F479784

General Info

Members Datasets Scaffolds Average Seq Length
765 342 757 210

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10347566|Ga0105248_103475662
Length 251
Sequence VRPCEPGSSIARYETKRFPSANKVPEHRARCTPFTFEELDMSMTRRTIGCLAATLLSFAALGVQAQAKAPEALIKEVSTDVLEAVKADKTIQAGDLRKVIALVDQKVLPYVNFQRMTASAVGRYWKQATPDQQKRLQDEFKLLLVRTYSGALSQVSAEQTVELRPTRSAPTDNEVVVRTEIKGKGDPIQLDYRLEKAGDSWKIYDVNVLGVWLVENYRNSFAQEIGANGIDGLIAKMAERNKSAAAGGAKS

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221585 Pelomonas sp. Root662 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
6 2643221656 Pelomonas sp. Root405 Isolate Unclassified
7 2738541337 Pelomonas sp. BT06 Isolate Unclassified
8 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
9 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
226 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
229 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
230 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
231 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
232 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
233 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
267 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
289 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
290 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
291 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
301 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
302 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
303 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
304 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
305 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
306 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
307 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
308 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
309 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
310 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
311 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
312 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
313 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
314 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
315 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
316 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
317 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
318 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
319 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
320 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
329 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
330 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
331 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
332 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
333 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
334 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
335 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
336 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
337 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
338 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
339 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
340 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
341 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
342 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 1.83
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.54
Nodule 0
Rhizoplane 2.22
Rhizosphere 84.44
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006778J45830_1077259 3300003162 Bacteria 1394
2 rootH1_10004194 3300003316 Bacteria 11979
3 rootL2_10098807 3300003322 Bacteria 2900
4 rootH1_10008114 3300003323 Bacteria 13430
5 rootH1_10022168 3300003323 Bacteria 2015
6 Ga0055525_1000004 3300003759 Bacteria 888039
7 Ga0065712_10084099 3300005290 Bacteria 2790
8 Ga0065715_10049568 3300005293 Bacteria 1024
9 Ga0065715_10104338 3300005293 Bacteria 2969
10 Ga0070658_10016712 3300005327 Bacteria 5873
11 Ga0070658_10386475 3300005327 Bacteria 1201
12 Ga0070676_10010818 3300005328 Bacteria 4951
13 Ga0070676_10017134 3300005328 Bacteria 4008
14 Ga0070676_10033533 3300005328 Bacteria 2946
15 Ga0070676_10034601 3300005328 Bacteria 2901
16 Ga0070676_10108413 3300005328 Bacteria 1726
17 Ga0070676_10157798 3300005328 Bacteria 1457
18 Ga0070683_100016923 3300005329 Bacteria 6433
19 Ga0070683_100377504 3300005329 Bacteria 1351
20 Ga0070690_100319948 3300005330 Bacteria 1117
21 Ga0070690_100647468 3300005330 Bacteria 807
22 Ga0070670_100005993 3300005331 Bacteria 10284
23 Ga0070670_100013611 3300005331 Bacteria 6971
24 Ga0070670_100021917 3300005331 Bacteria 5496
25 Ga0070670_100026210 3300005331 Bacteria 5018
26 Ga0070670_100034305 3300005331 Bacteria 4367
27 Ga0070670_100080193 3300005331 Bacteria 2805
28 Ga0070670_100099934 3300005331 Bacteria 2497
29 Ga0070670_100178991 3300005331 Bacteria 1840
30 Ga0070670_100201654 3300005331 Bacteria 1729
31 Ga0070670_100225662 3300005331 Bacteria 1630
32 Ga0070670_100287372 3300005331 Bacteria 1436
33 Ga0070670_100319287 3300005331 Bacteria 1360
34 Ga0070670_100868375 3300005331 Bacteria 817
35 Ga0070677_10018747 3300005333 Bacteria 2496
36 Ga0070677_10042845 3300005333 Bacteria 1795
37 Ga0068869_100003409 3300005334 Bacteria 9707
38 Ga0068869_100003488 3300005334 Bacteria 9627
39 Ga0070666_10055778 3300005335 Bacteria 2667
40 Ga0070666_10200545 3300005335 Bacteria 1404
41 Ga0070680_100007060 3300005336 Bacteria 8563
42 Ga0068868_100003534 3300005338 Bacteria 10890
43 Ga0068868_100242372 3300005338 Bacteria 1515
44 Ga0068868_100712822 3300005338 Bacteria 898
45 Ga0070660_100383928 3300005339 Bacteria 1160
46 Ga0070687_100100759 3300005343 Bacteria 1616
47 Ga0070661_100084282 3300005344 Bacteria 2348
48 Ga0070661_100108494 3300005344 Bacteria 2071
49 Ga0070661_100159403 3300005344 Bacteria 1708
50 Ga0070661_100504569 3300005344 Bacteria 969
51 Ga0070668_100082979 3300005347 Bacteria 2515
52 Ga0070668_100338802 3300005347 Bacteria 1270
53 Ga0070668_100658652 3300005347 Bacteria 920
54 Ga0070669_100044294 3300005353 Bacteria 3242
55 Ga0070669_100050718 3300005353 Bacteria 3031
56 Ga0070669_100508065 3300005353 Bacteria 1000
57 Ga0070675_100003929 3300005354 Bacteria 11264
58 Ga0070675_100010402 3300005354 Bacteria 7268
59 Ga0070675_100011240 3300005354 Bacteria 7009
60 Ga0070675_100231294 3300005354 Bacteria 1613
61 Ga0070675_100281933 3300005354 Bacteria 1460
62 Ga0070671_100008407 3300005355 Bacteria 8273
63 Ga0070671_100020098 3300005355 Bacteria 5442
64 Ga0070671_100181160 3300005355 Bacteria 1783
65 Ga0070671_100211408 3300005355 Bacteria 1645
66 Ga0070671_100624712 3300005355 Bacteria 932
67 Ga0070674_100020881 3300005356 Bacteria 4194
68 Ga0070674_100028306 3300005356 Bacteria 3680
69 Ga0070674_100088341 3300005356 Bacteria 2231
70 Ga0070674_100319315 3300005356 Bacteria 1244
71 Ga0070673_100002371 3300005364 Bacteria 11464
72 Ga0070673_100011725 3300005364 Bacteria 5994
73 Ga0070673_100273123 3300005364 Bacteria 1480
74 Ga0070673_101018487 3300005364 Bacteria 771
75 Ga0070688_100099803 3300005365 Bacteria 1912
76 Ga0070659_100011449 3300005366 Bacteria 6562
77 Ga0070659_100178140 3300005366 Bacteria 1744
78 Ga0070659_100481927 3300005366 Bacteria 1055
79 Ga0070667_100032917 3300005367 Bacteria 4327
80 Ga0070667_100135496 3300005367 Bacteria 2153
81 Ga0070667_100222831 3300005367 Bacteria 1679
82 Ga0070667_100673472 3300005367 Bacteria 956
83 Ga0070667_100714862 3300005367 Bacteria 927
84 Ga0070700_100067380 3300005441 Bacteria 2274
85 Ga0070694_100492507 3300005444 Bacteria 974
86 Ga0070663_100019470 3300005455 Bacteria 4474
87 Ga0070663_100624401 3300005455 Bacteria 909
88 Ga0070678_100006062 3300005456 Bacteria 7052
89 Ga0070678_100079865 3300005456 Bacteria 2475
90 Ga0070678_100081202 3300005456 Bacteria 2457
91 Ga0070678_100139871 3300005456 Bacteria 1936
92 Ga0070678_100161592 3300005456 Bacteria 1815
93 Ga0070678_100224568 3300005456 Bacteria 1562
94 Ga0070662_100005695 3300005457 Bacteria 7972
95 Ga0070662_100031932 3300005457 Bacteria 3699
96 Ga0070662_100066091 3300005457 Bacteria 2653
97 Ga0070662_100096975 3300005457 Bacteria 2225
98 Ga0070662_100317970 3300005457 Bacteria 1269
99 Ga0070681_10017630 3300005458 Bacteria 7135
100 Ga0068867_100000039 3300005459 Bacteria 80301
101 Ga0068867_100005426 3300005459 Bacteria 9022
102 Ga0068867_100011577 3300005459 Bacteria 6228
103 Ga0068867_100011992 3300005459 Bacteria 6123
104 Ga0068867_100030867 3300005459 Bacteria 3867
105 Ga0068867_100064789 3300005459 Bacteria 2717
106 Ga0068867_100071487 3300005459 Bacteria 2595
107 Ga0068867_100088852 3300005459 Bacteria 2342
108 Ga0070706_100032108 3300005467 Bacteria 4843
109 Ga0070707_100527591 3300005468 Bacteria 1143
110 Ga0070679_100000726 3300005530 Bacteria 28453
111 Ga0070684_100005261 3300005535 Bacteria 9903
112 Ga0070684_100296305 3300005535 Bacteria 1484
113 Ga0068853_100006811 3300005539 Bacteria 9111
114 Ga0068853_100016160 3300005539 Bacteria 6138
115 Ga0068853_100018149 3300005539 Bacteria 5819
116 Ga0068853_100631394 3300005539 Bacteria 1018
117 Ga0068853_100727613 3300005539 Bacteria 947
118 Ga0070672_100004529 3300005543 Bacteria 9099
119 Ga0070672_100017872 3300005543 Bacteria 5113
120 Ga0070672_100026382 3300005543 Bacteria 4322
121 Ga0070672_100086298 3300005543 Bacteria 2524
122 Ga0070672_100585351 3300005543 Bacteria 971
123 Ga0070693_100041764 3300005547 Bacteria 2582
124 Ga0070693_100044620 3300005547 Bacteria 2508
125 Ga0070665_100007443 3300005548 Bacteria 11136
126 Ga0070665_100104794 3300005548 Bacteria 2830
127 Ga0070665_100183680 3300005548 Bacteria 2092
128 Ga0070665_100331876 3300005548 Bacteria 1525
129 Ga0068855_100018761 3300005563 Bacteria 8316
130 Ga0070664_100015313 3300005564 Bacteria 6270
131 Ga0070664_100031340 3300005564 Bacteria 4441
132 Ga0070664_100082566 3300005564 Bacteria 2772
133 Ga0070664_100226738 3300005564 Bacteria 1673
134 Ga0070664_100484406 3300005564 Bacteria 1139
135 Ga0070664_100499843 3300005564 Bacteria 1120
136 Ga0068857_100010507 3300005577 Bacteria 8046
137 Ga0068857_100058624 3300005577 Bacteria 3419
138 Ga0068857_100916614 3300005577 Bacteria 841
139 Ga0068857_101003583 3300005577 Bacteria 803
140 Ga0068854_100093842 3300005578 Bacteria 2237
141 Ga0068854_100137085 3300005578 Bacteria 1874
142 Ga0068854_100815238 3300005578 Bacteria 814
143 Ga0068856_100013192 3300005614 Bacteria 8003
144 Ga0068856_100074496 3300005614 Bacteria 3361
145 Ga0068856_100154716 3300005614 Bacteria 2303
146 Ga0068856_100247911 3300005614 Bacteria 1796
147 Ga0068856_100531048 3300005614 Bacteria 1198
148 Ga0070702_100479630 3300005615 Bacteria 909
149 Ga0068852_100009092 3300005616 Bacteria 7356
150 Ga0068852_100013380 3300005616 Bacteria 6280
151 Ga0068852_100066202 3300005616 Bacteria 3155
152 Ga0068852_100076990 3300005616 Bacteria 2947
153 Ga0068852_100114694 3300005616 Bacteria 2455
154 Ga0068852_100145938 3300005616 Bacteria 2195
