F479834

General Info

Members Datasets Scaffolds Average Seq Length
766 313 766 157

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100103063|Ga0068857_1001030633
Length 187
Sequence MFAPMPRVGWPLTSPERGGGEAFAPPPRLPYSRAVITTVPSDFRAVLPEGGRLIGLDVGTKTIGTALCDAGWSFASPAQLIRRTKFTKDKAALVELITAQQVRGMVIGLPLNLDGTDSPRTQSTRAFARNLEDLGLPILMWDERWSTVAVERTLIEQDASRAKRAELIDKMAAAYILQGAIDGLVNT

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
191 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
192 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
193 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
194 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
197 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
198 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
199 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
200 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
201 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
274 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
275 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
276 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
279 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
280 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
281 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
282 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
283 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
284 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
290 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
291 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
292 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
296 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
297 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
298 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
299 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
300 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
301 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
304 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
305 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
306 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
309 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
312 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
313 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.1
Nodule 0.26
Rhizoplane 2.74
Rhizosphere 81.46
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c004772 3300000041 Bacteria 1170
2 JGI24740J21852_10043438 3300001979 Bacteria 1340
3 JGI24739J22299_10045976 3300001989 Bacteria 1431
4 JGI25150J39212_1000371 3300002774 Bacteria 21646
5 JGI25151J46595_10040622 3300003187 Bacteria 1701
6 JGI25153J46596_10000072 3300003215 Bacteria 115187
7 JGI25153J46596_10000113 3300003215 Bacteria 92345
8 JGI25153J46596_10011776 3300003215 Bacteria 3838
9 JGI25153J46596_10033304 3300003215 Bacteria 1703
10 Ga0055525_1000090 3300003759 Bacteria 141071
11 Ga0055542_1000568 3300003762 Bacteria 32512
12 Ga0055529_1000007 3300003763 Bacteria 403604
13 Ga0055529_1000109 3300003763 Bacteria 121019
14 Ga0055526_1014390 3300003771 Bacteria 3259
15 Ga0055537_1001776 3300003773 Bacteria 7894
16 Ga0055537_1007102 3300003773 Bacteria 2747
17 Ga0055524_1000030 3300003775 Bacteria 187756
18 Ga0055536_1015225 3300003781 Bacteria 2646
19 Ga0055534_1025003 3300003784 Bacteria 963
20 Ga0055530_10002769 3300003791 Bacteria 10828
21 Ga0055530_10007045 3300003791 Bacteria 4834
22 Ga0055530_10037092 3300003791 Bacteria 1222
23 Ga0055540_1001950 3300003792 Bacteria 11536
24 Ga0055531_10011244 3300003794 Bacteria 4344
25 Ga0055531_10016815 3300003794 Bacteria 3130
26 Ga0055543_1038990 3300004625 Bacteria 807
27 Ga0065165_1003301 3300005262 Bacteria 11598
28 Ga0065165_1016642 3300005262 Bacteria 2744
29 Ga0065165_1058829 3300005262 Bacteria 1060
30 Ga0065712_10133692 3300005290 Bacteria 1520
31 Ga0065712_10177419 3300005290 Bacteria 1210
32 Ga0065715_10123474 3300005293 Bacteria 2177
33 Ga0065715_10264084 3300005293 Bacteria 1129
34 Ga0070658_10131111 3300005327 Bacteria 2089
35 Ga0070658_10629296 3300005327 Bacteria 931
36 Ga0070658_10963645 3300005327 Bacteria 742
37 Ga0070676_10046635 3300005328 Bacteria 2528
38 Ga0070676_10148724 3300005328 Bacteria 1497
39 Ga0070676_10611688 3300005328 Bacteria 787
40 Ga0070683_100311548 3300005329 Bacteria 1498
41 Ga0070670_100005458 3300005331 Bacteria 10724
42 Ga0070670_100025761 3300005331 Bacteria 5061
43 Ga0070670_100030479 3300005331 Bacteria 4645
44 Ga0070670_100080462 3300005331 Bacteria 2800
45 Ga0070677_10015159 3300005333 Bacteria 2727
46 Ga0070677_10287692 3300005333 Bacteria 830
47 Ga0070666_10016649 3300005335 Bacteria 4704
48 Ga0070680_100001375 3300005336 Bacteria 17594
49 Ga0070682_100548140 3300005337 Bacteria 904
50 Ga0068868_100049426 3300005338 Bacteria 3300
51 Ga0070660_100000678 3300005339 Bacteria 22503
52 Ga0070660_100010750 3300005339 Bacteria 6479
53 Ga0070660_100090166 3300005339 Bacteria 2417
54 Ga0070661_100036375 3300005344 Bacteria 3579
55 Ga0070661_100103170 3300005344 Bacteria 2124
56 Ga0070661_100132023 3300005344 Bacteria 1877
57 Ga0070661_100953781 3300005344 Bacteria 710
58 Ga0070668_100000866 3300005347 Bacteria 21035
59 Ga0070669_100069166 3300005353 Bacteria 2607
60 Ga0070669_100416180 3300005353 Bacteria 1102
61 Ga0070675_100001861 3300005354 Bacteria 15546
62 Ga0070675_100046035 3300005354 Bacteria 3572
63 Ga0070675_100066444 3300005354 Bacteria 2983
64 Ga0070675_100418332 3300005354 Bacteria 1198
65 Ga0070671_100000229 3300005355 Bacteria 37462
66 Ga0070671_100014846 3300005355 Bacteria 6292
67 Ga0070671_100025732 3300005355 Bacteria 4831
68 Ga0070671_100124793 3300005355 Bacteria 2167
69 Ga0070671_100735937 3300005355 Bacteria 857
70 Ga0070674_100009305 3300005356 Bacteria 5881
71 Ga0070674_100022158 3300005356 Bacteria 4093
72 Ga0070674_100046526 3300005356 Bacteria 2969
73 Ga0070674_100935744 3300005356 Bacteria 757
74 Ga0070673_100172161 3300005364 Bacteria 1849
75 Ga0070673_100606681 3300005364 Bacteria 999
76 Ga0070673_101307105 3300005364 Bacteria 681
77 Ga0070688_101169469 3300005365 Bacteria 617
78 Ga0070659_100052960 3300005366 Bacteria 3194
79 Ga0070659_100508026 3300005366 Bacteria 1028
80 Ga0070659_100812838 3300005366 Bacteria 813
81 Ga0070714_101030431 3300005435 Bacteria 801
82 Ga0070663_100000936 3300005455 Bacteria 15858
83 Ga0070663_100327625 3300005455 Bacteria 1233
84 Ga0070678_100008085 3300005456 Bacteria 6278
85 Ga0070678_100409718 3300005456 Bacteria 1179
86 Ga0070678_101180233 3300005456 Bacteria 709
87 Ga0070662_100158225 3300005457 Bacteria 1770
88 Ga0070662_100370326 3300005457 Bacteria 1177
89 Ga0070662_100392701 3300005457 Bacteria 1144
90 Ga0070662_100678100 3300005457 Bacteria 871
91 Ga0070681_11336455 3300005458 Bacteria 640
92 Ga0070685_10417461 3300005466 Bacteria 933
93 Ga0070679_100001182 3300005530 Bacteria 22889
94 Ga0068853_101021074 3300005539 Bacteria 796
95 Ga0070672_100243695 3300005543 Bacteria 1512
96 Ga0070672_100407577 3300005543 Bacteria 1166
97 Ga0070696_100322340 3300005546 Bacteria 1189
98 Ga0070665_100000044 3300005548 Bacteria 276702
99 Ga0070665_100289401 3300005548 Bacteria 1641
100 Ga0070665_101394001 3300005548 Bacteria 710
101 Ga0070664_100001633 3300005564 Bacteria 17950
102 Ga0070664_100005797 3300005564 Bacteria 9967
103 Ga0070664_100338280 3300005564 Bacteria 1367
104 Ga0070664_100565018 3300005564 Bacteria 1053
105 Ga0070664_101690712 3300005564 Bacteria 600
106 Ga0068857_100103063 3300005577 Bacteria 2562
107 Ga0068854_100016865 3300005578 Bacteria 4877
108 Ga0068854_100159394 3300005578 Bacteria 1746
109 Ga0068854_100177479 3300005578 Bacteria 1662
110 Ga0068854_100300186 3300005578 Bacteria 1299
111 Ga0068854_100517717 3300005578 Bacteria 1007
112 Ga0068852_100093419 3300005616 Bacteria 2696
113 Ga0068864_100017494 3300005618 Bacteria 5976
114 Ga0068864_100086873 3300005618 Bacteria 2752
115 Ga0068864_100327470 3300005618 Bacteria 1440
116 Ga0068864_100409558 3300005618 Bacteria 1290
117 Ga0068861_100000342 3300005719 Bacteria 26513
118 Ga0068870_10290170 3300005840 Bacteria 1029
119 Ga0068863_100000030 3300005841 Bacteria 176023
120 Ga0068863_100026944 3300005841 Bacteria 5481
121 Ga0068858_100018879 3300005842 Bacteria 6451
122 Ga0068860_100013256 3300005843 Bacteria 8089
123 Ga0068860_100231329 3300005843 Bacteria 1796
124 Ga0068862_100000193 3300005844 Bacteria 67697
125 Ga0068862_101299057 3300005844 Bacteria 729
126 Ga0068862_101602987 3300005844 Bacteria 658
127 Ga0081539_10026991 3300005985 Bacteria 3646
128 Ga0081539_10084838 3300005985 Bacteria 1654
129 Ga0097621_100438278 3300006237 Bacteria 1175
130 Ga0097621_100550463 3300006237 Bacteria 1050
131 Ga0075370_10246309 3300006353 Bacteria 1059
132 Ga0068871_100240981 3300006358 Bacteria 1572
133 Ga0068871_100290180 3300006358 Bacteria 1433
134 Ga0068871_100494788 3300006358 Bacteria 1101
135 Ga0075434_101151816 3300006871 Bacteria 788
136 Ga0097620_100007008 3300006931 Bacteria 11447
137 Ga0097620_100253232 3300006931 Bacteria 1851
138 Ga0079104_1037292 3300006946 Bacteria 1159
139 Ga0105251_10375239 3300009011 Bacteria 651
140 Ga0105240_10194992 3300009093 Bacteria 2379
141 Ga0105240_10266083 3300009093 Bacteria 1976
142 Ga0111539_10752068 3300009094 Bacteria 1134
143 Ga0111539_12006472 3300009094 Bacteria 671
144 Ga0105247_10038604 3300009101 Bacteria 2916
145 Ga0105243_10000224 3300009148 Bacteria 65196
146 Ga0105241_10095554 3300009174 Bacteria 2353
147 Ga0105242_10069746 3300009176 Bacteria 2912
148 Ga0105248_10000774 3300009177 Bacteria 35872
149 Ga0105248_10033959 3300009177 Bacteria 5701
150 Ga0105248_10132262 3300009177 Bacteria 2815
151 Ga0105248_10280058 3300009177 Bacteria 1877
152 Ga0105237_10077367 3300009545 Bacteria 3317
153 Ga0105237_10310267 3300009545 Bacteria 1581
154 Ga0105249_10000002 3300009553 Bacteria 376207
155 Ga0105249_10222561 3300009553 Bacteria 1858
156 Ga0105249_11499678 3300009553 Bacteria 747
157 Ga0105239_12020966 3300010375 Bacteria 669
158 Ga0105239_12389164 3300010375 Bacteria 616
159 Ga0105246_10384876 3300011119 Bacteria 1160
160 Ga0157326_1002610 3300012513 Bacteria 1919
161 Ga0157373_10206341 3300013100 Bacteria 1385
162 Ga0157371_10103514 3300013102 Bacteria 2020
163 Ga0157371_10513931 3300013102 Bacteria 885
164 Ga0157371_10956656 3300013102 Bacteria 652
165 Ga0157370_10033595 3300013104 Bacteria 5001
166 Ga0157370_10074287 3300013104 Bacteria 3207
167 Ga0157370_10492452 3300013104 Bacteria 1126
168 Ga0157369_10050386 3300013105 Bacteria 4510
169 Ga0157369_10253056 3300013105 Bacteria 1838
170 Ga0157369_10421097 3300013105 Bacteria 1384
171 Ga0157369_10498766 3300013105 Bacteria 1260
172 Ga0157374_10008990 3300013296 Bacteria 8566
173 Ga0157374_11001573 3300013296 Bacteria 855
174 Ga0157374_11275575 3300013296 Bacteria 756
175 Ga0163162_11071317 3300013306 Bacteria 913
176 Ga0157372_10277840 3300013307 Bacteria 1947
