152 |
| 235 | 3300049705 | Ga0501225_0076567 | Ga0501225_0076567_97_573 | 152 |
| 236 | 3300049757 | Ga0501232_052611 | Ga0501232_052611_145_621 | 152 |
| 237 | 3300049758 | Ga0501241_018650 | Ga0501241_018650_629_1087 | 152 |
| 238 | 3300049759 | Ga0501262_013677 | Ga0501262_013677_66_542 | 152 |
| 239 | 3300049764 | Ga0501267_046191 | Ga0501267_046191_16_492 | 152 |
| 240 | 3300049765 | Ga0501268_124654 | Ga0501268_124654_83_559 | 152 |
| 241 | 3300049851 | Ga0501212_009499 | Ga0501212_009499_518_994 | 152 |
| 242 | 3300050511 | nmdc:mga08y16_1236079_c1 | nmdc:mga08y16_1236079_c1_82_561 | 152 |
| 243 | 3300059426 | Ga0590077_089741 | Ga0590077_089741_98_580 | 152 |
| 244 | 3300000041 | ARcpr5oldR_c004772 | ARcpr5oldR_0047722 | 153 |
| 245 | 3300001979 | JGI24740J21852_10043438 | JGI24740J21852_100434382 | 153 |
| 246 | 3300001989 | JGI24739J22299_10045976 | JGI24739J22299_100459762 | 153 |
| 247 | 3300002774 | JGI25150J39212_1000371 | JGI25150J39212_100037120 | 153 |
| 248 | 3300003187 | JGI25151J46595_10040622 | JGI25151J46595_100406222 | 153 |
| 249 | 3300003215 | JGI25153J46596_10000072 | JGI25153J46596_1000007261 | 153 |
| 250 | 3300003215 | JGI25153J46596_10000113 | JGI25153J46596_1000011367 | 153 |
| 251 | 3300003215 | JGI25153J46596_10011776 | JGI25153J46596_100117762 | 153 |
| 252 | 3300003215 | JGI25153J46596_10033304 | JGI25153J46596_100333042 | 153 |
| 253 | 3300003759 | Ga0055525_1000090 | Ga0055525_1000090128 | 153 |
| 254 | 3300003762 | Ga0055542_1000568 | Ga0055542_100056824 | 153 |
| 255 | 3300003763 | Ga0055529_1000007 | Ga0055529_100000724 | 153 |
| 256 | 3300003763 | Ga0055529_1000109 | Ga0055529_100010947 | 153 |
| 257 | 3300003771 | Ga0055526_1014390 | Ga0055526_10143903 | 153 |
| 258 | 3300003773 | Ga0055537_1001776 | Ga0055537_10017764 | 153 |
| 259 | 3300003773 | Ga0055537_1007102 | Ga0055537_10071022 | 153 |
| 260 | 3300003775 | Ga0055524_1000030 | Ga0055524_100003088 | 153 |
| 261 | 3300003781 | Ga0055536_1015225 | Ga0055536_10152252 | 153 |
| 262 | 3300003784 | Ga0055534_1025003 | Ga0055534_10250032 | 153 |
| 263 | 3300003791 | Ga0055530_10002769 | Ga0055530_100027692 | 153 |
| 264 | 3300003791 | Ga0055530_10007045 | Ga0055530_100070453 | 153 |
| 265 | 3300003791 | Ga0055530_10037092 | Ga0055530_100370922 | 153 |
| 266 | 3300003792 | Ga0055540_1001950 | Ga0055540_10019505 | 153 |
| 267 | 3300003794 | Ga0055531_10011244 | Ga0055531_100112442 | 153 |
| 268 | 3300003794 | Ga0055531_10016815 | Ga0055531_100168152 | 153 |
| 269 | 3300004625 | Ga0055543_1038990 | Ga0055543_10389902 | 153 |
| 270 | 3300005262 | Ga0065165_1003301 | Ga0065165_10033019 | 153 |
| 271 | 3300005262 | Ga0065165_1016642 | Ga0065165_10166421 | 153 |
| 272 | 3300005262 | Ga0065165_1058829 | Ga0065165_10588292 | 153 |
| 273 | 3300005290 | Ga0065712_10133692 | Ga0065712_101336922 | 153 |
| 274 | 3300005293 | Ga0065715_10123474 | Ga0065715_101234742 | 153 |
| 275 | 3300005327 | Ga0070658_10131111 | Ga0070658_101311113 | 153 |
| 276 | 3300005327 | Ga0070658_10629296 | Ga0070658_106292962 | 153 |
| 277 | 3300005327 | Ga0070658_10963645 | Ga0070658_109636451 | 153 |
| 278 | 3300005328 | Ga0070676_10046635 | Ga0070676_100466352 | 153 |
| 279 | 3300005329 | Ga0070683_100311548 | Ga0070683_1003115481 | 153 |
| 280 | 3300005331 | Ga0070670_100030479 | Ga0070670_1000304794 | 153 |
| 281 | 3300005331 | Ga0070670_100080462 | Ga0070670_1000804623 | 153 |
| 282 | 3300005333 | Ga0070677_10287692 | Ga0070677_102876922 | 153 |
| 283 | 3300005335 | Ga0070666_10016649 | Ga0070666_100166492 | 153 |
| 284 | 3300005336 | Ga0070680_100001375 | Ga0070680_1000013758 | 153 |
| 285 | 3300005338 | Ga0068868_100049426 | Ga0068868_1000494264 | 153 |
| 286 | 3300005339 | Ga0070660_100000678 | Ga0070660_10000067814 | 153 |
| 287 | 3300005339 | Ga0070660_100010750 | Ga0070660_1000107507 | 153 |
| 288 | 3300005339 | Ga0070660_100090166 | Ga0070660_1000901662 | 153 |
| 289 | 3300005344 | Ga0070661_100036375 | Ga0070661_1000363752 | 153 |
| 290 | 3300005344 | Ga0070661_100132023 | Ga0070661_1001320233 | 153 |
| 291 | 3300005344 | Ga0070661_100953781 | Ga0070661_1009537812 | 153 |
| 292 | 3300005347 | Ga0070668_100000866 | Ga0070668_10000086615 | 153 |
| 293 | 3300005353 | Ga0070669_100416180 | Ga0070669_1004161802 | 153 |
| 294 | 3300005354 | Ga0070675_100046035 | Ga0070675_1000460352 | 153 |
| 295 | 3300005354 | Ga0070675_100066444 | Ga0070675_1000664443 | 153 |
| 296 | 3300005354 | Ga0070675_100418332 | Ga0070675_1004183321 | 153 |
| 297 | 3300005355 | Ga0070671_100000229 | Ga0070671_1000002295 | 153 |
| 298 | 3300005355 | Ga0070671_100014846 | Ga0070671_1000148466 | 153 |
| 299 | 3300005355 | Ga0070671_100124793 | Ga0070671_1001247932 | 153 |
| 300 | 3300005355 | Ga0070671_100735937 | Ga0070671_1007359371 | 153 |
| 301 | 3300005356 | Ga0070674_100009305 | Ga0070674_1000093054 | 153 |
| 302 | 3300005356 | Ga0070674_100022158 | Ga0070674_1000221583 | 153 |
| 303 | 3300005356 | Ga0070674_100046526 | Ga0070674_1000465262 | 153 |
| 304 | 3300005356 | Ga0070674_100935744 | Ga0070674_1009357441 | 153 |
| 305 | 3300005364 | Ga0070673_100172161 | Ga0070673_1001721612 | 153 |