155 Ga0068852_100566609 3300005616 Bacteria 1137
156 Ga0068859_100051040 3300005617 Bacteria 4156
157 Ga0068859_100175354 3300005617 Bacteria 2226
158 Ga0068864_100003169 3300005618 Bacteria 13604
159 Ga0068864_100009398 3300005618 Bacteria 8066
160 Ga0068864_100027497 3300005618 Bacteria 4805
161 Ga0068864_100030416 3300005618 Bacteria 4576
162 Ga0068864_100245098 3300005618 Bacteria 1661
163 Ga0068864_100382206 3300005618 Bacteria 1334
164 Ga0068864_100609456 3300005618 Unclassified 1060
165 Ga0068866_10019689 3300005718 Bacteria 3078
166 Ga0068861_100005459 3300005719 Bacteria 8611
167 Ga0068861_100013781 3300005719 Bacteria 5662
168 Ga0068861_100145774 3300005719 Bacteria 1937
169 Ga0068861_100448370 3300005719 Bacteria 1156
170 Ga0068861_101123611 3300005719 Bacteria 756
171 Ga0068851_10008150 3300005834 Bacteria 4838
172 Ga0068851_10036705 3300005834 Bacteria 2454
173 Ga0068851_10044727 3300005834 Bacteria 2236
174 Ga0068851_10095413 3300005834 Bacteria 1572
175 Ga0068851_10361589 3300005834 Bacteria 846
176 Ga0068870_10076234 3300005840 Bacteria 1841
177 Ga0068870_10107103 3300005840 Bacteria 1590
178 Ga0068870_10142605 3300005840 Bacteria 1403
179 Ga0068870_10203098 3300005840 Bacteria 1203
180 Ga0068863_100018287 3300005841 Bacteria 6711
181 Ga0068863_100297048 3300005841 Bacteria 1566
182 Ga0068863_100704941 3300005841 Bacteria 1003
183 Ga0068858_100010630 3300005842 Bacteria 8712
184 Ga0068860_100039824 3300005843 Bacteria 4494
185 Ga0068860_100090075 3300005843 Bacteria 2921
186 Ga0068860_100126165 3300005843 Bacteria 2453
187 Ga0068860_100182469 3300005843 Bacteria 2029
188 Ga0068862_100042040 3300005844 Bacteria 3891
189 Ga0068862_100086453 3300005844 Bacteria 2726
190 Ga0068862_100441293 3300005844 Bacteria 1225
191 Ga0070716_100136193 3300006173 Bacteria 1560
192 Ga0075362_10185197 3300006177 Bacteria 1010
193 Ga0075367_10142236 3300006178 Bacteria 1486
194 Ga0075366_10000910 3300006195 Bacteria 14335
195 Ga0075366_10003844 3300006195 Bacteria 7999
196 Ga0075366_10008552 3300006195 Bacteria 5695
197 Ga0075366_10016010 3300006195 Bacteria 4305
198 Ga0075366_10021753 3300006195 Bacteria 3729
199 Ga0075366_10042018 3300006195 Bacteria 2707
200 Ga0075366_10100776 3300006195 Bacteria 1733
201 Ga0097621_100009144 3300006237 Bacteria 7182
202 Ga0097621_100044849 3300006237 Bacteria 3569
203 Ga0097621_100127529 3300006237 Bacteria 2162
204 Ga0075370_10000354 3300006353 Bacteria 16716
205 Ga0075370_10007324 3300006353 Bacteria 5618
206 Ga0075370_10029066 3300006353 Bacteria 3076
207 Ga0075370_10038737 3300006353 Bacteria 2683
208 Ga0075370_10049991 3300006353 Bacteria 2371
209 Ga0068871_100006200 3300006358 Bacteria 8431
210 Ga0068871_100008132 3300006358 Bacteria 7530
211 Ga0068871_100016972 3300006358 Bacteria 5497
212 Ga0068871_100021762 3300006358 Bacteria 4935
213 Ga0075430_100024549 3300006846 Bacteria 5127
214 Ga0068865_100041024 3300006881 Bacteria 3148
215 Ga0068865_100080474 3300006881 Bacteria 2336
216 Ga0068865_100112571 3300006881 Bacteria 2010
217 Ga0068865_100408227 3300006881 Bacteria 1114
218 Ga0068865_101203528 3300006881 Bacteria 671
219 Ga0097620_100051038 3300006931 Bacteria 4156
220 Ga0097620_100175351 3300006931 Bacteria 2226
221 Ga0075435_100811210 3300007076 Bacteria 815
222 Ga0105240_10002152 3300009093 Bacteria 32168
223 Ga0105240_10750669 3300009093 Bacteria 1061
224 Ga0111539_10668624 3300009094 Bacteria 1209
225 Ga0111539_11322043 3300009094 Bacteria 836
226 Ga0105245_10308565 3300009098 Bacteria 1555
227 Ga0105245_10371842 3300009098 Bacteria 1421
228 Ga0114129_10080001 3300009147 Bacteria 4544
229 Ga0114129_11755964 3300009147 Bacteria 756
230 Ga0105243_10004160 3300009148 Bacteria 11482
231 Ga0105243_10079876 3300009148 Bacteria 2666
232 Ga0105243_10178693 3300009148 Bacteria 1844
233 Ga0105243_10429104 3300009148 Bacteria 1235
234 Ga0105241_10050051 3300009174 Bacteria 3184
235 Ga0105242_10084716 3300009176 Bacteria 2657
236 Ga0105248_10011079 3300009177 Bacteria 9946
237 Ga0105248_10018942 3300009177 Bacteria 7611
238 Ga0105248_10074691 3300009177 Bacteria 3810
239 Ga0105248_10347566 3300009177 Bacteria 1670
240 Ga0105248_10415963 3300009177 Bacteria 1514
241 Ga0105248_10451657 3300009177 Bacteria 1448
242 Ga0105248_10956328 3300009177 Bacteria 967
243 Ga0105237_10003209 3300009545 Bacteria 19583
244 Ga0105237_10035404 3300009545 Bacteria 5052
245 Ga0105238_10009054 3300009551 Bacteria 9960
246 Ga0105238_10016299 3300009551 Bacteria 7521
247 Ga0105238_10152230 3300009551 Bacteria 2288
248 Ga0105238_10334890 3300009551 Bacteria 1501
249 Ga0105249_10074684 3300009553 Bacteria 3139
250 Ga0105249_10148826 3300009553 Bacteria 2252
251 Ga0105249_11515953 3300009553 Bacteria 743
252 Ga0105239_10001461 3300010375 Bacteria 31458
253 Ga0105239_10305478 3300010375 Bacteria 1792
254 Ga0105246_10061627 3300011119 Bacteria 2611
255 Ga0105246_10097110 3300011119 Bacteria 2137
256 Ga0105246_10983222 3300011119 Bacteria 763
257 Ga0157373_10053653 3300013100 Bacteria 2866
258 Ga0157371_10109439 3300013102 Bacteria 1961
259 Ga0157371_10196215 3300013102 Bacteria 1446
260 Ga0157370_10576582 3300013104 Bacteria 1031
261 Ga0157369_10058720 3300013105 Bacteria 4149
262 Ga0157369_10182335 3300013105 Bacteria 2209
263 Ga0157374_10031054 3300013296 Bacteria 4851
264 Ga0157374_10052887 3300013296 Bacteria 3784
265 Ga0157374_10064219 3300013296 Bacteria 3444
266 Ga0157374_10344983 3300013296 Bacteria 1479
267 Ga0157378_10389624 3300013297 Bacteria 1370
268 Ga0157378_10480928 3300013297 Bacteria 1237
269 Ga0157378_10689578 3300013297 Bacteria 1040
270 Ga0163162_10047853 3300013306 Bacteria 4284
271 Ga0163162_10262578 3300013306 Bacteria 1858
272 Ga0163162_10335040 3300013306 Bacteria 1645
273 Ga0163162_10585832 3300013306 Bacteria 1242
274 Ga0157372_10013740 3300013307 Bacteria 8651
275 Ga0157372_10163891 3300013307 Bacteria 2570
276 Ga0157375_10005174 3300013308 Bacteria 11316
277 Ga0157375_10012252 3300013308 Bacteria 7602
278 Ga0157375_10014262 3300013308 Bacteria 7084
279 Ga0157375_10018621 3300013308 Bacteria 6300
280 Ga0157375_10043978 3300013308 Bacteria 4334
281 Ga0163163_10170197 3300014325 Bacteria 2225
282 Ga0163163_10527962 3300014325 Bacteria 1243
283 Ga0163163_10558172 3300014325 Bacteria 1208
284 Ga0163163_10868387 3300014325 Bacteria 965
285 Ga0157380_10088041 3300014326 Bacteria 2554
286 Ga0157380_10173230 3300014326 Bacteria 1888
287 Ga0157380_10471894 3300014326 Bacteria 1211
288 Ga0157380_10744582 3300014326 Bacteria 991
289 Ga0157377_10000044 3300014745 Bacteria 100420
290 Ga0157377_10001565 3300014745 Bacteria 9949
291 Ga0157377_10278963 3300014745 Bacteria 1094
292 Ga0157379_10004002 3300014968 Bacteria 12563
293 Ga0157379_10010130 3300014968 Bacteria 8218
294 Ga0157379_10020334 3300014968 Bacteria 5869
295 Ga0157379_10026436 3300014968 Bacteria 5166
296 Ga0157379_10589571 3300014968 Bacteria 1037
297 Ga0157379_10697595 3300014968 Bacteria 953
298 Ga0157376_10003307 3300014969 Bacteria 11099
299 Ga0157376_10007305 3300014969 Bacteria 7869
300 Ga0157376_10077851 3300014969 Bacteria 2837
301 Ga0157376_10418916 3300014969 Bacteria 1299
302 Ga0157376_10625128 3300014969 Bacteria 1075
303 Ga0157376_10713108 3300014969 Bacteria 1009
304 Ga0182006_1108030 3300015261 Bacteria 979
305 Ga0163161_10006298 3300017792 Bacteria 8215
306 Ga0163161_10009331 3300017792 Bacteria 6789
307 Ga0163161_10086351 3300017792 Bacteria 2316
308 Ga0163161_10102709 3300017792 Bacteria 2129
309 Ga0163161_10376810 3300017792 Bacteria 1133
310 Ga0163161_10539629 3300017792 Bacteria 955
311 Ga0213872_10000067 3300021361 Bacteria 92410
312 Ga0209674_109982 3300025226 Bacteria 1033
313 Ga0209563_100013 3300025230 Bacteria 941463
314 Ga0209051_1016706 3300025303 Bacteria 3305
315 Ga0209051_1041082 3300025303 Bacteria 1650
316 Ga0209257_1000033 3300025304 Bacteria 671006
317 Ga0207697_10003064 3300025315 Bacteria 8383
318 Ga0207697_10027011 3300025315 Bacteria 2347
319 Ga0207656_10024202 3300025321 Bacteria 2453
320 Ga0207656_10086056 3300025321 Bacteria 1420
321 Ga0207656_10128452 3300025321 Unclassified 1185
322 Ga0207656_10244438 3300025321 Bacteria 878
323 Ga0207682_10002801 3300025893 Bacteria 7710
324 Ga0207682_10011716 3300025893 Bacteria 3427
325 Ga0207682_10050682 3300025893 Bacteria 1717
326 Ga0207642_10010828 3300025899 Bacteria 3231
327 Ga0207688_10041571 3300025901 Bacteria 2558
328 Ga0207680_10058549 3300025903 Bacteria 2336
329 Ga0207680_10123684 3300025903 Bacteria 1695
330 Ga0207645_10004979 3300025907 Bacteria 9736
331 Ga0207645_10023445 3300025907 Bacteria 4012
332 Ga0207645_10024932 3300025907 Bacteria 3874
333 Ga0207645_10049830 3300025907 Bacteria 2674
334 Ga0207645_10192813 3300025907 Bacteria 1339
335 Ga0207645_10421549 3300025907 Bacteria 899
336 Ga0207643_10042410 3300025908 Bacteria 2566
337 Ga0207643_10084950 3300025908 Bacteria 1838
338 Ga0207643_10131827 3300025908 Bacteria 1488
339 Ga0207643_10397455 3300025908 Bacteria 871
340 Ga0207705_10033024 3300025909 Bacteria 3698
341 Ga0207684_10132563 3300025910 Bacteria 2139
342 Ga0207654_10052847 3300025911 Bacteria 2343
343 Ga0207695_10107276 3300025913 Bacteria 2778
344 Ga0207671_10010388 3300025914 Bacteria 7685
345 Ga0207671_10048096 3300025914 Bacteria 3156
346 Ga0207660_10056055 3300025917 Bacteria 2819
347 Ga0207662_10006607 3300025918 Bacteria 6264
348 Ga0207662_10181995 3300025918 Bacteria 1353
349 Ga0207657_10057700 3300025919 Bacteria 3345
350 Ga0207657_10094391 3300025919 Bacteria 2491
351 Ga0207649_10063732 3300025920 Bacteria 2328
352 Ga0207649_10081985 3300025920 Bacteria 2090
353 Ga0207649_10167067 3300025920 Bacteria 1529
354 Ga0207649_10417669 3300025920 Bacteria 1007
355 Ga0207652_10009072 3300025921 Bacteria 8011
356 Ga0207681_10003514 3300025923 Bacteria 9755
357 Ga0207681_10018156 3300025923 Bacteria 4429
358 Ga0207681_10025216 3300025923 Bacteria 3822
359 Ga0207681_10037074 3300025923 Bacteria 3220
360 Ga0207694_10145491 3300025924 Bacteria 1907
361 Ga0207694_10171384 3300025924 Bacteria 1757
362 Ga0207650_10001276 3300025925 Bacteria 18258
363 Ga0207650_10004871 3300025925 Bacteria 9172
364 Ga0207650_10007499 3300025925 Bacteria 7439
365 Ga0207650_10023626 3300025925 Bacteria 4362
366 Ga0207650_10048255 3300025925 Bacteria 3140
367 Ga0207650_10132661 3300025925 Bacteria 1951
368 Ga0207650_10150940 3300025925 Bacteria 1834
369 Ga0207650_10255958 3300025925 Bacteria 1419
370 Ga0207659_10011834 3300025926 Bacteria 5526
371 Ga0207659_10014054 3300025926 Bacteria 5153
372 Ga0207659_10016592 3300025926 Bacteria 4796
373 Ga0207659_10057723 3300025926 Bacteria 2785
374 Ga0207659_10058923 3300025926 Bacteria 2758
375 Ga0207659_10087452 3300025926 Bacteria 2320
376 Ga0207644_10000523 3300025931 Bacteria 24867
377 Ga0207644_10001757 3300025931 Bacteria 14039
378 Ga0207644_10057199 3300025931 Bacteria 2815
379 Ga0207644_10139116 3300025931 Bacteria 1868
380 Ga0207690_10042222 3300025932 Bacteria 2994