177 Ga0157372_10478430 3300013307 Bacteria 1452
178 Ga0157372_11187251 3300013307 Bacteria 882
179 Ga0157375_10028876 3300013308 Bacteria 5207
180 Ga0157375_10529705 3300013308 Bacteria 1341
181 Ga0157375_11977275 3300013308 Unclassified 693
182 Ga0163163_10603432 3300014325 Bacteria 1161
183 Ga0163163_10941617 3300014325 Bacteria 927
184 Ga0157380_10128261 3300014326 Bacteria 2160
185 Ga0157380_10374411 3300014326 Bacteria 1341
186 Ga0157380_10951680 3300014326 Bacteria 889
187 Ga0157376_10813324 3300014969 Bacteria 948
188 Ga0206354_11575931 3300020081 Bacteria 536
189 Ga0213873_10000015 3300021358 Bacteria 131343
190 Ga0213876_10000005 3300021384 Bacteria 727326
191 Ga0213875_10002419 3300021388 Bacteria 11208
192 Ga0209674_112607 3300025226 Bacteria 818
193 Ga0209563_100111 3300025230 Bacteria 141123
194 Ga0207425_1000020 3300025245 Bacteria 372623
195 Ga0207425_1016432 3300025245 Bacteria 1641
196 Ga0209677_110816 3300025253 Bacteria 1483
197 Ga0209148_1000026 3300025254 Bacteria 629213
198 Ga0209129_1002331 3300025258 Bacteria 9399
199 Ga0209565_1000012 3300025263 Bacteria 606500
200 Ga0209565_1000299 3300025263 Bacteria 47081
201 Ga0209455_1000005 3300025272 Bacteria 1416756
202 Ga0209673_1013425 3300025273 Bacteria 3233
203 Ga0209675_1000126 3300025291 Bacteria 104792
204 Ga0209676_1087714 3300025292 Bacteria 691
205 Ga0209025_1000827 3300025294 Bacteria 49278
206 Ga0209025_1006865 3300025294 Bacteria 8685
207 Ga0209564_1002442 3300025295 Bacteria 14695
208 Ga0209758_1000004 3300025297 Bacteria 1375322
209 Ga0209758_1000035 3300025297 Bacteria 448190
210 Ga0209758_1009351 3300025297 Bacteria 6110
211 Ga0209050_1000001 3300025298 Bacteria 3563507
212 Ga0209050_1000014 3300025298 Bacteria 774327
213 Ga0209050_1002854 3300025298 Bacteria 13698
214 Ga0209050_1005539 3300025298 Bacteria 7887
215 Ga0209256_1000012 3300025299 Bacteria 790371
216 Ga0209051_1000503 3300025303 Bacteria 49548
217 Ga0209257_1000019 3300025304 Bacteria 774261
218 Ga0209257_1005815 3300025304 Bacteria 8371
219 Ga0209257_1023381 3300025304 Bacteria 2174
220 Ga0207682_10015894 3300025893 Bacteria 2933
221 Ga0207682_10185404 3300025893 Bacteria 952
222 Ga0207710_10024739 3300025900 Bacteria 2588
223 Ga0207688_10083694 3300025901 Bacteria 1825
224 Ga0207680_10156457 3300025903 Bacteria 1524
225 Ga0207647_10064331 3300025904 Bacteria 2229
226 Ga0207647_10068236 3300025904 Bacteria 2153
227 Ga0207645_10014446 3300025907 Bacteria 5283
228 Ga0207645_10042259 3300025907 Bacteria 2916
229 Ga0207645_10195466 3300025907 Bacteria 1330
230 Ga0207643_10276558 3300025908 Bacteria 1040
231 Ga0207705_10000205 3300025909 Bacteria 59773
232 Ga0207705_10043699 3300025909 Bacteria 3219
233 Ga0207705_10069560 3300025909 Bacteria 2550
234 Ga0207695_10012103 3300025913 Bacteria 10370
235 Ga0207695_11019262 3300025913 Bacteria 707
236 Ga0207671_10008911 3300025914 Bacteria 8449
237 Ga0207660_10001386 3300025917 Bacteria 16272
238 Ga0207657_10003566 3300025919 Bacteria 16604
239 Ga0207657_10007665 3300025919 Bacteria 11043
240 Ga0207657_10132392 3300025919 Bacteria 2043
241 Ga0207649_10011199 3300025920 Bacteria 4940
242 Ga0207649_10031511 3300025920 Bacteria 3152
243 Ga0207652_10000270 3300025921 Bacteria 54010
244 Ga0207681_10047525 3300025923 Bacteria 2892
245 Ga0207681_10653447 3300025923 Bacteria 872
246 Ga0207650_10011005 3300025925 Bacteria 6220
247 Ga0207650_10021945 3300025925 Bacteria 4517
248 Ga0207650_10028780 3300025925 Bacteria 3988
249 Ga0207650_10081699 3300025925 Bacteria 2452
250 Ga0207650_10123722 3300025925 Bacteria 2017
251 Ga0207650_10806601 3300025925 Bacteria 796
252 Ga0207659_10014204 3300025926 Bacteria 5127
253 Ga0207659_10056813 3300025926 Bacteria 2804
254 Ga0207659_10570309 3300025926 Bacteria 963
255 Ga0207659_11105081 3300025926 Bacteria 682
256 Ga0207644_10000186 3300025931 Bacteria 44897
257 Ga0207644_10006360 3300025931 Bacteria 7690
258 Ga0207644_10091495 3300025931 Bacteria 2268
259 Ga0207644_10129904 3300025931 Bacteria 1927
260 Ga0207644_10428206 3300025931 Bacteria 1085
261 Ga0207690_10062134 3300025932 Bacteria 2542
262 Ga0207706_10055988 3300025933 Bacteria 3477
263 Ga0207706_10084914 3300025933 Bacteria 2783
264 Ga0207706_10178902 3300025933 Bacteria 1863
265 Ga0207706_10188242 3300025933 Bacteria 1812
266 Ga0207706_10192419 3300025933 Bacteria 1790
267 Ga0207706_10375318 3300025933 Bacteria 1234
268 Ga0207706_10390329 3300025933 Bacteria 1207
269 Ga0207709_10000519 3300025935 Bacteria 33581
270 Ga0207669_10000688 3300025937 Bacteria 14596
271 Ga0207669_10001398 3300025937 Bacteria 10259
272 Ga0207691_10092329 3300025940 Bacteria 2711
273 Ga0207691_10178308 3300025940 Bacteria 1857
274 Ga0207691_10568172 3300025940 Bacteria 961
275 Ga0207711_10003926 3300025941 Bacteria 12797
276 Ga0207661_10231324 3300025944 Bacteria 1637
277 Ga0207679_10004650 3300025945 Bacteria 8546
278 Ga0207679_10014032 3300025945 Bacteria 5256
279 Ga0207679_10061085 3300025945 Bacteria 2804
280 Ga0207667_10000010 3300025949 Bacteria 477432
281 Ga0207667_10019200 3300025949 Bacteria 7644
282 Ga0207667_10483655 3300025949 Bacteria 1257
283 Ga0207651_10474834 3300025960 Bacteria 1077
284 Ga0207651_10728239 3300025960 Bacteria 875
285 Ga0207712_10000002 3300025961 Bacteria 706628
286 Ga0207712_10158317 3300025961 Bacteria 1757
287 Ga0207712_10182787 3300025961 Bacteria 1648
288 Ga0207712_10369324 3300025961 Bacteria 1197
289 Ga0207668_10000095 3300025972 Bacteria 63349
290 Ga0207668_10436003 3300025972 Bacteria 1115
291 Ga0207640_10001098 3300025981 Bacteria 14946
292 Ga0207640_10061049 3300025981 Bacteria 2495
293 Ga0207640_10256164 3300025981 Bacteria 1361
294 Ga0207640_10788341 3300025981 Bacteria 822
295 Ga0207658_10330576 3300025986 Bacteria 1322
296 Ga0207703_10015580 3300026035 Bacteria 5930
297 Ga0207639_10002650 3300026041 Bacteria 12018
298 Ga0207639_10009331 3300026041 Bacteria 6766
299 Ga0207639_11258253 3300026041 Bacteria 694
300 Ga0207639_11473724 3300026041 Bacteria 639
301 Ga0207678_10000766 3300026067 Bacteria 29323
302 Ga0207678_10573659 3300026067 Bacteria 988
303 Ga0207641_10000001 3300026088 Bacteria 1180841
304 Ga0207641_10005020 3300026088 Bacteria 11346
305 Ga0207648_10401092 3300026089 Bacteria 1243
306 Ga0207648_11110912 3300026089 Bacteria 742
307 Ga0207676_10000266 3300026095 Bacteria 45449
308 Ga0207676_10105278 3300026095 Bacteria 2348
309 Ga0207676_10335637 3300026095 Bacteria 1393
310 Ga0207676_10433715 3300026095 Bacteria 1235
311 Ga0207674_11020626 3300026116 Bacteria 796
312 Ga0207675_100000078 3300026118 Bacteria 75565
313 Ga0207675_102091961 3300026118 Bacteria 583
314 Ga0207683_10003319 3300026121 Bacteria 14028
315 Ga0207683_10027360 3300026121 Bacteria 4927
316 Ga0207698_10069323 3300026142 Bacteria 2788
317 Ga0209281_1046605 3300027111 Bacteria 706
318 Ga0209974_10002951 3300027876 Bacteria 6172
319 Ga0209974_10005220 3300027876 Bacteria 4584
320 Ga0209974_10171709 3300027876 Bacteria 791
321 Ga0268266_10000002 3300028379 Bacteria 3059047
322 Ga0268266_10015825 3300028379 Bacteria 6459
323 Ga0268266_10870879 3300028379 Bacteria 871
324 Ga0268266_11224015 3300028379 Bacteria 726
325 Ga0268265_10000048 3300028380 Bacteria 178523
326 Ga0268265_10370022 3300028380 Bacteria 1315
327 Ga0268265_11449638 3300028380 Bacteria 689
328 Ga0268264_10041875 3300028381 Bacteria 3789
329 Ga0268264_10227795 3300028381 Bacteria 1719
330 Ga0307517_10029306 3300028786 Bacteria 6506
331 Ga0307515_10335128 3300028794 Bacteria 1169
332 Ga0307513_10021678 3300031456 Bacteria 7578
333 Ga0307513_10026366 3300031456 Bacteria 6702
334 Ga0307513_10099124 3300031456 Bacteria 2943
335 Ga0307408_100037669 3300031548 Bacteria 3407
336 Ga0307408_100069478 3300031548 Bacteria 2597
337 Ga0307408_100091914 3300031548 Bacteria 2293
338 Ga0307408_100109958 3300031548 Bacteria 2115
339 Ga0307408_100179112 3300031548 Bacteria 1698
340 Ga0307408_100285135 3300031548 Bacteria 1377
341 Ga0307408_100510591 3300031548 Bacteria 1054
342 Ga0307408_100593032 3300031548 Bacteria 983
343 Ga0307408_100630286 3300031548 Bacteria 956
344 Ga0307408_101108284 3300031548 Bacteria 734
345 Ga0307408_101482990 3300031548 Bacteria 641
346 Ga0307408_101772917 3300031548 Bacteria 589
347 Ga0307405_10043911 3300031731 Bacteria 2730
348 Ga0307405_10046362 3300031731 Bacteria 2670
349 Ga0307405_10067136 3300031731 Bacteria 2290
350 Ga0307405_10080688 3300031731 Bacteria 2124
351 Ga0307405_10188254 3300031731 Bacteria 1488
352 Ga0307405_10207289 3300031731 Bacteria 1428
353 Ga0307405_10271451 3300031731 Bacteria 1272
354 Ga0307405_10294315 3300031731 Bacteria 1228
355 Ga0307405_10626227 3300031731 Bacteria 881
356 Ga0307405_10759491 3300031731 Bacteria 808
357 Ga0307405_10760781 3300031731 Bacteria 808
358 Ga0307405_11038382 3300031731 Bacteria 701
359 Ga0307405_11228325 3300031731 Bacteria 649
360 Ga0307405_11515044 3300031731 Bacteria 589
361 Ga0307413_10006703 3300031824 Bacteria 5285
362 Ga0307413_10011908 3300031824 Bacteria 4302
363 Ga0307413_10016281 3300031824 Bacteria 3836
364 Ga0307413_10082788 3300031824 Bacteria 2062
365 Ga0307413_10133190 3300031824 Bacteria 1704
366 Ga0307413_10158822 3300031824 Bacteria 1585
367 Ga0307413_10203583 3300031824 Bacteria 1431
368 Ga0307413_10252451 3300031824 Bacteria 1309
369 Ga0307413_10276044 3300031824 Bacteria 1261
370 Ga0307413_10289949 3300031824 Bacteria 1235
371 Ga0307413_10594900 3300031824 Bacteria 904
372 Ga0307413_10602259 3300031824 Bacteria 899
373 Ga0307413_10646140 3300031824 Bacteria 872
374 Ga0307413_10771391 3300031824 Bacteria 805
375 Ga0307413_11374476 3300031824 Bacteria 620
376 Ga0307413_11559294 3300031824 Bacteria 585
377 Ga0307410_10008260 3300031852 Bacteria 5762
378 Ga0307410_10008363 3300031852 Bacteria 5733
379 Ga0307410_10012900 3300031852 Bacteria 4853
380 Ga0307410_10031725 3300031852 Bacteria 3394
381 Ga0307410_10036234 3300031852 Bacteria 3210
382 Ga0307410_10066858 3300031852 Bacteria 2478
383 Ga0307410_10176499 3300031852 Bacteria 1614
384 Ga0307410_10193727 3300031852 Bacteria 1547
385 Ga0307410_10199811 3300031852 Bacteria 1525
386 Ga0307410_10240114 3300031852 Bacteria 1403
387 Ga0307410_10308023 3300031852 Bacteria 1252
388 Ga0307410_10408558 3300031852 Bacteria 1098
389 Ga0307410_10409007 3300031852 Bacteria 1098
390 Ga0307410_10784723 3300031852 Bacteria 809
391 Ga0307406_10016377 3300031901 Bacteria 4307
392 Ga0307406_10027889 3300031901 Bacteria 3407
393 Ga0307406_10048797 3300031901 Bacteria 2676
394 Ga0307406_10074194 3300031901 Bacteria 2239
395 Ga0307406_10090205 3300031901 Bacteria 2062
396 Ga0307406_10120770 3300031901 Bacteria 1821
397 Ga0307406_10128355 3300031901 Bacteria 1775
398 Ga0307406_10135367 3300031901 Bacteria 1736
399 Ga0307406_11094516 3300031901 Bacteria 688
400 Ga0307406_11378515 3300031901 Bacteria 617
401 Ga0307407_10008202 3300031903 Bacteria 4779
402 Ga0307407_10073983 3300031903 Bacteria 2037