| 306 | 3300005364 | Ga0070673_100606681 | Ga0070673_1006066811 | 153 |
| 307 | 3300005364 | Ga0070673_101307105 | Ga0070673_1013071052 | 153 |
| 308 | 3300005366 | Ga0070659_100052960 | Ga0070659_1000529603 | 153 |
| 309 | 3300005366 | Ga0070659_100812838 | Ga0070659_1008128381 | 153 |
| 310 | 3300005435 | Ga0070714_101030431 | Ga0070714_1010304312 | 153 |
| 311 | 3300005455 | Ga0070663_100000936 | Ga0070663_10000093612 | 153 |
| 312 | 3300005455 | Ga0070663_100327625 | Ga0070663_1003276252 | 153 |
| 313 | 3300005456 | Ga0070678_100008085 | Ga0070678_1000080858 | 153 |
| 314 | 3300005456 | Ga0070678_100409718 | Ga0070678_1004097182 | 153 |
| 315 | 3300005456 | Ga0070678_101180233 | Ga0070678_1011802332 | 153 |
| 316 | 3300005457 | Ga0070662_100158225 | Ga0070662_1001582252 | 153 |
| 317 | 3300005457 | Ga0070662_100370326 | Ga0070662_1003703261 | 153 |
| 318 | 3300005457 | Ga0070662_100392701 | Ga0070662_1003927012 | 153 |
| 319 | 3300005457 | Ga0070662_100678100 | Ga0070662_1006781001 | 153 |
| 320 | 3300005466 | Ga0070685_10417461 | Ga0070685_104174612 | 153 |
| 321 | 3300005530 | Ga0070679_100001182 | Ga0070679_10000118219 | 153 |
| 322 | 3300005543 | Ga0070672_100243695 | Ga0070672_1002436952 | 153 |
| 323 | 3300005543 | Ga0070672_100407577 | Ga0070672_1004075772 | 153 |
| 324 | 3300005546 | Ga0070696_100322340 | Ga0070696_1003223401 | 153 |
| 325 | 3300005548 | Ga0070665_100000044 | Ga0070665_100000044201 | 153 |
| 326 | 3300005548 | Ga0070665_100289401 | Ga0070665_1002894012 | 153 |
| 327 | 3300005564 | Ga0070664_100001633 | Ga0070664_1000016337 | 153 |
| 328 | 3300005564 | Ga0070664_101690712 | Ga0070664_1016907121 | 153 |
| 329 | 3300005577 | Ga0068857_100103063 | Ga0068857_1001030633 | 153 |
| 330 | 3300005578 | Ga0068854_100159394 | Ga0068854_1001593942 | 153 |
| 331 | 3300005578 | Ga0068854_100177479 | Ga0068854_1001774792 | 153 |
| 332 | 3300005578 | Ga0068854_100300186 | Ga0068854_1003001862 | 153 |
| 333 | 3300005578 | Ga0068854_100517717 | Ga0068854_1005177172 | 153 |
| 334 | 3300005616 | Ga0068852_100093419 | Ga0068852_1000934192 | 153 |
| 335 | 3300005618 | Ga0068864_100017494 | Ga0068864_1000174945 | 153 |
| 336 | 3300005618 | Ga0068864_100086873 | Ga0068864_1000868732 | 153 |
| 337 | 3300005841 | Ga0068863_100000030 | Ga0068863_10000003080 | 153 |
| 338 | 3300005841 | Ga0068863_100026944 | Ga0068863_1000269443 | 153 |
| 339 | 3300005842 | Ga0068858_100018879 | Ga0068858_1000188796 | 153 |
| 340 | 3300005843 | Ga0068860_100013256 | Ga0068860_1000132563 | 153 |
| 341 | 3300005843 | Ga0068860_100231329 | Ga0068860_1002313292 | 153 |
| 342 | 3300005844 | Ga0068862_100000193 | Ga0068862_10000019326 | 153 |
| 343 | 3300005844 | Ga0068862_101299057 | Ga0068862_1012990572 | 153 |
| 344 | 3300005844 | Ga0068862_101602987 | Ga0068862_1016029871 | 153 |
| 345 | 3300005985 | Ga0081539_10026991 | Ga0081539_100269913 | 153 |
| 346 | 3300005985 | Ga0081539_10084838 | Ga0081539_100848381 | 153 |
| 347 | 3300006237 | Ga0097621_100438278 | Ga0097621_1004382782 | 153 |
| 348 | 3300006237 | Ga0097621_100550463 | Ga0097621_1005504632 | 153 |
| 349 | 3300006353 | Ga0075370_10246309 | Ga0075370_102463092 | 153 |
| 350 | 3300006358 | Ga0068871_100240981 | Ga0068871_1002409812 | 153 |
| 351 | 3300006358 | Ga0068871_100290180 | Ga0068871_1002901802 | 153 |
| 352 | 3300006358 | Ga0068871_100494788 | Ga0068871_1004947882 | 153 |
| 353 | 3300006931 | Ga0097620_100253232 | Ga0097620_1002532323 | 153 |
| 354 | 3300006946 | Ga0079104_1037292 | Ga0079104_10372922 | 153 |
| 355 | 3300009093 | Ga0105240_10266083 | Ga0105240_102660832 | 153 |
| 356 | 3300009094 | Ga0111539_10752068 | Ga0111539_107520681 | 153 |
| 357 | 3300009101 | Ga0105247_10038604 | Ga0105247_100386043 | 153 |
| 358 | 3300009148 | Ga0105243_10000224 | Ga0105243_1000022428 | 153 |
| 359 | 3300009174 | Ga0105241_10095554 | Ga0105241_100955542 | 153 |
| 360 | 3300009176 | Ga0105242_10069746 | Ga0105242_100697462 | 153 |
| 361 | 3300009177 | Ga0105248_10033959 | Ga0105248_100339596 | 153 |
| 362 | 3300009177 | Ga0105248_10132262 | Ga0105248_101322622 | 153 |
| 363 | 3300009177 | Ga0105248_10280058 | Ga0105248_102800582 | 153 |
| 364 | 3300009545 | Ga0105237_10077367 | Ga0105237_100773672 | 153 |
| 365 | 3300009553 | Ga0105249_10000002 | Ga0105249_10000002105 | 153 |
| 366 | 3300009553 | Ga0105249_10222561 | Ga0105249_102225612 | 153 |
| 367 | 3300009553 | Ga0105249_11499678 | Ga0105249_114996781 | 153 |
| 368 | 3300010375 | Ga0105239_12020966 | Ga0105239_120209661 | 153 |
| 369 | 3300010375 | Ga0105239_12389164 | Ga0105239_123891641 | 153 |
| 370 | 3300011119 | Ga0105246_10384876 | Ga0105246_103848761 | 153 |
| 371 | 3300012513 | Ga0157326_1002610 | Ga0157326_10026102 | 153 |
| 372 | 3300013100 | Ga0157373_10206341 | Ga0157373_102063412 | 153 |
| 373 | 3300013102 | Ga0157371_10956656 | Ga0157371_109566561 | 153 |
| 374 | 3300013104 | Ga0157370_10033595 | Ga0157370_100335953 | 153 |
| 375 | 3300013104 | Ga0157370_10074287 | Ga0157370_100742874 | 153 |
| 376 | 3300013104 | Ga0157370_10492452 | Ga0157370_104924521 | 153 |
| 377 | 3300013105 | Ga0157369_10421097 | Ga0157369_104210972 | 153 |