381 Ga0207690_10241351 3300025932 Bacteria 1392
382 Ga0207690_10332564 3300025932 Bacteria 1197
383 Ga0207690_10462444 3300025932 Bacteria 1021
384 Ga0207706_10006211 3300025933 Bacteria 11101
385 Ga0207706_10019872 3300025933 Bacteria 6038
386 Ga0207706_10107644 3300025933 Bacteria 2453
387 Ga0207706_10205697 3300025933 Bacteria 1726
388 Ga0207706_10419226 3300025933 Bacteria 1160
389 Ga0207686_10406895 3300025934 Bacteria 1038
390 Ga0207709_10001856 3300025935 Bacteria 14068
391 Ga0207709_10035063 3300025935 Bacteria 2963
392 Ga0207709_10070679 3300025935 Bacteria 2214
393 Ga0207709_10083040 3300025935 Bacteria 2070
394 Ga0207669_10016372 3300025937 Bacteria 3765
395 Ga0207669_10045476 3300025937 Bacteria 2587
396 Ga0207669_10058535 3300025937 Bacteria 2351
397 Ga0207704_10032069 3300025938 Bacteria 2968
398 Ga0207704_10070145 3300025938 Bacteria 2218
399 Ga0207704_10107692 3300025938 Bacteria 1875
400 Ga0207704_10171053 3300025938 Bacteria 1558
401 Ga0207665_10025637 3300025939 Bacteria 3890
402 Ga0207691_10003381 3300025940 Bacteria 15525
403 Ga0207691_10010897 3300025940 Bacteria 8724
404 Ga0207691_10020835 3300025940 Bacteria 6195
405 Ga0207691_10101973 3300025940 Bacteria 2560
406 Ga0207691_10109769 3300025940 Bacteria 2454
407 Ga0207691_10175300 3300025940 Bacteria 1876
408 Ga0207711_10004582 3300025941 Bacteria 11755
409 Ga0207711_10008794 3300025941 Bacteria 8444
410 Ga0207711_10048247 3300025941 Bacteria 3643
411 Ga0207711_10126427 3300025941 Bacteria 2287
412 Ga0207711_10191886 3300025941 Bacteria 1862
413 Ga0207711_10923208 3300025941 Bacteria 811
414 Ga0207689_10003664 3300025942 Bacteria 14006
415 Ga0207689_10020357 3300025942 Bacteria 5586
416 Ga0207689_10035048 3300025942 Bacteria 4169
417 Ga0207661_10037727 3300025944 Bacteria 3782
418 Ga0207661_10466442 3300025944 Bacteria 1151
419 Ga0207679_10008387 3300025945 Bacteria 6580
420 Ga0207679_10030713 3300025945 Bacteria 3754
421 Ga0207679_10178370 3300025945 Bacteria 1755
422 Ga0207679_10226789 3300025945 Bacteria 1575
423 Ga0207679_10333958 3300025945 Bacteria 1316
424 Ga0207667_10251901 3300025949 Bacteria 1806
425 Ga0207651_10013666 3300025960 Bacteria 4655
426 Ga0207651_10014368 3300025960 Bacteria 4568
427 Ga0207651_10128790 3300025960 Bacteria 1933
428 Ga0207668_10033710 3300025972 Bacteria 3394
429 Ga0207668_10188473 3300025972 Bacteria 1632
430 Ga0207668_10490701 3300025972 Bacteria 1055
431 Ga0207668_10654983 3300025972 Bacteria 919
432 Ga0207640_10049149 3300025981 Bacteria 2729
433 Ga0207640_10447656 3300025981 Bacteria 1063
434 Ga0207658_10016179 3300025986 Bacteria 5125
435 Ga0207658_10066551 3300025986 Bacteria 2710
436 Ga0207658_10530481 3300025986 Unclassified 1051
437 Ga0207677_10028700 3300026023 Bacteria 3524
438 Ga0207677_10062293 3300026023 Bacteria 2587
439 Ga0207677_10223449 3300026023 Bacteria 1512
440 Ga0207677_10809071 3300026023 Bacteria 839
441 Ga0207703_10018898 3300026035 Bacteria 5384
442 Ga0207703_10266864 3300026035 Bacteria 1549
443 Ga0207703_10373875 3300026035 Bacteria 1317
444 Ga0207639_10040103 3300026041 Bacteria 3493
445 Ga0207639_10064583 3300026041 Bacteria 2838
446 Ga0207639_10117864 3300026041 Bacteria 2176
447 Ga0207639_10494890 3300026041 Bacteria 1116
448 Ga0207639_11044310 3300026041 Bacteria 766
449 Ga0207678_10015684 3300026067 Bacteria 6659
450 Ga0207678_10040687 3300026067 Bacteria 4030
451 Ga0207678_10082065 3300026067 Bacteria 2759
452 Ga0207678_10154674 3300026067 Bacteria 1958
453 Ga0207708_10012477 3300026075 Bacteria 6333
454 Ga0207702_10099445 3300026078 Bacteria 2564
455 Ga0207702_10121229 3300026078 Bacteria 2341
456 Ga0207702_10386077 3300026078 Bacteria 1347
457 Ga0207641_10009103 3300026088 Bacteria 8202
458 Ga0207641_10019205 3300026088 Bacteria 5608
459 Ga0207641_10021621 3300026088 Bacteria 5285
460 Ga0207641_10059586 3300026088 Bacteria 3251
461 Ga0207648_10000109 3300026089 Bacteria 80648
462 Ga0207648_10004239 3300026089 Bacteria 14817
463 Ga0207648_10009368 3300026089 Bacteria 9379
464 Ga0207648_10010311 3300026089 Bacteria 8871
465 Ga0207648_10441379 3300026089 Bacteria 1184
466 Ga0207676_10011582 3300026095 Bacteria 6306
467 Ga0207676_10045595 3300026095 Bacteria 3388
468 Ga0207676_10079068 3300026095 Bacteria 2666
469 Ga0207676_10426881 3300026095 Unclassified 1244
470 Ga0207676_10714046 3300026095 Bacteria 972
471 Ga0207674_10031922 3300026116 Bacteria 5528
472 Ga0207674_10557935 3300026116 Bacteria 1106
473 Ga0207675_100008151 3300026118 Bacteria 9875
474 Ga0207675_100023191 3300026118 Bacteria 5771
475 Ga0207675_100161335 3300026118 Bacteria 2138
476 Ga0207683_10025450 3300026121 Bacteria 5106
477 Ga0207683_10059454 3300026121 Bacteria 3357
478 Ga0207683_10080603 3300026121 Bacteria 2888
479 Ga0207683_10083536 3300026121 Bacteria 2838
480 Ga0207698_10016587 3300026142 Bacteria 4970
481 Ga0207698_10044118 3300026142 Bacteria 3347
482 Ga0207698_10046575 3300026142 Bacteria 3276
483 Ga0207698_10202437 3300026142 Bacteria 1779
484 Ga0207698_10338146 3300026142 Bacteria 1417
485 Ga0207698_10679887 3300026142 Bacteria 1022
486 Ga0207698_10711409 3300026142 Bacteria 1000
487 Ga0209973_1002610 3300027252 Bacteria 1705
488 Ga0209974_10001641 3300027876 Bacteria 8098
489 Ga0268266_10060195 3300028379 Bacteria 3273
490 Ga0268266_10072607 3300028379 Bacteria 2985
491 Ga0268266_10166821 3300028379 Bacteria 1996
492 Ga0268266_10219514 3300028379 Bacteria 1747
493 Ga0268266_10581397 3300028379 Bacteria 1075
494 Ga0268266_10590786 3300028379 Bacteria 1066
495 Ga0268265_10106367 3300028380 Bacteria 2279
496 Ga0268265_10302459 3300028380 Bacteria 1441
497 Ga0268265_10392985 3300028380 Bacteria 1279
498 Ga0268264_10003375 3300028381 Bacteria 13788
499 Ga0268264_10117505 3300028381 Bacteria 2339
500 Ga0307517_10001980 3300028786 Bacteria 33373
501 Ga0307515_10010956 3300028794 Bacteria 17284
502 Ga0307515_10017116 3300028794 Bacteria 13232
503 Ga0307515_10028743 3300028794 Bacteria 9433
504 Ga0307515_10065408 3300028794 Bacteria 5061
505 Ga0307515_10175282 3300028794 Bacteria 2118
506 Ga0307515_10299171 3300028794 Bacteria 1296
507 Ga0307512_10097071 3300030522 Bacteria 2018
508 Ga0307512_10109888 3300030522 Bacteria 1822
509 Ga0307512_10182862 3300030522 Bacteria 1174
510 Ga0265330_10003025 3300031235 Bacteria 8928
511 Ga0265332_10030405 3300031238 Bacteria 2359
512 Ga0265328_10111836 3300031239 Bacteria 1015
513 Ga0265329_10132407 3300031242 Bacteria 803
514 Ga0265331_10008795 3300031250 Bacteria 5719
515 Ga0265316_10487021 3300031344 Bacteria 882
516 Ga0307513_10017125 3300031456 Bacteria 8704
517 Ga0307513_10195204 3300031456 Bacteria 1871
518 Ga0307509_10000249 3300031507 Bacteria 87094
519 Ga0307509_10003703 3300031507 Bacteria 22876
520 Ga0307509_10012634 3300031507 Bacteria 10086
521 Ga0307509_10074077 3300031507 Bacteria 3543
522 Ga0307509_10108879 3300031507 Bacteria 2783
523 Ga0307509_10375294 3300031507 Bacteria 1137
524 Ga0307408_100000023 3300031548 Bacteria 295931
525 Ga0307408_100015636 3300031548 Bacteria 5056
526 Ga0307408_100196020 3300031548 Bacteria 1631
527 Ga0307508_10004816 3300031616 Bacteria 13012
528 Ga0307508_10006698 3300031616 Bacteria 10804
529 Ga0307508_10216955 3300031616 Bacteria 1513
530 Ga0307514_10001392 3300031649 Bacteria 30115
531 Ga0307514_10075735 3300031649 Bacteria 2508
532 Ga0307514_10089643 3300031649 Bacteria 2246
533 Ga0307514_10141807 3300031649 Bacteria 1632
534 Ga0265314_10017068 3300031711 Bacteria 5707
535 Ga0265342_10049206 3300031712 Bacteria 2523
536 Ga0307516_10000237 3300031730 Bacteria 70929
537 Ga0307516_10000303 3300031730 Bacteria 63898
538 Ga0307516_10285416 3300031730 Bacteria 1331
539 Ga0307516_10332005 3300031730 Bacteria 1189
540 Ga0307516_10339784 3300031730 Bacteria 1169
541 Ga0307516_10433851 3300031730 Bacteria 971
542 Ga0307413_10057428 3300031824 Bacteria 2380
543 Ga0307413_10168485 3300031824 Bacteria 1547
544 Ga0307413_10318493 3300031824 Bacteria 1187
545 Ga0307413_10423715 3300031824 Bacteria 1049
546 Ga0307410_10234165 3300031852 Bacteria 1420
547 Ga0307410_10439420 3300031852 Bacteria 1062
548 Ga0307406_10023123 3300031901 Bacteria 3696
549 Ga0307406_10984675 3300031901 Bacteria 723
550 Ga0307407_10468201 3300031903 Bacteria 918
551 Ga0307412_10027498 3300031911 Bacteria 3547
552 Ga0307412_10034896 3300031911 Bacteria 3209
553 Ga0307412_10100837 3300031911 Bacteria 2042
554 Ga0307409_100383629 3300031995 Bacteria 1337
555 Ga0307416_100014114 3300032002 Bacteria 5457
556 Ga0307416_100061065 3300032002 Bacteria 3074
557 Ga0307414_10240025 3300032004 Bacteria 1500
558 Ga0307411_10012282 3300032005 Bacteria 4665
559 Ga0307411_10016314 3300032005 Bacteria 4202
560 Ga0307411_10018187 3300032005 Bacteria 4026
561 Ga0307411_10026501 3300032005 Bacteria 3492
562 Ga0307415_100068180 3300032126 Bacteria 2489
563 Ga0307415_100116794 3300032126 Bacteria 1991
564 Ga0307510_10043278 3300033180 Bacteria 4896
565 Ga0307510_10072075 3300033180 Bacteria 3434
566 Ga0373930_0026541 3300034816 Bacteria 1168
567 Ga0373959_0010617 3300034820 Bacteria 1612
568 Ga0373949_0089859 3300035090 Bacteria 829
569 Ga0373951_0064691 3300035091 Bacteria 921
570 Ga0373952_0012226 3300035092 Bacteria 1685
571 Ga0373932_0018150 3300035112 Bacteria 1815
572 Ga0373936_0095384 3300035113 Bacteria 1251
573 Ga0373939_0000184 3300035114 Bacteria 17389
574 Ga0373945_0165722 3300035116 Bacteria 903
575 Ga0373960_0069961 3300035121 Bacteria 1083
576 Ga0373943_0109578 3300035170 Bacteria 1455
577 Ga0373943_0416011 3300035170 Bacteria 778
578 Ga0373946_0011338 3300035171 Bacteria 3323
579 Ga0373946_0068600 3300035171 Bacteria 1526
580 Ga0373955_0065797 3300035172 Bacteria 2013
581 Ga0373931_0000092 3300035691 Bacteria 41580
582 Ga0373931_0002695 3300035691 Bacteria 7904
583 Ga0373931_0009750 3300035691 Bacteria 4598
584 Ga0373927_0265998 3300035695 Bacteria 1128
585 Ga0373927_0678656 3300035695 Bacteria 681
586 Ga0373933_0097619 3300035724 Bacteria 1820
587 Ga0373947_0230131 3300035725 Bacteria 1221
588 Ga0373937_0171306 3300036401 Bacteria 2037
589 Ga0373937_0180302 3300036401 Bacteria 1983
590 Ga0373937_0622301 3300036401 Bacteria 1024
591 Ga0373925_0050008 3300037068 Bacteria 3117
592 Ga0373925_0221711 3300037068 Bacteria 1509
593 Ga0373925_0263414 3300037068 Bacteria 1385
594 Ga0373925_0392936 3300037068 Bacteria 1130
595 Ga0395900_0245950 3300037418 Bacteria 1792
596 Ga0395900_0646875 3300037418 Bacteria 994
597 Ga0395905_0000027 3300037471 Bacteria 297239
598 Ga0395905_0000151 3300037471 Bacteria 115485
599 Ga0395905_0014823 3300037471 Bacteria 7432
600 Ga0395905_0074018 3300037471 Bacteria 3192
601 Ga0395905_0417523 3300037471 Bacteria 1237
602 Ga0395901_0164028 3300038443 Bacteria 2333
603 Ga0436365_0757688 3300039437 Bacteria 1199
604 Ga0436361_0750298 3300039447 Bacteria 51036
605 Ga0451798_0362761 3300041458 Bacteria 2178
606 Ga0451802_0227373 3300041460 Bacteria 853
607 Ga0451853_0566426 3300041512 Bacteria 926
608 Ga0451853_1375847 3300041512 Bacteria 786