403 Ga0307407_10096050 3300031903 Bacteria 1828
404 Ga0307407_10295409 3300031903 Bacteria 1127
405 Ga0307407_10801828 3300031903 Bacteria 716
406 Ga0307407_10855436 3300031903 Bacteria 695
407 Ga0307407_11074987 3300031903 Bacteria 624
408 Ga0307412_10001209 3300031911 Bacteria 14667
409 Ga0307412_10007860 3300031911 Bacteria 6073
410 Ga0307412_10010257 3300031911 Bacteria 5393
411 Ga0307412_10015383 3300031911 Bacteria 4536
412 Ga0307412_10026639 3300031911 Bacteria 3596
413 Ga0307412_10032354 3300031911 Bacteria 3313
414 Ga0307412_10065901 3300031911 Bacteria 2453
415 Ga0307412_10113538 3300031911 Bacteria 1938
416 Ga0307412_10207187 3300031911 Bacteria 1493
417 Ga0307412_10307418 3300031911 Bacteria 1256
418 Ga0307412_10325664 3300031911 Bacteria 1224
419 Ga0307412_10434442 3300031911 Bacteria 1077
420 Ga0307412_10687872 3300031911 Bacteria 876
421 Ga0307412_10730928 3300031911 Bacteria 853
422 Ga0307412_10892354 3300031911 Bacteria 778
423 Ga0307412_11088650 3300031911 Bacteria 710
424 Ga0307409_100003074 3300031995 Bacteria 8931
425 Ga0307409_100003140 3300031995 Bacteria 8876
426 Ga0307409_100033832 3300031995 Bacteria 3725
427 Ga0307409_100034227 3300031995 Bacteria 3707
428 Ga0307409_100053927 3300031995 Bacteria 3093
429 Ga0307409_100062391 3300031995 Bacteria 2917
430 Ga0307409_100084640 3300031995 Bacteria 2575
431 Ga0307409_100085365 3300031995 Bacteria 2566
432 Ga0307409_100242822 3300031995 Bacteria 1641
433 Ga0307409_100245229 3300031995 Bacteria 1634
434 Ga0307409_100254134 3300031995 Bacteria 1608
435 Ga0307409_100288135 3300031995 Bacteria 1521
436 Ga0307409_100290302 3300031995 Bacteria 1516
437 Ga0307409_100318826 3300031995 Bacteria 1454
438 Ga0307409_100856127 3300031995 Bacteria 920
439 Ga0307409_100869573 3300031995 Bacteria 913
440 Ga0307409_101144123 3300031995 Bacteria 800
441 Ga0307409_101500954 3300031995 Bacteria 701
442 Ga0307409_102062297 3300031995 Bacteria 600
443 Ga0307416_100023508 3300032002 Bacteria 4474
444 Ga0307416_100038353 3300032002 Bacteria 3696
445 Ga0307416_100045203 3300032002 Bacteria 3466
446 Ga0307416_100050168 3300032002 Bacteria 3325
447 Ga0307416_100102973 3300032002 Bacteria 2491
448 Ga0307416_100198942 3300032002 Bacteria 1899
449 Ga0307416_100219543 3300032002 Bacteria 1821
450 Ga0307416_100270708 3300032002 Bacteria 1667
451 Ga0307416_100311353 3300032002 Bacteria 1571
452 Ga0307416_100350612 3300032002 Bacteria 1493
453 Ga0307416_100853736 3300032002 Bacteria 1008
454 Ga0307416_100867352 3300032002 Bacteria 1001
455 Ga0307416_101354408 3300032002 Bacteria 817
456 Ga0307416_101985382 3300032002 Bacteria 684
457 Ga0307416_102370443 3300032002 Bacteria 630
458 Ga0307414_10012107 3300032004 Bacteria 5090
459 Ga0307414_10026751 3300032004 Bacteria 3717
460 Ga0307414_10035547 3300032004 Bacteria 3316
461 Ga0307414_10107358 3300032004 Bacteria 2115
462 Ga0307414_10130273 3300032004 Bacteria 1951
463 Ga0307414_10153299 3300032004 Bacteria 1821
464 Ga0307414_10218778 3300032004 Bacteria 1562
465 Ga0307414_10403095 3300032004 Bacteria 1188
466 Ga0307414_10413963 3300032004 Bacteria 1174
467 Ga0307414_10453188 3300032004 Bacteria 1125
468 Ga0307414_10462305 3300032004 Bacteria 1115
469 Ga0307414_10485717 3300032004 Bacteria 1090
470 Ga0307414_10503155 3300032004 Bacteria 1072
471 Ga0307414_10544697 3300032004 Bacteria 1033
472 Ga0307414_10723269 3300032004 Bacteria 903
473 Ga0307414_11054593 3300032004 Bacteria 749
474 Ga0307414_11109844 3300032004 Bacteria 730
475 Ga0307411_10009509 3300032005 Bacteria 5116
476 Ga0307411_10011602 3300032005 Bacteria 4766
477 Ga0307411_10013960 3300032005 Bacteria 4454
478 Ga0307411_10014385 3300032005 Bacteria 4400
479 Ga0307411_10014534 3300032005 Bacteria 4384
480 Ga0307411_10040110 3300032005 Bacteria 2967
481 Ga0307411_10046371 3300032005 Bacteria 2801
482 Ga0307411_10051238 3300032005 Bacteria 2692
483 Ga0307411_10066346 3300032005 Bacteria 2424
484 Ga0307411_10099859 3300032005 Bacteria 2050
485 Ga0307411_10224941 3300032005 Bacteria 1458
486 Ga0307411_10230035 3300032005 Bacteria 1444
487 Ga0307411_10290366 3300032005 Bacteria 1306
488 Ga0307411_10322739 3300032005 Bacteria 1247
489 Ga0307411_10378027 3300032005 Bacteria 1164
490 Ga0307411_10426121 3300032005 Bacteria 1103
491 Ga0307411_10523850 3300032005 Bacteria 1006
492 Ga0307411_10842497 3300032005 Bacteria 810
493 Ga0307415_100000243 3300032126 Bacteria 23624
494 Ga0307415_100006668 3300032126 Bacteria 6249
495 Ga0307415_100017560 3300032126 Bacteria 4294
496 Ga0307415_100018107 3300032126 Bacteria 4243
497 Ga0307415_100043560 3300032126 Bacteria 2995
498 Ga0307415_100092487 3300032126 Bacteria 2193
499 Ga0307415_100099982 3300032126 Bacteria 2124
500 Ga0307415_100160827 3300032126 Bacteria 1740
501 Ga0307415_100417371 3300032126 Bacteria 1150
502 Ga0307415_100437885 3300032126 Bacteria 1126
503 Ga0307415_100483162 3300032126 Bacteria 1079
504 Ga0307415_100580063 3300032126 Bacteria 994
505 Ga0307415_101243109 3300032126 Bacteria 703
506 Ga0307510_10016431 3300033180 Bacteria 8735
507 Ga0373931_0500898 3300035691 Bacteria 783
508 Ga0395899_0004293 3300037312 Bacteria 11136
509 Ga0395899_0079364 3300037312 Bacteria 2390
510 Ga0395899_0180671 3300037312 Bacteria 1481
511 Ga0395899_0576921 3300037312 Bacteria 719
512 Ga0395899_0763848 3300037312 Bacteria 600
513 Ga0395900_0000572 3300037418 Bacteria 50991
514 Ga0395900_0006142 3300037418 Bacteria 12535
515 Ga0395900_0006337 3300037418 Bacteria 12335
516 Ga0395900_0029277 3300037418 Bacteria 5650
517 Ga0395900_0057885 3300037418 Bacteria 3990
518 Ga0395900_0191604 3300037418 Bacteria 2073
519 Ga0395900_0232001 3300037418 Bacteria 1855
520 Ga0395900_0257820 3300037418 Bacteria 1742
521 Ga0395900_0406941 3300037418 Bacteria 1323
522 Ga0395900_0465352 3300037418 Bacteria 1218
523 Ga0395900_0489616 3300037418 Bacteria 1181
524 Ga0395900_0560852 3300037418 Bacteria 1086
525 Ga0395900_0717705 3300037418 Bacteria 932
526 Ga0395900_1305674 3300037418 Bacteria 639
527 Ga0395900_1769977 3300037418 Bacteria 528
528 Ga0395898_0019268 3300037466 Bacteria 6946
529 Ga0395898_0109262 3300037466 Bacteria 2651
530 Ga0395898_0422397 3300037466 Bacteria 1270
531 Ga0395898_0467827 3300037466 Bacteria 1200
532 Ga0395898_0499082 3300037466 Bacteria 1157
533 Ga0395898_0500766 3300037466 Bacteria 1155
534 Ga0395898_0504124 3300037466 Bacteria 1151
535 Ga0395898_0642573 3300037466 Bacteria 1003
536 Ga0395898_0708193 3300037466 Bacteria 949
537 Ga0395905_0000165 3300037471 Bacteria 109385
538 Ga0395905_0005698 3300037471 Bacteria 12656
539 Ga0395905_0012133 3300037471 Bacteria 8301
540 Ga0395905_0013769 3300037471 Bacteria 7743
541 Ga0395905_0069248 3300037471 Bacteria 3304
542 Ga0395905_0135050 3300037471 Bacteria 2320
543 Ga0395905_0146241 3300037471 Bacteria 2223
544 Ga0395905_0165458 3300037471 Bacteria 2078
545 Ga0395905_0184714 3300037471 Bacteria 1957
546 Ga0395905_0226247 3300037471 Bacteria 1750
547 Ga0395905_0278199 3300037471 Bacteria 1559
548 Ga0395905_0280731 3300037471 Bacteria 1551
549 Ga0395905_0332185 3300037471 Bacteria 1411
550 Ga0395905_0728424 3300037471 Bacteria 894
551 Ga0395905_0787930 3300037471 Bacteria 853
552 Ga0395905_1022457 3300037471 Bacteria 729
553 Ga0395905_1027200 3300037471 Bacteria 727
554 Ga0436364_0383514 3300037853 Bacteria 1537
555 Ga0436364_1265496 3300037853 Bacteria 15678
556 Ga0395901_0006471 3300038443 Bacteria 11862
557 Ga0395901_0008086 3300038443 Bacteria 10624
558 Ga0395901_0012772 3300038443 Bacteria 8518
559 Ga0395901_0106729 3300038443 Bacteria 2939
560 Ga0395901_0197126 3300038443 Bacteria 2111
561 Ga0395901_0332159 3300038443 Bacteria 1571
562 Ga0395901_0447489 3300038443 Bacteria 1321
563 Ga0395901_1397569 3300038443 Bacteria 658
564 Ga0436365_0011005 3300039437 Bacteria 74317
565 Ga0436362_0287059 3300039453 Bacteria 76995
566 Ga0439436_0014215 3300041404 Bacteria 2405
567 Ga0439439_0025555 3300041406 Bacteria 1487
568 Ga0439447_161997 3300041407 Bacteria 515
569 Ga0439461_0002751 3300041410 Bacteria 2841
570 Ga0439465_0000503 3300041413 Bacteria 11668
571 Ga0439465_0038445 3300041413 Bacteria 1541
572 Ga0451849_1365278 3300041505 Bacteria 609
573 Ga0439431_0000032 3300041997 Bacteria 21299
574 Ga0439442_024784 3300042002 Bacteria 1248
575 Ga0439443_084187 3300042003 Bacteria 594
576 Ga0439432_015344 3300042006 Bacteria 2586
577 Ga0439452_016997 3300042010 Bacteria 1966
578 Ga0439462_0005391 3300042015 Bacteria 3153
579 Ga0439462_0114153 3300042015 Bacteria 749
580 Ga0450898_007035 3300042134 Bacteria 1745
581 Ga0450909_019070 3300042185 Bacteria 1020
582 Ga0439434_0000321 3300042435 Bacteria 13637
583 Ga0439434_0033481 3300042435 Bacteria 1566
584 Ga0439434_0058771 3300042435 Bacteria 1200
585 Ga0439460_0224251 3300042461 Bacteria 645
586 Ga0466966_0012606 3300044684 Bacteria 5603
587 Ga0466961_0202435 3300044693 Bacteria 1227
588 Ga0466963_0170187 3300044694 Bacteria 1518
589 Ga0466963_0775724 3300044694 Bacteria 676
590 Ga0453684_0342525 3300044712 Bacteria 1688
591 Ga0466971_0032538 3300044719 Bacteria 2337
592 Ga0466970_0023018 3300044765 Bacteria 3251
593 Ga0466970_0124999 3300044765 Bacteria 1410
594 Ga0466970_0272416 3300044765 Bacteria 951
595 Ga0466960_0041784 3300044901 Bacteria 2174
596 Ga0466960_0954308 3300044901 Bacteria 525
597 Ga0466959_0079138 3300045049 Bacteria 2370
598 Ga0466967_0097276 3300045976 Bacteria 2686
599 Ga0466967_0905879 3300045976 Bacteria 877
600 Ga0466967_1044786 3300045976 Bacteria 814
601 Ga0466967_1471167 3300045976 Bacteria 678
602 Ga0495617_047668 3300046452 Bacteria 1426
603 Ga0495629_0037829 3300046459 Bacteria 3401
604 Ga0495638_0278506 3300046460 Bacteria 910
605 Ga0495650_0000058 3300046471 Bacteria 302308
606 Ga0495584_0321877 3300046491 Bacteria 785
607 Ga0495585_0026323 3300046492 Bacteria 3322
608 Ga0495607_0368119 3300046501 Bacteria 660
609 Ga0495583_0002149 3300046506 Bacteria 17603
610 Ga0495583_0008668 3300046506 Bacteria 6187
611 Ga0495583_0011100 3300046506 Bacteria 5191
612 Ga0495606_0000359 3300046507 Bacteria 77863
613 Ga0495616_0027215 3300046513 Bacteria 3036
614 Ga0495631_0049559 3300046518 Bacteria 1838
615 Ga0495631_0062294 3300046518 Bacteria 1616
616 Ga0495632_0000060 3300046519 Bacteria 120480
617 Ga0495637_0024194 3300046520 Bacteria 2749
618 Ga0495637_0027122 3300046520 Bacteria 2565
619 Ga0495643_0000014 3300046522 Bacteria 314632
620 Ga0495643_0003466 3300046522 Bacteria 11521
621 Ga0495643_0003475 3300046522 Bacteria 11503
622 Ga0495643_0236222 3300046522 Bacteria 859
623 Ga0495648_0192194 3300046524 Bacteria 1029
624 Ga0495663_0000007 3300046525 Bacteria 262438
625 Ga0495663_0003896 3300046525 Bacteria 4251
626 Ga0495663_0067994 3300046525 Bacteria 1130
627 Ga0495642_0029122 3300046528 Bacteria 2203
628 Ga0495587_0116803 3300046536 Bacteria 1530
629 Ga0495609_0105027 3300046538 Bacteria 1222
630 Ga0495622_0033204 3300046557 Bacteria 2409
631 Ga0495633_0000722 3300046558 Bacteria 30009