| 378 | 3300013105 | Ga0157369_10498766 | Ga0157369_104987662 | 153 |
| 379 | 3300013296 | Ga0157374_10008990 | Ga0157374_100089909 | 153 |
| 380 | 3300013296 | Ga0157374_11275575 | Ga0157374_112755752 | 153 |
| 381 | 3300013306 | Ga0163162_11071317 | Ga0163162_110713172 | 153 |
| 382 | 3300013307 | Ga0157372_10277840 | Ga0157372_102778404 | 153 |
| 383 | 3300013307 | Ga0157372_10478430 | Ga0157372_104784302 | 153 |
| 384 | 3300013307 | Ga0157372_11187251 | Ga0157372_111872512 | 153 |
| 385 | 3300013308 | Ga0157375_10028876 | Ga0157375_100288763 | 153 |
| 386 | 3300013308 | Ga0157375_10529705 | Ga0157375_105297052 | 153 |
| 387 | 3300013308 | Ga0157375_11977275 | Ga0157375_119772752 | 153 |
| 388 | 3300014325 | Ga0163163_10941617 | Ga0163163_109416171 | 153 |
| 389 | 3300014326 | Ga0157380_10128261 | Ga0157380_101282613 | 153 |
| 390 | 3300014326 | Ga0157380_10951680 | Ga0157380_109516802 | 153 |
| 391 | 3300014969 | Ga0157376_10813324 | Ga0157376_108133242 | 153 |
| 392 | 3300021358 | Ga0213873_10000015 | Ga0213873_10000015115 | 153 |
| 393 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005620 | 153 |
| 394 | 3300021388 | Ga0213875_10002419 | Ga0213875_100024195 | 153 |
| 395 | 3300025226 | Ga0209674_112607 | Ga0209674_1126072 | 153 |
| 396 | 3300025230 | Ga0209563_100111 | Ga0209563_10011128 | 153 |
| 397 | 3300025245 | Ga0207425_1000020 | Ga0207425_1000020165 | 153 |
| 398 | 3300025245 | Ga0207425_1016432 | Ga0207425_10164322 | 153 |
| 399 | 3300025253 | Ga0209677_110816 | Ga0209677_1108162 | 153 |
| 400 | 3300025254 | Ga0209148_1000026 | Ga0209148_1000026361 | 153 |
| 401 | 3300025258 | Ga0209129_1002331 | Ga0209129_10023317 | 153 |
| 402 | 3300025263 | Ga0209565_1000012 | Ga0209565_1000012352 | 153 |
| 403 | 3300025263 | Ga0209565_1000299 | Ga0209565_100029944 | 153 |
| 404 | 3300025272 | Ga0209455_1000005 | Ga0209455_10000051108 | 153 |
| 405 | 3300025273 | Ga0209673_1013425 | Ga0209673_10134252 | 153 |
| 406 | 3300025291 | Ga0209675_1000126 | Ga0209675_100012622 | 153 |
| 407 | 3300025292 | Ga0209676_1087714 | Ga0209676_10877142 | 153 |
| 408 | 3300025294 | Ga0209025_1000827 | Ga0209025_10008272 | 153 |
| 409 | 3300025294 | Ga0209025_1006865 | Ga0209025_10068654 | 153 |
| 410 | 3300025295 | Ga0209564_1002442 | Ga0209564_100244217 | 153 |
| 411 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004429 | 153 |
| 412 | 3300025297 | Ga0209758_1000035 | Ga0209758_1000035376 | 153 |
| 413 | 3300025297 | Ga0209758_1009351 | Ga0209758_10093516 | 153 |
| 414 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012384 | 153 |
| 415 | 3300025298 | Ga0209050_1000014 | Ga0209050_1000014557 | 153 |
| 416 | 3300025298 | Ga0209050_1002854 | Ga0209050_100285411 | 153 |
| 417 | 3300025298 | Ga0209050_1005539 | Ga0209050_10055393 | 153 |
| 418 | 3300025299 | Ga0209256_1000012 | Ga0209256_1000012543 | 153 |
| 419 | 3300025303 | Ga0209051_1000503 | Ga0209051_10005036 | 153 |
| 420 | 3300025304 | Ga0209257_1000019 | Ga0209257_1000019135 | 153 |
| 421 | 3300025304 | Ga0209257_1005815 | Ga0209257_10058152 | 153 |
| 422 | 3300025304 | Ga0209257_1023381 | Ga0209257_10233812 | 153 |
| 423 | 3300025893 | Ga0207682_10185404 | Ga0207682_101854043 | 153 |
| 424 | 3300025900 | Ga0207710_10024739 | Ga0207710_100247392 | 153 |
| 425 | 3300025901 | Ga0207688_10083694 | Ga0207688_100836943 | 153 |
| 426 | 3300025903 | Ga0207680_10156457 | Ga0207680_101564572 | 153 |
| 427 | 3300025904 | Ga0207647_10064331 | Ga0207647_100643313 | 153 |
| 428 | 3300025904 | Ga0207647_10068236 | Ga0207647_100682363 | 153 |
| 429 | 3300025907 | Ga0207645_10014446 | Ga0207645_100144463 | 153 |
| 430 | 3300025907 | Ga0207645_10042259 | Ga0207645_100422593 | 153 |
| 431 | 3300025909 | Ga0207705_10000205 | Ga0207705_1000020535 | 153 |
| 432 | 3300025909 | Ga0207705_10043699 | Ga0207705_100436992 | 153 |
| 433 | 3300025909 | Ga0207705_10069560 | Ga0207705_100695602 | 153 |
| 434 | 3300025913 | Ga0207695_11019262 | Ga0207695_110192621 | 153 |
| 435 | 3300025914 | Ga0207671_10008911 | Ga0207671_100089113 | 153 |
| 436 | 3300025917 | Ga0207660_10001386 | Ga0207660_1000138618 | 153 |
| 437 | 3300025919 | Ga0207657_10003566 | Ga0207657_100035667 | 153 |
| 438 | 3300025919 | Ga0207657_10007665 | Ga0207657_100076656 | 153 |
| 439 | 3300025919 | Ga0207657_10132392 | Ga0207657_101323922 | 153 |
| 440 | 3300025920 | Ga0207649_10031511 | Ga0207649_100315113 | 153 |
| 441 | 3300025921 | Ga0207652_10000270 | Ga0207652_1000027020 | 153 |
| 442 | 3300025923 | Ga0207681_10653447 | Ga0207681_106534472 | 153 |
| 443 | 3300025925 | Ga0207650_10011005 | Ga0207650_100110056 | 153 |
| 444 | 3300025925 | Ga0207650_10028780 | Ga0207650_100287802 | 153 |
| 445 | 3300025925 | Ga0207650_10123722 | Ga0207650_101237222 | 153 |
| 446 | 3300025925 | Ga0207650_10806601 | Ga0207650_108066012 | 153 |
| 447 | 3300025926 | Ga0207659_10056813 | Ga0207659_100568132 | 153 |
| 448 | 3300025926 | Ga0207659_10570309 | Ga0207659_105703092 | 153 |
| 449 | 3300025926 | Ga0207659_11105081 | Ga0207659_111050811 | 153 |
| 450 | 3300025931 | Ga0207644_10000186 | Ga0207644_1000018644 | 153 |