609 Ga0451853_1931705 3300041512 Bacteria 944
610 Ga0439437_000095 3300042000 Bacteria 6474
611 Ga0439455_0003524 3300042012 Bacteria 3002
612 Ga0450911_000507 3300042115 Bacteria 12353
613 Ga0450888_000691 3300042126 Bacteria 3194
614 Ga0450891_000206 3300042129 Bacteria 5846
615 Ga0450901_004084 3300042533 Bacteria 1513
616 Ga0451577_0004735 3300042876 Bacteria 14256
617 Ga0451577_0155936 3300042876 Bacteria 2055
618 Ga0451577_0273095 3300042876 Bacteria 1531
619 Ga0451577_0404222 3300042876 Bacteria 1240
620 Ga0453683_0459440 3300044673 Bacteria 824
621 Ga0466965_0295094 3300044683 Bacteria 878
622 Ga0466964_0218482 3300044706 Bacteria 924
623 Ga0453684_0020128 3300044712 Bacteria 10096
624 Ga0453684_0086122 3300044712 Bacteria 3900
625 Ga0453684_0134244 3300044712 Bacteria 2966
626 Ga0453684_0286196 3300044712 Bacteria 1878
627 Ga0453684_0314661 3300044712 Bacteria 1775
628 Ga0453684_0412870 3300044712 Bacteria 1509
629 Ga0451576_0004667 3300045051 Bacteria 17660
630 Ga0451576_0005708 3300045051 Bacteria 15524
631 Ga0451576_0212037 3300045051 Bacteria 2022
632 Ga0451576_0315333 3300045051 Bacteria 1636
633 Ga0495592_0001883 3300046454 Bacteria 14765
634 Ga0495638_0279367 3300046460 Bacteria 908
635 Ga0495650_0060731 3300046471 Bacteria 1517
636 Ga0495639_0111302 3300046475 Bacteria 1300
637 Ga0495610_0038724 3300046512 Bacteria 2418
638 Ga0495628_0238440 3300046516 Bacteria 1361
639 Ga0495630_0448757 3300046517 Bacteria 988
640 Ga0495666_0098757 3300046526 Bacteria 1376
641 Ga0495642_0065027 3300046528 Bacteria 1518
642 Ga0495598_0016283 3300046537 Bacteria 1894
643 Ga0495621_0112088 3300046539 Bacteria 1047
644 Ga0495597_0198210 3300046542 Bacteria 805
645 Ga0495633_0156073 3300046558 Bacteria 1053
646 Ga0495656_0003963 3300046615 Bacteria 5031
647 Ga0495656_0328626 3300046615 Bacteria 789
648 Ga0495661_0369699 3300046665 Bacteria 702
649 Ga0495599_0135816 3300046678 Bacteria 1527
650 Ga0495647_0073605 3300046681 Bacteria 1372
651 Ga0495658_0052347 3300046683 Bacteria 2315
652 Ga0495658_0154088 3300046683 Bacteria 1413
653 Ga0495658_0269335 3300046683 Bacteria 1073
654 Ga0495658_0433225 3300046683 Bacteria 839
655 Ga0495669_0026101 3300046684 Bacteria 2552
656 Ga0495669_0210553 3300046684 Bacteria 931
657 Ga0495624_0207403 3300046690 Bacteria 1189
658 Ga0495670_0272753 3300046691 Bacteria 904
659 Ga0495671_0129216 3300046692 Bacteria 1232
660 Ga0495604_0523462 3300047317 Bacteria 767
661 Ga0495636_0110523 3300047318 Bacteria 1209
662 Ga0495676_0052751 3300047321 Bacteria 3244
663 Ga0495675_0308281 3300047444 Bacteria 939
664 Ga0495677_0017847 3300047445 Bacteria 2572
665 Ga0495685_050054 3300047447 Bacteria 1418
666 Ga0495684_0260937 3300047471 Bacteria 1257
667 Ga0496100_0004969 3300048903 Bacteria 7109
668 Ga0496101_0020005 3300048904 Bacteria 4577
669 Ga0496102_0050949 3300048905 Bacteria 3771
670 Ga0496104_0207849 3300048907 Bacteria 1869
671 Ga0496104_0382744 3300048907 Bacteria 1320
672 Ga0496105_0152969 3300048908 Bacteria 1896
673 Ga0496105_0343379 3300048908 Bacteria 1193
674 Ga0496107_0003649 3300048910 Bacteria 10348
675 Ga0496108_0163203 3300048911 Bacteria 1926
676 Ga0496108_0256556 3300048911 Bacteria 1521
677 Ga0496110_0072750 3300048913 Bacteria 3051
678 Ga0496114_0168105 3300048917 Bacteria 1910
679 Ga0496114_0266760 3300048917 Bacteria 1508
680 Ga0496114_0322005 3300048917 Bacteria 1366
681 Ga0496115_0160232 3300048918 Bacteria 1859
682 Ga0496121_0494783 3300048924 Bacteria 778
683 Ga0496122_0000612 3300048925 Bacteria 73307
684 Ga0496123_0000274 3300048926 Bacteria 101783
685 Ga0496124_0109171 3300048927 Bacteria 2230
686 Ga0501306_027319 3300049127 Bacteria 830
687 Ga0501309_000235 3300049129 Bacteria 3925
688 Ga0501310_000547 3300049130 Bacteria 3324
689 Ga0501304_005516 3300049160 Bacteria 994
690 Ga0501307_007500 3300049162 Bacteria 1205
691 Ga0501294_004193 3300049517 Bacteria 1360
692 Ga0501300_023207 3300049523 Bacteria 908
693 Ga0501301_003010 3300049524 Bacteria 1143
694 Ga0501311_010619 3300049527 Bacteria 1121
695 Ga0501312_018143 3300049528 Bacteria 1022
696 Ga0501314_001724 3300049530 Bacteria 1617
697 Ga0501315_002842 3300049531 Bacteria 1676
698 Ga0501317_023975 3300049533 Bacteria 846
699 Ga0501318_016293 3300049534 Bacteria 897
700 Ga0501322_004543 3300049538 Bacteria 937
701 Ga0501323_010154 3300049539 Bacteria 1119
702 Ga0501042_0775042 3300049578 Bacteria 698
703 Ga0501198_000024 3300049649 Bacteria 67171
704 Ga0501199_011061 3300049650 Bacteria 972
705 Ga0501206_002409 3300049653 Bacteria 2359
706 Ga0501207_053800 3300049654 Bacteria 724
707 Ga0501211_002221 3300049658 Bacteria 2061
708 Ga0501222_000020 3300049662 Bacteria 67164
709 Ga0501222_001970 3300049662 Bacteria 2846
710 Ga0501227_018678 3300049665 Bacteria 1576
711 Ga0501235_004234 3300049669 Bacteria 3109
712 Ga0501236_016828 3300049670 Bacteria 1039
713 Ga0501252_009169 3300049682 Bacteria 1149
714 Ga0501258_000428 3300049687 Bacteria 2805
715 Ga0501221_000262 3300049704 Bacteria 7763
716 Ga0501229_000047 3300049706 Bacteria 11920
717 Ga0501232_002169 3300049757 Bacteria 1676
718 Ga0501262_005168 3300049759 Bacteria 1535
719 Ga0501262_009579 3300049759 Bacteria 1200
720 Ga0501267_000585 3300049764 Bacteria 2887
721 nmdc:mga03683_281610_c1 3300050489 Bacteria 777
722 nmdc:mga03n38_539126_c1 3300050490 Bacteria 659
723 nmdc:mga00v17_200339_c1 3300050491 Bacteria 1290
724 nmdc:mga0yw44_690162_c1 3300050492 Bacteria 694
725 nmdc:mga0k408_100269_c1 3300050493 Bacteria 1707
726 nmdc:mga0k408_132241_c1 3300050493 Bacteria 1481
727 nmdc:mga0k408_302_c1 3300050493 Bacteria 26707
728 nmdc:mga0k408_35485_c1 3300050493 Bacteria 2860
729 nmdc:mga0k408_4061_c1 3300050493 Bacteria 7765
730 nmdc:mga0k408_57744_c1 3300050493 Bacteria 2253
731 nmdc:mga0k408_67442_c1 3300050493 Bacteria 2085
732 nmdc:mga0k408_7292_c1 3300050493 Bacteria 5907
733 nmdc:mga0k408_830_c1 3300050493 Bacteria 17018
734 nmdc:mga07m45_23681_c1 3300050496 Bacteria 3358
735 nmdc:mga07m45_5925_c1 3300050496 Bacteria 6133
736 nmdc:mga05p37_291899_c1 3300050507 Bacteria 1941
737 nmdc:mga09592_1397_c1 3300050508 Bacteria 19296
738 nmdc:mga0qj67_17079_c1 3300050509 Bacteria 5514
739 nmdc:mga0n895_650250_c1 3300050512 Bacteria 1053
740 nmdc:mga0rr50_727903_c1 3300050513 Bacteria 847
741 Ga0495601_0032063 3300053077 Bacteria 3269
742 Ga0495595_0058158 3300053084 Bacteria 1805
743 Ga0500578_0037319 3300053086 Bacteria 3121
744 Ga0500644_0004099 3300053088 Bacteria 3626
745 Ga0500651_0030909 3300053093 Bacteria 3371
746 Ga0500594_0000665 3300053118 Bacteria 7310
747 Ga0500652_080915 3300053131 Bacteria 1352
748 Ga0500655_029846 3300053133 Bacteria 1047
749 Ga0500559_0000032 3300053136 Bacteria 113579
750 Ga0500564_056359 3300053138 Bacteria 1790
751 Ga0500619_000006 3300053154 Bacteria 77270
752 Ga0500619_009997 3300053154 Bacteria 2379
753 Ga0500622_0001884 3300053156 Bacteria 15840
754 Ga0500634_0010236 3300053161 Bacteria 4784
755 Ga0500636_0173770 3300053177 Bacteria 1163
756 Ga0500645_002942 3300053730 Bacteria 7241
757 Ga0500587_012117 3300053739 Bacteria 1087

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042115 Ga0450911_000507 Ga0450911_000507_6562_7206 175
2 3300005614 Ga0068856_100247911 Ga0068856_1002479112 177
3 3300006178 Ga0075367_10142236 Ga0075367_101422363 178
4 3300028794 Ga0307515_10175282 Ga0307515_101752823 181
5 3300031456 Ga0307513_10017125 Ga0307513_100171257 181
6 3300031995 Ga0307409_100383629 Ga0307409_1003836292 181
7 3300041512 Ga0451853_1931705 Ga0451853_1931705_133_768 181
8 3300014326 Ga0157380_10744582 Ga0157380_107445822 182
9 3300044712 Ga0453684_0286196 Ga0453684_0286196_713_1321 182
10 3300005844 Ga0068862_100441293 Ga0068862_1004412932 183
11 3300006195 Ga0075366_10000910 Ga0075366_100009106 183
12 3300025931 Ga0207644_10139116 Ga0207644_101391163 183
13 3300028380 Ga0268265_10302459 Ga0268265_103024591 183
14 3300050493 nmdc:mga0k408_302_c1 nmdc:mga0k408_302_c1_7964_8596 183
15 3300037418 Ga0395900_0646875 Ga0395900_0646875_147_752 184
16 3300042876 Ga0451577_0155936 Ga0451577_0155936_113_730 184
17 3300044673 Ga0453683_0459440 Ga0453683_0459440_175_792 184
18 3300044712 Ga0453684_0412870 Ga0453684_0412870_489_1106 184
19 3300045051 Ga0451576_0004667 Ga0451576_0004667_6307_6924 184
20 3300028794 Ga0307515_10299171 Ga0307515_102991712 185
21 3300005327 Ga0070658_10386475 Ga0070658_103864752 186
22 3300006353 Ga0075370_10000354 Ga0075370_100003549 186
23 3300009098 Ga0105245_10308565 Ga0105245_103085653 186
24 3300009177 Ga0105248_10956328 Ga0105248_109563282 186
25 3300015261 Ga0182006_1108030 Ga0182006_11080302 186
26 3300025923 Ga0207681_10018156 Ga0207681_100181564 186
27 3300025932 Ga0207690_10241351 Ga0207690_102413513 186
28 3300028794 Ga0307515_10017116 Ga0307515_100171168 186
29 3300031344 Ga0265316_10487021 Ga0265316_104870211 186
30 3300031730 Ga0307516_10000303 Ga0307516_1000030343 186
31 3300048913 Ga0496110_0072750 Ga0496110_0072750_763_1398 186
32 3300048925 Ga0496122_0000612 Ga0496122_0000612_49117_49776 186
33 3300048926 Ga0496123_0000274 Ga0496123_0000274_52020_52679 186
34 3300048927 Ga0496124_0109171 Ga0496124_0109171_644_1303 186
35 3300050493 nmdc:mga0k408_57744_c1 nmdc:mga0k408_57744_c1_41_670 186
36 3300050496 nmdc:mga07m45_5925_c1 nmdc:mga07m45_5925_c1_3781_4410 186
37 3300006881 Ga0068865_101203528 Ga0068865_1012035281 187
38 3300009093 Ga0105240_10750669 Ga0105240_107506692 187
39 3300025303 Ga0209051_1041082 Ga0209051_10410821 187
40 3300026023 Ga0207677_10809071 Ga0207677_108090712 187
41 3300026089 Ga0207648_10441379 Ga0207648_104413793 187
42 3300028379 Ga0268266_10219514 Ga0268266_102195142 187
43 3300031235 Ga0265330_10003025 Ga0265330_1000302510 187
44 3300031238 Ga0265332_10030405 Ga0265332_100304053 187
45 3300031239 Ga0265328_10111836 Ga0265328_101118362 187
46 3300031242 Ga0265329_10132407 Ga0265329_101324072 187
47 3300031250 Ga0265331_10008795 Ga0265331_100087956 187
48 3300031649 Ga0307514_10001392 Ga0307514_100013928 187
49 3300031711 Ga0265314_10017068 Ga0265314_100170682 187
50 3300031712 Ga0265342_10049206 Ga0265342_100492062 187
51 3300041460 Ga0451802_0227373 Ga0451802_0227373_86_730 187
52 3300042876 Ga0451577_0004735 Ga0451577_0004735_7247_7903 187
53 3300044712 Ga0453684_0314661 Ga0453684_0314661_833_1441 187
54 3300046528 Ga0495642_0065027 Ga0495642_0065027_371_1018 187
55 3300046558 Ga0495633_0156073 Ga0495633_0156073_201_848 187
56 3300046615 Ga0495656_0003963 Ga0495656_0003963_712_1359 187
57 3300046665 Ga0495661_0369699 Ga0495661_0369699_32_679 187
58 3300046684 Ga0495669_0026101 Ga0495669_0026101_1027_1674 187
59 3300047318 Ga0495636_0110523 Ga0495636_0110523_260_907 187
60 3300047445 Ga0495677_0017847 Ga0495677_0017847_1634_2281 187
61 3300047447 Ga0495685_050054 Ga0495685_050054_643_1290 187
62 3300050490 nmdc:mga03n38_539126_c1 nmdc:mga03n38_539126_c1_13_630 187
63 3300050492 nmdc:mga0yw44_690162_c1 nmdc:mga0yw44_690162_c1_61_678 187