632 Ga0495633_0001967 3300046558 Bacteria 14886
633 Ga0495633_0033208 3300046558 Bacteria 2489
634 Ga0495633_0085980 3300046558 Bacteria 1462
635 Ga0495633_0397004 3300046558 Bacteria 624
636 Ga0495668_0000163 3300046616 Bacteria 99607
637 Ga0495668_0032485 3300046616 Bacteria 2937
638 Ga0495611_0037145 3300046648 Bacteria 2164
639 Ga0495611_0322776 3300046648 Bacteria 710
640 Ga0495625_0000568 3300046660 Bacteria 54059
641 Ga0495625_0027964 3300046660 Bacteria 4234
642 Ga0495625_0088136 3300046660 Bacteria 2150
643 Ga0495661_0321545 3300046665 Bacteria 769
644 Ga0495661_0400507 3300046665 Bacteria 667
645 Ga0495669_0000096 3300046684 Bacteria 56184
646 Ga0495669_0069883 3300046684 Bacteria 1599
647 Ga0495670_0000002 3300046691 Bacteria 601814
648 Ga0495670_0035919 3300046691 Bacteria 2469
649 Ga0495670_0100073 3300046691 Bacteria 1492
650 Ga0495670_0167230 3300046691 Bacteria 1157
651 Ga0495671_0000032 3300046692 Bacteria 201185
652 Ga0495671_0424699 3300046692 Bacteria 636
653 Ga0495649_0197103 3300046694 Bacteria 1047
654 Ga0495649_0204435 3300046694 Bacteria 1025
655 Ga0495600_0001482 3300046809 Bacteria 13007
656 Ga0495683_0003243 3300047323 Bacteria 9507
657 Ga0495683_0050546 3300047323 Bacteria 2080
658 Ga0495683_0282799 3300047323 Bacteria 717
659 Ga0495687_000378 3300047443 Bacteria 55453
660 Ga0495687_000511 3300047443 Bacteria 46733
661 Ga0495677_0002165 3300047445 Bacteria 7777
662 Ga0495677_0009953 3300047445 Bacteria 3499
663 Ga0495681_0012956 3300047470 Bacteria 4871
664 Ga0495681_0015295 3300047470 Bacteria 4348
665 Ga0495681_0124120 3300047470 Bacteria 1105
666 Ga0495681_0180537 3300047470 Bacteria 867
667 Ga0495686_0000191 3300047472 Bacteria 114738
668 Ga0495686_0006710 3300047472 Bacteria 8753
669 Ga0495686_0098637 3300047472 Bacteria 1765
670 Ga0495686_0162793 3300047472 Bacteria 1302
671 Ga0495686_0341753 3300047472 Bacteria 816
672 Ga0496100_0110081 3300048903 Bacteria 1912
673 Ga0496101_0021750 3300048904 Bacteria 4409
674 Ga0496102_0000069 3300048905 Bacteria 156067
675 Ga0496102_0000281 3300048905 Bacteria 64939
676 Ga0496102_0505399 3300048905 Bacteria 1131
677 Ga0496102_1256428 3300048905 Bacteria 660
678 Ga0496103_0000173 3300048906 Bacteria 67412
679 Ga0496103_0001375 3300048906 Bacteria 16413
680 Ga0496104_0025056 3300048907 Bacteria 5496
681 Ga0496104_0279269 3300048907 Bacteria 1583
682 Ga0496107_0014793 3300048910 Bacteria 5461
683 Ga0496107_0389245 3300048910 Bacteria 1037
684 Ga0496109_0292790 3300048912 Bacteria 1535
685 Ga0496111_0064758 3300048914 Bacteria 2652
686 Ga0496111_0912975 3300048914 Bacteria 632
687 Ga0496112_0009308 3300048915 Bacteria 8836
688 Ga0496112_0009432 3300048915 Bacteria 8797
689 Ga0496112_0236132 3300048915 Bacteria 1782
690 Ga0496114_0014216 3300048917 Bacteria 6385
691 Ga0496115_0000134 3300048918 Bacteria 67910
692 Ga0496115_0001169 3300048918 Bacteria 18809
693 Ga0496116_0000566 3300048919 Bacteria 49509
694 Ga0496116_0006626 3300048919 Bacteria 10465
695 Ga0496117_0000485 3300048920 Bacteria 65840
696 Ga0496117_0002942 3300048920 Bacteria 20612
697 Ga0496118_0000190 3300048921 Bacteria 108017
698 Ga0496118_0000392 3300048921 Bacteria 74074
699 Ga0496119_0090314 3300048922 Bacteria 1742
700 Ga0496119_0092952 3300048922 Bacteria 1710
701 Ga0496119_0166594 3300048922 Bacteria 1167
702 Ga0496120_0007020 3300048923 Bacteria 8464
703 Ga0496121_0000105 3300048924 Bacteria 191437
704 Ga0496121_0000655 3300048924 Bacteria 64922
705 Ga0496122_0048047 3300048925 Bacteria 3287
706 Ga0496123_0004252 3300048926 Bacteria 15248
707 Ga0496123_0060789 3300048926 Bacteria 2433
708 Ga0496124_0000068 3300048927 Bacteria 221819
709 Ga0496124_0000175 3300048927 Bacteria 128785
710 Ga0496124_0000546 3300048927 Bacteria 63624
711 Ga0496124_0001803 3300048927 Bacteria 29745
712 Ga0496124_0050277 3300048927 Bacteria 3553
713 Ga0496125_0056664 3300048928 Bacteria 3181
714 Ga0496126_0000634 3300048929 Bacteria 65566
715 Ga0501033_0262624 3300049570 Bacteria 1222
716 Ga0501034_0707041 3300049571 Bacteria 906
717 Ga0501047_0311038 3300049581 Bacteria 1416
718 Ga0501202_163988 3300049652 Bacteria 590
719 Ga0501233_101302 3300049668 Bacteria 762
720 Ga0501242_020888 3300049674 Bacteria 843
721 Ga0501225_0076567 3300049705 Bacteria 956
722 Ga0501080_0700549 3300049742 Bacteria 893
723 Ga0501232_052611 3300049757 Bacteria 632
724 Ga0501241_018650 3300049758 Bacteria 1272
725 Ga0501262_013677 3300049759 Bacteria 1049
726 Ga0501267_046191 3300049764 Bacteria 556
727 Ga0501268_053067 3300049765 Bacteria 789
728 Ga0501268_055004 3300049765 Bacteria 778
729 Ga0501268_124654 3300049765 Bacteria 574
730 Ga0501280_003226 3300049776 Bacteria 2541
731 Ga0501212_009499 3300049851 Bacteria 1372
732 nmdc:mga03683_197501_c1 3300050489 Bacteria 922
733 nmdc:mga0k408_31120_c1 3300050493 Bacteria 3045
734 nmdc:mga0qj67_182633_c1 3300050509 Bacteria 1704
735 nmdc:mga08y16_1236079_c1 3300050511 Bacteria 716
736 nmdc:mga08y16_982596_c1 3300050511 Bacteria 825
737 nmdc:mga0sz30_242758_c1 3300050516 Bacteria 802
738 Ga0495655_0035620 3300053083 Bacteria 1239
739 Ga0500643_000924 3300053087 Bacteria 18433
740 Ga0500643_007382 3300053087 Bacteria 4442
741 Ga0500646_0207484 3300053090 Bacteria 675
742 Ga0500566_0000374 3300053094 Bacteria 24596
743 Ga0500641_0113535 3300053096 Bacteria 1166
744 Ga0500650_0380821 3300053098 Bacteria 613
745 Ga0500556_0011172 3300053104 Bacteria 2654
746 Ga0500562_016340 3300053108 Bacteria 1908
747 Ga0500592_003670 3300053116 Bacteria 2446
748 Ga0500595_002853 3300053119 Bacteria 8306
749 Ga0500595_033823 3300053119 Bacteria 1694
750 Ga0500597_028503 3300053120 Bacteria 2278
751 Ga0500658_0004231 3300053134 Bacteria 5385
752 Ga0500658_0006024 3300053134 Bacteria 4507
753 Ga0500568_0074951 3300053139 Bacteria 1291
754 Ga0500604_0020991 3300053151 Bacteria 1843
755 Ga0500619_002638 3300053154 Bacteria 3499
756 Ga0500624_000022 3300053157 Bacteria 116892
757 Ga0500627_0000068 3300053158 Bacteria 44198
758 Ga0500627_0301936 3300053158 Bacteria 699
759 Ga0500636_0003684 3300053177 Bacteria 8639
760 Ga0500637_0000095 3300053178 Bacteria 31675
761 Ga0500611_001944 3300053727 Bacteria 2388
762 Ga0500645_000008 3300053730 Bacteria 212254
763 Ga0500645_077934 3300053730 Bacteria 947
764 Ga0500596_003731 3300053735 Bacteria 2857
765 Ga0500661_024634 3300055283 Bacteria 1064
766 Ga0590077_089741 3300059426 Bacteria 713

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005719 Ga0068861_100000342 Ga0068861_1000003425 151
2 3300009011 Ga0105251_10375239 Ga0105251_103752392 151
3 3300026118 Ga0207675_100000078 Ga0207675_10000007819 151
4 3300031548 Ga0307408_100109958 Ga0307408_1001099582 151
5 3300031548 Ga0307408_100593032 Ga0307408_1005930322 151
6 3300031548 Ga0307408_101482990 Ga0307408_1014829902 151
7 3300031731 Ga0307405_10080688 Ga0307405_100806882 151
8 3300031824 Ga0307413_10133190 Ga0307413_101331902 151
9 3300031824 Ga0307413_10158822 Ga0307413_101588222 151
10 3300031824 Ga0307413_10252451 Ga0307413_102524512 151
11 3300031824 Ga0307413_11374476 Ga0307413_113744762 151
12 3300031852 Ga0307410_10240114 Ga0307410_102401142 151
13 3300031901 Ga0307406_10027889 Ga0307406_100278892 151
14 3300031901 Ga0307406_11094516 Ga0307406_110945161 151
15 3300031903 Ga0307407_10073983 Ga0307407_100739833 151
16 3300031911 Ga0307412_10207187 Ga0307412_102071871 151
17 3300031911 Ga0307412_10892354 Ga0307412_108923542 151
18 3300031911 Ga0307412_11088650 Ga0307412_110886502 151
19 3300032002 Ga0307416_100350612 Ga0307416_1003506122 151
20 3300032002 Ga0307416_101985382 Ga0307416_1019853822 151
21 3300032002 Ga0307416_102370443 Ga0307416_1023704432 151
22 3300032004 Ga0307414_10035547 Ga0307414_100355474 151
23 3300032004 Ga0307414_10403095 Ga0307414_104030952 151
24 3300032004 Ga0307414_10453188 Ga0307414_104531882 151
25 3300032004 Ga0307414_10503155 Ga0307414_105031552 151
26 3300032005 Ga0307411_10230035 Ga0307411_102300352 151
27 3300032005 Ga0307411_10322739 Ga0307411_103227392 151
28 3300032126 Ga0307415_100092487 Ga0307415_1000924872 151
29 3300032126 Ga0307415_100099982 Ga0307415_1000999823 151
30 3300032126 Ga0307415_100437885 Ga0307415_1004378851 151
31 3300032126 Ga0307415_100483162 Ga0307415_1004831622 151
32 3300032126 Ga0307415_100580063 Ga0307415_1005800632 151
33 3300049652 Ga0501202_163988 Ga0501202_163988_39_500 151
34 3300049765 Ga0501268_053067 Ga0501268_053067_145_606 151
35 3300005290 Ga0065712_10177419 Ga0065712_101774191 152
36 3300005293 Ga0065715_10264084 Ga0065715_102640842 152
37 3300005328 Ga0070676_10148724 Ga0070676_101487242 152
38 3300005328 Ga0070676_10611688 Ga0070676_106116882 152
39 3300005331 Ga0070670_100005458 Ga0070670_1000054589 152
40 3300005331 Ga0070670_100025761 Ga0070670_1000257616 152
41 3300005333 Ga0070677_10015159 Ga0070677_100151592 152
42 3300005337 Ga0070682_100548140 Ga0070682_1005481402 152
43 3300005344 Ga0070661_100103170 Ga0070661_1001031702 152
44 3300005353 Ga0070669_100069166 Ga0070669_1000691662 152
45 3300005354 Ga0070675_100001861 Ga0070675_1000018619 152
46 3300005355 Ga0070671_100025732 Ga0070671_1000257322 152
47 3300005365 Ga0070688_101169469 Ga0070688_1011694691 152
48 3300005366 Ga0070659_100508026 Ga0070659_1005080262 152
49 3300005458 Ga0070681_11336455 Ga0070681_113364551 152
50 3300005539 Ga0068853_101021074 Ga0068853_1010210742 152
51 3300005548 Ga0070665_101394001 Ga0070665_1013940011 152
52 3300005564 Ga0070664_100005797 Ga0070664_1000057974 152
53 3300005564 Ga0070664_100338280 Ga0070664_1003382802 152
54 3300005564 Ga0070664_100565018 Ga0070664_1005650182 152
55 3300005578 Ga0068854_100016865 Ga0068854_1000168654 152
56 3300005618 Ga0068864_100327470 Ga0068864_1003274702 152
57 3300005618 Ga0068864_100409558 Ga0068864_1004095582 152
58 3300005840 Ga0068870_10290170 Ga0068870_102901702 152
59 3300006871 Ga0075434_101151816 Ga0075434_1011518161 152
60 3300006931 Ga0097620_100007008 Ga0097620_1000070089 152
61 3300009093 Ga0105240_10194992 Ga0105240_101949922 152
62 3300009094 Ga0111539_12006472 Ga0111539_120064721 152
63 3300009177 Ga0105248_10000774 Ga0105248_1000077414 152
64 3300009545 Ga0105237_10310267 Ga0105237_103102672 152
65 3300013102 Ga0157371_10103514 Ga0157371_101035143 152
66 3300013102 Ga0157371_10513931 Ga0157371_105139312 152
67 3300013105 Ga0157369_10050386 Ga0157369_100503862 152
68 3300013105 Ga0157369_10253056 Ga0157369_102530562 152
69 3300013296 Ga0157374_11001573 Ga0157374_110015732 152
70 3300014325 Ga0163163_10603432 Ga0163163_106034322 152
71 3300014326 Ga0157380_10374411 Ga0157380_103744112 152
72 3300020081 Ga0206354_11575931 Ga0206354_115759311 152
73 3300025893 Ga0207682_10015894 Ga0207682_100158942 152
74 3300025907 Ga0207645_10195466 Ga0207645_101954661 152
75 3300025908 Ga0207643_10276558 Ga0207643_102765582 152
76 3300025913 Ga0207695_10012103 Ga0207695_1001210310 152
77 3300025920 Ga0207649_10011199 Ga0207649_100111996 152