| 451 | 3300025931 | Ga0207644_10006360 | Ga0207644_100063606 | 153 |
| 452 | 3300025931 | Ga0207644_10091495 | Ga0207644_100914952 | 153 |
| 453 | 3300025931 | Ga0207644_10129904 | Ga0207644_101299042 | 153 |
| 454 | 3300025931 | Ga0207644_10428206 | Ga0207644_104282062 | 153 |
| 455 | 3300025932 | Ga0207690_10062134 | Ga0207690_100621342 | 153 |
| 456 | 3300025933 | Ga0207706_10055988 | Ga0207706_100559883 | 153 |
| 457 | 3300025933 | Ga0207706_10178902 | Ga0207706_101789022 | 153 |
| 458 | 3300025933 | Ga0207706_10188242 | Ga0207706_101882422 | 153 |
| 459 | 3300025933 | Ga0207706_10192419 | Ga0207706_101924192 | 153 |
| 460 | 3300025933 | Ga0207706_10375318 | Ga0207706_103753182 | 153 |
| 461 | 3300025933 | Ga0207706_10390329 | Ga0207706_103903292 | 153 |
| 462 | 3300025935 | Ga0207709_10000519 | Ga0207709_1000051927 | 153 |
| 463 | 3300025937 | Ga0207669_10000688 | Ga0207669_100006887 | 153 |
| 464 | 3300025937 | Ga0207669_10001398 | Ga0207669_100013988 | 153 |
| 465 | 3300025940 | Ga0207691_10092329 | Ga0207691_100923292 | 153 |
| 466 | 3300025940 | Ga0207691_10178308 | Ga0207691_101783082 | 153 |
| 467 | 3300025940 | Ga0207691_10568172 | Ga0207691_105681722 | 153 |
| 468 | 3300025944 | Ga0207661_10231324 | Ga0207661_102313241 | 153 |
| 469 | 3300025945 | Ga0207679_10014032 | Ga0207679_100140325 | 153 |
| 470 | 3300025945 | Ga0207679_10061085 | Ga0207679_100610852 | 153 |
| 471 | 3300025949 | Ga0207667_10000010 | Ga0207667_10000010363 | 153 |
| 472 | 3300025949 | Ga0207667_10019200 | Ga0207667_100192007 | 153 |
| 473 | 3300025949 | Ga0207667_10483655 | Ga0207667_104836552 | 153 |
| 474 | 3300025960 | Ga0207651_10474834 | Ga0207651_104748342 | 153 |
| 475 | 3300025960 | Ga0207651_10728239 | Ga0207651_107282392 | 153 |
| 476 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002477 | 153 |
| 477 | 3300025961 | Ga0207712_10158317 | Ga0207712_101583173 | 153 |
| 478 | 3300025961 | Ga0207712_10182787 | Ga0207712_101827872 | 153 |
| 479 | 3300025961 | Ga0207712_10369324 | Ga0207712_103693242 | 153 |
| 480 | 3300025972 | Ga0207668_10000095 | Ga0207668_1000009515 | 153 |
| 481 | 3300025972 | Ga0207668_10436003 | Ga0207668_104360031 | 153 |
| 482 | 3300025981 | Ga0207640_10061049 | Ga0207640_100610492 | 153 |
| 483 | 3300025981 | Ga0207640_10256164 | Ga0207640_102561642 | 153 |
| 484 | 3300025981 | Ga0207640_10788341 | Ga0207640_107883412 | 153 |
| 485 | 3300025986 | Ga0207658_10330576 | Ga0207658_103305762 | 153 |
| 486 | 3300026035 | Ga0207703_10015580 | Ga0207703_100155803 | 153 |
| 487 | 3300026041 | Ga0207639_10002650 | Ga0207639_1000265014 | 153 |
| 488 | 3300026041 | Ga0207639_10009331 | Ga0207639_100093315 | 153 |
| 489 | 3300026041 | Ga0207639_11258253 | Ga0207639_112582532 | 153 |
| 490 | 3300026041 | Ga0207639_11473724 | Ga0207639_114737242 | 153 |
| 491 | 3300026067 | Ga0207678_10000766 | Ga0207678_1000076620 | 153 |
| 492 | 3300026067 | Ga0207678_10573659 | Ga0207678_105736591 | 153 |
| 493 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001203 | 153 |
| 494 | 3300026088 | Ga0207641_10005020 | Ga0207641_100050203 | 153 |
| 495 | 3300026089 | Ga0207648_10401092 | Ga0207648_104010922 | 153 |
| 496 | 3300026089 | Ga0207648_11110912 | Ga0207648_111109122 | 153 |
| 497 | 3300026095 | Ga0207676_10000266 | Ga0207676_1000026624 | 153 |
| 498 | 3300026095 | Ga0207676_10105278 | Ga0207676_101052782 | 153 |
| 499 | 3300026116 | Ga0207674_11020626 | Ga0207674_110206262 | 153 |
| 500 | 3300026118 | Ga0207675_102091961 | Ga0207675_1020919611 | 153 |
| 501 | 3300026121 | Ga0207683_10003319 | Ga0207683_100033195 | 153 |
| 502 | 3300026121 | Ga0207683_10027360 | Ga0207683_100273602 | 153 |
| 503 | 3300026142 | Ga0207698_10069323 | Ga0207698_100693234 | 153 |
| 504 | 3300027111 | Ga0209281_1046605 | Ga0209281_10466052 | 153 |
| 505 | 3300027876 | Ga0209974_10002951 | Ga0209974_100029513 | 153 |
| 506 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022090 | 153 |
| 507 | 3300028379 | Ga0268266_10015825 | Ga0268266_100158252 | 153 |
| 508 | 3300028379 | Ga0268266_11224015 | Ga0268266_112240152 | 153 |
| 509 | 3300028380 | Ga0268265_10000048 | Ga0268265_10000048157 | 153 |
| 510 | 3300028380 | Ga0268265_10370022 | Ga0268265_103700222 | 153 |
| 511 | 3300028380 | Ga0268265_11449638 | Ga0268265_114496381 | 153 |
| 512 | 3300028381 | Ga0268264_10041875 | Ga0268264_100418753 | 153 |
| 513 | 3300028381 | Ga0268264_10227795 | Ga0268264_102277953 | 153 |
| 514 | 3300028786 | Ga0307517_10029306 | Ga0307517_100293063 | 153 |
| 515 | 3300028794 | Ga0307515_10335128 | Ga0307515_103351282 | 153 |
| 516 | 3300031456 | Ga0307513_10021678 | Ga0307513_100216783 | 153 |
| 517 | 3300031456 | Ga0307513_10026366 | Ga0307513_100263669 | 153 |
| 518 | 3300031456 | Ga0307513_10099124 | Ga0307513_100991242 | 153 |
| 519 | 3300031548 | Ga0307408_100037669 | Ga0307408_1000376692 | 153 |
| 520 | 3300031548 | Ga0307408_100179112 | Ga0307408_1001791122 | 153 |
| 521 | 3300031731 | Ga0307405_10046362 | Ga0307405_100463622 | 153 |
| 522 | 3300031731 | Ga0307405_10760781 | Ga0307405_107607812 | 153 |
| 523 | 3300031824 | Ga0307413_10082788 | Ga0307413_100827882 | 153 |