64 3300003323 rootH1_10022168 rootH1_100221682 188
65 3300003759 Ga0055525_1000004 Ga0055525_1000004180 188
66 3300005539 Ga0068853_100018149 Ga0068853_1000181492 188
67 3300005616 Ga0068852_100076990 Ga0068852_1000769903 188
68 3300009093 Ga0105240_10002152 Ga0105240_100021523 188
69 3300009545 Ga0105237_10003209 Ga0105237_1000320915 188
70 3300009551 Ga0105238_10009054 Ga0105238_100090545 188
71 3300010375 Ga0105239_10001461 Ga0105239_1000146123 188
72 3300014325 Ga0163163_10527962 Ga0163163_105279622 188
73 3300025226 Ga0209674_109982 Ga0209674_1099821 188
74 3300025230 Ga0209563_100013 Ga0209563_100013180 188
75 3300025913 Ga0207695_10107276 Ga0207695_101072763 188
76 3300025914 Ga0207671_10010388 Ga0207671_100103887 188
77 3300025924 Ga0207694_10171384 Ga0207694_101713842 188
78 3300026041 Ga0207639_10064583 Ga0207639_100645832 188
79 3300026142 Ga0207698_10046575 Ga0207698_100465753 188
80 3300027252 Ga0209973_1002610 Ga0209973_10026102 188
81 3300027876 Ga0209974_10001641 Ga0209974_100016415 188
82 3300049578 Ga0501042_0775042 Ga0501042_0775042_39_665 188
83 3300053154 Ga0500619_000006 Ga0500619_000006_11743_12363 188
84 iso_pu_bacteria 2881101125 2881103397 188
85 3300003316 rootH1_10004194 rootH1_100041943 189
86 3300003322 rootL2_10098807 rootL2_100988073 189
87 3300005331 Ga0070670_100026210 Ga0070670_1000262103 189
88 3300005331 Ga0070670_100201654 Ga0070670_1002016542 189
89 3300005344 Ga0070661_100504569 Ga0070661_1005045691 189
90 3300005354 Ga0070675_100231294 Ga0070675_1002312942 189
91 3300005355 Ga0070671_100008407 Ga0070671_1000084075 189
92 3300005356 Ga0070674_100028306 Ga0070674_1000283061 189
93 3300005356 Ga0070674_100319315 Ga0070674_1003193152 189
94 3300005364 Ga0070673_101018487 Ga0070673_1010184871 189
95 3300005456 Ga0070678_100079865 Ga0070678_1000798654 189
96 3300006237 Ga0097621_100009144 Ga0097621_1000091446 189
97 3300006358 Ga0068871_100008132 Ga0068871_1000081327 189
98 3300006881 Ga0068865_100112571 Ga0068865_1001125712 189
99 3300009147 Ga0114129_10080001 Ga0114129_100800013 189
100 3300009148 Ga0105243_10079876 Ga0105243_100798762 189
101 3300009177 Ga0105248_10018942 Ga0105248_100189424 189
102 3300013296 Ga0157374_10064219 Ga0157374_100642194 189
103 3300013308 Ga0157375_10005174 Ga0157375_100051747 189
104 3300014325 Ga0163163_10170197 Ga0163163_101701973 189
105 3300017792 Ga0163161_10102709 Ga0163161_101027092 189
106 3300021361 Ga0213872_10000067 Ga0213872_1000006750 189
107 3300025925 Ga0207650_10132661 Ga0207650_101326614 189
108 3300025925 Ga0207650_10150940 Ga0207650_101509402 189
109 3300025931 Ga0207644_10001757 Ga0207644_100017577 189
110 3300025933 Ga0207706_10205697 Ga0207706_102056973 189
111 3300025935 Ga0207709_10035063 Ga0207709_100350632 189
112 3300025937 Ga0207669_10045476 Ga0207669_100454764 189
113 3300025941 Ga0207711_10008794 Ga0207711_100087947 189
114 3300025941 Ga0207711_10126427 Ga0207711_101264273 189
115 3300026088 Ga0207641_10059586 Ga0207641_100595864 189
116 3300026095 Ga0207676_10045595 Ga0207676_100455953 189
117 3300026121 Ga0207683_10059454 Ga0207683_100594545 189
118 3300031548 Ga0307408_100000023 Ga0307408_100000023216 189
119 3300037418 Ga0395900_0245950 Ga0395900_0245950_635_1285 189
120 3300037471 Ga0395905_0000027 Ga0395905_0000027_119247_119909 189
121 3300037471 Ga0395905_0014823 Ga0395905_0014823_425_1042 189
122 3300037471 Ga0395905_0074018 Ga0395905_0074018_215_865 189
123 3300037471 Ga0395905_0417523 Ga0395905_0417523_116_763 189
124 3300038443 Ga0395901_0164028 Ga0395901_0164028_1264_1914 189
125 3300039447 Ga0436361_0750298 Ga0436361_0750298_10078_10704 189
126 3300044683 Ga0466965_0295094 Ga0466965_0295094_216_836 189
127 3300046539 Ga0495621_0112088 Ga0495621_0112088_392_1018 189
128 3300050507 nmdc:mga05p37_291899_c1 nmdc:mga05p37_291899_c1_834_1466 189
129 3300003323 rootH1_10008114 rootH1_1000811413 190
130 3300005327 Ga0070658_10016712 Ga0070658_100167126 190
131 3300005328 Ga0070676_10157798 Ga0070676_101577982 190
132 3300005329 Ga0070683_100016923 Ga0070683_1000169237 190
133 3300005329 Ga0070683_100377504 Ga0070683_1003775042 190
134 3300005330 Ga0070690_100647468 Ga0070690_1006474682 190
135 3300005334 Ga0068869_100003488 Ga0068869_1000034887 190
136 3300005338 Ga0068868_100003534 Ga0068868_1000035346 190
137 3300005344 Ga0070661_100084282 Ga0070661_1000842824 190
138 3300005344 Ga0070661_100108494 Ga0070661_1001084943 190
139 3300005347 Ga0070668_100082979 Ga0070668_1000829794 190
140 3300005353 Ga0070669_100044294 Ga0070669_1000442942 190
141 3300005354 Ga0070675_100010402 Ga0070675_1000104026 190
142 3300005355 Ga0070671_100181160 Ga0070671_1001811602 190
143 3300005366 Ga0070659_100011449 Ga0070659_1000114498 190
144 3300005366 Ga0070659_100178140 Ga0070659_1001781403 190
145 3300005367 Ga0070667_100673472 Ga0070667_1006734722 190
146 3300005444 Ga0070694_100492507 Ga0070694_1004925071 190
147 3300005456 Ga0070678_100161592 Ga0070678_1001615922 190
148 3300005457 Ga0070662_100005695 Ga0070662_1000056956 190
149 3300005457 Ga0070662_100317970 Ga0070662_1003179702 190
150 3300005459 Ga0068867_100000039 Ga0068867_10000003956 190
151 3300005459 Ga0068867_100071487 Ga0068867_1000714873 190
152 3300005467 Ga0070706_100032108 Ga0070706_1000321083 190
153 3300005535 Ga0070684_100005261 Ga0070684_1000052616 190
154 3300005535 Ga0070684_100296305 Ga0070684_1002963052 190
155 3300005539 Ga0068853_100006811 Ga0068853_1000068116 190
156 3300005539 Ga0068853_100016160 Ga0068853_1000161602 190
157 3300005539 Ga0068853_100631394 Ga0068853_1006313941 190
158 3300005547 Ga0070693_100041764 Ga0070693_1000417644 190
159 3300005547 Ga0070693_100044620 Ga0070693_1000446202 190
160 3300005548 Ga0070665_100007443 Ga0070665_1000074436 190
161 3300005548 Ga0070665_100104794 Ga0070665_1001047943 190
162 3300005563 Ga0068855_100018761 Ga0068855_1000187616 190
163 3300005564 Ga0070664_100015313 Ga0070664_1000153134 190
164 3300005564 Ga0070664_100031340 Ga0070664_1000313406 190
165 3300005577 Ga0068857_100010507 Ga0068857_1000105076 190
166 3300005577 Ga0068857_101003583 Ga0068857_1010035831 190
167 3300005578 Ga0068854_100093842 Ga0068854_1000938423 190
168 3300005578 Ga0068854_100137085 Ga0068854_1001370852 190
169 3300005614 Ga0068856_100013192 Ga0068856_1000131926 190
170 3300005614 Ga0068856_100074496 Ga0068856_1000744963 190
171 3300005615 Ga0070702_100479630 Ga0070702_1004796302 190
172 3300005616 Ga0068852_100009092 Ga0068852_1000090924 190
173 3300005616 Ga0068852_100013380 Ga0068852_1000133804 190
174 3300005616 Ga0068852_100066202 Ga0068852_1000662023 190
175 3300005616 Ga0068852_100114694 Ga0068852_1001146943 190
176 3300005617 Ga0068859_100175354 Ga0068859_1001753542 190
177 3300005618 Ga0068864_100003169 Ga0068864_10000316914 190
178 3300005618 Ga0068864_100009398 Ga0068864_1000093986 190
179 3300005719 Ga0068861_100005459 Ga0068861_1000054596 190
180 3300005719 Ga0068861_100145774 Ga0068861_1001457743 190
181 3300005834 Ga0068851_10036705 Ga0068851_100367055 190
182 3300005841 Ga0068863_100297048 Ga0068863_1002970482 190
183 3300005841 Ga0068863_100704941 Ga0068863_1007049412 190
184 3300005842 Ga0068858_100010630 Ga0068858_1000106307 190
185 3300005843 Ga0068860_100090075 Ga0068860_1000900754 190
186 3300005843 Ga0068860_100182469 Ga0068860_1001824693 190
187 3300005844 Ga0068862_100042040 Ga0068862_1000420404 190
188 3300005844 Ga0068862_100086453 Ga0068862_1000864533 190
189 3300006173 Ga0070716_100136193 Ga0070716_1001361933 190
190 3300006195 Ga0075366_10003844 Ga0075366_100038447 190
191 3300006195 Ga0075366_10100776 Ga0075366_101007762 190
192 3300006237 Ga0097621_100127529 Ga0097621_1001275294 190
193 3300006353 Ga0075370_10038737 Ga0075370_100387372 190
194 3300006358 Ga0068871_100016972 Ga0068871_1000169726 190
195 3300006881 Ga0068865_100080474 Ga0068865_1000804742 190
196 3300006931 Ga0097620_100175351 Ga0097620_1001753514 190
197 3300007076 Ga0075435_100811210 Ga0075435_1008112101 190
198 3300009094 Ga0111539_10668624 Ga0111539_106686241 190
199 3300009094 Ga0111539_11322043 Ga0111539_113220432 190
200 3300009148 Ga0105243_10004160 Ga0105243_100041607 190
201 3300009174 Ga0105241_10050051 Ga0105241_100500514 190
202 3300009177 Ga0105248_10011079 Ga0105248_100110797 190
203 3300009177 Ga0105248_10074691 Ga0105248_100746914 190
204 3300009177 Ga0105248_10451657 Ga0105248_104516572 190
205 3300009545 Ga0105237_10035404 Ga0105237_100354044 190
206 3300009551 Ga0105238_10016299 Ga0105238_100162992 190
207 3300009551 Ga0105238_10152230 Ga0105238_101522304 190
208 3300009553 Ga0105249_10148826 Ga0105249_101488261 190
209 3300010375 Ga0105239_10305478 Ga0105239_103054782 190
210 3300011119 Ga0105246_10061627 Ga0105246_100616272 190
211 3300011119 Ga0105246_10983222 Ga0105246_109832221 190
212 3300013100 Ga0157373_10053653 Ga0157373_100536532 190
213 3300013102 Ga0157371_10196215 Ga0157371_101962152 190
214 3300013105 Ga0157369_10058720 Ga0157369_100587204 190
215 3300013105 Ga0157369_10182335 Ga0157369_101823353 190
216 3300013296 Ga0157374_10031054 Ga0157374_100310544 190
217 3300013296 Ga0157374_10052887 Ga0157374_100528874 190
218 3300013306 Ga0163162_10047853 Ga0163162_100478536 190
219 3300013307 Ga0157372_10013740 Ga0157372_100137404 190
220 3300013307 Ga0157372_10163891 Ga0157372_101638914 190
221 3300013308 Ga0157375_10043978 Ga0157375_100439786 190
222 3300014745 Ga0157377_10000044 Ga0157377_1000004418 190
223 3300014745 Ga0157377_10001565 Ga0157377_100015657 190
224 3300014968 Ga0157379_10010130 Ga0157379_100101307 190
225 3300014968 Ga0157379_10020334 Ga0157379_100203346 190
226 3300014968 Ga0157379_10026436 Ga0157379_100264366 190
227 3300014969 Ga0157376_10003307 Ga0157376_100033077 190
228 3300017792 Ga0163161_10006298 Ga0163161_100062987 190
229 3300017792 Ga0163161_10376810 Ga0163161_103768102 190
230 3300017792 Ga0163161_10539629 Ga0163161_105396292 190
231 3300025315 Ga0207697_10027011 Ga0207697_100270111 190
232 3300025321 Ga0207656_10086056 Ga0207656_100860562 190
233 3300025321 Ga0207656_10244438 Ga0207656_102444381 190
234 3300025903 Ga0207680_10058549 Ga0207680_100585491 190
235 3300025907 Ga0207645_10192813 Ga0207645_101928132 190
236 3300025908 Ga0207643_10131827 Ga0207643_101318272 190
237 3300025909 Ga0207705_10033024 Ga0207705_100330244 190
238 3300025910 Ga0207684_10132563 Ga0207684_101325632 190
239 3300025911 Ga0207654_10052847 Ga0207654_100528473 190
240 3300025914 Ga0207671_10048096 Ga0207671_100480964 190
241 3300025918 Ga0207662_10181995 Ga0207662_101819953 190
242 3300025919 Ga0207657_10057700 Ga0207657_100577002 190
243 3300025919 Ga0207657_10094391 Ga0207657_100943914 190
244 3300025920 Ga0207649_10081985 Ga0207649_100819852 190
245 3300025920 Ga0207649_10167067 Ga0207649_101670673 190
246 3300025923 Ga0207681_10025216 Ga0207681_100252165 190
247 3300025924 Ga0207694_10145491 Ga0207694_101454912 190
248 3300025926 Ga0207659_10011834 Ga0207659_100118346 190
249 3300025932 Ga0207690_10042222 Ga0207690_100422222 190
250 3300025932 Ga0207690_10332564 Ga0207690_103325642 190
251 3300025932 Ga0207690_10462444 Ga0207690_104624442 190
252 3300025933 Ga0207706_10019872 Ga0207706_100198722 190
253 3300025935 Ga0207709_10001856 Ga0207709_100018564 190
254 3300025935 Ga0207709_10083040 Ga0207709_100830402 190
255 3300025939 Ga0207665_10025637 Ga0207665_100256374 190
256 3300025940 Ga0207691_10109769 Ga0207691_101097693 190
257 3300025941 Ga0207711_10004582 Ga0207711_100045827 190
258 3300025941 Ga0207711_10048247 Ga0207711_100482473 190
259 3300025942 Ga0207689_10003664 Ga0207689_100036648 190
260 3300025944 Ga0207661_10037727 Ga0207661_100377274 190
261 3300025944 Ga0207661_10466442 Ga0207661_104664421 190
262 3300025945 Ga0207679_10008387 Ga0207679_100083874 190
263 3300025945 Ga0207679_10030713 Ga0207679_100307135 190
264 3300025945 Ga0207679_10333958 Ga0207679_103339581 190
265 3300025949 Ga0207667_10251901 Ga0207667_102519012 190
266 3300025972 Ga0207668_10033710 Ga0207668_100337105 190
267 3300025972 Ga0207668_10188473 Ga0207668_101884733 190
268 3300025981 Ga0207640_10049149 Ga0207640_100491493 190
269 3300025981 Ga0207640_10447656 Ga0207640_104476561 190
270 3300026023 Ga0207677_10028700 Ga0207677_100287005 190
271 3300026035 Ga0207703_10018898 Ga0207703_100188982 190
272 3300026035 Ga0207703_10373875 Ga0207703_103738753 190
273 3300026041 Ga0207639_10040103 Ga0207639_100401032 190
274 3300026041 Ga0207639_10117864 Ga0207639_101178643 190
275 3300026041 Ga0207639_10494890 Ga0207639_104948903 190
276 3300026041 Ga0207639_11044310 Ga0207639_110443101 190
277 3300026067 Ga0207678_10040687 Ga0207678_100406873 190
278 3300026067 Ga0207678_10082065 Ga0207678_100820653 190
279 3300026078 Ga0207702_10099445 Ga0207702_100994452 190
280 3300026078 Ga0207702_10386077 Ga0207702_103860771 190
281 3300026088 Ga0207641_10019205 Ga0207641_100192057 190
282 3300026088 Ga0207641_10021621 Ga0207641_100216214 190
283 3300026089 Ga0207648_10000109 Ga0207648_1000010956 190
284 3300026095 Ga0207676_10011582 Ga0207676_100115824 190
285 3300026116 Ga0207674_10557935 Ga0207674_105579352 190
286 3300026118 Ga0207675_100023191 Ga0207675_1000231917 190
287 3300026118 Ga0207675_100161335 Ga0207675_1001613353 190
288 3300026121 Ga0207683_10080603 Ga0207683_100806034 190
289 3300026142 Ga0207698_10016587 Ga0207698_100165875 190
290 3300026142 Ga0207698_10044118 Ga0207698_100441183 190
291 3300026142 Ga0207698_10711409 Ga0207698_107114091 190
292 3300028379 Ga0268266_10060195 Ga0268266_100601955 190
293 3300028380 Ga0268265_10392985 Ga0268265_103929853 190
294 3300028381 Ga0268264_10003375 Ga0268264_100033757 190
295 3300028794 Ga0307515_10010956 Ga0307515_100109565 190
296 3300031730 Ga0307516_10339784 Ga0307516_103397842 190
297 3300032005 Ga0307411_10018187 Ga0307411_100181873 190
298 3300034816 Ga0373930_0026541 Ga0373930_0026541_381_1010 190
299 3300035090 Ga0373949_0089859 Ga0373949_0089859_156_785 190
300 3300035092 Ga0373952_0012226 Ga0373952_0012226_646_1275 190
301 3300035170 Ga0373943_0109578 Ga0373943_0109578_566_1198 190
302 3300035170 Ga0373943_0416011 Ga0373943_0416011_24_656 190
303 3300035171 Ga0373946_0011338 Ga0373946_0011338_2684_3310 190
304 3300035171 Ga0373946_0068600 Ga0373946_0068600_594_1226 190
305 3300035172 Ga0373955_0065797 Ga0373955_0065797_270_896 190
306 3300035691 Ga0373931_0002695 Ga0373931_0002695_3581_4210 190
307 3300035695 Ga0373927_0265998 Ga0373927_0265998_457_1089 190
308 3300035724 Ga0373933_0097619 Ga0373933_0097619_1140_1772 190
309 3300035725 Ga0373947_0230131 Ga0373947_0230131_499_1131 190
310 3300036401 Ga0373937_0171306 Ga0373937_0171306_367_993 190
311 3300036401 Ga0373937_0622301 Ga0373937_0622301_99_731 190
312 3300037068 Ga0373925_0050008 Ga0373925_0050008_1898_2524 190
313 3300037068 Ga0373925_0263414 Ga0373925_0263414_358_984 190
314 3300039437 Ga0436365_0757688 Ga0436365_0757688_535_1164 190
315 3300041512 Ga0451853_1375847 Ga0451853_1375847_66_698 190
316 3300042000 Ga0439437_000095 Ga0439437_000095_422_1060 190
317 3300042012 Ga0439455_0003524 Ga0439455_0003524_1052_1690 190
318 3300042126 Ga0450888_000691 Ga0450888_000691_2135_2773 190
319 3300042129 Ga0450891_000206 Ga0450891_000206_3535_4173 190
320 3300042533 Ga0450901_004084 Ga0450901_004084_206_844 190
321 3300042876 Ga0451577_0404222 Ga0451577_0404222_321_947 190
322 3300044706 Ga0466964_0218482 Ga0466964_0218482_260_889 190
323 3300044712 Ga0453684_0134244 Ga0453684_0134244_343_981 190
324 3300045051 Ga0451576_0005708 Ga0451576_0005708_11353_12000 190
325 3300045051 Ga0451576_0212037 Ga0451576_0212037_124_753 190
326 3300045051 Ga0451576_0315333 Ga0451576_0315333_159_779 190
327 3300046516 Ga0495628_0238440 Ga0495628_0238440_124_756 190
328 3300046542 Ga0495597_0198210 Ga0495597_0198210_111_731 190
329 3300046681 Ga0495647_0073605 Ga0495647_0073605_684_1310 190
330 3300046683 Ga0495658_0052347 Ga0495658_0052347_1296_1928 190
331 3300046683 Ga0495658_0154088 Ga0495658_0154088_30_659 190
332 3300046683 Ga0495658_0433225 Ga0495658_0433225_170_796 190
333 3300046684 Ga0495669_0210553 Ga0495669_0210553_204_836 190
334 3300046691 Ga0495670_0272753 Ga0495670_0272753_198_827 190
335 3300047444 Ga0495675_0308281 Ga0495675_0308281_24_650 190
336 3300048903 Ga0496100_0004969 Ga0496100_0004969_3395_4024 190
337 3300048904 Ga0496101_0020005 Ga0496101_0020005_3226_3855 190
338 3300048905 Ga0496102_0050949 Ga0496102_0050949_2620_3249 190
339 3300048907 Ga0496104_0207849 Ga0496104_0207849_1035_1664 190
340 3300048907 Ga0496104_0382744 Ga0496104_0382744_270_902 190
341 3300048908 Ga0496105_0152969 Ga0496105_0152969_717_1346 190
342 3300048908 Ga0496105_0343379 Ga0496105_0343379_101_736 190
343 3300048910 Ga0496107_0003649 Ga0496107_0003649_3982_4611 190
344 3300048911 Ga0496108_0163203 Ga0496108_0163203_626_1258 190
345 3300048911 Ga0496108_0256556 Ga0496108_0256556_94_723 190
346 3300048917 Ga0496114_0168105 Ga0496114_0168105_528_1163 190
347 3300048917 Ga0496114_0266760 Ga0496114_0266760_321_950 190
348 3300048918 Ga0496115_0160232 Ga0496115_0160232_478_1107 190
349 3300049127 Ga0501306_027319 Ga0501306_027319_150_788 190
350 3300049129 Ga0501309_000235 Ga0501309_000235_1282_1920 190
351 3300049130 Ga0501310_000547 Ga0501310_000547_1456_2094 190
352 3300049160 Ga0501304_005516 Ga0501304_005516_242_880 190
353 3300049162 Ga0501307_007500 Ga0501307_007500_204_842 190
354 3300049517 Ga0501294_004193 Ga0501294_004193_178_816 190
355 3300049523 Ga0501300_023207 Ga0501300_023207_230_868 190
356 3300049524 Ga0501301_003010 Ga0501301_003010_414_1013 190
357 3300049527 Ga0501311_010619 Ga0501311_010619_241_879 190
358 3300049528 Ga0501312_018143 Ga0501312_018143_231_869 190
359 3300049530 Ga0501314_001724 Ga0501314_001724_777_1415 190
360 3300049531 Ga0501315_002842 Ga0501315_002842_728_1366 190
361 3300049533 Ga0501317_023975 Ga0501317_023975_111_749 190
362 3300049534 Ga0501318_016293 Ga0501318_016293_42_680 190
363 3300049538 Ga0501322_004543 Ga0501322_004543_109_747 190
364 3300049539 Ga0501323_010154 Ga0501323_010154_125_763 190
365 3300049649 Ga0501198_000024 Ga0501198_000024_37639_38271 190
366 3300049650 Ga0501199_011061 Ga0501199_011061_34_672 190
367 3300049653 Ga0501206_002409 Ga0501206_002409_293_892 190
368 3300049654 Ga0501207_053800 Ga0501207_053800_13_651 190
369 3300049658 Ga0501211_002221 Ga0501211_002221_1356_1994 190
370 3300049662 Ga0501222_000020 Ga0501222_000020_28919_29551 190
371 3300049662 Ga0501222_001970 Ga0501222_001970_1870_2508 190
372 3300049665 Ga0501227_018678 Ga0501227_018678_440_1078 190
373 3300049669 Ga0501235_004234 Ga0501235_004234_2102_2740 190
374 3300049670 Ga0501236_016828 Ga0501236_016828_302_940 190
375 3300049682 Ga0501252_009169 Ga0501252_009169_396_1034 190
376 3300049687 Ga0501258_000428 Ga0501258_000428_440_1078 190
377 3300049704 Ga0501221_000262 Ga0501221_000262_3119_3757 190
378 3300049706 Ga0501229_000047 Ga0501229_000047_9597_10235 190
379 3300049757 Ga0501232_002169 Ga0501232_002169_695_1333 190
380 3300049759 Ga0501262_005168 Ga0501262_005168_468_1106 190
381 3300049759 Ga0501262_009579 Ga0501262_009579_192_791 190
382 3300049764 Ga0501267_000585 Ga0501267_000585_363_1001 190
383 3300050493 nmdc:mga0k408_100269_c1 nmdc:mga0k408_100269_c1_488_1126 190
384 3300050493 nmdc:mga0k408_132241_c1 nmdc:mga0k408_132241_c1_633_1250 190
385 3300050493 nmdc:mga0k408_830_c1 nmdc:mga0k408_830_c1_4301_4921 190
386 3300050496 nmdc:mga07m45_23681_c1 nmdc:mga07m45_23681_c1_1474_2121 190
387 3300050512 nmdc:mga0n895_650250_c1 nmdc:mga0n895_650250_c1_181_810 190
388 3300050513 nmdc:mga0rr50_727903_c1 nmdc:mga0rr50_727903_c1_162_791 190
389 iso_pu_bacteria 2643221544 2643743076 190
390 iso_pu_bacteria 2643221585 2643932898 190
391 iso_pu_bacteria 2643221639 2644218507 190
392 iso_pu_bacteria 2643221646 2644260402 190
393 iso_pu_bacteria 2643221656 2644314148 190
394 iso_pu_bacteria 2738541337 2739055937 190
395 3300005293 Ga0065715_10049568 Ga0065715_100495682 191
396 3300005328 Ga0070676_10010818 Ga0070676_100108186 191
397 3300005328 Ga0070676_10017134 Ga0070676_100171343 191
398 3300005331 Ga0070670_100005993 Ga0070670_1000059937 191
399 3300005331 Ga0070670_100013611 Ga0070670_1000136113 191
400 3300005331 Ga0070670_100080193 Ga0070670_1000801934 191
401 3300005331 Ga0070670_100287372 Ga0070670_1002873722 191
402 3300005333 Ga0070677_10018747 Ga0070677_100187473 191
403 3300005334 Ga0068869_100003409 Ga0068869_1000034095 191
404 3300005335 Ga0070666_10055778 Ga0070666_100557782 191
405 3300005336 Ga0070680_100007060 Ga0070680_1000070607 191
406 3300005338 Ga0068868_100712822 Ga0068868_1007128222 191
407 3300005339 Ga0070660_100383928 Ga0070660_1003839281 191
408 3300005343 Ga0070687_100100759 Ga0070687_1001007593 191
409 3300005344 Ga0070661_100159403 Ga0070661_1001594032 191
410 3300005347 Ga0070668_100658652 Ga0070668_1006586522 191
411 3300005353 Ga0070669_100508065 Ga0070669_1005080652 191
412 3300005354 Ga0070675_100003929 Ga0070675_1000039297 191
413 3300005354 Ga0070675_100011240 Ga0070675_1000112402 191
414 3300005354 Ga0070675_100281933 Ga0070675_1002819333 191
415 3300005355 Ga0070671_100020098 Ga0070671_1000200986 191
416 3300005364 Ga0070673_100011725 Ga0070673_1000117255 191
417 3300005364 Ga0070673_100273123 Ga0070673_1002731232 191
418 3300005366 Ga0070659_100481927 Ga0070659_1004819272 191
419 3300005367 Ga0070667_100032917 Ga0070667_1000329175 191
420 3300005367 Ga0070667_100135496 Ga0070667_1001354962 191
421 3300005367 Ga0070667_100714862 Ga0070667_1007148621 191
422 3300005441 Ga0070700_100067380 Ga0070700_1000673802 191
423 3300005455 Ga0070663_100624401 Ga0070663_1006244011 191
424 3300005456 Ga0070678_100081202 Ga0070678_1000812021 191
425 3300005456 Ga0070678_100139871 Ga0070678_1001398713 191
426 3300005457 Ga0070662_100031932 Ga0070662_1000319323 191
427 3300005457 Ga0070662_100096975 Ga0070662_1000969751 191
428 3300005458 Ga0070681_10017630 Ga0070681_100176303 191
429 3300005459 Ga0068867_100011577 Ga0068867_1000115776 191
430 3300005459 Ga0068867_100011992 Ga0068867_1000119924 191
431 3300005459 Ga0068867_100064789 Ga0068867_1000647893 191
432 3300005468 Ga0070707_100527591 Ga0070707_1005275912 191
433 3300005530 Ga0070679_100000726 Ga0070679_10000072626 191
434 3300005539 Ga0068853_100727613 Ga0068853_1007276132 191
435 3300005543 Ga0070672_100004529 Ga0070672_1000045297 191
436 3300005543 Ga0070672_100017872 Ga0070672_1000178726 191
437 3300005548 Ga0070665_100183680 Ga0070665_1001836802 191
438 3300005548 Ga0070665_100331876 Ga0070665_1003318762 191
439 3300005564 Ga0070664_100082566 Ga0070664_1000825662 191
440 3300005564 Ga0070664_100226738 Ga0070664_1002267383 191
441 3300005577 Ga0068857_100058624 Ga0068857_1000586244 191
442 3300005577 Ga0068857_100916614 Ga0068857_1009166141 191
443 3300005578 Ga0068854_100815238 Ga0068854_1008152382 191
444 3300005614 Ga0068856_100531048 Ga0068856_1005310483 191
445 3300005616 Ga0068852_100145938 Ga0068852_1001459384 191
446 3300005616 Ga0068852_100566609 Ga0068852_1005666092 191
447 3300005617 Ga0068859_100051040 Ga0068859_1000510402 191
448 3300005618 Ga0068864_100027497 Ga0068864_1000274976 191
449 3300005618 Ga0068864_100382206 Ga0068864_1003822061 191
450 3300005718 Ga0068866_10019689 Ga0068866_100196894 191
451 3300005719 Ga0068861_100013781 Ga0068861_1000137816 191
452 3300005719 Ga0068861_100448370 Ga0068861_1004483702 191
453 3300005834 Ga0068851_10095413 Ga0068851_100954131 191
454 3300005834 Ga0068851_10361589 Ga0068851_103615891 191
455 3300005840 Ga0068870_10076234 Ga0068870_100762344 191
456 3300005840 Ga0068870_10107103 Ga0068870_101071032 191
457 3300005840 Ga0068870_10203098 Ga0068870_102030982 191
458 3300005841 Ga0068863_100018287 Ga0068863_1000182876 191
459 3300005843 Ga0068860_100039824 Ga0068860_1000398242 191
460 3300006195 Ga0075366_10008552 Ga0075366_100085526 191
461 3300006195 Ga0075366_10016010 Ga0075366_100160105 191
462 3300006195 Ga0075366_10021753 Ga0075366_100217534 191
463 3300006195 Ga0075366_10042018 Ga0075366_100420185 191
464 3300006353 Ga0075370_10007324 Ga0075370_100073244 191
465 3300006353 Ga0075370_10029066 Ga0075370_100290663 191
466 3300006353 Ga0075370_10049991 Ga0075370_100499913 191
467 3300006358 Ga0068871_100021762 Ga0068871_1000217626 191
468 3300006846 Ga0075430_100024549 Ga0075430_1000245493 191
469 3300006881 Ga0068865_100041024 Ga0068865_1000410243 191
470 3300006881 Ga0068865_100408227 Ga0068865_1004082272 191
471 3300006931 Ga0097620_100051038 Ga0097620_1000510386 191
472 3300009098 Ga0105245_10371842 Ga0105245_103718422 191
473 3300009147 Ga0114129_11755964 Ga0114129_117559641 191
474 3300009148 Ga0105243_10178693 Ga0105243_101786931 191
475 3300009148 Ga0105243_10429104 Ga0105243_104291041 191
476 3300009176 Ga0105242_10084716 Ga0105242_100847164 191
477 3300009177 Ga0105248_10347566 Ga0105248_103475662 191
478 3300009177 Ga0105248_10415963 Ga0105248_104159632 191
479 3300009553 Ga0105249_10074684 Ga0105249_100746844 191
480 3300009553 Ga0105249_11515953 Ga0105249_115159531 191
481 3300011119 Ga0105246_10097110 Ga0105246_100971103 191
482 3300013102 Ga0157371_10109439 Ga0157371_101094394 191
483 3300013104 Ga0157370_10576582 Ga0157370_105765822 191
484 3300013296 Ga0157374_10344983 Ga0157374_103449832 191
485 3300013297 Ga0157378_10389624 Ga0157378_103896242 191
486 3300013297 Ga0157378_10689578 Ga0157378_106895781 191
487 3300013306 Ga0163162_10262578 Ga0163162_102625783 191
488 3300013306 Ga0163162_10335040 Ga0163162_103350402 191
489 3300013308 Ga0157375_10014262 Ga0157375_100142624 191
490 3300013308 Ga0157375_10018621 Ga0157375_100186216 191
491 3300014325 Ga0163163_10558172 Ga0163163_105581722 191
492 3300014326 Ga0157380_10088041 Ga0157380_100880414 191
493 3300014326 Ga0157380_10173230 Ga0157380_101732303 191
494 3300014745 Ga0157377_10278963 Ga0157377_102789632 191
495 3300014968 Ga0157379_10589571 Ga0157379_105895712 191
496 3300014968 Ga0157379_10697595 Ga0157379_106975951 191
497 3300014969 Ga0157376_10007305 Ga0157376_100073057 191
498 3300014969 Ga0157376_10418916 Ga0157376_104189162 191
499 3300014969 Ga0157376_10625128 Ga0157376_106251282 191
500 3300014969 Ga0157376_10713108 Ga0157376_107131081 191
501 3300017792 Ga0163161_10086351 Ga0163161_100863512 191
502 3300025303 Ga0209051_1016706 Ga0209051_10167064 191
503 3300025304 Ga0209257_1000033 Ga0209257_100003315 191
504 3300025321 Ga0207656_10024202 Ga0207656_100242024 191
505 3300025893 Ga0207682_10050682 Ga0207682_100506823 191
506 3300025899 Ga0207642_10010828 Ga0207642_100108284 191
507 3300025901 Ga0207688_10041571 Ga0207688_100415712 191
508 3300025903 Ga0207680_10123684 Ga0207680_101236843 191
509 3300025907 Ga0207645_10004979 Ga0207645_100049796 191
510 3300025907 Ga0207645_10049830 Ga0207645_100498303 191
511 3300025908 Ga0207643_10042410 Ga0207643_100424103 191
512 3300025908 Ga0207643_10397455 Ga0207643_103974552 191
513 3300025917 Ga0207660_10056055 Ga0207660_100560553 191
514 3300025918 Ga0207662_10006607 Ga0207662_100066076 191
515 3300025920 Ga0207649_10063732 Ga0207649_100637323 191
516 3300025920 Ga0207649_10417669 Ga0207649_104176691 191
517 3300025921 Ga0207652_10009072 Ga0207652_100090726 191
518 3300025923 Ga0207681_10037074 Ga0207681_100370742 191
519 3300025925 Ga0207650_10004871 Ga0207650_100048716 191
520 3300025925 Ga0207650_10007499 Ga0207650_100074997 191
521 3300025926 Ga0207659_10016592 Ga0207659_100165925 191
522 3300025926 Ga0207659_10058923 Ga0207659_100589234 191
523 3300025926 Ga0207659_10087452 Ga0207659_100874523 191
524 3300025931 Ga0207644_10057199 Ga0207644_100571993 191
525 3300025933 Ga0207706_10006211 Ga0207706_100062117 191
526 3300025933 Ga0207706_10107644 Ga0207706_101076442 191
527 3300025934 Ga0207686_10406895 Ga0207686_104068951 191
528 3300025935 Ga0207709_10070679 Ga0207709_100706793 191
529 3300025938 Ga0207704_10032069 Ga0207704_100320693 191
530 3300025938 Ga0207704_10070145 Ga0207704_100701452 191
531 3300025938 Ga0207704_10171053 Ga0207704_101710532 191
532 3300025940 Ga0207691_10010897 Ga0207691_100108975 191
533 3300025940 Ga0207691_10020835 Ga0207691_100208354 191
534 3300025941 Ga0207711_10191886 Ga0207711_101918863 191
535 3300025941 Ga0207711_10923208 Ga0207711_109232081 191
536 3300025942 Ga0207689_10020357 Ga0207689_100203573 191
537 3300025942 Ga0207689_10035048 Ga0207689_100350484 191
538 3300025945 Ga0207679_10178370 Ga0207679_101783702 191
539 3300025945 Ga0207679_10226789 Ga0207679_102267892 191
540 3300025960 Ga0207651_10013666 Ga0207651_100136665 191
541 3300025972 Ga0207668_10490701 Ga0207668_104907012 191
542 3300025986 Ga0207658_10016179 Ga0207658_100161795 191
543 3300025986 Ga0207658_10066551 Ga0207658_100665512 191
544 3300026023 Ga0207677_10062293 Ga0207677_100622934 191
545 3300026035 Ga0207703_10266864 Ga0207703_102668643 191
546 3300026067 Ga0207678_10154674 Ga0207678_101546742 191
547 3300026075 Ga0207708_10012477 Ga0207708_100124773 191
548 3300026088 Ga0207641_10009103 Ga0207641_100091035 191
549 3300026089 Ga0207648_10009368 Ga0207648_100093687 191
550 3300026095 Ga0207676_10714046 Ga0207676_107140462 191
551 3300026116 Ga0207674_10031922 Ga0207674_100319223 191
552 3300026118 Ga0207675_100008151 Ga0207675_1000081513 191
553 3300028379 Ga0268266_10166821 Ga0268266_101668212 191
554 3300028379 Ga0268266_10590786 Ga0268266_105907862 191
555 3300028380 Ga0268265_10106367 Ga0268265_101063673 191
556 3300028786 Ga0307517_10001980 Ga0307517_100019805 191
557 3300028794 Ga0307515_10028743 Ga0307515_100287435 191
558 3300028794 Ga0307515_10065408 Ga0307515_100654085 191
559 3300030522 Ga0307512_10097071 Ga0307512_100970714 191
560 3300030522 Ga0307512_10109888 Ga0307512_101098883 191
561 3300030522 Ga0307512_10182862 Ga0307512_101828621 191
562 3300031456 Ga0307513_10195204 Ga0307513_101952042 191
563 3300031507 Ga0307509_10000249 Ga0307509_1000024970 191
564 3300031507 Ga0307509_10003703 Ga0307509_1000370313 191
565 3300031507 Ga0307509_10012634 Ga0307509_100126346 191
566 3300031507 Ga0307509_10074077 Ga0307509_100740775 191
567 3300031507 Ga0307509_10108879 Ga0307509_101088793 191
568 3300031507 Ga0307509_10375294 Ga0307509_103752941 191
569 3300031616 Ga0307508_10004816 Ga0307508_100048167 191
570 3300031616 Ga0307508_10006698 Ga0307508_100066984 191
571 3300031616 Ga0307508_10216955 Ga0307508_102169551 191
572 3300031649 Ga0307514_10075735 Ga0307514_100757353 191
573 3300031649 Ga0307514_10089643 Ga0307514_100896433 191
574 3300031649 Ga0307514_10141807 Ga0307514_101418072 191
575 3300031730 Ga0307516_10285416 Ga0307516_102854162 191
576 3300031730 Ga0307516_10332005 Ga0307516_103320053 191
577 3300031730 Ga0307516_10433851 Ga0307516_104338511 191
578 3300031911 Ga0307412_10034896 Ga0307412_100348964 191
579 3300032002 Ga0307416_100014114 Ga0307416_1000141143 191
580 3300032005 Ga0307411_10026501 Ga0307411_100265012 191
581 3300032126 Ga0307415_100116794 Ga0307415_1001167943 191
582 3300033180 Ga0307510_10043278 Ga0307510_100432786 191
583 3300033180 Ga0307510_10072075 Ga0307510_100720754 191
584 3300035091 Ga0373951_0064691 Ga0373951_0064691_18_671 191
585 3300035112 Ga0373932_0018150 Ga0373932_0018150_978_1604 191
586 3300035113 Ga0373936_0095384 Ga0373936_0095384_343_960 191
587 3300035114 Ga0373939_0000184 Ga0373939_0000184_11770_12423 191
588 3300035116 Ga0373945_0165722 Ga0373945_0165722_28_645 191
589 3300035121 Ga0373960_0069961 Ga0373960_0069961_217_870 191
590 3300035691 Ga0373931_0000092 Ga0373931_0000092_30428_31081 191
591 3300035691 Ga0373931_0009750 Ga0373931_0009750_2126_2752 191
592 3300035695 Ga0373927_0678656 Ga0373927_0678656_35_661 191
593 3300036401 Ga0373937_0180302 Ga0373937_0180302_924_1541 191
594 3300037068 Ga0373925_0221711 Ga0373925_0221711_135_761 191
595 3300037068 Ga0373925_0392936 Ga0373925_0392936_341_958 191
596 3300037471 Ga0395905_0000151 Ga0395905_0000151_42823_43464 191
597 3300041512 Ga0451853_0566426 Ga0451853_0566426_43_669 191
598 3300044712 Ga0453684_0020128 Ga0453684_0020128_1275_1907 191
599 3300046454 Ga0495592_0001883 Ga0495592_0001883_8069_8695 191
600 3300046460 Ga0495638_0279367 Ga0495638_0279367_132_758 191
601 3300046471 Ga0495650_0060731 Ga0495650_0060731_880_1506 191
602 3300046475 Ga0495639_0111302 Ga0495639_0111302_279_896 191
603 3300046512 Ga0495610_0038724 Ga0495610_0038724_1048_1674 191
604 3300046517 Ga0495630_0448757 Ga0495630_0448757_59_685 191
605 3300046526 Ga0495666_0098757 Ga0495666_0098757_313_939 191
606 3300046537 Ga0495598_0016283 Ga0495598_0016283_267_902 191
607 3300046615 Ga0495656_0328626 Ga0495656_0328626_47_673 191
608 3300046678 Ga0495599_0135816 Ga0495599_0135816_857_1474 191
609 3300046683 Ga0495658_0269335 Ga0495658_0269335_227_853 191
610 3300046690 Ga0495624_0207403 Ga0495624_0207403_348_974 191
611 3300046692 Ga0495671_0129216 Ga0495671_0129216_57_686 191
612 3300047317 Ga0495604_0523462 Ga0495604_0523462_113_724 191
613 3300047321 Ga0495676_0052751 Ga0495676_0052751_1726_2352 191
614 3300047471 Ga0495684_0260937 Ga0495684_0260937_361_978 191
615 3300048917 Ga0496114_0322005 Ga0496114_0322005_643_1269 191
616 3300048924 Ga0496121_0494783 Ga0496121_0494783_30_656 191
617 3300050489 nmdc:mga03683_281610_c1 nmdc:mga03683_281610_c1_25_678 191
618 3300050491 nmdc:mga00v17_200339_c1 nmdc:mga00v17_200339_c1_536_1168 191
619 3300050493 nmdc:mga0k408_35485_c1 nmdc:mga0k408_35485_c1_926_1558 191
620 3300050493 nmdc:mga0k408_4061_c1 nmdc:mga0k408_4061_c1_2450_3082 191
621 3300050493 nmdc:mga0k408_67442_c1 nmdc:mga0k408_67442_c1_1271_1897 191
622 3300050493 nmdc:mga0k408_7292_c1 nmdc:mga0k408_7292_c1_702_1364 191
623 3300050508 nmdc:mga09592_1397_c1 nmdc:mga09592_1397_c1_8232_8870 191
624 3300050509 nmdc:mga0qj67_17079_c1 nmdc:mga0qj67_17079_c1_3921_4559 191
625 3300053077 Ga0495601_0032063 Ga0495601_0032063_2028_2645 191
626 3300053084 Ga0495595_0058158 Ga0495595_0058158_405_1022 191
627 3300053086 Ga0500578_0037319 Ga0500578_0037319_1269_1895 191
628 3300053088 Ga0500644_0004099 Ga0500644_0004099_1716_2342 191
629 3300053093 Ga0500651_0030909 Ga0500651_0030909_1823_2449 191
630 3300053118 Ga0500594_0000665 Ga0500594_0000665_5886_6512 191
631 3300053131 Ga0500652_080915 Ga0500652_080915_339_965 191
632 3300053133 Ga0500655_029846 Ga0500655_029846_278_904 191
633 3300053136 Ga0500559_0000032 Ga0500559_0000032_34505_35131 191
634 3300053138 Ga0500564_056359 Ga0500564_056359_1080_1706 191
635 3300053154 Ga0500619_009997 Ga0500619_009997_1008_1634 191
636 3300053156 Ga0500622_0001884 Ga0500622_0001884_6019_6645 191
637 3300053177 Ga0500636_0173770 Ga0500636_0173770_85_711 191
638 3300053730 Ga0500645_002942 Ga0500645_002942_4475_5101 191
639 3300053739 Ga0500587_012117 Ga0500587_012117_80_706 191
640 iso_pu_bacteria 2643221654 2644301238 191
641 3300005290 Ga0065712_10084099 Ga0065712_100840994 192
642 3300005293 Ga0065715_10104338 Ga0065715_101043381 192
643 3300005328 Ga0070676_10033533 Ga0070676_100335332 192
644 3300005328 Ga0070676_10034601 Ga0070676_100346014 192
645 3300005328 Ga0070676_10108413 Ga0070676_101084132 192
646 3300005330 Ga0070690_100319948 Ga0070690_1003199483 192
647 3300005331 Ga0070670_100021917 Ga0070670_1000219174 192
648 3300005331 Ga0070670_100034305 Ga0070670_1000343054 192
649 3300005331 Ga0070670_100099934 Ga0070670_1000999342 192
650 3300005331 Ga0070670_100178991 Ga0070670_1001789912 192
651 3300005331 Ga0070670_100225662 Ga0070670_1002256621 192
652 3300005331 Ga0070670_100319287 Ga0070670_1003192872 192
653 3300005331 Ga0070670_100868375 Ga0070670_1008683751 192
654 3300005333 Ga0070677_10042845 Ga0070677_100428452 192
655 3300005335 Ga0070666_10200545 Ga0070666_102005451 192
656 3300005338 Ga0068868_100242372 Ga0068868_1002423723 192
657 3300005347 Ga0070668_100338802 Ga0070668_1003388021 192
658 3300005353 Ga0070669_100050718 Ga0070669_1000507182 192
659 3300005355 Ga0070671_100211408 Ga0070671_1002114082 192
660 3300005355 Ga0070671_100624712 Ga0070671_1006247121 192
661 3300005356 Ga0070674_100020881 Ga0070674_1000208811 192
662 3300005356 Ga0070674_100088341 Ga0070674_1000883412 192
663 3300005364 Ga0070673_100002371 Ga0070673_1000023717 192
664 3300005365 Ga0070688_100099803 Ga0070688_1000998032 192
665 3300005367 Ga0070667_100222831 Ga0070667_1002228311 192
666 3300005456 Ga0070678_100006062 Ga0070678_1000060624 192
667 3300005456 Ga0070678_100224568 Ga0070678_1002245681 192
668 3300005457 Ga0070662_100066091 Ga0070662_1000660914 192
669 3300005459 Ga0068867_100005426 Ga0068867_1000054264 192
670 3300005459 Ga0068867_100030867 Ga0068867_1000308673 192
671 3300005459 Ga0068867_100088852 Ga0068867_1000888523 192
672 3300005543 Ga0070672_100026382 Ga0070672_1000263825 192
673 3300005543 Ga0070672_100086298 Ga0070672_1000862983 192
674 3300005543 Ga0070672_100585351 Ga0070672_1005853512 192
675 3300005564 Ga0070664_100484406 Ga0070664_1004844062 192
676 3300005564 Ga0070664_100499843 Ga0070664_1004998433 192
677 3300005614 Ga0068856_100154716 Ga0068856_1001547164 192
678 3300005618 Ga0068864_100030416 Ga0068864_1000304162 192
679 3300005618 Ga0068864_100245098 Ga0068864_1002450982 192
680 3300005618 Ga0068864_100609456 Ga0068864_1006094562 192
681 3300005719 Ga0068861_101123611 Ga0068861_1011236111 192
682 3300005834 Ga0068851_10008150 Ga0068851_100081504 192
683 3300005834 Ga0068851_10044727 Ga0068851_100447271 192
684 3300005840 Ga0068870_10142605 Ga0068870_101426052 192
685 3300006177 Ga0075362_10185197 Ga0075362_101851972 192
686 3300006237 Ga0097621_100044849 Ga0097621_1000448493 192
687 3300006358 Ga0068871_100006200 Ga0068871_1000062008 192
688 3300009551 Ga0105238_10334890 Ga0105238_103348902 192
689 3300013297 Ga0157378_10480928 Ga0157378_104809281 192
690 3300013306 Ga0163162_10585832 Ga0163162_105858323 192
691 3300013308 Ga0157375_10012252 Ga0157375_100122528 192
692 3300014325 Ga0163163_10868387 Ga0163163_108683871 192
693 3300014326 Ga0157380_10471894 Ga0157380_104718941 192
694 3300014969 Ga0157376_10077851 Ga0157376_100778514 192
695 3300017792 Ga0163161_10009331 Ga0163161_100093315 192
696 3300025315 Ga0207697_10003064 Ga0207697_100030645 192
697 3300025321 Ga0207656_10128452 Ga0207656_101284522 192
698 3300025893 Ga0207682_10002801 Ga0207682_100028014 192
699 3300025893 Ga0207682_10011716 Ga0207682_100117163 192
700 3300025907 Ga0207645_10023445 Ga0207645_100234454 192
701 3300025907 Ga0207645_10024932 Ga0207645_100249325 192
702 3300025907 Ga0207645_10421549 Ga0207645_104215492 192
703 3300025908 Ga0207643_10084950 Ga0207643_100849502 192
704 3300025923 Ga0207681_10003514 Ga0207681_100035147 192
705 3300025925 Ga0207650_10001276 Ga0207650_1000127610 192
706 3300025925 Ga0207650_10023626 Ga0207650_100236264 192
707 3300025925 Ga0207650_10048255 Ga0207650_100482555 192
708 3300025925 Ga0207650_10255958 Ga0207650_102559582 192
709 3300025926 Ga0207659_10014054 Ga0207659_100140543 192
710 3300025926 Ga0207659_10057723 Ga0207659_100577234 192
711 3300025931 Ga0207644_10000523 Ga0207644_1000052315 192
712 3300025933 Ga0207706_10419226 Ga0207706_104192262 192
713 3300025937 Ga0207669_10016372 Ga0207669_100163724 192
714 3300025937 Ga0207669_10058535 Ga0207669_100585353 192
715 3300025938 Ga0207704_10107692 Ga0207704_101076923 192
716 3300025940 Ga0207691_10003381 Ga0207691_1000338111 192
717 3300025940 Ga0207691_10101973 Ga0207691_101019733 192
718 3300025940 Ga0207691_10175300 Ga0207691_101753003 192
719 3300025960 Ga0207651_10014368 Ga0207651_100143683 192
720 3300025960 Ga0207651_10128790 Ga0207651_101287903 192
721 3300025972 Ga0207668_10654983 Ga0207668_106549832 192
722 3300025986 Ga0207658_10530481 Ga0207658_105304812 192
723 3300026023 Ga0207677_10223449 Ga0207677_102234493 192
724 3300026078 Ga0207702_10121229 Ga0207702_101212292 192
725 3300026089 Ga0207648_10004239 Ga0207648_100042394 192
726 3300026089 Ga0207648_10010311 Ga0207648_100103117 192
727 3300026095 Ga0207676_10079068 Ga0207676_100790682 192
728 3300026095 Ga0207676_10426881 Ga0207676_104268812 192
729 3300026121 Ga0207683_10025450 Ga0207683_100254503 192
730 3300026121 Ga0207683_10083536 Ga0207683_100835363 192
731 3300026142 Ga0207698_10202437 Ga0207698_102024372 192
732 3300026142 Ga0207698_10338146 Ga0207698_103381462 192
733 3300026142 Ga0207698_10679887 Ga0207698_106798871 192
734 3300028379 Ga0268266_10072607 Ga0268266_100726072 192
735 3300028379 Ga0268266_10581397 Ga0268266_105813972 192
736 3300031548 Ga0307408_100015636 Ga0307408_1000156363 192
737 3300031548 Ga0307408_100196020 Ga0307408_1001960202 192
738 3300031730 Ga0307516_10000237 Ga0307516_1000023745 192
739 3300031824 Ga0307413_10057428 Ga0307413_100574283 192
740 3300031824 Ga0307413_10168485 Ga0307413_101684851 192
741 3300031824 Ga0307413_10318493 Ga0307413_103184932 192
742 3300031824 Ga0307413_10423715 Ga0307413_104237151 192
743 3300031852 Ga0307410_10234165 Ga0307410_102341651 192
744 3300031852 Ga0307410_10439420 Ga0307410_104394202 192
745 3300031901 Ga0307406_10023123 Ga0307406_100231233 192
746 3300031901 Ga0307406_10984675 Ga0307406_109846751 192
747 3300031903 Ga0307407_10468201 Ga0307407_104682011 192
748 3300031911 Ga0307412_10027498 Ga0307412_100274983 192
749 3300031911 Ga0307412_10100837 Ga0307412_101008372 192
750 3300032002 Ga0307416_100061065 Ga0307416_1000610653 192
751 3300032004 Ga0307414_10240025 Ga0307414_102400252 192
752 3300032005 Ga0307411_10012282 Ga0307411_100122823 192
753 3300032005 Ga0307411_10016314 Ga0307411_100163144 192
754 3300032126 Ga0307415_100068180 Ga0307415_1000681803 192
755 3300041458 Ga0451798_0362761 Ga0451798_0362761_1231_1863 192
756 3300003162 Ga0006778J45830_1077259 Ga0006778J45830_10772592 193
757 3300005455 Ga0070663_100019470 Ga0070663_1000194704 193
758 3300005843 Ga0068860_100126165 Ga0068860_1001261652 193
759 3300014968 Ga0157379_10004002 Ga0157379_1000400211 193
760 3300026067 Ga0207678_10015684 Ga0207678_100156843 193
761 3300028381 Ga0268264_10117505 Ga0268264_101175053 193
762 3300034820 Ga0373959_0010617 Ga0373959_0010617_173_799 193
763 3300042876 Ga0451577_0273095 Ga0451577_0273095_747_1403 193
764 3300044712 Ga0453684_0086122 Ga0453684_0086122_763_1401 193
765 3300053161 Ga0500634_0010236 Ga0500634_0010236_3352_4047 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05494

MlaC

MlaC protein

75

239

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgu-assembly1.cif.gz_A three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89 0.9476 17 190
2qgu-assembly1.cif.gz_A three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89 0.917 17 190
6x04-assembly1.cif.gz_I nup133 (aa55-481) from s. cerevisiae bound by vhh-san5 0.8883 105 154
6x04-assembly1.cif.gz_G nup133 (aa55-481) from s. cerevisiae bound by vhh-san5 0.8842 105 154
6x04-assembly1.cif.gz_C nup133 (aa55-481) from s. cerevisiae bound by vhh-san5 0.8817 105 154
ID Description Score Start End Superfamily
2qguA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9112 17 157 3.10.450.50
2qguA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8772 17 157 3.10.450.50
af_P0ADV7_24_204_3.10.450.710 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC 0.8718 16 186 3.10.450.710
4fczA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC 0.8348 14 187 3.10.450.710
af_P0ADV7_24_204_3.10.450.710 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC 0.8232 16 186 3.10.450.710
ID Description Score Start End GO Terms
AF-A0A257KGL5-F1-model_v4 Toluene tolerance protein 0.9456 74 192
AF-A0A537AV23-F1-model_v4 ABC transporter substrate-binding protein 0.9408 3 191
AF-A0A2N4U5J0-F1-model_v4 ABC transporter 0.9302 5 186
AF-A0A0N0JKE2-F1-model_v4 Uncharacterized protein 0.9281 2 190
AF-A0A3P4B2E5-F1-model_v4 Putative phospholipid-binding protein MlaC 0.9253 11 182

Feature Viewer

pLDDT pTM Quality
87.14 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map