78 3300025923 Ga0207681_10047525 Ga0207681_100475253 152
79 3300025925 Ga0207650_10021945 Ga0207650_100219454 152
80 3300025925 Ga0207650_10081699 Ga0207650_100816992 152
81 3300025926 Ga0207659_10014204 Ga0207659_100142045 152
82 3300025933 Ga0207706_10084914 Ga0207706_100849142 152
83 3300025941 Ga0207711_10003926 Ga0207711_100039262 152
84 3300025945 Ga0207679_10004650 Ga0207679_100046504 152
85 3300025981 Ga0207640_10001098 Ga0207640_1000109811 152
86 3300026095 Ga0207676_10335637 Ga0207676_103356372 152
87 3300026095 Ga0207676_10433715 Ga0207676_104337152 152
88 3300027876 Ga0209974_10005220 Ga0209974_100052203 152
89 3300027876 Ga0209974_10171709 Ga0209974_101717092 152
90 3300028379 Ga0268266_10870879 Ga0268266_108708792 152
91 3300031548 Ga0307408_100069478 Ga0307408_1000694782 152
92 3300031548 Ga0307408_100091914 Ga0307408_1000919142 152
93 3300031548 Ga0307408_100285135 Ga0307408_1002851352 152
94 3300031548 Ga0307408_100510591 Ga0307408_1005105912 152
95 3300031548 Ga0307408_100630286 Ga0307408_1006302862 152
96 3300031548 Ga0307408_101108284 Ga0307408_1011082841 152
97 3300031548 Ga0307408_101772917 Ga0307408_1017729172 152
98 3300031731 Ga0307405_10043911 Ga0307405_100439114 152
99 3300031731 Ga0307405_10067136 Ga0307405_100671363 152
100 3300031731 Ga0307405_10188254 Ga0307405_101882542 152
101 3300031731 Ga0307405_10207289 Ga0307405_102072892 152
102 3300031731 Ga0307405_10271451 Ga0307405_102714512 152
103 3300031731 Ga0307405_10294315 Ga0307405_102943152 152
104 3300031731 Ga0307405_10626227 Ga0307405_106262272 152
105 3300031731 Ga0307405_10759491 Ga0307405_107594912 152
106 3300031731 Ga0307405_11038382 Ga0307405_110383822 152
107 3300031731 Ga0307405_11228325 Ga0307405_112283251 152
108 3300031731 Ga0307405_11515044 Ga0307405_115150442 152
109 3300031824 Ga0307413_10006703 Ga0307413_100067033 152
110 3300031824 Ga0307413_10011908 Ga0307413_100119083 152
111 3300031824 Ga0307413_10016281 Ga0307413_100162813 152
112 3300031824 Ga0307413_10203583 Ga0307413_102035832 152
113 3300031824 Ga0307413_10276044 Ga0307413_102760442 152
114 3300031824 Ga0307413_10289949 Ga0307413_102899492 152
115 3300031824 Ga0307413_10594900 Ga0307413_105949002 152
116 3300031824 Ga0307413_10602259 Ga0307413_106022592 152
117 3300031824 Ga0307413_10771391 Ga0307413_107713912 152
118 3300031824 Ga0307413_11559294 Ga0307413_115592941 152
119 3300031852 Ga0307410_10008260 Ga0307410_100082604 152
120 3300031852 Ga0307410_10008363 Ga0307410_100083632 152
121 3300031852 Ga0307410_10012900 Ga0307410_100129003 152
122 3300031852 Ga0307410_10036234 Ga0307410_100362344 152
123 3300031852 Ga0307410_10176499 Ga0307410_101764991 152
124 3300031852 Ga0307410_10193727 Ga0307410_101937272 152
125 3300031852 Ga0307410_10199811 Ga0307410_101998112 152
126 3300031852 Ga0307410_10308023 Ga0307410_103080232 152
127 3300031852 Ga0307410_10408558 Ga0307410_104085582 152
128 3300031852 Ga0307410_10409007 Ga0307410_104090072 152
129 3300031852 Ga0307410_10784723 Ga0307410_107847232 152
130 3300031901 Ga0307406_10016377 Ga0307406_100163774 152
131 3300031901 Ga0307406_10048797 Ga0307406_100487972 152
132 3300031901 Ga0307406_10074194 Ga0307406_100741942 152
133 3300031901 Ga0307406_10120770 Ga0307406_101207702 152
134 3300031901 Ga0307406_10135367 Ga0307406_101353672 152
135 3300031901 Ga0307406_11378515 Ga0307406_113785152 152
136 3300031903 Ga0307407_10096050 Ga0307407_100960502 152
137 3300031903 Ga0307407_10295409 Ga0307407_102954092 152
138 3300031903 Ga0307407_10801828 Ga0307407_108018282 152
139 3300031903 Ga0307407_10855436 Ga0307407_108554361 152
140 3300031903 Ga0307407_11074987 Ga0307407_110749872 152
141 3300031911 Ga0307412_10007860 Ga0307412_100078603 152
142 3300031911 Ga0307412_10010257 Ga0307412_100102573 152
143 3300031911 Ga0307412_10015383 Ga0307412_100153834 152
144 3300031911 Ga0307412_10026639 Ga0307412_100266394 152
145 3300031911 Ga0307412_10032354 Ga0307412_100323541 152
146 3300031911 Ga0307412_10065901 Ga0307412_100659013 152
147 3300031911 Ga0307412_10113538 Ga0307412_101135382 152
148 3300031911 Ga0307412_10307418 Ga0307412_103074182 152
149 3300031911 Ga0307412_10434442 Ga0307412_104344422 152
150 3300031995 Ga0307409_100003140 Ga0307409_1000031408 152
151 3300031995 Ga0307409_100034227 Ga0307409_1000342273 152
152 3300031995 Ga0307409_100053927 Ga0307409_1000539272 152
153 3300031995 Ga0307409_100062391 Ga0307409_1000623912 152
154 3300031995 Ga0307409_100084640 Ga0307409_1000846402 152
155 3300031995 Ga0307409_100085365 Ga0307409_1000853654 152
156 3300031995 Ga0307409_100242822 Ga0307409_1002428223 152
157 3300031995 Ga0307409_100288135 Ga0307409_1002881352 152
158 3300031995 Ga0307409_100290302 Ga0307409_1002903021 152
159 3300031995 Ga0307409_100318826 Ga0307409_1003188262 152
160 3300031995 Ga0307409_100856127 Ga0307409_1008561272 152
161 3300031995 Ga0307409_100869573 Ga0307409_1008695732 152
162 3300031995 Ga0307409_101500954 Ga0307409_1015009542 152
163 3300032002 Ga0307416_100023508 Ga0307416_1000235083 152
164 3300032002 Ga0307416_100038353 Ga0307416_1000383532 152
165 3300032002 Ga0307416_100045203 Ga0307416_1000452035 152
166 3300032002 Ga0307416_100102973 Ga0307416_1001029732 152
167 3300032002 Ga0307416_100198942 Ga0307416_1001989422 152
168 3300032002 Ga0307416_100219543 Ga0307416_1002195433 152
169 3300032002 Ga0307416_100270708 Ga0307416_1002707082 152
170 3300032002 Ga0307416_100311353 Ga0307416_1003113532 152
171 3300032002 Ga0307416_100867352 Ga0307416_1008673522 152
172 3300032004 Ga0307414_10012107 Ga0307414_100121073 152
173 3300032004 Ga0307414_10026751 Ga0307414_100267514 152
174 3300032004 Ga0307414_10107358 Ga0307414_101073582 152
175 3300032004 Ga0307414_10130273 Ga0307414_101302732 152
176 3300032004 Ga0307414_10153299 Ga0307414_101532992 152
177 3300032004 Ga0307414_10413963 Ga0307414_104139632 152
178 3300032004 Ga0307414_10462305 Ga0307414_104623052 152
179 3300032004 Ga0307414_10485717 Ga0307414_104857172 152
180 3300032004 Ga0307414_10544697 Ga0307414_105446972 152
181 3300032004 Ga0307414_10723269 Ga0307414_107232692 152
182 3300032004 Ga0307414_11054593 Ga0307414_110545932 152
183 3300032004 Ga0307414_11109844 Ga0307414_111098442 152
184 3300032005 Ga0307411_10009509 Ga0307411_100095094 152
185 3300032005 Ga0307411_10011602 Ga0307411_100116025 152
186 3300032005 Ga0307411_10013960 Ga0307411_100139605 152
187 3300032005 Ga0307411_10014385 Ga0307411_100143855 152
188 3300032005 Ga0307411_10014534 Ga0307411_100145342 152
189 3300032005 Ga0307411_10040110 Ga0307411_100401103 152
190 3300032005 Ga0307411_10046371 Ga0307411_100463713 152
191 3300032005 Ga0307411_10051238 Ga0307411_100512383 152
192 3300032005 Ga0307411_10066346 Ga0307411_100663463 152
193 3300032005 Ga0307411_10099859 Ga0307411_100998592 152
194 3300032005 Ga0307411_10224941 Ga0307411_102249412 152
195 3300032005 Ga0307411_10290366 Ga0307411_102903662 152
196 3300032005 Ga0307411_10378027 Ga0307411_103780271 152
197 3300032005 Ga0307411_10426121 Ga0307411_104261212 152
198 3300032005 Ga0307411_10523850 Ga0307411_105238501 152
199 3300032005 Ga0307411_10842497 Ga0307411_108424972 152
200 3300032126 Ga0307415_100000243 Ga0307415_1000002437 152
201 3300032126 Ga0307415_100006668 Ga0307415_1000066683 152
202 3300032126 Ga0307415_100017560 Ga0307415_1000175602 152
203 3300032126 Ga0307415_100018107 Ga0307415_1000181075 152
204 3300032126 Ga0307415_100417371 Ga0307415_1004173711 152
205 3300032126 Ga0307415_101243109 Ga0307415_1012431091 152
206 3300037312 Ga0395899_0079364 Ga0395899_0079364_820_1299 152
207 3300037312 Ga0395899_0180671 Ga0395899_0180671_208_690 152
208 3300037418 Ga0395900_0000572 Ga0395900_0000572_19365_19847 152
209 3300037418 Ga0395900_0006337 Ga0395900_0006337_416_892 152
210 3300037418 Ga0395900_0057885 Ga0395900_0057885_1080_1559 152
211 3300037418 Ga0395900_0191604 Ga0395900_0191604_1014_1496 152
212 3300037418 Ga0395900_0257820 Ga0395900_0257820_1217_1699 152
213 3300037418 Ga0395900_0489616 Ga0395900_0489616_156_635 152
214 3300037466 Ga0395898_0109262 Ga0395898_0109262_208_690 152
215 3300037466 Ga0395898_0467827 Ga0395898_0467827_435_917 152
216 3300037466 Ga0395898_0499082 Ga0395898_0499082_31_513 152
217 3300037471 Ga0395905_0000165 Ga0395905_0000165_59363_59845 152
218 3300037471 Ga0395905_0005698 Ga0395905_0005698_1804_2280 152
219 3300037471 Ga0395905_0069248 Ga0395905_0069248_2739_3218 152
220 3300037471 Ga0395905_0135050 Ga0395905_0135050_1592_2071 152
221 3300037471 Ga0395905_0332185 Ga0395905_0332185_456_926 152
222 3300038443 Ga0395901_0106729 Ga0395901_0106729_1106_1576 152
223 3300038443 Ga0395901_0197126 Ga0395901_0197126_1058_1540 152
224 3300038443 Ga0395901_0332159 Ga0395901_0332159_32_514 152
225 3300044712 Ga0453684_0342525 Ga0453684_0342525_1059_1529 152
226 3300044901 Ga0466960_0041784 Ga0466960_0041784_1143_1613 152
227 3300044901 Ga0466960_0954308 Ga0466960_0954308_19_501 152
228 3300046452 Ga0495617_047668 Ga0495617_047668_904_1374 152
229 3300046525 Ga0495663_0067994 Ga0495663_0067994_136_621 152
230 3300047472 Ga0495686_0162793 Ga0495686_0162793_372_842 152
231 3300048912 Ga0496109_0292790 Ga0496109_0292790_606_1076 152
232 3300048914 Ga0496111_0912975 Ga0496111_0912975_14_484 152
233 3300049668 Ga0501233_101302 Ga0501233_101302_238_714 152
234 3300049674 Ga0501242_020888 Ga0501242_020888_123_599 152
235 3300049705 Ga0501225_0076567 Ga0501225_0076567_97_573 152
236 3300049757 Ga0501232_052611 Ga0501232_052611_145_621 152
237 3300049758 Ga0501241_018650 Ga0501241_018650_629_1087 152
238 3300049759 Ga0501262_013677 Ga0501262_013677_66_542 152
239 3300049764 Ga0501267_046191 Ga0501267_046191_16_492 152
240 3300049765 Ga0501268_124654 Ga0501268_124654_83_559 152
241 3300049851 Ga0501212_009499 Ga0501212_009499_518_994 152
242 3300050511 nmdc:mga08y16_1236079_c1 nmdc:mga08y16_1236079_c1_82_561 152
243 3300059426 Ga0590077_089741 Ga0590077_089741_98_580 152
244 3300000041 ARcpr5oldR_c004772 ARcpr5oldR_0047722 153
245 3300001979 JGI24740J21852_10043438 JGI24740J21852_100434382 153
246 3300001989 JGI24739J22299_10045976 JGI24739J22299_100459762 153
247 3300002774 JGI25150J39212_1000371 JGI25150J39212_100037120 153
248 3300003187 JGI25151J46595_10040622 JGI25151J46595_100406222 153
249 3300003215 JGI25153J46596_10000072 JGI25153J46596_1000007261 153
250 3300003215 JGI25153J46596_10000113 JGI25153J46596_1000011367 153
251 3300003215 JGI25153J46596_10011776 JGI25153J46596_100117762 153
252 3300003215 JGI25153J46596_10033304 JGI25153J46596_100333042 153
253 3300003759 Ga0055525_1000090 Ga0055525_1000090128 153
254 3300003762 Ga0055542_1000568 Ga0055542_100056824 153
255 3300003763 Ga0055529_1000007 Ga0055529_100000724 153
256 3300003763 Ga0055529_1000109 Ga0055529_100010947 153
257 3300003771 Ga0055526_1014390 Ga0055526_10143903 153
258 3300003773 Ga0055537_1001776 Ga0055537_10017764 153
259 3300003773 Ga0055537_1007102 Ga0055537_10071022 153
260 3300003775 Ga0055524_1000030 Ga0055524_100003088 153
261 3300003781 Ga0055536_1015225 Ga0055536_10152252 153
262 3300003784 Ga0055534_1025003 Ga0055534_10250032 153
263 3300003791 Ga0055530_10002769 Ga0055530_100027692 153
264 3300003791 Ga0055530_10007045 Ga0055530_100070453 153
265 3300003791 Ga0055530_10037092 Ga0055530_100370922 153
266 3300003792 Ga0055540_1001950 Ga0055540_10019505 153
267 3300003794 Ga0055531_10011244 Ga0055531_100112442 153
268 3300003794 Ga0055531_10016815 Ga0055531_100168152 153
269 3300004625 Ga0055543_1038990 Ga0055543_10389902 153
270 3300005262 Ga0065165_1003301 Ga0065165_10033019 153
271 3300005262 Ga0065165_1016642 Ga0065165_10166421 153
272 3300005262 Ga0065165_1058829 Ga0065165_10588292 153
273 3300005290 Ga0065712_10133692 Ga0065712_101336922 153
274 3300005293 Ga0065715_10123474 Ga0065715_101234742 153
275 3300005327 Ga0070658_10131111 Ga0070658_101311113 153
276 3300005327 Ga0070658_10629296 Ga0070658_106292962 153
277 3300005327 Ga0070658_10963645 Ga0070658_109636451 153
278 3300005328 Ga0070676_10046635 Ga0070676_100466352 153
279 3300005329 Ga0070683_100311548 Ga0070683_1003115481 153
280 3300005331 Ga0070670_100030479 Ga0070670_1000304794 153
281 3300005331 Ga0070670_100080462 Ga0070670_1000804623 153
282 3300005333 Ga0070677_10287692 Ga0070677_102876922 153
283 3300005335 Ga0070666_10016649 Ga0070666_100166492 153
284 3300005336 Ga0070680_100001375 Ga0070680_1000013758 153
285 3300005338 Ga0068868_100049426 Ga0068868_1000494264 153
286 3300005339 Ga0070660_100000678 Ga0070660_10000067814 153
287 3300005339 Ga0070660_100010750 Ga0070660_1000107507 153
288 3300005339 Ga0070660_100090166 Ga0070660_1000901662 153
289 3300005344 Ga0070661_100036375 Ga0070661_1000363752 153
290 3300005344 Ga0070661_100132023 Ga0070661_1001320233 153
291 3300005344 Ga0070661_100953781 Ga0070661_1009537812 153
292 3300005347 Ga0070668_100000866 Ga0070668_10000086615 153
293 3300005353 Ga0070669_100416180 Ga0070669_1004161802 153
294 3300005354 Ga0070675_100046035 Ga0070675_1000460352 153
295 3300005354 Ga0070675_100066444 Ga0070675_1000664443 153
296 3300005354 Ga0070675_100418332 Ga0070675_1004183321 153
297 3300005355 Ga0070671_100000229 Ga0070671_1000002295 153
298 3300005355 Ga0070671_100014846 Ga0070671_1000148466 153
299 3300005355 Ga0070671_100124793 Ga0070671_1001247932 153
300 3300005355 Ga0070671_100735937 Ga0070671_1007359371 153
301 3300005356 Ga0070674_100009305 Ga0070674_1000093054 153
302 3300005356 Ga0070674_100022158 Ga0070674_1000221583 153
303 3300005356 Ga0070674_100046526 Ga0070674_1000465262 153
304 3300005356 Ga0070674_100935744 Ga0070674_1009357441 153
305 3300005364 Ga0070673_100172161 Ga0070673_1001721612 153
306 3300005364 Ga0070673_100606681 Ga0070673_1006066811 153
307 3300005364 Ga0070673_101307105 Ga0070673_1013071052 153
308 3300005366 Ga0070659_100052960 Ga0070659_1000529603 153
309 3300005366 Ga0070659_100812838 Ga0070659_1008128381 153
310 3300005435 Ga0070714_101030431 Ga0070714_1010304312 153
311 3300005455 Ga0070663_100000936 Ga0070663_10000093612 153
312 3300005455 Ga0070663_100327625 Ga0070663_1003276252 153
313 3300005456 Ga0070678_100008085 Ga0070678_1000080858 153
314 3300005456 Ga0070678_100409718 Ga0070678_1004097182 153
315 3300005456 Ga0070678_101180233 Ga0070678_1011802332 153
316 3300005457 Ga0070662_100158225 Ga0070662_1001582252 153
317 3300005457 Ga0070662_100370326 Ga0070662_1003703261 153
318 3300005457 Ga0070662_100392701 Ga0070662_1003927012 153
319 3300005457 Ga0070662_100678100 Ga0070662_1006781001 153
320 3300005466 Ga0070685_10417461 Ga0070685_104174612 153
321 3300005530 Ga0070679_100001182 Ga0070679_10000118219 153
322 3300005543 Ga0070672_100243695 Ga0070672_1002436952 153
323 3300005543 Ga0070672_100407577 Ga0070672_1004075772 153
324 3300005546 Ga0070696_100322340 Ga0070696_1003223401 153
325 3300005548 Ga0070665_100000044 Ga0070665_100000044201 153
326 3300005548 Ga0070665_100289401 Ga0070665_1002894012 153
327 3300005564 Ga0070664_100001633 Ga0070664_1000016337 153
328 3300005564 Ga0070664_101690712 Ga0070664_1016907121 153
329 3300005577 Ga0068857_100103063 Ga0068857_1001030633 153
330 3300005578 Ga0068854_100159394 Ga0068854_1001593942 153
331 3300005578 Ga0068854_100177479 Ga0068854_1001774792 153
332 3300005578 Ga0068854_100300186 Ga0068854_1003001862 153
333 3300005578 Ga0068854_100517717 Ga0068854_1005177172 153
334 3300005616 Ga0068852_100093419 Ga0068852_1000934192 153
335 3300005618 Ga0068864_100017494 Ga0068864_1000174945 153
336 3300005618 Ga0068864_100086873 Ga0068864_1000868732 153
337 3300005841 Ga0068863_100000030 Ga0068863_10000003080 153
338 3300005841 Ga0068863_100026944 Ga0068863_1000269443 153
339 3300005842 Ga0068858_100018879 Ga0068858_1000188796 153
340 3300005843 Ga0068860_100013256 Ga0068860_1000132563 153
341 3300005843 Ga0068860_100231329 Ga0068860_1002313292 153
342 3300005844 Ga0068862_100000193 Ga0068862_10000019326 153
343 3300005844 Ga0068862_101299057 Ga0068862_1012990572 153
344 3300005844 Ga0068862_101602987 Ga0068862_1016029871 153
345 3300005985 Ga0081539_10026991 Ga0081539_100269913 153
346 3300005985 Ga0081539_10084838 Ga0081539_100848381 153
347 3300006237 Ga0097621_100438278 Ga0097621_1004382782 153
348 3300006237 Ga0097621_100550463 Ga0097621_1005504632 153
349 3300006353 Ga0075370_10246309 Ga0075370_102463092 153
350 3300006358 Ga0068871_100240981 Ga0068871_1002409812 153
351 3300006358 Ga0068871_100290180 Ga0068871_1002901802 153
352 3300006358 Ga0068871_100494788 Ga0068871_1004947882 153
353 3300006931 Ga0097620_100253232 Ga0097620_1002532323 153
354 3300006946 Ga0079104_1037292 Ga0079104_10372922 153
355 3300009093 Ga0105240_10266083 Ga0105240_102660832 153
356 3300009094 Ga0111539_10752068 Ga0111539_107520681 153
357 3300009101 Ga0105247_10038604 Ga0105247_100386043 153
358 3300009148 Ga0105243_10000224 Ga0105243_1000022428 153
359 3300009174 Ga0105241_10095554 Ga0105241_100955542 153
360 3300009176 Ga0105242_10069746 Ga0105242_100697462 153
361 3300009177 Ga0105248_10033959 Ga0105248_100339596 153
362 3300009177 Ga0105248_10132262 Ga0105248_101322622 153
363 3300009177 Ga0105248_10280058 Ga0105248_102800582 153
364 3300009545 Ga0105237_10077367 Ga0105237_100773672 153
365 3300009553 Ga0105249_10000002 Ga0105249_10000002105 153
366 3300009553 Ga0105249_10222561 Ga0105249_102225612 153
367 3300009553 Ga0105249_11499678 Ga0105249_114996781 153
368 3300010375 Ga0105239_12020966 Ga0105239_120209661 153
369 3300010375 Ga0105239_12389164 Ga0105239_123891641 153
370 3300011119 Ga0105246_10384876 Ga0105246_103848761 153
371 3300012513 Ga0157326_1002610 Ga0157326_10026102 153
372 3300013100 Ga0157373_10206341 Ga0157373_102063412 153
373 3300013102 Ga0157371_10956656 Ga0157371_109566561 153
374 3300013104 Ga0157370_10033595 Ga0157370_100335953 153
375 3300013104 Ga0157370_10074287 Ga0157370_100742874 153
376 3300013104 Ga0157370_10492452 Ga0157370_104924521 153
377 3300013105 Ga0157369_10421097 Ga0157369_104210972 153
378 3300013105 Ga0157369_10498766 Ga0157369_104987662 153
379 3300013296 Ga0157374_10008990 Ga0157374_100089909 153
380 3300013296 Ga0157374_11275575 Ga0157374_112755752 153
381 3300013306 Ga0163162_11071317 Ga0163162_110713172 153
382 3300013307 Ga0157372_10277840 Ga0157372_102778404 153
383 3300013307 Ga0157372_10478430 Ga0157372_104784302 153
384 3300013307 Ga0157372_11187251 Ga0157372_111872512 153
385 3300013308 Ga0157375_10028876 Ga0157375_100288763 153
386 3300013308 Ga0157375_10529705 Ga0157375_105297052 153
387 3300013308 Ga0157375_11977275 Ga0157375_119772752 153
388 3300014325 Ga0163163_10941617 Ga0163163_109416171 153
389 3300014326 Ga0157380_10128261 Ga0157380_101282613 153
390 3300014326 Ga0157380_10951680 Ga0157380_109516802 153
391 3300014969 Ga0157376_10813324 Ga0157376_108133242 153
392 3300021358 Ga0213873_10000015 Ga0213873_10000015115 153
393 3300021384 Ga0213876_10000005 Ga0213876_10000005620 153
394 3300021388 Ga0213875_10002419 Ga0213875_100024195 153
395 3300025226 Ga0209674_112607 Ga0209674_1126072 153
396 3300025230 Ga0209563_100111 Ga0209563_10011128 153
397 3300025245 Ga0207425_1000020 Ga0207425_1000020165 153
398 3300025245 Ga0207425_1016432 Ga0207425_10164322 153
399 3300025253 Ga0209677_110816 Ga0209677_1108162 153
400 3300025254 Ga0209148_1000026 Ga0209148_1000026361 153
401 3300025258 Ga0209129_1002331 Ga0209129_10023317 153
402 3300025263 Ga0209565_1000012 Ga0209565_1000012352 153
403 3300025263 Ga0209565_1000299 Ga0209565_100029944 153
404 3300025272 Ga0209455_1000005 Ga0209455_10000051108 153
405 3300025273 Ga0209673_1013425 Ga0209673_10134252 153
406 3300025291 Ga0209675_1000126 Ga0209675_100012622 153
407 3300025292 Ga0209676_1087714 Ga0209676_10877142 153
408 3300025294 Ga0209025_1000827 Ga0209025_10008272 153
409 3300025294 Ga0209025_1006865 Ga0209025_10068654 153
410 3300025295 Ga0209564_1002442 Ga0209564_100244217 153
411 3300025297 Ga0209758_1000004 Ga0209758_1000004429 153
412 3300025297 Ga0209758_1000035 Ga0209758_1000035376 153
413 3300025297 Ga0209758_1009351 Ga0209758_10093516 153
414 3300025298 Ga0209050_1000001 Ga0209050_10000012384 153
415 3300025298 Ga0209050_1000014 Ga0209050_1000014557 153
416 3300025298 Ga0209050_1002854 Ga0209050_100285411 153
417 3300025298 Ga0209050_1005539 Ga0209050_10055393 153
418 3300025299 Ga0209256_1000012 Ga0209256_1000012543 153
419 3300025303 Ga0209051_1000503 Ga0209051_10005036 153
420 3300025304 Ga0209257_1000019 Ga0209257_1000019135 153
421 3300025304 Ga0209257_1005815 Ga0209257_10058152 153
422 3300025304 Ga0209257_1023381 Ga0209257_10233812 153
423 3300025893 Ga0207682_10185404 Ga0207682_101854043 153
424 3300025900 Ga0207710_10024739 Ga0207710_100247392 153
425 3300025901 Ga0207688_10083694 Ga0207688_100836943 153
426 3300025903 Ga0207680_10156457 Ga0207680_101564572 153
427 3300025904 Ga0207647_10064331 Ga0207647_100643313 153
428 3300025904 Ga0207647_10068236 Ga0207647_100682363 153
429 3300025907 Ga0207645_10014446 Ga0207645_100144463 153
430 3300025907 Ga0207645_10042259 Ga0207645_100422593 153
431 3300025909 Ga0207705_10000205 Ga0207705_1000020535 153
432 3300025909 Ga0207705_10043699 Ga0207705_100436992 153
433 3300025909 Ga0207705_10069560 Ga0207705_100695602 153
434 3300025913 Ga0207695_11019262 Ga0207695_110192621 153
435 3300025914 Ga0207671_10008911 Ga0207671_100089113 153
436 3300025917 Ga0207660_10001386 Ga0207660_1000138618 153
437 3300025919 Ga0207657_10003566 Ga0207657_100035667 153
438 3300025919 Ga0207657_10007665 Ga0207657_100076656 153
439 3300025919 Ga0207657_10132392 Ga0207657_101323922 153
440 3300025920 Ga0207649_10031511 Ga0207649_100315113 153
441 3300025921 Ga0207652_10000270 Ga0207652_1000027020 153
442 3300025923 Ga0207681_10653447 Ga0207681_106534472 153
443 3300025925 Ga0207650_10011005 Ga0207650_100110056 153
444 3300025925 Ga0207650_10028780 Ga0207650_100287802 153
445 3300025925 Ga0207650_10123722 Ga0207650_101237222 153
446 3300025925 Ga0207650_10806601 Ga0207650_108066012 153
447 3300025926 Ga0207659_10056813 Ga0207659_100568132 153
448 3300025926 Ga0207659_10570309 Ga0207659_105703092 153
449 3300025926 Ga0207659_11105081 Ga0207659_111050811 153
450 3300025931 Ga0207644_10000186 Ga0207644_1000018644 153
451 3300025931 Ga0207644_10006360 Ga0207644_100063606 153
452 3300025931 Ga0207644_10091495 Ga0207644_100914952 153
453 3300025931 Ga0207644_10129904 Ga0207644_101299042 153
454 3300025931 Ga0207644_10428206 Ga0207644_104282062 153
455 3300025932 Ga0207690_10062134 Ga0207690_100621342 153
456 3300025933 Ga0207706_10055988 Ga0207706_100559883 153
457 3300025933 Ga0207706_10178902 Ga0207706_101789022 153
458 3300025933 Ga0207706_10188242 Ga0207706_101882422 153
459 3300025933 Ga0207706_10192419 Ga0207706_101924192 153
460 3300025933 Ga0207706_10375318 Ga0207706_103753182 153
461 3300025933 Ga0207706_10390329 Ga0207706_103903292 153
462 3300025935 Ga0207709_10000519 Ga0207709_1000051927 153
463 3300025937 Ga0207669_10000688 Ga0207669_100006887 153
464 3300025937 Ga0207669_10001398 Ga0207669_100013988 153
465 3300025940 Ga0207691_10092329 Ga0207691_100923292 153
466 3300025940 Ga0207691_10178308 Ga0207691_101783082 153
467 3300025940 Ga0207691_10568172 Ga0207691_105681722 153
468 3300025944 Ga0207661_10231324 Ga0207661_102313241 153
469 3300025945 Ga0207679_10014032 Ga0207679_100140325 153
470 3300025945 Ga0207679_10061085 Ga0207679_100610852 153
471 3300025949 Ga0207667_10000010 Ga0207667_10000010363 153
472 3300025949 Ga0207667_10019200 Ga0207667_100192007 153
473 3300025949 Ga0207667_10483655 Ga0207667_104836552 153
474 3300025960 Ga0207651_10474834 Ga0207651_104748342 153
475 3300025960 Ga0207651_10728239 Ga0207651_107282392 153
476 3300025961 Ga0207712_10000002 Ga0207712_10000002477 153
477 3300025961 Ga0207712_10158317 Ga0207712_101583173 153
478 3300025961 Ga0207712_10182787 Ga0207712_101827872 153
479 3300025961 Ga0207712_10369324 Ga0207712_103693242 153
480 3300025972 Ga0207668_10000095 Ga0207668_1000009515 153
481 3300025972 Ga0207668_10436003 Ga0207668_104360031 153
482 3300025981 Ga0207640_10061049 Ga0207640_100610492 153
483 3300025981 Ga0207640_10256164 Ga0207640_102561642 153
484 3300025981 Ga0207640_10788341 Ga0207640_107883412 153
485 3300025986 Ga0207658_10330576 Ga0207658_103305762 153
486 3300026035 Ga0207703_10015580 Ga0207703_100155803 153
487 3300026041 Ga0207639_10002650 Ga0207639_1000265014 153
488 3300026041 Ga0207639_10009331 Ga0207639_100093315 153
489 3300026041 Ga0207639_11258253 Ga0207639_112582532 153
490 3300026041 Ga0207639_11473724 Ga0207639_114737242 153
491 3300026067 Ga0207678_10000766 Ga0207678_1000076620 153
492 3300026067 Ga0207678_10573659 Ga0207678_105736591 153
493 3300026088 Ga0207641_10000001 Ga0207641_10000001203 153
494 3300026088 Ga0207641_10005020 Ga0207641_100050203 153
495 3300026089 Ga0207648_10401092 Ga0207648_104010922 153
496 3300026089 Ga0207648_11110912 Ga0207648_111109122 153
497 3300026095 Ga0207676_10000266 Ga0207676_1000026624 153
498 3300026095 Ga0207676_10105278 Ga0207676_101052782 153
499 3300026116 Ga0207674_11020626 Ga0207674_110206262 153
500 3300026118 Ga0207675_102091961 Ga0207675_1020919611 153
501 3300026121 Ga0207683_10003319 Ga0207683_100033195 153
502 3300026121 Ga0207683_10027360 Ga0207683_100273602 153
503 3300026142 Ga0207698_10069323 Ga0207698_100693234 153
504 3300027111 Ga0209281_1046605 Ga0209281_10466052 153
505 3300027876 Ga0209974_10002951 Ga0209974_100029513 153
506 3300028379 Ga0268266_10000002 Ga0268266_100000022090 153
507 3300028379 Ga0268266_10015825 Ga0268266_100158252 153
508 3300028379 Ga0268266_11224015 Ga0268266_112240152 153
509 3300028380 Ga0268265_10000048 Ga0268265_10000048157 153
510 3300028380 Ga0268265_10370022 Ga0268265_103700222 153
511 3300028380 Ga0268265_11449638 Ga0268265_114496381 153
512 3300028381 Ga0268264_10041875 Ga0268264_100418753 153
513 3300028381 Ga0268264_10227795 Ga0268264_102277953 153
514 3300028786 Ga0307517_10029306 Ga0307517_100293063 153
515 3300028794 Ga0307515_10335128 Ga0307515_103351282 153
516 3300031456 Ga0307513_10021678 Ga0307513_100216783 153
517 3300031456 Ga0307513_10026366 Ga0307513_100263669 153
518 3300031456 Ga0307513_10099124 Ga0307513_100991242 153
519 3300031548 Ga0307408_100037669 Ga0307408_1000376692 153
520 3300031548 Ga0307408_100179112 Ga0307408_1001791122 153
521 3300031731 Ga0307405_10046362 Ga0307405_100463622 153
522 3300031731 Ga0307405_10760781 Ga0307405_107607812 153
523 3300031824 Ga0307413_10082788 Ga0307413_100827882 153
524 3300031824 Ga0307413_10646140 Ga0307413_106461402 153
525 3300031852 Ga0307410_10031725 Ga0307410_100317253 153
526 3300031852 Ga0307410_10066858 Ga0307410_100668582 153
527 3300031901 Ga0307406_10090205 Ga0307406_100902051 153
528 3300031901 Ga0307406_10128355 Ga0307406_101283552 153
529 3300031903 Ga0307407_10008202 Ga0307407_100082023 153
530 3300031911 Ga0307412_10001209 Ga0307412_100012096 153
531 3300031911 Ga0307412_10325664 Ga0307412_103256642 153
532 3300031911 Ga0307412_10687872 Ga0307412_106878721 153
533 3300031911 Ga0307412_10730928 Ga0307412_107309282 153
534 3300031995 Ga0307409_100003074 Ga0307409_1000030745 153
535 3300031995 Ga0307409_100033832 Ga0307409_1000338324 153
536 3300031995 Ga0307409_100245229 Ga0307409_1002452293 153
537 3300031995 Ga0307409_100254134 Ga0307409_1002541342 153
538 3300031995 Ga0307409_101144123 Ga0307409_1011441232 153
539 3300031995 Ga0307409_102062297 Ga0307409_1020622971 153
540 3300032002 Ga0307416_100050168 Ga0307416_1000501682 153
541 3300032002 Ga0307416_100853736 Ga0307416_1008537362 153
542 3300032002 Ga0307416_101354408 Ga0307416_1013544081 153
543 3300032004 Ga0307414_10218778 Ga0307414_102187783 153
544 3300032126 Ga0307415_100043560 Ga0307415_1000435604 153
545 3300032126 Ga0307415_100160827 Ga0307415_1001608272 153
546 3300033180 Ga0307510_10016431 Ga0307510_100164316 153
547 3300035691 Ga0373931_0500898 Ga0373931_0500898_147_629 153
548 3300037312 Ga0395899_0004293 Ga0395899_0004293_935_1417 153
549 3300037312 Ga0395899_0576921 Ga0395899_0576921_55_522 153
550 3300037312 Ga0395899_0763848 Ga0395899_0763848_23_505 153
551 3300037418 Ga0395900_0006142 Ga0395900_0006142_2694_3176 153
552 3300037418 Ga0395900_0029277 Ga0395900_0029277_1655_2137 153
553 3300037418 Ga0395900_0232001 Ga0395900_0232001_817_1299 153
554 3300037418 Ga0395900_0406941 Ga0395900_0406941_557_1039 153
555 3300037418 Ga0395900_0465352 Ga0395900_0465352_113_595 153
556 3300037418 Ga0395900_0560852 Ga0395900_0560852_553_1035 153
557 3300037418 Ga0395900_0717705 Ga0395900_0717705_396_878 153
558 3300037418 Ga0395900_1305674 Ga0395900_1305674_53_535 153
559 3300037418 Ga0395900_1769977 Ga0395900_1769977_27_509 153
560 3300037466 Ga0395898_0019268 Ga0395898_0019268_78_560 153
561 3300037466 Ga0395898_0422397 Ga0395898_0422397_39_521 153
562 3300037466 Ga0395898_0500766 Ga0395898_0500766_40_522 153
563 3300037466 Ga0395898_0504124 Ga0395898_0504124_202_684 153
564 3300037466 Ga0395898_0642573 Ga0395898_0642573_258_740 153
565 3300037466 Ga0395898_0708193 Ga0395898_0708193_259_741 153
566 3300037471 Ga0395905_0012133 Ga0395905_0012133_3354_3836 153
567 3300037471 Ga0395905_0013769 Ga0395905_0013769_1116_1598 153
568 3300037471 Ga0395905_0146241 Ga0395905_0146241_1389_1871 153
569 3300037471 Ga0395905_0165458 Ga0395905_0165458_1098_1580 153
570 3300037471 Ga0395905_0184714 Ga0395905_0184714_854_1336 153
571 3300037471 Ga0395905_0226247 Ga0395905_0226247_1049_1531 153
572 3300037471 Ga0395905_0278199 Ga0395905_0278199_105_587 153
573 3300037471 Ga0395905_0280731 Ga0395905_0280731_733_1215 153
574 3300037471 Ga0395905_0728424 Ga0395905_0728424_182_649 153
575 3300037471 Ga0395905_0787930 Ga0395905_0787930_348_830 153
576 3300037471 Ga0395905_1022457 Ga0395905_1022457_23_505 153
577 3300037471 Ga0395905_1027200 Ga0395905_1027200_24_506 153
578 3300037853 Ga0436364_0383514 Ga0436364_0383514_37_501 153
579 3300037853 Ga0436364_1265496 Ga0436364_1265496_4503_4985 153
580 3300038443 Ga0395901_0006471 Ga0395901_0006471_9479_9961 153
581 3300038443 Ga0395901_0008086 Ga0395901_0008086_4574_5056 153
582 3300038443 Ga0395901_0012772 Ga0395901_0012772_71_553 153
583 3300038443 Ga0395901_0447489 Ga0395901_0447489_733_1215 153
584 3300038443 Ga0395901_1397569 Ga0395901_1397569_153_635 153
585 3300039437 Ga0436365_0011005 Ga0436365_0011005_41987_42466 153
586 3300039453 Ga0436362_0287059 Ga0436362_0287059_41987_42466 153
587 3300041404 Ga0439436_0014215 Ga0439436_0014215_1545_2006 153
588 3300041406 Ga0439439_0025555 Ga0439439_0025555_620_1081 153
589 3300041407 Ga0439447_161997 Ga0439447_161997_31_492 153
590 3300041410 Ga0439461_0002751 Ga0439461_0002751_1049_1510 153
591 3300041413 Ga0439465_0000503 Ga0439465_0000503_9909_10370 153
592 3300041413 Ga0439465_0038445 Ga0439465_0038445_1049_1510 153
593 3300041505 Ga0451849_1365278 Ga0451849_1365278_62_544 153
594 3300041997 Ga0439431_0000032 Ga0439431_0000032_17751_18212 153
595 3300042002 Ga0439442_024784 Ga0439442_024784_275_736 153
596 3300042003 Ga0439443_084187 Ga0439443_084187_55_531 153
597 3300042006 Ga0439432_015344 Ga0439432_015344_1065_1526 153
598 3300042010 Ga0439452_016997 Ga0439452_016997_1169_1630 153
599 3300042015 Ga0439462_0005391 Ga0439462_0005391_1381_1842 153
600 3300042015 Ga0439462_0114153 Ga0439462_0114153_274_735 153
601 3300042134 Ga0450898_007035 Ga0450898_007035_223_696 153
602 3300042185 Ga0450909_019070 Ga0450909_019070_21_482 153
603 3300042435 Ga0439434_0000321 Ga0439434_0000321_11839_12300 153
604 3300042435 Ga0439434_0033481 Ga0439434_0033481_234_695 153
605 3300042435 Ga0439434_0058771 Ga0439434_0058771_472_945 153
606 3300042461 Ga0439460_0224251 Ga0439460_0224251_10_498 153
607 3300044684 Ga0466966_0012606 Ga0466966_0012606_1827_2309 153
608 3300044693 Ga0466961_0202435 Ga0466961_0202435_175_657 153
609 3300044694 Ga0466963_0170187 Ga0466963_0170187_548_1030 153
610 3300044694 Ga0466963_0775724 Ga0466963_0775724_76_558 153
611 3300044719 Ga0466971_0032538 Ga0466971_0032538_894_1376 153
612 3300044765 Ga0466970_0023018 Ga0466970_0023018_1460_1942 153
613 3300044765 Ga0466970_0124999 Ga0466970_0124999_467_949 153
614 3300044765 Ga0466970_0272416 Ga0466970_0272416_456_932 153
615 3300045049 Ga0466959_0079138 Ga0466959_0079138_981_1463 153
616 3300045976 Ga0466967_0097276 Ga0466967_0097276_1195_1677 153
617 3300045976 Ga0466967_0905879 Ga0466967_0905879_395_856 153
618 3300045976 Ga0466967_1044786 Ga0466967_1044786_272_754 153
619 3300045976 Ga0466967_1471167 Ga0466967_1471167_100_582 153
620 3300046459 Ga0495629_0037829 Ga0495629_0037829_1513_1980 153
621 3300046460 Ga0495638_0278506 Ga0495638_0278506_143_610 153
622 3300046471 Ga0495650_0000058 Ga0495650_0000058_231038_231505 153
623 3300046491 Ga0495584_0321877 Ga0495584_0321877_289_756 153
624 3300046492 Ga0495585_0026323 Ga0495585_0026323_2186_2653 153
625 3300046501 Ga0495607_0368119 Ga0495607_0368119_118_585 153
626 3300046506 Ga0495583_0002149 Ga0495583_0002149_2589_3056 153
627 3300046506 Ga0495583_0008668 Ga0495583_0008668_277_744 153
628 3300046506 Ga0495583_0011100 Ga0495583_0011100_3477_3944 153
629 3300046507 Ga0495606_0000359 Ga0495606_0000359_49363_49830 153
630 3300046513 Ga0495616_0027215 Ga0495616_0027215_1354_1821 153
631 3300046518 Ga0495631_0049559 Ga0495631_0049559_14_481 153
632 3300046518 Ga0495631_0062294 Ga0495631_0062294_310_777 153
633 3300046519 Ga0495632_0000060 Ga0495632_0000060_85607_86080 153
634 3300046520 Ga0495637_0024194 Ga0495637_0024194_199_666 153
635 3300046520 Ga0495637_0027122 Ga0495637_0027122_520_993 153
636 3300046522 Ga0495643_0000014 Ga0495643_0000014_180119_180592 153
637 3300046522 Ga0495643_0003466 Ga0495643_0003466_9678_10145 153
638 3300046522 Ga0495643_0003475 Ga0495643_0003475_5576_6043 153
639 3300046522 Ga0495643_0236222 Ga0495643_0236222_187_654 153
640 3300046524 Ga0495648_0192194 Ga0495648_0192194_456_920 153
641 3300046525 Ga0495663_0000007 Ga0495663_0000007_128663_129136 153
642 3300046525 Ga0495663_0003896 Ga0495663_0003896_266_733 153
643 3300046528 Ga0495642_0029122 Ga0495642_0029122_1695_2162 153
644 3300046536 Ga0495587_0116803 Ga0495587_0116803_418_885 153
645 3300046538 Ga0495609_0105027 Ga0495609_0105027_461_928 153
646 3300046557 Ga0495622_0033204 Ga0495622_0033204_20_487 153
647 3300046558 Ga0495633_0000722 Ga0495633_0000722_5046_5513 153
648 3300046558 Ga0495633_0001967 Ga0495633_0001967_9281_9754 153
649 3300046558 Ga0495633_0033208 Ga0495633_0033208_1203_1670 153
650 3300046558 Ga0495633_0085980 Ga0495633_0085980_866_1339 153
651 3300046558 Ga0495633_0397004 Ga0495633_0397004_22_510 153
652 3300046616 Ga0495668_0000163 Ga0495668_0000163_98992_99459 153
653 3300046616 Ga0495668_0032485 Ga0495668_0032485_822_1286 153
654 3300046648 Ga0495611_0037145 Ga0495611_0037145_139_606 153
655 3300046648 Ga0495611_0322776 Ga0495611_0322776_35_502 153
656 3300046660 Ga0495625_0000568 Ga0495625_0000568_16897_17364 153
657 3300046660 Ga0495625_0027964 Ga0495625_0027964_3295_3762 153
658 3300046660 Ga0495625_0088136 Ga0495625_0088136_1481_1948 153
659 3300046665 Ga0495661_0321545 Ga0495661_0321545_279_746 153
660 3300046665 Ga0495661_0400507 Ga0495661_0400507_34_498 153
661 3300046684 Ga0495669_0000096 Ga0495669_0000096_3932_4399 153
662 3300046684 Ga0495669_0069883 Ga0495669_0069883_233_715 153
663 3300046691 Ga0495670_0000002 Ga0495670_0000002_597327_597788 153
664 3300046691 Ga0495670_0035919 Ga0495670_0035919_1654_2121 153
665 3300046691 Ga0495670_0100073 Ga0495670_0100073_823_1308 153
666 3300046691 Ga0495670_0167230 Ga0495670_0167230_618_1094 153
667 3300046692 Ga0495671_0000032 Ga0495671_0000032_66672_67145 153
668 3300046692 Ga0495671_0424699 Ga0495671_0424699_35_502 153
669 3300046694 Ga0495649_0197103 Ga0495649_0197103_227_694 153
670 3300046694 Ga0495649_0204435 Ga0495649_0204435_52_516 153
671 3300046809 Ga0495600_0001482 Ga0495600_0001482_8256_8723 153
672 3300047323 Ga0495683_0003243 Ga0495683_0003243_3483_3950 153
673 3300047323 Ga0495683_0050546 Ga0495683_0050546_239_706 153
674 3300047323 Ga0495683_0282799 Ga0495683_0282799_93_575 153
675 3300047443 Ga0495687_000378 Ga0495687_000378_51747_52214 153
676 3300047443 Ga0495687_000511 Ga0495687_000511_31610_32077 153
677 3300047445 Ga0495677_0002165 Ga0495677_0002165_1631_2095 153
678 3300047445 Ga0495677_0009953 Ga0495677_0009953_119_586 153
679 3300047470 Ga0495681_0012956 Ga0495681_0012956_723_1190 153
680 3300047470 Ga0495681_0015295 Ga0495681_0015295_3306_3779 153
681 3300047470 Ga0495681_0124120 Ga0495681_0124120_17_481 153
682 3300047470 Ga0495681_0180537 Ga0495681_0180537_349_816 153
683 3300047472 Ga0495686_0000191 Ga0495686_0000191_25367_25828 153
684 3300047472 Ga0495686_0006710 Ga0495686_0006710_157_618 153
685 3300047472 Ga0495686_0098637 Ga0495686_0098637_184_657 153
686 3300047472 Ga0495686_0341753 Ga0495686_0341753_13_474 153
687 3300048903 Ga0496100_0110081 Ga0496100_0110081_246_728 153
688 3300048904 Ga0496101_0021750 Ga0496101_0021750_2306_2788 153
689 3300048905 Ga0496102_0000069 Ga0496102_0000069_97017_97478 153
690 3300048905 Ga0496102_0000281 Ga0496102_0000281_5656_6123 153
691 3300048905 Ga0496102_0505399 Ga0496102_0505399_513_983 153
692 3300048905 Ga0496102_1256428 Ga0496102_1256428_48_530 153
693 3300048906 Ga0496103_0000173 Ga0496103_0000173_55609_56070 153
694 3300048906 Ga0496103_0001375 Ga0496103_0001375_10390_10857 153
695 3300048907 Ga0496104_0025056 Ga0496104_0025056_1123_1590 153
696 3300048907 Ga0496104_0279269 Ga0496104_0279269_766_1227 153
697 3300048910 Ga0496107_0014793 Ga0496107_0014793_4383_4865 153
698 3300048910 Ga0496107_0389245 Ga0496107_0389245_323_784 153
699 3300048914 Ga0496111_0064758 Ga0496111_0064758_782_1249 153
700 3300048915 Ga0496112_0009308 Ga0496112_0009308_4095_4577 153
701 3300048915 Ga0496112_0009432 Ga0496112_0009432_436_918 153
702 3300048915 Ga0496112_0236132 Ga0496112_0236132_129_611 153
703 3300048917 Ga0496114_0014216 Ga0496114_0014216_1378_1845 153
704 3300048918 Ga0496115_0000134 Ga0496115_0000134_23655_24122 153
705 3300048918 Ga0496115_0001169 Ga0496115_0001169_3733_4194 153
706 3300048919 Ga0496116_0000566 Ga0496116_0000566_46839_47300 153
707 3300048919 Ga0496116_0006626 Ga0496116_0006626_8898_9365 153
708 3300048920 Ga0496117_0000485 Ga0496117_0000485_10540_11001 153
709 3300048920 Ga0496117_0002942 Ga0496117_0002942_14521_14988 153
710 3300048921 Ga0496118_0000190 Ga0496118_0000190_10540_11001 153
711 3300048921 Ga0496118_0000392 Ga0496118_0000392_43073_43540 153
712 3300048922 Ga0496119_0090314 Ga0496119_0090314_529_990 153
713 3300048922 Ga0496119_0092952 Ga0496119_0092952_484_951 153
714 3300048922 Ga0496119_0166594 Ga0496119_0166594_549_1010 153
715 3300048923 Ga0496120_0007020 Ga0496120_0007020_2502_2969 153
716 3300048924 Ga0496121_0000105 Ga0496121_0000105_66750_67211 153
717 3300048924 Ga0496121_0000655 Ga0496121_0000655_58931_59398 153
718 3300048925 Ga0496122_0048047 Ga0496122_0048047_656_1117 153
719 3300048926 Ga0496123_0004252 Ga0496123_0004252_1800_2363 153
720 3300048926 Ga0496123_0060789 Ga0496123_0060789_1566_2027 153
721 3300048927 Ga0496124_0000068 Ga0496124_0000068_215708_216175 153
722 3300048927 Ga0496124_0000175 Ga0496124_0000175_114367_114828 153
723 3300048927 Ga0496124_0000546 Ga0496124_0000546_52624_53085 153
724 3300048927 Ga0496124_0001803 Ga0496124_0001803_23263_23826 153
725 3300048927 Ga0496124_0050277 Ga0496124_0050277_1691_2152 153
726 3300048928 Ga0496125_0056664 Ga0496125_0056664_1433_1894 153
727 3300048929 Ga0496126_0000634 Ga0496126_0000634_59583_60050 153
728 3300049570 Ga0501033_0262624 Ga0501033_0262624_16_477 153
729 3300049571 Ga0501034_0707041 Ga0501034_0707041_404_865 153
730 3300049581 Ga0501047_0311038 Ga0501047_0311038_496_957 153
731 3300049742 Ga0501080_0700549 Ga0501080_0700549_167_628 153
732 3300049765 Ga0501268_055004 Ga0501268_055004_253_732 153
733 3300049776 Ga0501280_003226 Ga0501280_003226_37_510 153
734 3300050489 nmdc:mga03683_197501_c1 nmdc:mga03683_197501_c1_375_836 153
735 3300050493 nmdc:mga0k408_31120_c1 nmdc:mga0k408_31120_c1_1165_1632 153
736 3300050509 nmdc:mga0qj67_182633_c1 nmdc:mga0qj67_182633_c1_401_874 153
737 3300050511 nmdc:mga08y16_982596_c1 nmdc:mga08y16_982596_c1_80_553 153
738 3300050516 nmdc:mga0sz30_242758_c1 nmdc:mga0sz30_242758_c1_21_488 153
739 3300053083 Ga0495655_0035620 Ga0495655_0035620_499_981 153
740 3300053087 Ga0500643_000924 Ga0500643_000924_6747_7211 153
741 3300053087 Ga0500643_007382 Ga0500643_007382_675_1139 153
742 3300053090 Ga0500646_0207484 Ga0500646_0207484_63_524 153
743 3300053094 Ga0500566_0000374 Ga0500566_0000374_12849_13310 153
744 3300053096 Ga0500641_0113535 Ga0500641_0113535_320_781 153
745 3300053098 Ga0500650_0380821 Ga0500650_0380821_21_485 153
746 3300053104 Ga0500556_0011172 Ga0500556_0011172_102_572 153
747 3300053108 Ga0500562_016340 Ga0500562_016340_141_602 153
748 3300053116 Ga0500592_003670 Ga0500592_003670_370_831 153
749 3300053119 Ga0500595_002853 Ga0500595_002853_5545_6012 153
750 3300053119 Ga0500595_033823 Ga0500595_033823_672_1133 153
751 3300053120 Ga0500597_028503 Ga0500597_028503_189_653 153
752 3300053134 Ga0500658_0004231 Ga0500658_0004231_1536_1997 153
753 3300053134 Ga0500658_0006024 Ga0500658_0006024_866_1330 153
754 3300053139 Ga0500568_0074951 Ga0500568_0074951_454_915 153
755 3300053151 Ga0500604_0020991 Ga0500604_0020991_1228_1689 153
756 3300053154 Ga0500619_002638 Ga0500619_002638_2650_3117 153
757 3300053157 Ga0500624_000022 Ga0500624_000022_115360_115824 153
758 3300053158 Ga0500627_0000068 Ga0500627_0000068_35580_36041 153
759 3300053158 Ga0500627_0301936 Ga0500627_0301936_178_645 153
760 3300053177 Ga0500636_0003684 Ga0500636_0003684_2630_3097 153
761 3300053178 Ga0500637_0000095 Ga0500637_0000095_30143_30607 153
762 3300053727 Ga0500611_001944 Ga0500611_001944_1173_1637 153
763 3300053730 Ga0500645_000008 Ga0500645_000008_206204_206671 153
764 3300053730 Ga0500645_077934 Ga0500645_077934_161_625 153
765 3300053735 Ga0500596_003731 Ga0500596_003731_2063_2530 153
766 3300055283 Ga0500661_024634 Ga0500661_024634_114_581 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03652

RuvX

Holliday junction resolvase

51

183

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.885 17 148
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8579 17 148
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8485 16 149
1nmn-assembly2.cif.gz_B structure of yqgf from escherichia coli, a hypothetical protein 0.8386 16 148
1nu0-assembly2.cif.gz_B structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein 0.834 16 148
ID Description Score Start End Superfamily
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.9217 17 152 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.879 17 152 3.30.420.140
af_F4IC62_83_217_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8678 20 149 3.30.420.140
af_Q2FXW1_3_142_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8365 17 150 3.30.420.140
af_Q8GYR7_22_166_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8353 17 152 3.30.420.140
ID Description Score Start End GO Terms
AF-A0A1V5KJL9-F1-model_v4 Multifunctional fusion protein [Includes: Putative pre-16S rRNA nuclease (EC 3.1.-.-); UPF0473 protein BWY81_00711] 0.9713 18 149 GO:0000967
GO:0004518
GO:0005829
AF-A0A7V3UIF6-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9685 15 152 GO:0000967
GO:0004518
GO:0005829
AF-A0A2V9WEU1-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9676 14 152 GO:0000967
GO:0004518
GO:0005829
AF-X1G2L9-F1-model_v4 YqgF/RNase H-like domain-containing protein 0.967 18 104 GO:0000967
GO:0004518
GO:0005829
AF-A0A3R8B1S0-F1-model_v4 Holliday junction resolvase RuvX 0.9658 7 97 GO:0000967
GO:0004518
GO:0005829

Feature Viewer

pLDDT pTM Quality
90.93 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map