| 524 | 3300031824 | Ga0307413_10646140 | Ga0307413_106461402 | 153 |
| 525 | 3300031852 | Ga0307410_10031725 | Ga0307410_100317253 | 153 |
| 526 | 3300031852 | Ga0307410_10066858 | Ga0307410_100668582 | 153 |
| 527 | 3300031901 | Ga0307406_10090205 | Ga0307406_100902051 | 153 |
| 528 | 3300031901 | Ga0307406_10128355 | Ga0307406_101283552 | 153 |
| 529 | 3300031903 | Ga0307407_10008202 | Ga0307407_100082023 | 153 |
| 530 | 3300031911 | Ga0307412_10001209 | Ga0307412_100012096 | 153 |
| 531 | 3300031911 | Ga0307412_10325664 | Ga0307412_103256642 | 153 |
| 532 | 3300031911 | Ga0307412_10687872 | Ga0307412_106878721 | 153 |
| 533 | 3300031911 | Ga0307412_10730928 | Ga0307412_107309282 | 153 |
| 534 | 3300031995 | Ga0307409_100003074 | Ga0307409_1000030745 | 153 |
| 535 | 3300031995 | Ga0307409_100033832 | Ga0307409_1000338324 | 153 |
| 536 | 3300031995 | Ga0307409_100245229 | Ga0307409_1002452293 | 153 |
| 537 | 3300031995 | Ga0307409_100254134 | Ga0307409_1002541342 | 153 |
| 538 | 3300031995 | Ga0307409_101144123 | Ga0307409_1011441232 | 153 |
| 539 | 3300031995 | Ga0307409_102062297 | Ga0307409_1020622971 | 153 |
| 540 | 3300032002 | Ga0307416_100050168 | Ga0307416_1000501682 | 153 |
| 541 | 3300032002 | Ga0307416_100853736 | Ga0307416_1008537362 | 153 |
| 542 | 3300032002 | Ga0307416_101354408 | Ga0307416_1013544081 | 153 |
| 543 | 3300032004 | Ga0307414_10218778 | Ga0307414_102187783 | 153 |
| 544 | 3300032126 | Ga0307415_100043560 | Ga0307415_1000435604 | 153 |
| 545 | 3300032126 | Ga0307415_100160827 | Ga0307415_1001608272 | 153 |
| 546 | 3300033180 | Ga0307510_10016431 | Ga0307510_100164316 | 153 |
| 547 | 3300035691 | Ga0373931_0500898 | Ga0373931_0500898_147_629 | 153 |
| 548 | 3300037312 | Ga0395899_0004293 | Ga0395899_0004293_935_1417 | 153 |
| 549 | 3300037312 | Ga0395899_0576921 | Ga0395899_0576921_55_522 | 153 |
| 550 | 3300037312 | Ga0395899_0763848 | Ga0395899_0763848_23_505 | 153 |
| 551 | 3300037418 | Ga0395900_0006142 | Ga0395900_0006142_2694_3176 | 153 |
| 552 | 3300037418 | Ga0395900_0029277 | Ga0395900_0029277_1655_2137 | 153 |
| 553 | 3300037418 | Ga0395900_0232001 | Ga0395900_0232001_817_1299 | 153 |
| 554 | 3300037418 | Ga0395900_0406941 | Ga0395900_0406941_557_1039 | 153 |
| 555 | 3300037418 | Ga0395900_0465352 | Ga0395900_0465352_113_595 | 153 |
| 556 | 3300037418 | Ga0395900_0560852 | Ga0395900_0560852_553_1035 | 153 |
| 557 | 3300037418 | Ga0395900_0717705 | Ga0395900_0717705_396_878 | 153 |
| 558 | 3300037418 | Ga0395900_1305674 | Ga0395900_1305674_53_535 | 153 |
| 559 | 3300037418 | Ga0395900_1769977 | Ga0395900_1769977_27_509 | 153 |
| 560 | 3300037466 | Ga0395898_0019268 | Ga0395898_0019268_78_560 | 153 |
| 561 | 3300037466 | Ga0395898_0422397 | Ga0395898_0422397_39_521 | 153 |
| 562 | 3300037466 | Ga0395898_0500766 | Ga0395898_0500766_40_522 | 153 |
| 563 | 3300037466 | Ga0395898_0504124 | Ga0395898_0504124_202_684 | 153 |
| 564 | 3300037466 | Ga0395898_0642573 | Ga0395898_0642573_258_740 | 153 |
| 565 | 3300037466 | Ga0395898_0708193 | Ga0395898_0708193_259_741 | 153 |
| 566 | 3300037471 | Ga0395905_0012133 | Ga0395905_0012133_3354_3836 | 153 |
| 567 | 3300037471 | Ga0395905_0013769 | Ga0395905_0013769_1116_1598 | 153 |
| 568 | 3300037471 | Ga0395905_0146241 | Ga0395905_0146241_1389_1871 | 153 |
| 569 | 3300037471 | Ga0395905_0165458 | Ga0395905_0165458_1098_1580 | 153 |
| 570 | 3300037471 | Ga0395905_0184714 | Ga0395905_0184714_854_1336 | 153 |
| 571 | 3300037471 | Ga0395905_0226247 | Ga0395905_0226247_1049_1531 | 153 |
| 572 | 3300037471 | Ga0395905_0278199 | Ga0395905_0278199_105_587 | 153 |
| 573 | 3300037471 | Ga0395905_0280731 | Ga0395905_0280731_733_1215 | 153 |
| 574 | 3300037471 | Ga0395905_0728424 | Ga0395905_0728424_182_649 | 153 |
| 575 | 3300037471 | Ga0395905_0787930 | Ga0395905_0787930_348_830 | 153 |
| 576 | 3300037471 | Ga0395905_1022457 | Ga0395905_1022457_23_505 | 153 |
| 577 | 3300037471 | Ga0395905_1027200 | Ga0395905_1027200_24_506 | 153 |
| 578 | 3300037853 | Ga0436364_0383514 | Ga0436364_0383514_37_501 | 153 |
| 579 | 3300037853 | Ga0436364_1265496 | Ga0436364_1265496_4503_4985 | 153 |
| 580 | 3300038443 | Ga0395901_0006471 | Ga0395901_0006471_9479_9961 | 153 |
| 581 | 3300038443 | Ga0395901_0008086 | Ga0395901_0008086_4574_5056 | 153 |
| 582 | 3300038443 | Ga0395901_0012772 | Ga0395901_0012772_71_553 | 153 |
| 583 | 3300038443 | Ga0395901_0447489 | Ga0395901_0447489_733_1215 | 153 |
| 584 | 3300038443 | Ga0395901_1397569 | Ga0395901_1397569_153_635 | 153 |
| 585 | 3300039437 | Ga0436365_0011005 | Ga0436365_0011005_41987_42466 | 153 |
| 586 | 3300039453 | Ga0436362_0287059 | Ga0436362_0287059_41987_42466 | 153 |
| 587 | 3300041404 | Ga0439436_0014215 | Ga0439436_0014215_1545_2006 | 153 |
| 588 | 3300041406 | Ga0439439_0025555 | Ga0439439_0025555_620_1081 | 153 |
| 589 | 3300041407 | Ga0439447_161997 | Ga0439447_161997_31_492 | 153 |
| 590 | 3300041410 | Ga0439461_0002751 | Ga0439461_0002751_1049_1510 | 153 |
| 591 | 3300041413 | Ga0439465_0000503 | Ga0439465_0000503_9909_10370 | 153 |
| 592 | 3300041413 | Ga0439465_0038445 | Ga0439465_0038445_1049_1510 | 153 |
| 593 | 3300041505 | Ga0451849_1365278 | Ga0451849_1365278_62_544 | 153 |
| 594 | 3300041997 | Ga0439431_0000032 | Ga0439431_0000032_17751_18212 | 153 |
| 595 | 3300042002 | Ga0439442_024784 | Ga0439442_024784_275_736 | 153 |
| 596 | 3300042003 | Ga0439443_084187 | Ga0439443_084187_55_531 | 153 |
| 597 | 3300042006 | Ga0439432_015344 | Ga0439432_015344_1065_1526 | 153 |
| 598 | 3300042010 | Ga0439452_016997 | Ga0439452_016997_1169_1630 | 153 |
| 599 | 3300042015 | Ga0439462_0005391 | Ga0439462_0005391_1381_1842 | 153 |
| 600 | 3300042015 | Ga0439462_0114153 | Ga0439462_0114153_274_735 | 153 |
| 601 | 3300042134 | Ga0450898_007035 | Ga0450898_007035_223_696 | 153 |
| 602 | 3300042185 | Ga0450909_019070 | Ga0450909_019070_21_482 | 153 |
| 603 | 3300042435 | Ga0439434_0000321 | Ga0439434_0000321_11839_12300 | 153 |
| 604 | 3300042435 | Ga0439434_0033481 | Ga0439434_0033481_234_695 | 153 |
| 605 | 3300042435 | Ga0439434_0058771 | Ga0439434_0058771_472_945 | 153 |
| 606 | 3300042461 | Ga0439460_0224251 | Ga0439460_0224251_10_498 | 153 |
| 607 | 3300044684 | Ga0466966_0012606 | Ga0466966_0012606_1827_2309 | 153 |
| 608 | 3300044693 | Ga0466961_0202435 | Ga0466961_0202435_175_657 | 153 |
| 609 | 3300044694 | Ga0466963_0170187 | Ga0466963_0170187_548_1030 | 153 |
| 610 | 3300044694 | Ga0466963_0775724 | Ga0466963_0775724_76_558 | 153 |
| 611 | 3300044719 | Ga0466971_0032538 | Ga0466971_0032538_894_1376 | 153 |
| 612 | 3300044765 | Ga0466970_0023018 | Ga0466970_0023018_1460_1942 | 153 |
| 613 | 3300044765 | Ga0466970_0124999 | Ga0466970_0124999_467_949 | 153 |
| 614 | 3300044765 | Ga0466970_0272416 | Ga0466970_0272416_456_932 | 153 |
| 615 | 3300045049 | Ga0466959_0079138 | Ga0466959_0079138_981_1463 | 153 |
| 616 | 3300045976 | Ga0466967_0097276 | Ga0466967_0097276_1195_1677 | 153 |
| 617 | 3300045976 | Ga0466967_0905879 | Ga0466967_0905879_395_856 | 153 |
| 618 | 3300045976 | Ga0466967_1044786 | Ga0466967_1044786_272_754 | 153 |
| 619 | 3300045976 | Ga0466967_1471167 | Ga0466967_1471167_100_582 | 153 |
| 620 | 3300046459 | Ga0495629_0037829 | Ga0495629_0037829_1513_1980 | 153 |
| 621 | 3300046460 | Ga0495638_0278506 | Ga0495638_0278506_143_610 | 153 |
| 622 | 3300046471 | Ga0495650_0000058 | Ga0495650_0000058_231038_231505 | 153 |
| 623 | 3300046491 | Ga0495584_0321877 | Ga0495584_0321877_289_756 | 153 |
| 624 | 3300046492 | Ga0495585_0026323 | Ga0495585_0026323_2186_2653 | 153 |
| 625 | 3300046501 | Ga0495607_0368119 | Ga0495607_0368119_118_585 | 153 |
| 626 | 3300046506 | Ga0495583_0002149 | Ga0495583_0002149_2589_3056 | 153 |
| 627 | 3300046506 | Ga0495583_0008668 | Ga0495583_0008668_277_744 | 153 |
| 628 | 3300046506 | Ga0495583_0011100 | Ga0495583_0011100_3477_3944 | 153 |
| 629 | 3300046507 | Ga0495606_0000359 | Ga0495606_0000359_49363_49830 | 153 |
| 630 | 3300046513 | Ga0495616_0027215 | Ga0495616_0027215_1354_1821 | 153 |
| 631 | 3300046518 | Ga0495631_0049559 | Ga0495631_0049559_14_481 | 153 |
| 632 | 3300046518 | Ga0495631_0062294 | Ga0495631_0062294_310_777 | 153 |
| 633 | 3300046519 | Ga0495632_0000060 | Ga0495632_0000060_85607_86080 | 153 |
| 634 | 3300046520 | Ga0495637_0024194 | Ga0495637_0024194_199_666 | 153 |
| 635 | 3300046520 | Ga0495637_0027122 | Ga0495637_0027122_520_993 | 153 |
| 636 | 3300046522 | Ga0495643_0000014 | Ga0495643_0000014_180119_180592 | 153 |
| 637 | 3300046522 | Ga0495643_0003466 | Ga0495643_0003466_9678_10145 | 153 |
| 638 | 3300046522 | Ga0495643_0003475 | Ga0495643_0003475_5576_6043 | 153 |
| 639 | 3300046522 | Ga0495643_0236222 | Ga0495643_0236222_187_654 | 153 |
| 640 | 3300046524 | Ga0495648_0192194 | Ga0495648_0192194_456_920 | 153 |
| 641 | 3300046525 | Ga0495663_0000007 | Ga0495663_0000007_128663_129136 | 153 |
| 642 | 3300046525 | Ga0495663_0003896 | Ga0495663_0003896_266_733 | 153 |
| 643 | 3300046528 | Ga0495642_0029122 | Ga0495642_0029122_1695_2162 | 153 |
| 644 | 3300046536 | Ga0495587_0116803 | Ga0495587_0116803_418_885 | 153 |
| 645 | 3300046538 | Ga0495609_0105027 | Ga0495609_0105027_461_928 | 153 |
| 646 | 3300046557 | Ga0495622_0033204 | Ga0495622_0033204_20_487 | 153 |
| 647 | 3300046558 | Ga0495633_0000722 | Ga0495633_0000722_5046_5513 | 153 |
| 648 | 3300046558 | Ga0495633_0001967 | Ga0495633_0001967_9281_9754 | 153 |
| 649 | 3300046558 | Ga0495633_0033208 | Ga0495633_0033208_1203_1670 | 153 |
| 650 | 3300046558 | Ga0495633_0085980 | Ga0495633_0085980_866_1339 | 153 |
| 651 | 3300046558 | Ga0495633_0397004 | Ga0495633_0397004_22_510 | 153 |
| 652 | 3300046616 | Ga0495668_0000163 | Ga0495668_0000163_98992_99459 | 153 |
| 653 | 3300046616 | Ga0495668_0032485 | Ga0495668_0032485_822_1286 | 153 |
| 654 | 3300046648 | Ga0495611_0037145 | Ga0495611_0037145_139_606 | 153 |
| 655 | 3300046648 | Ga0495611_0322776 | Ga0495611_0322776_35_502 | 153 |
| 656 | 3300046660 | Ga0495625_0000568 | Ga0495625_0000568_16897_17364 | 153 |
| 657 | 3300046660 | Ga0495625_0027964 | Ga0495625_0027964_3295_3762 | 153 |
| 658 | 3300046660 | Ga0495625_0088136 | Ga0495625_0088136_1481_1948 | 153 |
| 659 | 3300046665 | Ga0495661_0321545 | Ga0495661_0321545_279_746 | 153 |
| 660 | 3300046665 | Ga0495661_0400507 | Ga0495661_0400507_34_498 | 153 |
| 661 | 3300046684 | Ga0495669_0000096 | Ga0495669_0000096_3932_4399 | 153 |
| 662 | 3300046684 | Ga0495669_0069883 | Ga0495669_0069883_233_715 | 153 |
| 663 | 3300046691 | Ga0495670_0000002 | Ga0495670_0000002_597327_597788 | 153 |
| 664 | 3300046691 | Ga0495670_0035919 | Ga0495670_0035919_1654_2121 | 153 |
| 665 | 3300046691 | Ga0495670_0100073 | Ga0495670_0100073_823_1308 | 153 |
| 666 | 3300046691 | Ga0495670_0167230 | Ga0495670_0167230_618_1094 | 153 |
| 667 | 3300046692 | Ga0495671_0000032 | Ga0495671_0000032_66672_67145 | 153 |
| 668 | 3300046692 | Ga0495671_0424699 | Ga0495671_0424699_35_502 | 153 |
| 669 | 3300046694 | Ga0495649_0197103 | Ga0495649_0197103_227_694 | 153 |
| 670 | 3300046694 | Ga0495649_0204435 | Ga0495649_0204435_52_516 | 153 |
| 671 | 3300046809 | Ga0495600_0001482 | Ga0495600_0001482_8256_8723 | 153 |
| 672 | 3300047323 | Ga0495683_0003243 | Ga0495683_0003243_3483_3950 | 153 |
| 673 | 3300047323 | Ga0495683_0050546 | Ga0495683_0050546_239_706 | 153 |
| 674 | 3300047323 | Ga0495683_0282799 | Ga0495683_0282799_93_575 | 153 |
| 675 | 3300047443 | Ga0495687_000378 | Ga0495687_000378_51747_52214 | 153 |
| 676 | 3300047443 | Ga0495687_000511 | Ga0495687_000511_31610_32077 | 153 |
| 677 | 3300047445 | Ga0495677_0002165 | Ga0495677_0002165_1631_2095 | 153 |
| 678 | 3300047445 | Ga0495677_0009953 | Ga0495677_0009953_119_586 | 153 |
| 679 | 3300047470 | Ga0495681_0012956 | Ga0495681_0012956_723_1190 | 153 |
| 680 | 3300047470 | Ga0495681_0015295 | Ga0495681_0015295_3306_3779 | 153 |
| 681 | 3300047470 | Ga0495681_0124120 | Ga0495681_0124120_17_481 | 153 |
| 682 | 3300047470 | Ga0495681_0180537 | Ga0495681_0180537_349_816 | 153 |
| 683 | 3300047472 | Ga0495686_0000191 | Ga0495686_0000191_25367_25828 | 153 |
| 684 | 3300047472 | Ga0495686_0006710 | Ga0495686_0006710_157_618 | 153 |
| 685 | 3300047472 | Ga0495686_0098637 | Ga0495686_0098637_184_657 | 153 |
| 686 | 3300047472 | Ga0495686_0341753 | Ga0495686_0341753_13_474 | 153 |
| 687 | 3300048903 | Ga0496100_0110081 | Ga0496100_0110081_246_728 | 153 |
| 688 | 3300048904 | Ga0496101_0021750 | Ga0496101_0021750_2306_2788 | 153 |
| 689 | 3300048905 | Ga0496102_0000069 | Ga0496102_0000069_97017_97478 | 153 |
| 690 | 3300048905 | Ga0496102_0000281 | Ga0496102_0000281_5656_6123 | 153 |
| 691 | 3300048905 | Ga0496102_0505399 | Ga0496102_0505399_513_983 | 153 |
| 692 | 3300048905 | Ga0496102_1256428 | Ga0496102_1256428_48_530 | 153 |
| 693 | 3300048906 | Ga0496103_0000173 | Ga0496103_0000173_55609_56070 | 153 |
| 694 | 3300048906 | Ga0496103_0001375 | Ga0496103_0001375_10390_10857 | 153 |
| 695 | 3300048907 | Ga0496104_0025056 | Ga0496104_0025056_1123_1590 | 153 |
| 696 | 3300048907 | Ga0496104_0279269 | Ga0496104_0279269_766_1227 | 153 |
| 697 | 3300048910 | Ga0496107_0014793 | Ga0496107_0014793_4383_4865 | 153 |
| 698 | 3300048910 | Ga0496107_0389245 | Ga0496107_0389245_323_784 | 153 |
| 699 | 3300048914 | Ga0496111_0064758 | Ga0496111_0064758_782_1249 | 153 |
| 700 | 3300048915 | Ga0496112_0009308 | Ga0496112_0009308_4095_4577 | 153 |
| 701 | 3300048915 | Ga0496112_0009432 | Ga0496112_0009432_436_918 | 153 |
| 702 | 3300048915 | Ga0496112_0236132 | Ga0496112_0236132_129_611 | 153 |
| 703 | 3300048917 | Ga0496114_0014216 | Ga0496114_0014216_1378_1845 | 153 |
| 704 | 3300048918 | Ga0496115_0000134 | Ga0496115_0000134_23655_24122 | 153 |
| 705 | 3300048918 | Ga0496115_0001169 | Ga0496115_0001169_3733_4194 | 153 |
| 706 | 3300048919 | Ga0496116_0000566 | Ga0496116_0000566_46839_47300 | 153 |
| 707 | 3300048919 | Ga0496116_0006626 | Ga0496116_0006626_8898_9365 | 153 |
| 708 | 3300048920 | Ga0496117_0000485 | Ga0496117_0000485_10540_11001 | 153 |
| 709 | 3300048920 | Ga0496117_0002942 | Ga0496117_0002942_14521_14988 | 153 |
| 710 | 3300048921 | Ga0496118_0000190 | Ga0496118_0000190_10540_11001 | 153 |
| 711 | 3300048921 | Ga0496118_0000392 | Ga0496118_0000392_43073_43540 | 153 |
| 712 | 3300048922 | Ga0496119_0090314 | Ga0496119_0090314_529_990 | 153 |
| 713 | 3300048922 | Ga0496119_0092952 | Ga0496119_0092952_484_951 | 153 |
| 714 | 3300048922 | Ga0496119_0166594 | Ga0496119_0166594_549_1010 | 153 |
| 715 | 3300048923 | Ga0496120_0007020 | Ga0496120_0007020_2502_2969 | 153 |
| 716 | 3300048924 | Ga0496121_0000105 | Ga0496121_0000105_66750_67211 | 153 |
| 717 | 3300048924 | Ga0496121_0000655 | Ga0496121_0000655_58931_59398 | 153 |
| 718 | 3300048925 | Ga0496122_0048047 | Ga0496122_0048047_656_1117 | 153 |
| 719 | 3300048926 | Ga0496123_0004252 | Ga0496123_0004252_1800_2363 | 153 |
| 720 | 3300048926 | Ga0496123_0060789 | Ga0496123_0060789_1566_2027 | 153 |
| 721 | 3300048927 | Ga0496124_0000068 | Ga0496124_0000068_215708_216175 | 153 |
| 722 | 3300048927 | Ga0496124_0000175 | Ga0496124_0000175_114367_114828 | 153 |
| 723 | 3300048927 | Ga0496124_0000546 | Ga0496124_0000546_52624_53085 | 153 |
| 724 | 3300048927 | Ga0496124_0001803 | Ga0496124_0001803_23263_23826 | 153 |
| 725 | 3300048927 | Ga0496124_0050277 | Ga0496124_0050277_1691_2152 | 153 |
| 726 | 3300048928 | Ga0496125_0056664 | Ga0496125_0056664_1433_1894 | 153 |
| 727 | 3300048929 | Ga0496126_0000634 | Ga0496126_0000634_59583_60050 | 153 |
| 728 | 3300049570 | Ga0501033_0262624 | Ga0501033_0262624_16_477 | 153 |
| 729 | 3300049571 | Ga0501034_0707041 | Ga0501034_0707041_404_865 | 153 |
| 730 | 3300049581 | Ga0501047_0311038 | Ga0501047_0311038_496_957 | 153 |
| 731 | 3300049742 | Ga0501080_0700549 | Ga0501080_0700549_167_628 | 153 |
| 732 | 3300049765 | Ga0501268_055004 | Ga0501268_055004_253_732 | 153 |
| 733 | 3300049776 | Ga0501280_003226 | Ga0501280_003226_37_510 | 153 |
| 734 | 3300050489 | nmdc:mga03683_197501_c1 | nmdc:mga03683_197501_c1_375_836 | 153 |
| 735 | 3300050493 | nmdc:mga0k408_31120_c1 | nmdc:mga0k408_31120_c1_1165_1632 | 153 |
| 736 | 3300050509 | nmdc:mga0qj67_182633_c1 | nmdc:mga0qj67_182633_c1_401_874 | 153 |
| 737 | 3300050511 | nmdc:mga08y16_982596_c1 | nmdc:mga08y16_982596_c1_80_553 | 153 |
| 738 | 3300050516 | nmdc:mga0sz30_242758_c1 | nmdc:mga0sz30_242758_c1_21_488 | 153 |
| 739 | 3300053083 | Ga0495655_0035620 | Ga0495655_0035620_499_981 | 153 |
| 740 | 3300053087 | Ga0500643_000924 | Ga0500643_000924_6747_7211 | 153 |
| 741 | 3300053087 | Ga0500643_007382 | Ga0500643_007382_675_1139 | 153 |
| 742 | 3300053090 | Ga0500646_0207484 | Ga0500646_0207484_63_524 | 153 |
| 743 | 3300053094 | Ga0500566_0000374 | Ga0500566_0000374_12849_13310 | 153 |
| 744 | 3300053096 | Ga0500641_0113535 | Ga0500641_0113535_320_781 | 153 |
| 745 | 3300053098 | Ga0500650_0380821 | Ga0500650_0380821_21_485 | 153 |
| 746 | 3300053104 | Ga0500556_0011172 | Ga0500556_0011172_102_572 | 153 |
| 747 | 3300053108 | Ga0500562_016340 | Ga0500562_016340_141_602 | 153 |
| 748 | 3300053116 | Ga0500592_003670 | Ga0500592_003670_370_831 | 153 |
| 749 | 3300053119 | Ga0500595_002853 | Ga0500595_002853_5545_6012 | 153 |
| 750 | 3300053119 | Ga0500595_033823 | Ga0500595_033823_672_1133 | 153 |
| 751 | 3300053120 | Ga0500597_028503 | Ga0500597_028503_189_653 | 153 |
| 752 | 3300053134 | Ga0500658_0004231 | Ga0500658_0004231_1536_1997 | 153 |
| 753 | 3300053134 | Ga0500658_0006024 | Ga0500658_0006024_866_1330 | 153 |
| 754 | 3300053139 | Ga0500568_0074951 | Ga0500568_0074951_454_915 | 153 |
| 755 | 3300053151 | Ga0500604_0020991 | Ga0500604_0020991_1228_1689 | 153 |
| 756 | 3300053154 | Ga0500619_002638 | Ga0500619_002638_2650_3117 | 153 |
| 757 | 3300053157 | Ga0500624_000022 | Ga0500624_000022_115360_115824 | 153 |
| 758 | 3300053158 | Ga0500627_0000068 | Ga0500627_0000068_35580_36041 | 153 |
| 759 | 3300053158 | Ga0500627_0301936 | Ga0500627_0301936_178_645 | 153 |
| 760 | 3300053177 | Ga0500636_0003684 | Ga0500636_0003684_2630_3097 | 153 |
| 761 | 3300053178 | Ga0500637_0000095 | Ga0500637_0000095_30143_30607 | 153 |
| 762 | 3300053727 | Ga0500611_001944 | Ga0500611_001944_1173_1637 | 153 |
| 763 | 3300053730 | Ga0500645_000008 | Ga0500645_000008_206204_206671 | 153 |
| 764 | 3300053730 | Ga0500645_077934 | Ga0500645_077934_161_625 | 153 |
| 765 | 3300053735 | Ga0500596_003731 | Ga0500596_003731_2063_2530 | 153 |
| 766 | 3300055283 | Ga0500661_024634 | Ga0500661_024634_114_581 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7w89-assembly1.cif.gz_A | the structure of deinococcus radiodurans yqgf | 0.885 | 17 | 148 |
| 7w89-assembly1.cif.gz_A | the structure of deinococcus radiodurans yqgf | 0.8579 | 17 | 148 |
| 1nmn-assembly1.cif.gz_A | structure of yqgf from escherichia coli, a hypothetical protein | 0.8485 | 16 | 149 |
| 1nmn-assembly2.cif.gz_B | structure of yqgf from escherichia coli, a hypothetical protein | 0.8386 | 16 | 148 |
| 1nu0-assembly2.cif.gz_B | structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein | 0.834 | 16 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGV7_22_163_3.30.420.140 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain | 0.9217 | 17 | 152 | 3.30.420.140 |
| af_P9WGV7_22_163_3.30.420.140 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain | 0.879 | 17 | 152 | 3.30.420.140 |
| af_F4IC62_83_217_3.30.420.140 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain | 0.8678 | 20 | 149 | 3.30.420.140 |
| af_Q2FXW1_3_142_3.30.420.140 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain | 0.8365 | 17 | 150 | 3.30.420.140 |
| af_Q8GYR7_22_166_3.30.420.140 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain | 0.8353 | 17 | 152 | 3.30.420.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V5KJL9-F1-model_v4 | Multifunctional fusion protein [Includes: Putative pre-16S rRNA nuclease (EC 3.1.-.-); UPF0473 protein BWY81_00711] | 0.9713 | 18 | 149 |
GO:0000967
GO:0004518 GO:0005829 |
| AF-A0A7V3UIF6-F1-model_v4 | Putative pre-16S rRNA nuclease (EC 3.1.-.-) | 0.9685 | 15 | 152 |
GO:0000967
GO:0004518 GO:0005829 |
| AF-A0A2V9WEU1-F1-model_v4 | Putative pre-16S rRNA nuclease (EC 3.1.-.-) | 0.9676 | 14 | 152 |
GO:0000967
GO:0004518 GO:0005829 |
| AF-X1G2L9-F1-model_v4 | YqgF/RNase H-like domain-containing protein | 0.967 | 18 | 104 |
GO:0000967
GO:0004518 GO:0005829 |
| AF-A0A3R8B1S0-F1-model_v4 | Holliday junction resolvase RuvX | 0.9658 | 7 | 97 |
GO:0000967
GO:0004518 GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar