F479784
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 765 | 342 | 757 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10347566|Ga0105248_103475662 |
| Length | 251 |
| Sequence | VRPCEPGSSIARYETKRFPSANKVPEHRARCTPFTFEELDMSMTRRTIGCLAATLLSFAALGVQAQAKAPEALIKEVSTDVLEAVKADKTIQAGDLRKVIALVDQKVLPYVNFQRMTASAVGRYWKQATPDQQKRLQDEFKLLLVRTYSGALSQVSAEQTVELRPTRSAPTDNEVVVRTEIKGKGDPIQLDYRLEKAGDSWKIYDVNVLGVWLVENYRNSFAQEIGANGIDGLIAKMAERNKSAAAGGAKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 2 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 3 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 4 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 5 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 6 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 7 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 8 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 9 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 111 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 201 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 228 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 229 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 230 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 231 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 232 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 233 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 289 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 290 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 291 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 301 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 302 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 303 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 304 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 305 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 306 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 310 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 311 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 312 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 313 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 314 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 316 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 317 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 318 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 319 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 321 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 330 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 332 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 334 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 335 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 336 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 338 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 339 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 340 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.12 |
| Metatranscriptomes | 1.83 |
| Isolates | 1.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.54 |
| Nodule | 0 |
| Rhizoplane | 2.22 |
| Rhizosphere | 84.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006778J45830_1077259 | 3300003162 | Bacteria | 1394 |
| 2 | rootH1_10004194 | 3300003316 | Bacteria | 11979 |
| 3 | rootL2_10098807 | 3300003322 | Bacteria | 2900 |
| 4 | rootH1_10008114 | 3300003323 | Bacteria | 13430 |
| 5 | rootH1_10022168 | 3300003323 | Bacteria | 2015 |
| 6 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 7 | Ga0065712_10084099 | 3300005290 | Bacteria | 2790 |
| 8 | Ga0065715_10049568 | 3300005293 | Bacteria | 1024 |
| 9 | Ga0065715_10104338 | 3300005293 | Bacteria | 2969 |
| 10 | Ga0070658_10016712 | 3300005327 | Bacteria | 5873 |
| 11 | Ga0070658_10386475 | 3300005327 | Bacteria | 1201 |
| 12 | Ga0070676_10010818 | 3300005328 | Bacteria | 4951 |
| 13 | Ga0070676_10017134 | 3300005328 | Bacteria | 4008 |
| 14 | Ga0070676_10033533 | 3300005328 | Bacteria | 2946 |
| 15 | Ga0070676_10034601 | 3300005328 | Bacteria | 2901 |
| 16 | Ga0070676_10108413 | 3300005328 | Bacteria | 1726 |
| 17 | Ga0070676_10157798 | 3300005328 | Bacteria | 1457 |
| 18 | Ga0070683_100016923 | 3300005329 | Bacteria | 6433 |
| 19 | Ga0070683_100377504 | 3300005329 | Bacteria | 1351 |
| 20 | Ga0070690_100319948 | 3300005330 | Bacteria | 1117 |
| 21 | Ga0070690_100647468 | 3300005330 | Bacteria | 807 |
| 22 | Ga0070670_100005993 | 3300005331 | Bacteria | 10284 |
| 23 | Ga0070670_100013611 | 3300005331 | Bacteria | 6971 |
| 24 | Ga0070670_100021917 | 3300005331 | Bacteria | 5496 |
| 25 | Ga0070670_100026210 | 3300005331 | Bacteria | 5018 |
| 26 | Ga0070670_100034305 | 3300005331 | Bacteria | 4367 |
| 27 | Ga0070670_100080193 | 3300005331 | Bacteria | 2805 |
| 28 | Ga0070670_100099934 | 3300005331 | Bacteria | 2497 |
| 29 | Ga0070670_100178991 | 3300005331 | Bacteria | 1840 |
| 30 | Ga0070670_100201654 | 3300005331 | Bacteria | 1729 |
| 31 | Ga0070670_100225662 | 3300005331 | Bacteria | 1630 |
| 32 | Ga0070670_100287372 | 3300005331 | Bacteria | 1436 |
| 33 | Ga0070670_100319287 | 3300005331 | Bacteria | 1360 |
| 34 | Ga0070670_100868375 | 3300005331 | Bacteria | 817 |
| 35 | Ga0070677_10018747 | 3300005333 | Bacteria | 2496 |
| 36 | Ga0070677_10042845 | 3300005333 | Bacteria | 1795 |
| 37 | Ga0068869_100003409 | 3300005334 | Bacteria | 9707 |
| 38 | Ga0068869_100003488 | 3300005334 | Bacteria | 9627 |
| 39 | Ga0070666_10055778 | 3300005335 | Bacteria | 2667 |
| 40 | Ga0070666_10200545 | 3300005335 | Bacteria | 1404 |
| 41 | Ga0070680_100007060 | 3300005336 | Bacteria | 8563 |
| 42 | Ga0068868_100003534 | 3300005338 | Bacteria | 10890 |
| 43 | Ga0068868_100242372 | 3300005338 | Bacteria | 1515 |
| 44 | Ga0068868_100712822 | 3300005338 | Bacteria | 898 |
| 45 | Ga0070660_100383928 | 3300005339 | Bacteria | 1160 |
| 46 | Ga0070687_100100759 | 3300005343 | Bacteria | 1616 |
| 47 | Ga0070661_100084282 | 3300005344 | Bacteria | 2348 |
| 48 | Ga0070661_100108494 | 3300005344 | Bacteria | 2071 |
| 49 | Ga0070661_100159403 | 3300005344 | Bacteria | 1708 |
| 50 | Ga0070661_100504569 | 3300005344 | Bacteria | 969 |
| 51 | Ga0070668_100082979 | 3300005347 | Bacteria | 2515 |
| 52 | Ga0070668_100338802 | 3300005347 | Bacteria | 1270 |
| 53 | Ga0070668_100658652 | 3300005347 | Bacteria | 920 |
| 54 | Ga0070669_100044294 | 3300005353 | Bacteria | 3242 |
| 55 | Ga0070669_100050718 | 3300005353 | Bacteria | 3031 |
| 56 | Ga0070669_100508065 | 3300005353 | Bacteria | 1000 |
| 57 | Ga0070675_100003929 | 3300005354 | Bacteria | 11264 |
| 58 | Ga0070675_100010402 | 3300005354 | Bacteria | 7268 |
| 59 | Ga0070675_100011240 | 3300005354 | Bacteria | 7009 |
| 60 | Ga0070675_100231294 | 3300005354 | Bacteria | 1613 |
| 61 | Ga0070675_100281933 | 3300005354 | Bacteria | 1460 |
| 62 | Ga0070671_100008407 | 3300005355 | Bacteria | 8273 |
| 63 | Ga0070671_100020098 | 3300005355 | Bacteria | 5442 |
| 64 | Ga0070671_100181160 | 3300005355 | Bacteria | 1783 |
| 65 | Ga0070671_100211408 | 3300005355 | Bacteria | 1645 |
| 66 | Ga0070671_100624712 | 3300005355 | Bacteria | 932 |
| 67 | Ga0070674_100020881 | 3300005356 | Bacteria | 4194 |
| 68 | Ga0070674_100028306 | 3300005356 | Bacteria | 3680 |
| 69 | Ga0070674_100088341 | 3300005356 | Bacteria | 2231 |
| 70 | Ga0070674_100319315 | 3300005356 | Bacteria | 1244 |
| 71 | Ga0070673_100002371 | 3300005364 | Bacteria | 11464 |
| 72 | Ga0070673_100011725 | 3300005364 | Bacteria | 5994 |
| 73 | Ga0070673_100273123 | 3300005364 | Bacteria | 1480 |
| 74 | Ga0070673_101018487 | 3300005364 | Bacteria | 771 |
| 75 | Ga0070688_100099803 | 3300005365 | Bacteria | 1912 |
| 76 | Ga0070659_100011449 | 3300005366 | Bacteria | 6562 |
| 77 | Ga0070659_100178140 | 3300005366 | Bacteria | 1744 |
| 78 | Ga0070659_100481927 | 3300005366 | Bacteria | 1055 |
| 79 | Ga0070667_100032917 | 3300005367 | Bacteria | 4327 |
| 80 | Ga0070667_100135496 | 3300005367 | Bacteria | 2153 |
| 81 | Ga0070667_100222831 | 3300005367 | Bacteria | 1679 |
| 82 | Ga0070667_100673472 | 3300005367 | Bacteria | 956 |
| 83 | Ga0070667_100714862 | 3300005367 | Bacteria | 927 |
| 84 | Ga0070700_100067380 | 3300005441 | Bacteria | 2274 |
| 85 | Ga0070694_100492507 | 3300005444 | Bacteria | 974 |
| 86 | Ga0070663_100019470 | 3300005455 | Bacteria | 4474 |
| 87 | Ga0070663_100624401 | 3300005455 | Bacteria | 909 |
| 88 | Ga0070678_100006062 | 3300005456 | Bacteria | 7052 |
| 89 | Ga0070678_100079865 | 3300005456 | Bacteria | 2475 |
| 90 | Ga0070678_100081202 | 3300005456 | Bacteria | 2457 |
| 91 | Ga0070678_100139871 | 3300005456 | Bacteria | 1936 |
| 92 | Ga0070678_100161592 | 3300005456 | Bacteria | 1815 |
| 93 | Ga0070678_100224568 | 3300005456 | Bacteria | 1562 |
| 94 | Ga0070662_100005695 | 3300005457 | Bacteria | 7972 |
| 95 | Ga0070662_100031932 | 3300005457 | Bacteria | 3699 |
| 96 | Ga0070662_100066091 | 3300005457 | Bacteria | 2653 |
| 97 | Ga0070662_100096975 | 3300005457 | Bacteria | 2225 |
| 98 | Ga0070662_100317970 | 3300005457 | Bacteria | 1269 |
| 99 | Ga0070681_10017630 | 3300005458 | Bacteria | 7135 |
| 100 | Ga0068867_100000039 | 3300005459 | Bacteria | 80301 |
| 101 | Ga0068867_100005426 | 3300005459 | Bacteria | 9022 |
| 102 | Ga0068867_100011577 | 3300005459 | Bacteria | 6228 |
| 103 | Ga0068867_100011992 | 3300005459 | Bacteria | 6123 |
| 104 | Ga0068867_100030867 | 3300005459 | Bacteria | 3867 |
| 105 | Ga0068867_100064789 | 3300005459 | Bacteria | 2717 |
| 106 | Ga0068867_100071487 | 3300005459 | Bacteria | 2595 |
| 107 | Ga0068867_100088852 | 3300005459 | Bacteria | 2342 |
| 108 | Ga0070706_100032108 | 3300005467 | Bacteria | 4843 |
| 109 | Ga0070707_100527591 | 3300005468 | Bacteria | 1143 |
| 110 | Ga0070679_100000726 | 3300005530 | Bacteria | 28453 |
| 111 | Ga0070684_100005261 | 3300005535 | Bacteria | 9903 |
| 112 | Ga0070684_100296305 | 3300005535 | Bacteria | 1484 |
| 113 | Ga0068853_100006811 | 3300005539 | Bacteria | 9111 |
| 114 | Ga0068853_100016160 | 3300005539 | Bacteria | 6138 |
| 115 | Ga0068853_100018149 | 3300005539 | Bacteria | 5819 |
| 116 | Ga0068853_100631394 | 3300005539 | Bacteria | 1018 |
| 117 | Ga0068853_100727613 | 3300005539 | Bacteria | 947 |
| 118 | Ga0070672_100004529 | 3300005543 | Bacteria | 9099 |
| 119 | Ga0070672_100017872 | 3300005543 | Bacteria | 5113 |
| 120 | Ga0070672_100026382 | 3300005543 | Bacteria | 4322 |
| 121 | Ga0070672_100086298 | 3300005543 | Bacteria | 2524 |
| 122 | Ga0070672_100585351 | 3300005543 | Bacteria | 971 |
| 123 | Ga0070693_100041764 | 3300005547 | Bacteria | 2582 |
| 124 | Ga0070693_100044620 | 3300005547 | Bacteria | 2508 |
| 125 | Ga0070665_100007443 | 3300005548 | Bacteria | 11136 |
| 126 | Ga0070665_100104794 | 3300005548 | Bacteria | 2830 |
| 127 | Ga0070665_100183680 | 3300005548 | Bacteria | 2092 |
| 128 | Ga0070665_100331876 | 3300005548 | Bacteria | 1525 |
| 129 | Ga0068855_100018761 | 3300005563 | Bacteria | 8316 |
| 130 | Ga0070664_100015313 | 3300005564 | Bacteria | 6270 |
| 131 | Ga0070664_100031340 | 3300005564 | Bacteria | 4441 |
| 132 | Ga0070664_100082566 | 3300005564 | Bacteria | 2772 |
| 133 | Ga0070664_100226738 | 3300005564 | Bacteria | 1673 |
| 134 | Ga0070664_100484406 | 3300005564 | Bacteria | 1139 |
| 135 | Ga0070664_100499843 | 3300005564 | Bacteria | 1120 |
| 136 | Ga0068857_100010507 | 3300005577 | Bacteria | 8046 |
| 137 | Ga0068857_100058624 | 3300005577 | Bacteria | 3419 |
| 138 | Ga0068857_100916614 | 3300005577 | Bacteria | 841 |
| 139 | Ga0068857_101003583 | 3300005577 | Bacteria | 803 |
| 140 | Ga0068854_100093842 | 3300005578 | Bacteria | 2237 |
| 141 | Ga0068854_100137085 | 3300005578 | Bacteria | 1874 |
| 142 | Ga0068854_100815238 | 3300005578 | Bacteria | 814 |
| 143 | Ga0068856_100013192 | 3300005614 | Bacteria | 8003 |
| 144 | Ga0068856_100074496 | 3300005614 | Bacteria | 3361 |
| 145 | Ga0068856_100154716 | 3300005614 | Bacteria | 2303 |
| 146 | Ga0068856_100247911 | 3300005614 | Bacteria | 1796 |
| 147 | Ga0068856_100531048 | 3300005614 | Bacteria | 1198 |
| 148 | Ga0070702_100479630 | 3300005615 | Bacteria | 909 |
| 149 | Ga0068852_100009092 | 3300005616 | Bacteria | 7356 |
| 150 | Ga0068852_100013380 | 3300005616 | Bacteria | 6280 |
| 151 | Ga0068852_100066202 | 3300005616 | Bacteria | 3155 |
| 152 | Ga0068852_100076990 | 3300005616 | Bacteria | 2947 |
| 153 | Ga0068852_100114694 | 3300005616 | Bacteria | 2455 |
| 154 | Ga0068852_100145938 | 3300005616 | Bacteria | 2195 |
| 155 | Ga0068852_100566609 | 3300005616 | Bacteria | 1137 |
| 156 | Ga0068859_100051040 | 3300005617 | Bacteria | 4156 |
| 157 | Ga0068859_100175354 | 3300005617 | Bacteria | 2226 |
| 158 | Ga0068864_100003169 | 3300005618 | Bacteria | 13604 |
| 159 | Ga0068864_100009398 | 3300005618 | Bacteria | 8066 |
| 160 | Ga0068864_100027497 | 3300005618 | Bacteria | 4805 |
| 161 | Ga0068864_100030416 | 3300005618 | Bacteria | 4576 |
| 162 | Ga0068864_100245098 | 3300005618 | Bacteria | 1661 |
| 163 | Ga0068864_100382206 | 3300005618 | Bacteria | 1334 |
| 164 | Ga0068864_100609456 | 3300005618 | Unclassified | 1060 |
| 165 | Ga0068866_10019689 | 3300005718 | Bacteria | 3078 |
| 166 | Ga0068861_100005459 | 3300005719 | Bacteria | 8611 |
| 167 | Ga0068861_100013781 | 3300005719 | Bacteria | 5662 |
| 168 | Ga0068861_100145774 | 3300005719 | Bacteria | 1937 |
| 169 | Ga0068861_100448370 | 3300005719 | Bacteria | 1156 |
| 170 | Ga0068861_101123611 | 3300005719 | Bacteria | 756 |
| 171 | Ga0068851_10008150 | 3300005834 | Bacteria | 4838 |
| 172 | Ga0068851_10036705 | 3300005834 | Bacteria | 2454 |
| 173 | Ga0068851_10044727 | 3300005834 | Bacteria | 2236 |
| 174 | Ga0068851_10095413 | 3300005834 | Bacteria | 1572 |
| 175 | Ga0068851_10361589 | 3300005834 | Bacteria | 846 |
| 176 | Ga0068870_10076234 | 3300005840 | Bacteria | 1841 |
| 177 | Ga0068870_10107103 | 3300005840 | Bacteria | 1590 |
| 178 | Ga0068870_10142605 | 3300005840 | Bacteria | 1403 |
| 179 | Ga0068870_10203098 | 3300005840 | Bacteria | 1203 |
| 180 | Ga0068863_100018287 | 3300005841 | Bacteria | 6711 |
| 181 | Ga0068863_100297048 | 3300005841 | Bacteria | 1566 |
| 182 | Ga0068863_100704941 | 3300005841 | Bacteria | 1003 |
| 183 | Ga0068858_100010630 | 3300005842 | Bacteria | 8712 |
| 184 | Ga0068860_100039824 | 3300005843 | Bacteria | 4494 |
| 185 | Ga0068860_100090075 | 3300005843 | Bacteria | 2921 |
| 186 | Ga0068860_100126165 | 3300005843 | Bacteria | 2453 |
| 187 | Ga0068860_100182469 | 3300005843 | Bacteria | 2029 |
| 188 | Ga0068862_100042040 | 3300005844 | Bacteria | 3891 |
| 189 | Ga0068862_100086453 | 3300005844 | Bacteria | 2726 |
| 190 | Ga0068862_100441293 | 3300005844 | Bacteria | 1225 |
| 191 | Ga0070716_100136193 | 3300006173 | Bacteria | 1560 |
| 192 | Ga0075362_10185197 | 3300006177 | Bacteria | 1010 |
| 193 | Ga0075367_10142236 | 3300006178 | Bacteria | 1486 |
| 194 | Ga0075366_10000910 | 3300006195 | Bacteria | 14335 |
| 195 | Ga0075366_10003844 | 3300006195 | Bacteria | 7999 |
| 196 | Ga0075366_10008552 | 3300006195 | Bacteria | 5695 |
| 197 | Ga0075366_10016010 | 3300006195 | Bacteria | 4305 |
| 198 | Ga0075366_10021753 | 3300006195 | Bacteria | 3729 |
| 199 | Ga0075366_10042018 | 3300006195 | Bacteria | 2707 |
| 200 | Ga0075366_10100776 | 3300006195 | Bacteria | 1733 |
| 201 | Ga0097621_100009144 | 3300006237 | Bacteria | 7182 |
| 202 | Ga0097621_100044849 | 3300006237 | Bacteria | 3569 |
| 203 | Ga0097621_100127529 | 3300006237 | Bacteria | 2162 |
| 204 | Ga0075370_10000354 | 3300006353 | Bacteria | 16716 |
| 205 | Ga0075370_10007324 | 3300006353 | Bacteria | 5618 |
| 206 | Ga0075370_10029066 | 3300006353 | Bacteria | 3076 |
| 207 | Ga0075370_10038737 | 3300006353 | Bacteria | 2683 |
| 208 | Ga0075370_10049991 | 3300006353 | Bacteria | 2371 |
| 209 | Ga0068871_100006200 | 3300006358 | Bacteria | 8431 |
| 210 | Ga0068871_100008132 | 3300006358 | Bacteria | 7530 |
| 211 | Ga0068871_100016972 | 3300006358 | Bacteria | 5497 |
| 212 | Ga0068871_100021762 | 3300006358 | Bacteria | 4935 |
| 213 | Ga0075430_100024549 | 3300006846 | Bacteria | 5127 |
| 214 | Ga0068865_100041024 | 3300006881 | Bacteria | 3148 |
| 215 | Ga0068865_100080474 | 3300006881 | Bacteria | 2336 |
| 216 | Ga0068865_100112571 | 3300006881 | Bacteria | 2010 |
| 217 | Ga0068865_100408227 | 3300006881 | Bacteria | 1114 |
| 218 | Ga0068865_101203528 | 3300006881 | Bacteria | 671 |
| 219 | Ga0097620_100051038 | 3300006931 | Bacteria | 4156 |
| 220 | Ga0097620_100175351 | 3300006931 | Bacteria | 2226 |
| 221 | Ga0075435_100811210 | 3300007076 | Bacteria | 815 |
| 222 | Ga0105240_10002152 | 3300009093 | Bacteria | 32168 |
| 223 | Ga0105240_10750669 | 3300009093 | Bacteria | 1061 |
| 224 | Ga0111539_10668624 | 3300009094 | Bacteria | 1209 |
| 225 | Ga0111539_11322043 | 3300009094 | Bacteria | 836 |
| 226 | Ga0105245_10308565 | 3300009098 | Bacteria | 1555 |
| 227 | Ga0105245_10371842 | 3300009098 | Bacteria | 1421 |
| 228 | Ga0114129_10080001 | 3300009147 | Bacteria | 4544 |
| 229 | Ga0114129_11755964 | 3300009147 | Bacteria | 756 |
| 230 | Ga0105243_10004160 | 3300009148 | Bacteria | 11482 |
| 231 | Ga0105243_10079876 | 3300009148 | Bacteria | 2666 |
| 232 | Ga0105243_10178693 | 3300009148 | Bacteria | 1844 |
| 233 | Ga0105243_10429104 | 3300009148 | Bacteria | 1235 |
| 234 | Ga0105241_10050051 | 3300009174 | Bacteria | 3184 |
| 235 | Ga0105242_10084716 | 3300009176 | Bacteria | 2657 |
| 236 | Ga0105248_10011079 | 3300009177 | Bacteria | 9946 |
| 237 | Ga0105248_10018942 | 3300009177 | Bacteria | 7611 |
| 238 | Ga0105248_10074691 | 3300009177 | Bacteria | 3810 |
| 239 | Ga0105248_10347566 | 3300009177 | Bacteria | 1670 |
| 240 | Ga0105248_10415963 | 3300009177 | Bacteria | 1514 |
| 241 | Ga0105248_10451657 | 3300009177 | Bacteria | 1448 |
| 242 | Ga0105248_10956328 | 3300009177 | Bacteria | 967 |
| 243 | Ga0105237_10003209 | 3300009545 | Bacteria | 19583 |
| 244 | Ga0105237_10035404 | 3300009545 | Bacteria | 5052 |
| 245 | Ga0105238_10009054 | 3300009551 | Bacteria | 9960 |
| 246 | Ga0105238_10016299 | 3300009551 | Bacteria | 7521 |
| 247 | Ga0105238_10152230 | 3300009551 | Bacteria | 2288 |
| 248 | Ga0105238_10334890 | 3300009551 | Bacteria | 1501 |
| 249 | Ga0105249_10074684 | 3300009553 | Bacteria | 3139 |
| 250 | Ga0105249_10148826 | 3300009553 | Bacteria | 2252 |
| 251 | Ga0105249_11515953 | 3300009553 | Bacteria | 743 |
| 252 | Ga0105239_10001461 | 3300010375 | Bacteria | 31458 |
| 253 | Ga0105239_10305478 | 3300010375 | Bacteria | 1792 |
| 254 | Ga0105246_10061627 | 3300011119 | Bacteria | 2611 |
| 255 | Ga0105246_10097110 | 3300011119 | Bacteria | 2137 |
| 256 | Ga0105246_10983222 | 3300011119 | Bacteria | 763 |
| 257 | Ga0157373_10053653 | 3300013100 | Bacteria | 2866 |
| 258 | Ga0157371_10109439 | 3300013102 | Bacteria | 1961 |
| 259 | Ga0157371_10196215 | 3300013102 | Bacteria | 1446 |
| 260 | Ga0157370_10576582 | 3300013104 | Bacteria | 1031 |
| 261 | Ga0157369_10058720 | 3300013105 | Bacteria | 4149 |
| 262 | Ga0157369_10182335 | 3300013105 | Bacteria | 2209 |
| 263 | Ga0157374_10031054 | 3300013296 | Bacteria | 4851 |
| 264 | Ga0157374_10052887 | 3300013296 | Bacteria | 3784 |
| 265 | Ga0157374_10064219 | 3300013296 | Bacteria | 3444 |
| 266 | Ga0157374_10344983 | 3300013296 | Bacteria | 1479 |
| 267 | Ga0157378_10389624 | 3300013297 | Bacteria | 1370 |
| 268 | Ga0157378_10480928 | 3300013297 | Bacteria | 1237 |
| 269 | Ga0157378_10689578 | 3300013297 | Bacteria | 1040 |
| 270 | Ga0163162_10047853 | 3300013306 | Bacteria | 4284 |
| 271 | Ga0163162_10262578 | 3300013306 | Bacteria | 1858 |
| 272 | Ga0163162_10335040 | 3300013306 | Bacteria | 1645 |
| 273 | Ga0163162_10585832 | 3300013306 | Bacteria | 1242 |
| 274 | Ga0157372_10013740 | 3300013307 | Bacteria | 8651 |
| 275 | Ga0157372_10163891 | 3300013307 | Bacteria | 2570 |
| 276 | Ga0157375_10005174 | 3300013308 | Bacteria | 11316 |
| 277 | Ga0157375_10012252 | 3300013308 | Bacteria | 7602 |
| 278 | Ga0157375_10014262 | 3300013308 | Bacteria | 7084 |
| 279 | Ga0157375_10018621 | 3300013308 | Bacteria | 6300 |
| 280 | Ga0157375_10043978 | 3300013308 | Bacteria | 4334 |
| 281 | Ga0163163_10170197 | 3300014325 | Bacteria | 2225 |
| 282 | Ga0163163_10527962 | 3300014325 | Bacteria | 1243 |
| 283 | Ga0163163_10558172 | 3300014325 | Bacteria | 1208 |
| 284 | Ga0163163_10868387 | 3300014325 | Bacteria | 965 |
| 285 | Ga0157380_10088041 | 3300014326 | Bacteria | 2554 |
| 286 | Ga0157380_10173230 | 3300014326 | Bacteria | 1888 |
| 287 | Ga0157380_10471894 | 3300014326 | Bacteria | 1211 |
| 288 | Ga0157380_10744582 | 3300014326 | Bacteria | 991 |
| 289 | Ga0157377_10000044 | 3300014745 | Bacteria | 100420 |
| 290 | Ga0157377_10001565 | 3300014745 | Bacteria | 9949 |
| 291 | Ga0157377_10278963 | 3300014745 | Bacteria | 1094 |
| 292 | Ga0157379_10004002 | 3300014968 | Bacteria | 12563 |
| 293 | Ga0157379_10010130 | 3300014968 | Bacteria | 8218 |
| 294 | Ga0157379_10020334 | 3300014968 | Bacteria | 5869 |
| 295 | Ga0157379_10026436 | 3300014968 | Bacteria | 5166 |
| 296 | Ga0157379_10589571 | 3300014968 | Bacteria | 1037 |
| 297 | Ga0157379_10697595 | 3300014968 | Bacteria | 953 |
| 298 | Ga0157376_10003307 | 3300014969 | Bacteria | 11099 |
| 299 | Ga0157376_10007305 | 3300014969 | Bacteria | 7869 |
| 300 | Ga0157376_10077851 | 3300014969 | Bacteria | 2837 |
| 301 | Ga0157376_10418916 | 3300014969 | Bacteria | 1299 |
| 302 | Ga0157376_10625128 | 3300014969 | Bacteria | 1075 |
| 303 | Ga0157376_10713108 | 3300014969 | Bacteria | 1009 |
| 304 | Ga0182006_1108030 | 3300015261 | Bacteria | 979 |
| 305 | Ga0163161_10006298 | 3300017792 | Bacteria | 8215 |
| 306 | Ga0163161_10009331 | 3300017792 | Bacteria | 6789 |
| 307 | Ga0163161_10086351 | 3300017792 | Bacteria | 2316 |
| 308 | Ga0163161_10102709 | 3300017792 | Bacteria | 2129 |
| 309 | Ga0163161_10376810 | 3300017792 | Bacteria | 1133 |
| 310 | Ga0163161_10539629 | 3300017792 | Bacteria | 955 |
| 311 | Ga0213872_10000067 | 3300021361 | Bacteria | 92410 |
| 312 | Ga0209674_109982 | 3300025226 | Bacteria | 1033 |
| 313 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 314 | Ga0209051_1016706 | 3300025303 | Bacteria | 3305 |
| 315 | Ga0209051_1041082 | 3300025303 | Bacteria | 1650 |
| 316 | Ga0209257_1000033 | 3300025304 | Bacteria | 671006 |
| 317 | Ga0207697_10003064 | 3300025315 | Bacteria | 8383 |
| 318 | Ga0207697_10027011 | 3300025315 | Bacteria | 2347 |
| 319 | Ga0207656_10024202 | 3300025321 | Bacteria | 2453 |
| 320 | Ga0207656_10086056 | 3300025321 | Bacteria | 1420 |
| 321 | Ga0207656_10128452 | 3300025321 | Unclassified | 1185 |
| 322 | Ga0207656_10244438 | 3300025321 | Bacteria | 878 |
| 323 | Ga0207682_10002801 | 3300025893 | Bacteria | 7710 |
| 324 | Ga0207682_10011716 | 3300025893 | Bacteria | 3427 |
| 325 | Ga0207682_10050682 | 3300025893 | Bacteria | 1717 |
| 326 | Ga0207642_10010828 | 3300025899 | Bacteria | 3231 |
| 327 | Ga0207688_10041571 | 3300025901 | Bacteria | 2558 |
| 328 | Ga0207680_10058549 | 3300025903 | Bacteria | 2336 |
| 329 | Ga0207680_10123684 | 3300025903 | Bacteria | 1695 |
| 330 | Ga0207645_10004979 | 3300025907 | Bacteria | 9736 |
| 331 | Ga0207645_10023445 | 3300025907 | Bacteria | 4012 |
| 332 | Ga0207645_10024932 | 3300025907 | Bacteria | 3874 |
| 333 | Ga0207645_10049830 | 3300025907 | Bacteria | 2674 |
| 334 | Ga0207645_10192813 | 3300025907 | Bacteria | 1339 |
| 335 | Ga0207645_10421549 | 3300025907 | Bacteria | 899 |
| 336 | Ga0207643_10042410 | 3300025908 | Bacteria | 2566 |
| 337 | Ga0207643_10084950 | 3300025908 | Bacteria | 1838 |
| 338 | Ga0207643_10131827 | 3300025908 | Bacteria | 1488 |
| 339 | Ga0207643_10397455 | 3300025908 | Bacteria | 871 |
| 340 | Ga0207705_10033024 | 3300025909 | Bacteria | 3698 |
| 341 | Ga0207684_10132563 | 3300025910 | Bacteria | 2139 |
| 342 | Ga0207654_10052847 | 3300025911 | Bacteria | 2343 |
| 343 | Ga0207695_10107276 | 3300025913 | Bacteria | 2778 |
| 344 | Ga0207671_10010388 | 3300025914 | Bacteria | 7685 |
| 345 | Ga0207671_10048096 | 3300025914 | Bacteria | 3156 |
| 346 | Ga0207660_10056055 | 3300025917 | Bacteria | 2819 |
| 347 | Ga0207662_10006607 | 3300025918 | Bacteria | 6264 |
| 348 | Ga0207662_10181995 | 3300025918 | Bacteria | 1353 |
| 349 | Ga0207657_10057700 | 3300025919 | Bacteria | 3345 |
| 350 | Ga0207657_10094391 | 3300025919 | Bacteria | 2491 |
| 351 | Ga0207649_10063732 | 3300025920 | Bacteria | 2328 |
| 352 | Ga0207649_10081985 | 3300025920 | Bacteria | 2090 |
| 353 | Ga0207649_10167067 | 3300025920 | Bacteria | 1529 |
| 354 | Ga0207649_10417669 | 3300025920 | Bacteria | 1007 |
| 355 | Ga0207652_10009072 | 3300025921 | Bacteria | 8011 |
| 356 | Ga0207681_10003514 | 3300025923 | Bacteria | 9755 |
| 357 | Ga0207681_10018156 | 3300025923 | Bacteria | 4429 |
| 358 | Ga0207681_10025216 | 3300025923 | Bacteria | 3822 |
| 359 | Ga0207681_10037074 | 3300025923 | Bacteria | 3220 |
| 360 | Ga0207694_10145491 | 3300025924 | Bacteria | 1907 |
| 361 | Ga0207694_10171384 | 3300025924 | Bacteria | 1757 |
| 362 | Ga0207650_10001276 | 3300025925 | Bacteria | 18258 |
| 363 | Ga0207650_10004871 | 3300025925 | Bacteria | 9172 |
| 364 | Ga0207650_10007499 | 3300025925 | Bacteria | 7439 |
| 365 | Ga0207650_10023626 | 3300025925 | Bacteria | 4362 |
| 366 | Ga0207650_10048255 | 3300025925 | Bacteria | 3140 |
| 367 | Ga0207650_10132661 | 3300025925 | Bacteria | 1951 |
| 368 | Ga0207650_10150940 | 3300025925 | Bacteria | 1834 |
| 369 | Ga0207650_10255958 | 3300025925 | Bacteria | 1419 |
| 370 | Ga0207659_10011834 | 3300025926 | Bacteria | 5526 |
| 371 | Ga0207659_10014054 | 3300025926 | Bacteria | 5153 |
| 372 | Ga0207659_10016592 | 3300025926 | Bacteria | 4796 |
| 373 | Ga0207659_10057723 | 3300025926 | Bacteria | 2785 |
| 374 | Ga0207659_10058923 | 3300025926 | Bacteria | 2758 |
| 375 | Ga0207659_10087452 | 3300025926 | Bacteria | 2320 |
| 376 | Ga0207644_10000523 | 3300025931 | Bacteria | 24867 |
| 377 | Ga0207644_10001757 | 3300025931 | Bacteria | 14039 |
| 378 | Ga0207644_10057199 | 3300025931 | Bacteria | 2815 |
| 379 | Ga0207644_10139116 | 3300025931 | Bacteria | 1868 |
| 380 | Ga0207690_10042222 | 3300025932 | Bacteria | 2994 |
| 381 | Ga0207690_10241351 | 3300025932 | Bacteria | 1392 |
| 382 | Ga0207690_10332564 | 3300025932 | Bacteria | 1197 |
| 383 | Ga0207690_10462444 | 3300025932 | Bacteria | 1021 |
| 384 | Ga0207706_10006211 | 3300025933 | Bacteria | 11101 |
| 385 | Ga0207706_10019872 | 3300025933 | Bacteria | 6038 |
| 386 | Ga0207706_10107644 | 3300025933 | Bacteria | 2453 |
| 387 | Ga0207706_10205697 | 3300025933 | Bacteria | 1726 |
| 388 | Ga0207706_10419226 | 3300025933 | Bacteria | 1160 |
| 389 | Ga0207686_10406895 | 3300025934 | Bacteria | 1038 |
| 390 | Ga0207709_10001856 | 3300025935 | Bacteria | 14068 |
| 391 | Ga0207709_10035063 | 3300025935 | Bacteria | 2963 |
| 392 | Ga0207709_10070679 | 3300025935 | Bacteria | 2214 |
| 393 | Ga0207709_10083040 | 3300025935 | Bacteria | 2070 |
| 394 | Ga0207669_10016372 | 3300025937 | Bacteria | 3765 |
| 395 | Ga0207669_10045476 | 3300025937 | Bacteria | 2587 |
| 396 | Ga0207669_10058535 | 3300025937 | Bacteria | 2351 |
| 397 | Ga0207704_10032069 | 3300025938 | Bacteria | 2968 |
| 398 | Ga0207704_10070145 | 3300025938 | Bacteria | 2218 |
| 399 | Ga0207704_10107692 | 3300025938 | Bacteria | 1875 |
| 400 | Ga0207704_10171053 | 3300025938 | Bacteria | 1558 |
| 401 | Ga0207665_10025637 | 3300025939 | Bacteria | 3890 |
| 402 | Ga0207691_10003381 | 3300025940 | Bacteria | 15525 |
| 403 | Ga0207691_10010897 | 3300025940 | Bacteria | 8724 |
| 404 | Ga0207691_10020835 | 3300025940 | Bacteria | 6195 |
| 405 | Ga0207691_10101973 | 3300025940 | Bacteria | 2560 |
| 406 | Ga0207691_10109769 | 3300025940 | Bacteria | 2454 |
| 407 | Ga0207691_10175300 | 3300025940 | Bacteria | 1876 |
| 408 | Ga0207711_10004582 | 3300025941 | Bacteria | 11755 |
| 409 | Ga0207711_10008794 | 3300025941 | Bacteria | 8444 |
| 410 | Ga0207711_10048247 | 3300025941 | Bacteria | 3643 |
| 411 | Ga0207711_10126427 | 3300025941 | Bacteria | 2287 |
| 412 | Ga0207711_10191886 | 3300025941 | Bacteria | 1862 |
| 413 | Ga0207711_10923208 | 3300025941 | Bacteria | 811 |
| 414 | Ga0207689_10003664 | 3300025942 | Bacteria | 14006 |
| 415 | Ga0207689_10020357 | 3300025942 | Bacteria | 5586 |
| 416 | Ga0207689_10035048 | 3300025942 | Bacteria | 4169 |
| 417 | Ga0207661_10037727 | 3300025944 | Bacteria | 3782 |
| 418 | Ga0207661_10466442 | 3300025944 | Bacteria | 1151 |
| 419 | Ga0207679_10008387 | 3300025945 | Bacteria | 6580 |
| 420 | Ga0207679_10030713 | 3300025945 | Bacteria | 3754 |
| 421 | Ga0207679_10178370 | 3300025945 | Bacteria | 1755 |
| 422 | Ga0207679_10226789 | 3300025945 | Bacteria | 1575 |
| 423 | Ga0207679_10333958 | 3300025945 | Bacteria | 1316 |
| 424 | Ga0207667_10251901 | 3300025949 | Bacteria | 1806 |
| 425 | Ga0207651_10013666 | 3300025960 | Bacteria | 4655 |
| 426 | Ga0207651_10014368 | 3300025960 | Bacteria | 4568 |
| 427 | Ga0207651_10128790 | 3300025960 | Bacteria | 1933 |
| 428 | Ga0207668_10033710 | 3300025972 | Bacteria | 3394 |
| 429 | Ga0207668_10188473 | 3300025972 | Bacteria | 1632 |
| 430 | Ga0207668_10490701 | 3300025972 | Bacteria | 1055 |
| 431 | Ga0207668_10654983 | 3300025972 | Bacteria | 919 |
| 432 | Ga0207640_10049149 | 3300025981 | Bacteria | 2729 |
| 433 | Ga0207640_10447656 | 3300025981 | Bacteria | 1063 |
| 434 | Ga0207658_10016179 | 3300025986 | Bacteria | 5125 |
| 435 | Ga0207658_10066551 | 3300025986 | Bacteria | 2710 |
| 436 | Ga0207658_10530481 | 3300025986 | Unclassified | 1051 |
| 437 | Ga0207677_10028700 | 3300026023 | Bacteria | 3524 |
| 438 | Ga0207677_10062293 | 3300026023 | Bacteria | 2587 |
| 439 | Ga0207677_10223449 | 3300026023 | Bacteria | 1512 |
| 440 | Ga0207677_10809071 | 3300026023 | Bacteria | 839 |
| 441 | Ga0207703_10018898 | 3300026035 | Bacteria | 5384 |
| 442 | Ga0207703_10266864 | 3300026035 | Bacteria | 1549 |
| 443 | Ga0207703_10373875 | 3300026035 | Bacteria | 1317 |
| 444 | Ga0207639_10040103 | 3300026041 | Bacteria | 3493 |
| 445 | Ga0207639_10064583 | 3300026041 | Bacteria | 2838 |
| 446 | Ga0207639_10117864 | 3300026041 | Bacteria | 2176 |
| 447 | Ga0207639_10494890 | 3300026041 | Bacteria | 1116 |
| 448 | Ga0207639_11044310 | 3300026041 | Bacteria | 766 |
| 449 | Ga0207678_10015684 | 3300026067 | Bacteria | 6659 |
| 450 | Ga0207678_10040687 | 3300026067 | Bacteria | 4030 |
| 451 | Ga0207678_10082065 | 3300026067 | Bacteria | 2759 |
| 452 | Ga0207678_10154674 | 3300026067 | Bacteria | 1958 |
| 453 | Ga0207708_10012477 | 3300026075 | Bacteria | 6333 |
| 454 | Ga0207702_10099445 | 3300026078 | Bacteria | 2564 |
| 455 | Ga0207702_10121229 | 3300026078 | Bacteria | 2341 |
| 456 | Ga0207702_10386077 | 3300026078 | Bacteria | 1347 |
| 457 | Ga0207641_10009103 | 3300026088 | Bacteria | 8202 |
| 458 | Ga0207641_10019205 | 3300026088 | Bacteria | 5608 |
| 459 | Ga0207641_10021621 | 3300026088 | Bacteria | 5285 |
| 460 | Ga0207641_10059586 | 3300026088 | Bacteria | 3251 |
| 461 | Ga0207648_10000109 | 3300026089 | Bacteria | 80648 |
| 462 | Ga0207648_10004239 | 3300026089 | Bacteria | 14817 |
| 463 | Ga0207648_10009368 | 3300026089 | Bacteria | 9379 |
| 464 | Ga0207648_10010311 | 3300026089 | Bacteria | 8871 |
| 465 | Ga0207648_10441379 | 3300026089 | Bacteria | 1184 |
| 466 | Ga0207676_10011582 | 3300026095 | Bacteria | 6306 |
| 467 | Ga0207676_10045595 | 3300026095 | Bacteria | 3388 |
| 468 | Ga0207676_10079068 | 3300026095 | Bacteria | 2666 |
| 469 | Ga0207676_10426881 | 3300026095 | Unclassified | 1244 |
| 470 | Ga0207676_10714046 | 3300026095 | Bacteria | 972 |
| 471 | Ga0207674_10031922 | 3300026116 | Bacteria | 5528 |
| 472 | Ga0207674_10557935 | 3300026116 | Bacteria | 1106 |
| 473 | Ga0207675_100008151 | 3300026118 | Bacteria | 9875 |
| 474 | Ga0207675_100023191 | 3300026118 | Bacteria | 5771 |
| 475 | Ga0207675_100161335 | 3300026118 | Bacteria | 2138 |
| 476 | Ga0207683_10025450 | 3300026121 | Bacteria | 5106 |
| 477 | Ga0207683_10059454 | 3300026121 | Bacteria | 3357 |
| 478 | Ga0207683_10080603 | 3300026121 | Bacteria | 2888 |
| 479 | Ga0207683_10083536 | 3300026121 | Bacteria | 2838 |
| 480 | Ga0207698_10016587 | 3300026142 | Bacteria | 4970 |
| 481 | Ga0207698_10044118 | 3300026142 | Bacteria | 3347 |
| 482 | Ga0207698_10046575 | 3300026142 | Bacteria | 3276 |
| 483 | Ga0207698_10202437 | 3300026142 | Bacteria | 1779 |
| 484 | Ga0207698_10338146 | 3300026142 | Bacteria | 1417 |
| 485 | Ga0207698_10679887 | 3300026142 | Bacteria | 1022 |
| 486 | Ga0207698_10711409 | 3300026142 | Bacteria | 1000 |
| 487 | Ga0209973_1002610 | 3300027252 | Bacteria | 1705 |
| 488 | Ga0209974_10001641 | 3300027876 | Bacteria | 8098 |
| 489 | Ga0268266_10060195 | 3300028379 | Bacteria | 3273 |
| 490 | Ga0268266_10072607 | 3300028379 | Bacteria | 2985 |
| 491 | Ga0268266_10166821 | 3300028379 | Bacteria | 1996 |
| 492 | Ga0268266_10219514 | 3300028379 | Bacteria | 1747 |
| 493 | Ga0268266_10581397 | 3300028379 | Bacteria | 1075 |
| 494 | Ga0268266_10590786 | 3300028379 | Bacteria | 1066 |
| 495 | Ga0268265_10106367 | 3300028380 | Bacteria | 2279 |
| 496 | Ga0268265_10302459 | 3300028380 | Bacteria | 1441 |
| 497 | Ga0268265_10392985 | 3300028380 | Bacteria | 1279 |
| 498 | Ga0268264_10003375 | 3300028381 | Bacteria | 13788 |
| 499 | Ga0268264_10117505 | 3300028381 | Bacteria | 2339 |
| 500 | Ga0307517_10001980 | 3300028786 | Bacteria | 33373 |
| 501 | Ga0307515_10010956 | 3300028794 | Bacteria | 17284 |
| 502 | Ga0307515_10017116 | 3300028794 | Bacteria | 13232 |
| 503 | Ga0307515_10028743 | 3300028794 | Bacteria | 9433 |
| 504 | Ga0307515_10065408 | 3300028794 | Bacteria | 5061 |
| 505 | Ga0307515_10175282 | 3300028794 | Bacteria | 2118 |
| 506 | Ga0307515_10299171 | 3300028794 | Bacteria | 1296 |
| 507 | Ga0307512_10097071 | 3300030522 | Bacteria | 2018 |
| 508 | Ga0307512_10109888 | 3300030522 | Bacteria | 1822 |
| 509 | Ga0307512_10182862 | 3300030522 | Bacteria | 1174 |
| 510 | Ga0265330_10003025 | 3300031235 | Bacteria | 8928 |
| 511 | Ga0265332_10030405 | 3300031238 | Bacteria | 2359 |
| 512 | Ga0265328_10111836 | 3300031239 | Bacteria | 1015 |
| 513 | Ga0265329_10132407 | 3300031242 | Bacteria | 803 |
| 514 | Ga0265331_10008795 | 3300031250 | Bacteria | 5719 |
| 515 | Ga0265316_10487021 | 3300031344 | Bacteria | 882 |
| 516 | Ga0307513_10017125 | 3300031456 | Bacteria | 8704 |
| 517 | Ga0307513_10195204 | 3300031456 | Bacteria | 1871 |
| 518 | Ga0307509_10000249 | 3300031507 | Bacteria | 87094 |
| 519 | Ga0307509_10003703 | 3300031507 | Bacteria | 22876 |
| 520 | Ga0307509_10012634 | 3300031507 | Bacteria | 10086 |
| 521 | Ga0307509_10074077 | 3300031507 | Bacteria | 3543 |
| 522 | Ga0307509_10108879 | 3300031507 | Bacteria | 2783 |
| 523 | Ga0307509_10375294 | 3300031507 | Bacteria | 1137 |
| 524 | Ga0307408_100000023 | 3300031548 | Bacteria | 295931 |
| 525 | Ga0307408_100015636 | 3300031548 | Bacteria | 5056 |
| 526 | Ga0307408_100196020 | 3300031548 | Bacteria | 1631 |
| 527 | Ga0307508_10004816 | 3300031616 | Bacteria | 13012 |
| 528 | Ga0307508_10006698 | 3300031616 | Bacteria | 10804 |
| 529 | Ga0307508_10216955 | 3300031616 | Bacteria | 1513 |
| 530 | Ga0307514_10001392 | 3300031649 | Bacteria | 30115 |
| 531 | Ga0307514_10075735 | 3300031649 | Bacteria | 2508 |
| 532 | Ga0307514_10089643 | 3300031649 | Bacteria | 2246 |
| 533 | Ga0307514_10141807 | 3300031649 | Bacteria | 1632 |
| 534 | Ga0265314_10017068 | 3300031711 | Bacteria | 5707 |
| 535 | Ga0265342_10049206 | 3300031712 | Bacteria | 2523 |
| 536 | Ga0307516_10000237 | 3300031730 | Bacteria | 70929 |
| 537 | Ga0307516_10000303 | 3300031730 | Bacteria | 63898 |
| 538 | Ga0307516_10285416 | 3300031730 | Bacteria | 1331 |
| 539 | Ga0307516_10332005 | 3300031730 | Bacteria | 1189 |
| 540 | Ga0307516_10339784 | 3300031730 | Bacteria | 1169 |
| 541 | Ga0307516_10433851 | 3300031730 | Bacteria | 971 |
| 542 | Ga0307413_10057428 | 3300031824 | Bacteria | 2380 |
| 543 | Ga0307413_10168485 | 3300031824 | Bacteria | 1547 |
| 544 | Ga0307413_10318493 | 3300031824 | Bacteria | 1187 |
| 545 | Ga0307413_10423715 | 3300031824 | Bacteria | 1049 |
| 546 | Ga0307410_10234165 | 3300031852 | Bacteria | 1420 |
| 547 | Ga0307410_10439420 | 3300031852 | Bacteria | 1062 |
| 548 | Ga0307406_10023123 | 3300031901 | Bacteria | 3696 |
| 549 | Ga0307406_10984675 | 3300031901 | Bacteria | 723 |
| 550 | Ga0307407_10468201 | 3300031903 | Bacteria | 918 |
| 551 | Ga0307412_10027498 | 3300031911 | Bacteria | 3547 |
| 552 | Ga0307412_10034896 | 3300031911 | Bacteria | 3209 |
| 553 | Ga0307412_10100837 | 3300031911 | Bacteria | 2042 |
| 554 | Ga0307409_100383629 | 3300031995 | Bacteria | 1337 |
| 555 | Ga0307416_100014114 | 3300032002 | Bacteria | 5457 |
| 556 | Ga0307416_100061065 | 3300032002 | Bacteria | 3074 |
| 557 | Ga0307414_10240025 | 3300032004 | Bacteria | 1500 |
| 558 | Ga0307411_10012282 | 3300032005 | Bacteria | 4665 |
| 559 | Ga0307411_10016314 | 3300032005 | Bacteria | 4202 |
| 560 | Ga0307411_10018187 | 3300032005 | Bacteria | 4026 |
| 561 | Ga0307411_10026501 | 3300032005 | Bacteria | 3492 |
| 562 | Ga0307415_100068180 | 3300032126 | Bacteria | 2489 |
| 563 | Ga0307415_100116794 | 3300032126 | Bacteria | 1991 |
| 564 | Ga0307510_10043278 | 3300033180 | Bacteria | 4896 |
| 565 | Ga0307510_10072075 | 3300033180 | Bacteria | 3434 |
| 566 | Ga0373930_0026541 | 3300034816 | Bacteria | 1168 |
| 567 | Ga0373959_0010617 | 3300034820 | Bacteria | 1612 |
| 568 | Ga0373949_0089859 | 3300035090 | Bacteria | 829 |
| 569 | Ga0373951_0064691 | 3300035091 | Bacteria | 921 |
| 570 | Ga0373952_0012226 | 3300035092 | Bacteria | 1685 |
| 571 | Ga0373932_0018150 | 3300035112 | Bacteria | 1815 |
| 572 | Ga0373936_0095384 | 3300035113 | Bacteria | 1251 |
| 573 | Ga0373939_0000184 | 3300035114 | Bacteria | 17389 |
| 574 | Ga0373945_0165722 | 3300035116 | Bacteria | 903 |
| 575 | Ga0373960_0069961 | 3300035121 | Bacteria | 1083 |
| 576 | Ga0373943_0109578 | 3300035170 | Bacteria | 1455 |
| 577 | Ga0373943_0416011 | 3300035170 | Bacteria | 778 |
| 578 | Ga0373946_0011338 | 3300035171 | Bacteria | 3323 |
| 579 | Ga0373946_0068600 | 3300035171 | Bacteria | 1526 |
| 580 | Ga0373955_0065797 | 3300035172 | Bacteria | 2013 |
| 581 | Ga0373931_0000092 | 3300035691 | Bacteria | 41580 |
| 582 | Ga0373931_0002695 | 3300035691 | Bacteria | 7904 |
| 583 | Ga0373931_0009750 | 3300035691 | Bacteria | 4598 |
| 584 | Ga0373927_0265998 | 3300035695 | Bacteria | 1128 |
| 585 | Ga0373927_0678656 | 3300035695 | Bacteria | 681 |
| 586 | Ga0373933_0097619 | 3300035724 | Bacteria | 1820 |
| 587 | Ga0373947_0230131 | 3300035725 | Bacteria | 1221 |
| 588 | Ga0373937_0171306 | 3300036401 | Bacteria | 2037 |
| 589 | Ga0373937_0180302 | 3300036401 | Bacteria | 1983 |
| 590 | Ga0373937_0622301 | 3300036401 | Bacteria | 1024 |
| 591 | Ga0373925_0050008 | 3300037068 | Bacteria | 3117 |
| 592 | Ga0373925_0221711 | 3300037068 | Bacteria | 1509 |
| 593 | Ga0373925_0263414 | 3300037068 | Bacteria | 1385 |
| 594 | Ga0373925_0392936 | 3300037068 | Bacteria | 1130 |
| 595 | Ga0395900_0245950 | 3300037418 | Bacteria | 1792 |
| 596 | Ga0395900_0646875 | 3300037418 | Bacteria | 994 |
| 597 | Ga0395905_0000027 | 3300037471 | Bacteria | 297239 |
| 598 | Ga0395905_0000151 | 3300037471 | Bacteria | 115485 |
| 599 | Ga0395905_0014823 | 3300037471 | Bacteria | 7432 |
| 600 | Ga0395905_0074018 | 3300037471 | Bacteria | 3192 |
| 601 | Ga0395905_0417523 | 3300037471 | Bacteria | 1237 |
| 602 | Ga0395901_0164028 | 3300038443 | Bacteria | 2333 |
| 603 | Ga0436365_0757688 | 3300039437 | Bacteria | 1199 |
| 604 | Ga0436361_0750298 | 3300039447 | Bacteria | 51036 |
| 605 | Ga0451798_0362761 | 3300041458 | Bacteria | 2178 |
| 606 | Ga0451802_0227373 | 3300041460 | Bacteria | 853 |
| 607 | Ga0451853_0566426 | 3300041512 | Bacteria | 926 |
| 608 | Ga0451853_1375847 | 3300041512 | Bacteria | 786 |
| 609 | Ga0451853_1931705 | 3300041512 | Bacteria | 944 |
| 610 | Ga0439437_000095 | 3300042000 | Bacteria | 6474 |
| 611 | Ga0439455_0003524 | 3300042012 | Bacteria | 3002 |
| 612 | Ga0450911_000507 | 3300042115 | Bacteria | 12353 |
| 613 | Ga0450888_000691 | 3300042126 | Bacteria | 3194 |
| 614 | Ga0450891_000206 | 3300042129 | Bacteria | 5846 |
| 615 | Ga0450901_004084 | 3300042533 | Bacteria | 1513 |
| 616 | Ga0451577_0004735 | 3300042876 | Bacteria | 14256 |
| 617 | Ga0451577_0155936 | 3300042876 | Bacteria | 2055 |
| 618 | Ga0451577_0273095 | 3300042876 | Bacteria | 1531 |
| 619 | Ga0451577_0404222 | 3300042876 | Bacteria | 1240 |
| 620 | Ga0453683_0459440 | 3300044673 | Bacteria | 824 |
| 621 | Ga0466965_0295094 | 3300044683 | Bacteria | 878 |
| 622 | Ga0466964_0218482 | 3300044706 | Bacteria | 924 |
| 623 | Ga0453684_0020128 | 3300044712 | Bacteria | 10096 |
| 624 | Ga0453684_0086122 | 3300044712 | Bacteria | 3900 |
| 625 | Ga0453684_0134244 | 3300044712 | Bacteria | 2966 |
| 626 | Ga0453684_0286196 | 3300044712 | Bacteria | 1878 |
| 627 | Ga0453684_0314661 | 3300044712 | Bacteria | 1775 |
| 628 | Ga0453684_0412870 | 3300044712 | Bacteria | 1509 |
| 629 | Ga0451576_0004667 | 3300045051 | Bacteria | 17660 |
| 630 | Ga0451576_0005708 | 3300045051 | Bacteria | 15524 |
| 631 | Ga0451576_0212037 | 3300045051 | Bacteria | 2022 |
| 632 | Ga0451576_0315333 | 3300045051 | Bacteria | 1636 |
| 633 | Ga0495592_0001883 | 3300046454 | Bacteria | 14765 |
| 634 | Ga0495638_0279367 | 3300046460 | Bacteria | 908 |
| 635 | Ga0495650_0060731 | 3300046471 | Bacteria | 1517 |
| 636 | Ga0495639_0111302 | 3300046475 | Bacteria | 1300 |
| 637 | Ga0495610_0038724 | 3300046512 | Bacteria | 2418 |
| 638 | Ga0495628_0238440 | 3300046516 | Bacteria | 1361 |
| 639 | Ga0495630_0448757 | 3300046517 | Bacteria | 988 |
| 640 | Ga0495666_0098757 | 3300046526 | Bacteria | 1376 |
| 641 | Ga0495642_0065027 | 3300046528 | Bacteria | 1518 |
| 642 | Ga0495598_0016283 | 3300046537 | Bacteria | 1894 |
| 643 | Ga0495621_0112088 | 3300046539 | Bacteria | 1047 |
| 644 | Ga0495597_0198210 | 3300046542 | Bacteria | 805 |
| 645 | Ga0495633_0156073 | 3300046558 | Bacteria | 1053 |
| 646 | Ga0495656_0003963 | 3300046615 | Bacteria | 5031 |
| 647 | Ga0495656_0328626 | 3300046615 | Bacteria | 789 |
| 648 | Ga0495661_0369699 | 3300046665 | Bacteria | 702 |
| 649 | Ga0495599_0135816 | 3300046678 | Bacteria | 1527 |
| 650 | Ga0495647_0073605 | 3300046681 | Bacteria | 1372 |
| 651 | Ga0495658_0052347 | 3300046683 | Bacteria | 2315 |
| 652 | Ga0495658_0154088 | 3300046683 | Bacteria | 1413 |
| 653 | Ga0495658_0269335 | 3300046683 | Bacteria | 1073 |
| 654 | Ga0495658_0433225 | 3300046683 | Bacteria | 839 |
| 655 | Ga0495669_0026101 | 3300046684 | Bacteria | 2552 |
| 656 | Ga0495669_0210553 | 3300046684 | Bacteria | 931 |
| 657 | Ga0495624_0207403 | 3300046690 | Bacteria | 1189 |
| 658 | Ga0495670_0272753 | 3300046691 | Bacteria | 904 |
| 659 | Ga0495671_0129216 | 3300046692 | Bacteria | 1232 |
| 660 | Ga0495604_0523462 | 3300047317 | Bacteria | 767 |
| 661 | Ga0495636_0110523 | 3300047318 | Bacteria | 1209 |
| 662 | Ga0495676_0052751 | 3300047321 | Bacteria | 3244 |
| 663 | Ga0495675_0308281 | 3300047444 | Bacteria | 939 |
| 664 | Ga0495677_0017847 | 3300047445 | Bacteria | 2572 |
| 665 | Ga0495685_050054 | 3300047447 | Bacteria | 1418 |
| 666 | Ga0495684_0260937 | 3300047471 | Bacteria | 1257 |
| 667 | Ga0496100_0004969 | 3300048903 | Bacteria | 7109 |
| 668 | Ga0496101_0020005 | 3300048904 | Bacteria | 4577 |
| 669 | Ga0496102_0050949 | 3300048905 | Bacteria | 3771 |
| 670 | Ga0496104_0207849 | 3300048907 | Bacteria | 1869 |
| 671 | Ga0496104_0382744 | 3300048907 | Bacteria | 1320 |
| 672 | Ga0496105_0152969 | 3300048908 | Bacteria | 1896 |
| 673 | Ga0496105_0343379 | 3300048908 | Bacteria | 1193 |
| 674 | Ga0496107_0003649 | 3300048910 | Bacteria | 10348 |
| 675 | Ga0496108_0163203 | 3300048911 | Bacteria | 1926 |
| 676 | Ga0496108_0256556 | 3300048911 | Bacteria | 1521 |
| 677 | Ga0496110_0072750 | 3300048913 | Bacteria | 3051 |
| 678 | Ga0496114_0168105 | 3300048917 | Bacteria | 1910 |
| 679 | Ga0496114_0266760 | 3300048917 | Bacteria | 1508 |
| 680 | Ga0496114_0322005 | 3300048917 | Bacteria | 1366 |
| 681 | Ga0496115_0160232 | 3300048918 | Bacteria | 1859 |
| 682 | Ga0496121_0494783 | 3300048924 | Bacteria | 778 |
| 683 | Ga0496122_0000612 | 3300048925 | Bacteria | 73307 |
| 684 | Ga0496123_0000274 | 3300048926 | Bacteria | 101783 |
| 685 | Ga0496124_0109171 | 3300048927 | Bacteria | 2230 |
| 686 | Ga0501306_027319 | 3300049127 | Bacteria | 830 |
| 687 | Ga0501309_000235 | 3300049129 | Bacteria | 3925 |
| 688 | Ga0501310_000547 | 3300049130 | Bacteria | 3324 |
| 689 | Ga0501304_005516 | 3300049160 | Bacteria | 994 |
| 690 | Ga0501307_007500 | 3300049162 | Bacteria | 1205 |
| 691 | Ga0501294_004193 | 3300049517 | Bacteria | 1360 |
| 692 | Ga0501300_023207 | 3300049523 | Bacteria | 908 |
| 693 | Ga0501301_003010 | 3300049524 | Bacteria | 1143 |
| 694 | Ga0501311_010619 | 3300049527 | Bacteria | 1121 |
| 695 | Ga0501312_018143 | 3300049528 | Bacteria | 1022 |
| 696 | Ga0501314_001724 | 3300049530 | Bacteria | 1617 |
| 697 | Ga0501315_002842 | 3300049531 | Bacteria | 1676 |
| 698 | Ga0501317_023975 | 3300049533 | Bacteria | 846 |
| 699 | Ga0501318_016293 | 3300049534 | Bacteria | 897 |
| 700 | Ga0501322_004543 | 3300049538 | Bacteria | 937 |
| 701 | Ga0501323_010154 | 3300049539 | Bacteria | 1119 |
| 702 | Ga0501042_0775042 | 3300049578 | Bacteria | 698 |
| 703 | Ga0501198_000024 | 3300049649 | Bacteria | 67171 |
| 704 | Ga0501199_011061 | 3300049650 | Bacteria | 972 |
| 705 | Ga0501206_002409 | 3300049653 | Bacteria | 2359 |
| 706 | Ga0501207_053800 | 3300049654 | Bacteria | 724 |
| 707 | Ga0501211_002221 | 3300049658 | Bacteria | 2061 |
| 708 | Ga0501222_000020 | 3300049662 | Bacteria | 67164 |
| 709 | Ga0501222_001970 | 3300049662 | Bacteria | 2846 |
| 710 | Ga0501227_018678 | 3300049665 | Bacteria | 1576 |
| 711 | Ga0501235_004234 | 3300049669 | Bacteria | 3109 |
| 712 | Ga0501236_016828 | 3300049670 | Bacteria | 1039 |
| 713 | Ga0501252_009169 | 3300049682 | Bacteria | 1149 |
| 714 | Ga0501258_000428 | 3300049687 | Bacteria | 2805 |
| 715 | Ga0501221_000262 | 3300049704 | Bacteria | 7763 |
| 716 | Ga0501229_000047 | 3300049706 | Bacteria | 11920 |
| 717 | Ga0501232_002169 | 3300049757 | Bacteria | 1676 |
| 718 | Ga0501262_005168 | 3300049759 | Bacteria | 1535 |
| 719 | Ga0501262_009579 | 3300049759 | Bacteria | 1200 |
| 720 | Ga0501267_000585 | 3300049764 | Bacteria | 2887 |
| 721 | nmdc:mga03683_281610_c1 | 3300050489 | Bacteria | 777 |
| 722 | nmdc:mga03n38_539126_c1 | 3300050490 | Bacteria | 659 |
| 723 | nmdc:mga00v17_200339_c1 | 3300050491 | Bacteria | 1290 |
| 724 | nmdc:mga0yw44_690162_c1 | 3300050492 | Bacteria | 694 |
| 725 | nmdc:mga0k408_100269_c1 | 3300050493 | Bacteria | 1707 |
| 726 | nmdc:mga0k408_132241_c1 | 3300050493 | Bacteria | 1481 |
| 727 | nmdc:mga0k408_302_c1 | 3300050493 | Bacteria | 26707 |
| 728 | nmdc:mga0k408_35485_c1 | 3300050493 | Bacteria | 2860 |
| 729 | nmdc:mga0k408_4061_c1 | 3300050493 | Bacteria | 7765 |
| 730 | nmdc:mga0k408_57744_c1 | 3300050493 | Bacteria | 2253 |
| 731 | nmdc:mga0k408_67442_c1 | 3300050493 | Bacteria | 2085 |
| 732 | nmdc:mga0k408_7292_c1 | 3300050493 | Bacteria | 5907 |
| 733 | nmdc:mga0k408_830_c1 | 3300050493 | Bacteria | 17018 |
| 734 | nmdc:mga07m45_23681_c1 | 3300050496 | Bacteria | 3358 |
| 735 | nmdc:mga07m45_5925_c1 | 3300050496 | Bacteria | 6133 |
| 736 | nmdc:mga05p37_291899_c1 | 3300050507 | Bacteria | 1941 |
| 737 | nmdc:mga09592_1397_c1 | 3300050508 | Bacteria | 19296 |
| 738 | nmdc:mga0qj67_17079_c1 | 3300050509 | Bacteria | 5514 |
| 739 | nmdc:mga0n895_650250_c1 | 3300050512 | Bacteria | 1053 |
| 740 | nmdc:mga0rr50_727903_c1 | 3300050513 | Bacteria | 847 |
| 741 | Ga0495601_0032063 | 3300053077 | Bacteria | 3269 |
| 742 | Ga0495595_0058158 | 3300053084 | Bacteria | 1805 |
| 743 | Ga0500578_0037319 | 3300053086 | Bacteria | 3121 |
| 744 | Ga0500644_0004099 | 3300053088 | Bacteria | 3626 |
| 745 | Ga0500651_0030909 | 3300053093 | Bacteria | 3371 |
| 746 | Ga0500594_0000665 | 3300053118 | Bacteria | 7310 |
| 747 | Ga0500652_080915 | 3300053131 | Bacteria | 1352 |
| 748 | Ga0500655_029846 | 3300053133 | Bacteria | 1047 |
| 749 | Ga0500559_0000032 | 3300053136 | Bacteria | 113579 |
| 750 | Ga0500564_056359 | 3300053138 | Bacteria | 1790 |
| 751 | Ga0500619_000006 | 3300053154 | Bacteria | 77270 |
| 752 | Ga0500619_009997 | 3300053154 | Bacteria | 2379 |
| 753 | Ga0500622_0001884 | 3300053156 | Bacteria | 15840 |
| 754 | Ga0500634_0010236 | 3300053161 | Bacteria | 4784 |
| 755 | Ga0500636_0173770 | 3300053177 | Bacteria | 1163 |
| 756 | Ga0500645_002942 | 3300053730 | Bacteria | 7241 |
| 757 | Ga0500587_012117 | 3300053739 | Bacteria | 1087 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042115 | Ga0450911_000507 | Ga0450911_000507_6562_7206 | 175 |
| 2 | 3300005614 | Ga0068856_100247911 | Ga0068856_1002479112 | 177 |
| 3 | 3300006178 | Ga0075367_10142236 | Ga0075367_101422363 | 178 |
| 4 | 3300028794 | Ga0307515_10175282 | Ga0307515_101752823 | 181 |
| 5 | 3300031456 | Ga0307513_10017125 | Ga0307513_100171257 | 181 |
| 6 | 3300031995 | Ga0307409_100383629 | Ga0307409_1003836292 | 181 |
| 7 | 3300041512 | Ga0451853_1931705 | Ga0451853_1931705_133_768 | 181 |
| 8 | 3300014326 | Ga0157380_10744582 | Ga0157380_107445822 | 182 |
| 9 | 3300044712 | Ga0453684_0286196 | Ga0453684_0286196_713_1321 | 182 |
| 10 | 3300005844 | Ga0068862_100441293 | Ga0068862_1004412932 | 183 |
| 11 | 3300006195 | Ga0075366_10000910 | Ga0075366_100009106 | 183 |
| 12 | 3300025931 | Ga0207644_10139116 | Ga0207644_101391163 | 183 |
| 13 | 3300028380 | Ga0268265_10302459 | Ga0268265_103024591 | 183 |
| 14 | 3300050493 | nmdc:mga0k408_302_c1 | nmdc:mga0k408_302_c1_7964_8596 | 183 |
| 15 | 3300037418 | Ga0395900_0646875 | Ga0395900_0646875_147_752 | 184 |
| 16 | 3300042876 | Ga0451577_0155936 | Ga0451577_0155936_113_730 | 184 |
| 17 | 3300044673 | Ga0453683_0459440 | Ga0453683_0459440_175_792 | 184 |
| 18 | 3300044712 | Ga0453684_0412870 | Ga0453684_0412870_489_1106 | 184 |
| 19 | 3300045051 | Ga0451576_0004667 | Ga0451576_0004667_6307_6924 | 184 |
| 20 | 3300028794 | Ga0307515_10299171 | Ga0307515_102991712 | 185 |
| 21 | 3300005327 | Ga0070658_10386475 | Ga0070658_103864752 | 186 |
| 22 | 3300006353 | Ga0075370_10000354 | Ga0075370_100003549 | 186 |
| 23 | 3300009098 | Ga0105245_10308565 | Ga0105245_103085653 | 186 |
| 24 | 3300009177 | Ga0105248_10956328 | Ga0105248_109563282 | 186 |
| 25 | 3300015261 | Ga0182006_1108030 | Ga0182006_11080302 | 186 |
| 26 | 3300025923 | Ga0207681_10018156 | Ga0207681_100181564 | 186 |
| 27 | 3300025932 | Ga0207690_10241351 | Ga0207690_102413513 | 186 |
| 28 | 3300028794 | Ga0307515_10017116 | Ga0307515_100171168 | 186 |
| 29 | 3300031344 | Ga0265316_10487021 | Ga0265316_104870211 | 186 |
| 30 | 3300031730 | Ga0307516_10000303 | Ga0307516_1000030343 | 186 |
| 31 | 3300048913 | Ga0496110_0072750 | Ga0496110_0072750_763_1398 | 186 |
| 32 | 3300048925 | Ga0496122_0000612 | Ga0496122_0000612_49117_49776 | 186 |
| 33 | 3300048926 | Ga0496123_0000274 | Ga0496123_0000274_52020_52679 | 186 |
| 34 | 3300048927 | Ga0496124_0109171 | Ga0496124_0109171_644_1303 | 186 |
| 35 | 3300050493 | nmdc:mga0k408_57744_c1 | nmdc:mga0k408_57744_c1_41_670 | 186 |
| 36 | 3300050496 | nmdc:mga07m45_5925_c1 | nmdc:mga07m45_5925_c1_3781_4410 | 186 |
| 37 | 3300006881 | Ga0068865_101203528 | Ga0068865_1012035281 | 187 |
| 38 | 3300009093 | Ga0105240_10750669 | Ga0105240_107506692 | 187 |
| 39 | 3300025303 | Ga0209051_1041082 | Ga0209051_10410821 | 187 |
| 40 | 3300026023 | Ga0207677_10809071 | Ga0207677_108090712 | 187 |
| 41 | 3300026089 | Ga0207648_10441379 | Ga0207648_104413793 | 187 |
| 42 | 3300028379 | Ga0268266_10219514 | Ga0268266_102195142 | 187 |
| 43 | 3300031235 | Ga0265330_10003025 | Ga0265330_1000302510 | 187 |
| 44 | 3300031238 | Ga0265332_10030405 | Ga0265332_100304053 | 187 |
| 45 | 3300031239 | Ga0265328_10111836 | Ga0265328_101118362 | 187 |
| 46 | 3300031242 | Ga0265329_10132407 | Ga0265329_101324072 | 187 |
| 47 | 3300031250 | Ga0265331_10008795 | Ga0265331_100087956 | 187 |
| 48 | 3300031649 | Ga0307514_10001392 | Ga0307514_100013928 | 187 |
| 49 | 3300031711 | Ga0265314_10017068 | Ga0265314_100170682 | 187 |
| 50 | 3300031712 | Ga0265342_10049206 | Ga0265342_100492062 | 187 |
| 51 | 3300041460 | Ga0451802_0227373 | Ga0451802_0227373_86_730 | 187 |
| 52 | 3300042876 | Ga0451577_0004735 | Ga0451577_0004735_7247_7903 | 187 |
| 53 | 3300044712 | Ga0453684_0314661 | Ga0453684_0314661_833_1441 | 187 |
| 54 | 3300046528 | Ga0495642_0065027 | Ga0495642_0065027_371_1018 | 187 |
| 55 | 3300046558 | Ga0495633_0156073 | Ga0495633_0156073_201_848 | 187 |
| 56 | 3300046615 | Ga0495656_0003963 | Ga0495656_0003963_712_1359 | 187 |
| 57 | 3300046665 | Ga0495661_0369699 | Ga0495661_0369699_32_679 | 187 |
| 58 | 3300046684 | Ga0495669_0026101 | Ga0495669_0026101_1027_1674 | 187 |
| 59 | 3300047318 | Ga0495636_0110523 | Ga0495636_0110523_260_907 | 187 |
| 60 | 3300047445 | Ga0495677_0017847 | Ga0495677_0017847_1634_2281 | 187 |
| 61 | 3300047447 | Ga0495685_050054 | Ga0495685_050054_643_1290 | 187 |
| 62 | 3300050490 | nmdc:mga03n38_539126_c1 | nmdc:mga03n38_539126_c1_13_630 | 187 |
| 63 | 3300050492 | nmdc:mga0yw44_690162_c1 | nmdc:mga0yw44_690162_c1_61_678 | 187 |
| 64 | 3300003323 | rootH1_10022168 | rootH1_100221682 | 188 |
| 65 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004180 | 188 |
| 66 | 3300005539 | Ga0068853_100018149 | Ga0068853_1000181492 | 188 |
| 67 | 3300005616 | Ga0068852_100076990 | Ga0068852_1000769903 | 188 |
| 68 | 3300009093 | Ga0105240_10002152 | Ga0105240_100021523 | 188 |
| 69 | 3300009545 | Ga0105237_10003209 | Ga0105237_1000320915 | 188 |
| 70 | 3300009551 | Ga0105238_10009054 | Ga0105238_100090545 | 188 |
| 71 | 3300010375 | Ga0105239_10001461 | Ga0105239_1000146123 | 188 |
| 72 | 3300014325 | Ga0163163_10527962 | Ga0163163_105279622 | 188 |
| 73 | 3300025226 | Ga0209674_109982 | Ga0209674_1099821 | 188 |
| 74 | 3300025230 | Ga0209563_100013 | Ga0209563_100013180 | 188 |
| 75 | 3300025913 | Ga0207695_10107276 | Ga0207695_101072763 | 188 |
| 76 | 3300025914 | Ga0207671_10010388 | Ga0207671_100103887 | 188 |
| 77 | 3300025924 | Ga0207694_10171384 | Ga0207694_101713842 | 188 |
| 78 | 3300026041 | Ga0207639_10064583 | Ga0207639_100645832 | 188 |
| 79 | 3300026142 | Ga0207698_10046575 | Ga0207698_100465753 | 188 |
| 80 | 3300027252 | Ga0209973_1002610 | Ga0209973_10026102 | 188 |
| 81 | 3300027876 | Ga0209974_10001641 | Ga0209974_100016415 | 188 |
| 82 | 3300049578 | Ga0501042_0775042 | Ga0501042_0775042_39_665 | 188 |
| 83 | 3300053154 | Ga0500619_000006 | Ga0500619_000006_11743_12363 | 188 |
| 84 | iso_pu_bacteria | 2881101125 | 2881103397 | 188 |
| 85 | 3300003316 | rootH1_10004194 | rootH1_100041943 | 189 |
| 86 | 3300003322 | rootL2_10098807 | rootL2_100988073 | 189 |
| 87 | 3300005331 | Ga0070670_100026210 | Ga0070670_1000262103 | 189 |
| 88 | 3300005331 | Ga0070670_100201654 | Ga0070670_1002016542 | 189 |
| 89 | 3300005344 | Ga0070661_100504569 | Ga0070661_1005045691 | 189 |
| 90 | 3300005354 | Ga0070675_100231294 | Ga0070675_1002312942 | 189 |
| 91 | 3300005355 | Ga0070671_100008407 | Ga0070671_1000084075 | 189 |
| 92 | 3300005356 | Ga0070674_100028306 | Ga0070674_1000283061 | 189 |
| 93 | 3300005356 | Ga0070674_100319315 | Ga0070674_1003193152 | 189 |
| 94 | 3300005364 | Ga0070673_101018487 | Ga0070673_1010184871 | 189 |
| 95 | 3300005456 | Ga0070678_100079865 | Ga0070678_1000798654 | 189 |
| 96 | 3300006237 | Ga0097621_100009144 | Ga0097621_1000091446 | 189 |
| 97 | 3300006358 | Ga0068871_100008132 | Ga0068871_1000081327 | 189 |
| 98 | 3300006881 | Ga0068865_100112571 | Ga0068865_1001125712 | 189 |
| 99 | 3300009147 | Ga0114129_10080001 | Ga0114129_100800013 | 189 |
| 100 | 3300009148 | Ga0105243_10079876 | Ga0105243_100798762 | 189 |
| 101 | 3300009177 | Ga0105248_10018942 | Ga0105248_100189424 | 189 |
| 102 | 3300013296 | Ga0157374_10064219 | Ga0157374_100642194 | 189 |
| 103 | 3300013308 | Ga0157375_10005174 | Ga0157375_100051747 | 189 |
| 104 | 3300014325 | Ga0163163_10170197 | Ga0163163_101701973 | 189 |
| 105 | 3300017792 | Ga0163161_10102709 | Ga0163161_101027092 | 189 |
| 106 | 3300021361 | Ga0213872_10000067 | Ga0213872_1000006750 | 189 |
| 107 | 3300025925 | Ga0207650_10132661 | Ga0207650_101326614 | 189 |
| 108 | 3300025925 | Ga0207650_10150940 | Ga0207650_101509402 | 189 |
| 109 | 3300025931 | Ga0207644_10001757 | Ga0207644_100017577 | 189 |
| 110 | 3300025933 | Ga0207706_10205697 | Ga0207706_102056973 | 189 |
| 111 | 3300025935 | Ga0207709_10035063 | Ga0207709_100350632 | 189 |
| 112 | 3300025937 | Ga0207669_10045476 | Ga0207669_100454764 | 189 |
| 113 | 3300025941 | Ga0207711_10008794 | Ga0207711_100087947 | 189 |
| 114 | 3300025941 | Ga0207711_10126427 | Ga0207711_101264273 | 189 |
| 115 | 3300026088 | Ga0207641_10059586 | Ga0207641_100595864 | 189 |
| 116 | 3300026095 | Ga0207676_10045595 | Ga0207676_100455953 | 189 |
| 117 | 3300026121 | Ga0207683_10059454 | Ga0207683_100594545 | 189 |
| 118 | 3300031548 | Ga0307408_100000023 | Ga0307408_100000023216 | 189 |
| 119 | 3300037418 | Ga0395900_0245950 | Ga0395900_0245950_635_1285 | 189 |
| 120 | 3300037471 | Ga0395905_0000027 | Ga0395905_0000027_119247_119909 | 189 |
| 121 | 3300037471 | Ga0395905_0014823 | Ga0395905_0014823_425_1042 | 189 |
| 122 | 3300037471 | Ga0395905_0074018 | Ga0395905_0074018_215_865 | 189 |
| 123 | 3300037471 | Ga0395905_0417523 | Ga0395905_0417523_116_763 | 189 |
| 124 | 3300038443 | Ga0395901_0164028 | Ga0395901_0164028_1264_1914 | 189 |
| 125 | 3300039447 | Ga0436361_0750298 | Ga0436361_0750298_10078_10704 | 189 |
| 126 | 3300044683 | Ga0466965_0295094 | Ga0466965_0295094_216_836 | 189 |
| 127 | 3300046539 | Ga0495621_0112088 | Ga0495621_0112088_392_1018 | 189 |
| 128 | 3300050507 | nmdc:mga05p37_291899_c1 | nmdc:mga05p37_291899_c1_834_1466 | 189 |
| 129 | 3300003323 | rootH1_10008114 | rootH1_1000811413 | 190 |
| 130 | 3300005327 | Ga0070658_10016712 | Ga0070658_100167126 | 190 |
| 131 | 3300005328 | Ga0070676_10157798 | Ga0070676_101577982 | 190 |
| 132 | 3300005329 | Ga0070683_100016923 | Ga0070683_1000169237 | 190 |
| 133 | 3300005329 | Ga0070683_100377504 | Ga0070683_1003775042 | 190 |
| 134 | 3300005330 | Ga0070690_100647468 | Ga0070690_1006474682 | 190 |
| 135 | 3300005334 | Ga0068869_100003488 | Ga0068869_1000034887 | 190 |
| 136 | 3300005338 | Ga0068868_100003534 | Ga0068868_1000035346 | 190 |
| 137 | 3300005344 | Ga0070661_100084282 | Ga0070661_1000842824 | 190 |
| 138 | 3300005344 | Ga0070661_100108494 | Ga0070661_1001084943 | 190 |
| 139 | 3300005347 | Ga0070668_100082979 | Ga0070668_1000829794 | 190 |
| 140 | 3300005353 | Ga0070669_100044294 | Ga0070669_1000442942 | 190 |
| 141 | 3300005354 | Ga0070675_100010402 | Ga0070675_1000104026 | 190 |
| 142 | 3300005355 | Ga0070671_100181160 | Ga0070671_1001811602 | 190 |
| 143 | 3300005366 | Ga0070659_100011449 | Ga0070659_1000114498 | 190 |
| 144 | 3300005366 | Ga0070659_100178140 | Ga0070659_1001781403 | 190 |
| 145 | 3300005367 | Ga0070667_100673472 | Ga0070667_1006734722 | 190 |
| 146 | 3300005444 | Ga0070694_100492507 | Ga0070694_1004925071 | 190 |
| 147 | 3300005456 | Ga0070678_100161592 | Ga0070678_1001615922 | 190 |
| 148 | 3300005457 | Ga0070662_100005695 | Ga0070662_1000056956 | 190 |
| 149 | 3300005457 | Ga0070662_100317970 | Ga0070662_1003179702 | 190 |
| 150 | 3300005459 | Ga0068867_100000039 | Ga0068867_10000003956 | 190 |
| 151 | 3300005459 | Ga0068867_100071487 | Ga0068867_1000714873 | 190 |
| 152 | 3300005467 | Ga0070706_100032108 | Ga0070706_1000321083 | 190 |
| 153 | 3300005535 | Ga0070684_100005261 | Ga0070684_1000052616 | 190 |
| 154 | 3300005535 | Ga0070684_100296305 | Ga0070684_1002963052 | 190 |
| 155 | 3300005539 | Ga0068853_100006811 | Ga0068853_1000068116 | 190 |
| 156 | 3300005539 | Ga0068853_100016160 | Ga0068853_1000161602 | 190 |
| 157 | 3300005539 | Ga0068853_100631394 | Ga0068853_1006313941 | 190 |
| 158 | 3300005547 | Ga0070693_100041764 | Ga0070693_1000417644 | 190 |
| 159 | 3300005547 | Ga0070693_100044620 | Ga0070693_1000446202 | 190 |
| 160 | 3300005548 | Ga0070665_100007443 | Ga0070665_1000074436 | 190 |
| 161 | 3300005548 | Ga0070665_100104794 | Ga0070665_1001047943 | 190 |
| 162 | 3300005563 | Ga0068855_100018761 | Ga0068855_1000187616 | 190 |
| 163 | 3300005564 | Ga0070664_100015313 | Ga0070664_1000153134 | 190 |
| 164 | 3300005564 | Ga0070664_100031340 | Ga0070664_1000313406 | 190 |
| 165 | 3300005577 | Ga0068857_100010507 | Ga0068857_1000105076 | 190 |
| 166 | 3300005577 | Ga0068857_101003583 | Ga0068857_1010035831 | 190 |
| 167 | 3300005578 | Ga0068854_100093842 | Ga0068854_1000938423 | 190 |
| 168 | 3300005578 | Ga0068854_100137085 | Ga0068854_1001370852 | 190 |
| 169 | 3300005614 | Ga0068856_100013192 | Ga0068856_1000131926 | 190 |
| 170 | 3300005614 | Ga0068856_100074496 | Ga0068856_1000744963 | 190 |
| 171 | 3300005615 | Ga0070702_100479630 | Ga0070702_1004796302 | 190 |
| 172 | 3300005616 | Ga0068852_100009092 | Ga0068852_1000090924 | 190 |
| 173 | 3300005616 | Ga0068852_100013380 | Ga0068852_1000133804 | 190 |
| 174 | 3300005616 | Ga0068852_100066202 | Ga0068852_1000662023 | 190 |
| 175 | 3300005616 | Ga0068852_100114694 | Ga0068852_1001146943 | 190 |
| 176 | 3300005617 | Ga0068859_100175354 | Ga0068859_1001753542 | 190 |
| 177 | 3300005618 | Ga0068864_100003169 | Ga0068864_10000316914 | 190 |
| 178 | 3300005618 | Ga0068864_100009398 | Ga0068864_1000093986 | 190 |
| 179 | 3300005719 | Ga0068861_100005459 | Ga0068861_1000054596 | 190 |
| 180 | 3300005719 | Ga0068861_100145774 | Ga0068861_1001457743 | 190 |
| 181 | 3300005834 | Ga0068851_10036705 | Ga0068851_100367055 | 190 |
| 182 | 3300005841 | Ga0068863_100297048 | Ga0068863_1002970482 | 190 |
| 183 | 3300005841 | Ga0068863_100704941 | Ga0068863_1007049412 | 190 |
| 184 | 3300005842 | Ga0068858_100010630 | Ga0068858_1000106307 | 190 |
| 185 | 3300005843 | Ga0068860_100090075 | Ga0068860_1000900754 | 190 |
| 186 | 3300005843 | Ga0068860_100182469 | Ga0068860_1001824693 | 190 |
| 187 | 3300005844 | Ga0068862_100042040 | Ga0068862_1000420404 | 190 |
| 188 | 3300005844 | Ga0068862_100086453 | Ga0068862_1000864533 | 190 |
| 189 | 3300006173 | Ga0070716_100136193 | Ga0070716_1001361933 | 190 |
| 190 | 3300006195 | Ga0075366_10003844 | Ga0075366_100038447 | 190 |
| 191 | 3300006195 | Ga0075366_10100776 | Ga0075366_101007762 | 190 |
| 192 | 3300006237 | Ga0097621_100127529 | Ga0097621_1001275294 | 190 |
| 193 | 3300006353 | Ga0075370_10038737 | Ga0075370_100387372 | 190 |
| 194 | 3300006358 | Ga0068871_100016972 | Ga0068871_1000169726 | 190 |
| 195 | 3300006881 | Ga0068865_100080474 | Ga0068865_1000804742 | 190 |
| 196 | 3300006931 | Ga0097620_100175351 | Ga0097620_1001753514 | 190 |
| 197 | 3300007076 | Ga0075435_100811210 | Ga0075435_1008112101 | 190 |
| 198 | 3300009094 | Ga0111539_10668624 | Ga0111539_106686241 | 190 |
| 199 | 3300009094 | Ga0111539_11322043 | Ga0111539_113220432 | 190 |
| 200 | 3300009148 | Ga0105243_10004160 | Ga0105243_100041607 | 190 |
| 201 | 3300009174 | Ga0105241_10050051 | Ga0105241_100500514 | 190 |
| 202 | 3300009177 | Ga0105248_10011079 | Ga0105248_100110797 | 190 |
| 203 | 3300009177 | Ga0105248_10074691 | Ga0105248_100746914 | 190 |
| 204 | 3300009177 | Ga0105248_10451657 | Ga0105248_104516572 | 190 |
| 205 | 3300009545 | Ga0105237_10035404 | Ga0105237_100354044 | 190 |
| 206 | 3300009551 | Ga0105238_10016299 | Ga0105238_100162992 | 190 |
| 207 | 3300009551 | Ga0105238_10152230 | Ga0105238_101522304 | 190 |
| 208 | 3300009553 | Ga0105249_10148826 | Ga0105249_101488261 | 190 |
| 209 | 3300010375 | Ga0105239_10305478 | Ga0105239_103054782 | 190 |
| 210 | 3300011119 | Ga0105246_10061627 | Ga0105246_100616272 | 190 |
| 211 | 3300011119 | Ga0105246_10983222 | Ga0105246_109832221 | 190 |
| 212 | 3300013100 | Ga0157373_10053653 | Ga0157373_100536532 | 190 |
| 213 | 3300013102 | Ga0157371_10196215 | Ga0157371_101962152 | 190 |
| 214 | 3300013105 | Ga0157369_10058720 | Ga0157369_100587204 | 190 |
| 215 | 3300013105 | Ga0157369_10182335 | Ga0157369_101823353 | 190 |
| 216 | 3300013296 | Ga0157374_10031054 | Ga0157374_100310544 | 190 |
| 217 | 3300013296 | Ga0157374_10052887 | Ga0157374_100528874 | 190 |
| 218 | 3300013306 | Ga0163162_10047853 | Ga0163162_100478536 | 190 |
| 219 | 3300013307 | Ga0157372_10013740 | Ga0157372_100137404 | 190 |
| 220 | 3300013307 | Ga0157372_10163891 | Ga0157372_101638914 | 190 |
| 221 | 3300013308 | Ga0157375_10043978 | Ga0157375_100439786 | 190 |
| 222 | 3300014745 | Ga0157377_10000044 | Ga0157377_1000004418 | 190 |
| 223 | 3300014745 | Ga0157377_10001565 | Ga0157377_100015657 | 190 |
| 224 | 3300014968 | Ga0157379_10010130 | Ga0157379_100101307 | 190 |
| 225 | 3300014968 | Ga0157379_10020334 | Ga0157379_100203346 | 190 |
| 226 | 3300014968 | Ga0157379_10026436 | Ga0157379_100264366 | 190 |
| 227 | 3300014969 | Ga0157376_10003307 | Ga0157376_100033077 | 190 |
| 228 | 3300017792 | Ga0163161_10006298 | Ga0163161_100062987 | 190 |
| 229 | 3300017792 | Ga0163161_10376810 | Ga0163161_103768102 | 190 |
| 230 | 3300017792 | Ga0163161_10539629 | Ga0163161_105396292 | 190 |
| 231 | 3300025315 | Ga0207697_10027011 | Ga0207697_100270111 | 190 |
| 232 | 3300025321 | Ga0207656_10086056 | Ga0207656_100860562 | 190 |
| 233 | 3300025321 | Ga0207656_10244438 | Ga0207656_102444381 | 190 |
| 234 | 3300025903 | Ga0207680_10058549 | Ga0207680_100585491 | 190 |
| 235 | 3300025907 | Ga0207645_10192813 | Ga0207645_101928132 | 190 |
| 236 | 3300025908 | Ga0207643_10131827 | Ga0207643_101318272 | 190 |
| 237 | 3300025909 | Ga0207705_10033024 | Ga0207705_100330244 | 190 |
| 238 | 3300025910 | Ga0207684_10132563 | Ga0207684_101325632 | 190 |
| 239 | 3300025911 | Ga0207654_10052847 | Ga0207654_100528473 | 190 |
| 240 | 3300025914 | Ga0207671_10048096 | Ga0207671_100480964 | 190 |
| 241 | 3300025918 | Ga0207662_10181995 | Ga0207662_101819953 | 190 |
| 242 | 3300025919 | Ga0207657_10057700 | Ga0207657_100577002 | 190 |
| 243 | 3300025919 | Ga0207657_10094391 | Ga0207657_100943914 | 190 |
| 244 | 3300025920 | Ga0207649_10081985 | Ga0207649_100819852 | 190 |
| 245 | 3300025920 | Ga0207649_10167067 | Ga0207649_101670673 | 190 |
| 246 | 3300025923 | Ga0207681_10025216 | Ga0207681_100252165 | 190 |
| 247 | 3300025924 | Ga0207694_10145491 | Ga0207694_101454912 | 190 |
| 248 | 3300025926 | Ga0207659_10011834 | Ga0207659_100118346 | 190 |
| 249 | 3300025932 | Ga0207690_10042222 | Ga0207690_100422222 | 190 |
| 250 | 3300025932 | Ga0207690_10332564 | Ga0207690_103325642 | 190 |
| 251 | 3300025932 | Ga0207690_10462444 | Ga0207690_104624442 | 190 |
| 252 | 3300025933 | Ga0207706_10019872 | Ga0207706_100198722 | 190 |
| 253 | 3300025935 | Ga0207709_10001856 | Ga0207709_100018564 | 190 |
| 254 | 3300025935 | Ga0207709_10083040 | Ga0207709_100830402 | 190 |
| 255 | 3300025939 | Ga0207665_10025637 | Ga0207665_100256374 | 190 |
| 256 | 3300025940 | Ga0207691_10109769 | Ga0207691_101097693 | 190 |
| 257 | 3300025941 | Ga0207711_10004582 | Ga0207711_100045827 | 190 |
| 258 | 3300025941 | Ga0207711_10048247 | Ga0207711_100482473 | 190 |
| 259 | 3300025942 | Ga0207689_10003664 | Ga0207689_100036648 | 190 |
| 260 | 3300025944 | Ga0207661_10037727 | Ga0207661_100377274 | 190 |
| 261 | 3300025944 | Ga0207661_10466442 | Ga0207661_104664421 | 190 |
| 262 | 3300025945 | Ga0207679_10008387 | Ga0207679_100083874 | 190 |
| 263 | 3300025945 | Ga0207679_10030713 | Ga0207679_100307135 | 190 |
| 264 | 3300025945 | Ga0207679_10333958 | Ga0207679_103339581 | 190 |
| 265 | 3300025949 | Ga0207667_10251901 | Ga0207667_102519012 | 190 |
| 266 | 3300025972 | Ga0207668_10033710 | Ga0207668_100337105 | 190 |
| 267 | 3300025972 | Ga0207668_10188473 | Ga0207668_101884733 | 190 |
| 268 | 3300025981 | Ga0207640_10049149 | Ga0207640_100491493 | 190 |
| 269 | 3300025981 | Ga0207640_10447656 | Ga0207640_104476561 | 190 |
| 270 | 3300026023 | Ga0207677_10028700 | Ga0207677_100287005 | 190 |
| 271 | 3300026035 | Ga0207703_10018898 | Ga0207703_100188982 | 190 |
| 272 | 3300026035 | Ga0207703_10373875 | Ga0207703_103738753 | 190 |
| 273 | 3300026041 | Ga0207639_10040103 | Ga0207639_100401032 | 190 |
| 274 | 3300026041 | Ga0207639_10117864 | Ga0207639_101178643 | 190 |
| 275 | 3300026041 | Ga0207639_10494890 | Ga0207639_104948903 | 190 |
| 276 | 3300026041 | Ga0207639_11044310 | Ga0207639_110443101 | 190 |
| 277 | 3300026067 | Ga0207678_10040687 | Ga0207678_100406873 | 190 |
| 278 | 3300026067 | Ga0207678_10082065 | Ga0207678_100820653 | 190 |
| 279 | 3300026078 | Ga0207702_10099445 | Ga0207702_100994452 | 190 |
| 280 | 3300026078 | Ga0207702_10386077 | Ga0207702_103860771 | 190 |
| 281 | 3300026088 | Ga0207641_10019205 | Ga0207641_100192057 | 190 |
| 282 | 3300026088 | Ga0207641_10021621 | Ga0207641_100216214 | 190 |
| 283 | 3300026089 | Ga0207648_10000109 | Ga0207648_1000010956 | 190 |
| 284 | 3300026095 | Ga0207676_10011582 | Ga0207676_100115824 | 190 |
| 285 | 3300026116 | Ga0207674_10557935 | Ga0207674_105579352 | 190 |
| 286 | 3300026118 | Ga0207675_100023191 | Ga0207675_1000231917 | 190 |
| 287 | 3300026118 | Ga0207675_100161335 | Ga0207675_1001613353 | 190 |
| 288 | 3300026121 | Ga0207683_10080603 | Ga0207683_100806034 | 190 |
| 289 | 3300026142 | Ga0207698_10016587 | Ga0207698_100165875 | 190 |
| 290 | 3300026142 | Ga0207698_10044118 | Ga0207698_100441183 | 190 |
| 291 | 3300026142 | Ga0207698_10711409 | Ga0207698_107114091 | 190 |
| 292 | 3300028379 | Ga0268266_10060195 | Ga0268266_100601955 | 190 |
| 293 | 3300028380 | Ga0268265_10392985 | Ga0268265_103929853 | 190 |
| 294 | 3300028381 | Ga0268264_10003375 | Ga0268264_100033757 | 190 |
| 295 | 3300028794 | Ga0307515_10010956 | Ga0307515_100109565 | 190 |
| 296 | 3300031730 | Ga0307516_10339784 | Ga0307516_103397842 | 190 |
| 297 | 3300032005 | Ga0307411_10018187 | Ga0307411_100181873 | 190 |
| 298 | 3300034816 | Ga0373930_0026541 | Ga0373930_0026541_381_1010 | 190 |
| 299 | 3300035090 | Ga0373949_0089859 | Ga0373949_0089859_156_785 | 190 |
| 300 | 3300035092 | Ga0373952_0012226 | Ga0373952_0012226_646_1275 | 190 |
| 301 | 3300035170 | Ga0373943_0109578 | Ga0373943_0109578_566_1198 | 190 |
| 302 | 3300035170 | Ga0373943_0416011 | Ga0373943_0416011_24_656 | 190 |
| 303 | 3300035171 | Ga0373946_0011338 | Ga0373946_0011338_2684_3310 | 190 |
| 304 | 3300035171 | Ga0373946_0068600 | Ga0373946_0068600_594_1226 | 190 |
| 305 | 3300035172 | Ga0373955_0065797 | Ga0373955_0065797_270_896 | 190 |
| 306 | 3300035691 | Ga0373931_0002695 | Ga0373931_0002695_3581_4210 | 190 |
| 307 | 3300035695 | Ga0373927_0265998 | Ga0373927_0265998_457_1089 | 190 |
| 308 | 3300035724 | Ga0373933_0097619 | Ga0373933_0097619_1140_1772 | 190 |
| 309 | 3300035725 | Ga0373947_0230131 | Ga0373947_0230131_499_1131 | 190 |
| 310 | 3300036401 | Ga0373937_0171306 | Ga0373937_0171306_367_993 | 190 |
| 311 | 3300036401 | Ga0373937_0622301 | Ga0373937_0622301_99_731 | 190 |
| 312 | 3300037068 | Ga0373925_0050008 | Ga0373925_0050008_1898_2524 | 190 |
| 313 | 3300037068 | Ga0373925_0263414 | Ga0373925_0263414_358_984 | 190 |
| 314 | 3300039437 | Ga0436365_0757688 | Ga0436365_0757688_535_1164 | 190 |
| 315 | 3300041512 | Ga0451853_1375847 | Ga0451853_1375847_66_698 | 190 |
| 316 | 3300042000 | Ga0439437_000095 | Ga0439437_000095_422_1060 | 190 |
| 317 | 3300042012 | Ga0439455_0003524 | Ga0439455_0003524_1052_1690 | 190 |
| 318 | 3300042126 | Ga0450888_000691 | Ga0450888_000691_2135_2773 | 190 |
| 319 | 3300042129 | Ga0450891_000206 | Ga0450891_000206_3535_4173 | 190 |
| 320 | 3300042533 | Ga0450901_004084 | Ga0450901_004084_206_844 | 190 |
| 321 | 3300042876 | Ga0451577_0404222 | Ga0451577_0404222_321_947 | 190 |
| 322 | 3300044706 | Ga0466964_0218482 | Ga0466964_0218482_260_889 | 190 |
| 323 | 3300044712 | Ga0453684_0134244 | Ga0453684_0134244_343_981 | 190 |
| 324 | 3300045051 | Ga0451576_0005708 | Ga0451576_0005708_11353_12000 | 190 |
| 325 | 3300045051 | Ga0451576_0212037 | Ga0451576_0212037_124_753 | 190 |
| 326 | 3300045051 | Ga0451576_0315333 | Ga0451576_0315333_159_779 | 190 |
| 327 | 3300046516 | Ga0495628_0238440 | Ga0495628_0238440_124_756 | 190 |
| 328 | 3300046542 | Ga0495597_0198210 | Ga0495597_0198210_111_731 | 190 |
| 329 | 3300046681 | Ga0495647_0073605 | Ga0495647_0073605_684_1310 | 190 |
| 330 | 3300046683 | Ga0495658_0052347 | Ga0495658_0052347_1296_1928 | 190 |
| 331 | 3300046683 | Ga0495658_0154088 | Ga0495658_0154088_30_659 | 190 |
| 332 | 3300046683 | Ga0495658_0433225 | Ga0495658_0433225_170_796 | 190 |
| 333 | 3300046684 | Ga0495669_0210553 | Ga0495669_0210553_204_836 | 190 |
| 334 | 3300046691 | Ga0495670_0272753 | Ga0495670_0272753_198_827 | 190 |
| 335 | 3300047444 | Ga0495675_0308281 | Ga0495675_0308281_24_650 | 190 |
| 336 | 3300048903 | Ga0496100_0004969 | Ga0496100_0004969_3395_4024 | 190 |
| 337 | 3300048904 | Ga0496101_0020005 | Ga0496101_0020005_3226_3855 | 190 |
| 338 | 3300048905 | Ga0496102_0050949 | Ga0496102_0050949_2620_3249 | 190 |
| 339 | 3300048907 | Ga0496104_0207849 | Ga0496104_0207849_1035_1664 | 190 |
| 340 | 3300048907 | Ga0496104_0382744 | Ga0496104_0382744_270_902 | 190 |
| 341 | 3300048908 | Ga0496105_0152969 | Ga0496105_0152969_717_1346 | 190 |
| 342 | 3300048908 | Ga0496105_0343379 | Ga0496105_0343379_101_736 | 190 |
| 343 | 3300048910 | Ga0496107_0003649 | Ga0496107_0003649_3982_4611 | 190 |
| 344 | 3300048911 | Ga0496108_0163203 | Ga0496108_0163203_626_1258 | 190 |
| 345 | 3300048911 | Ga0496108_0256556 | Ga0496108_0256556_94_723 | 190 |
| 346 | 3300048917 | Ga0496114_0168105 | Ga0496114_0168105_528_1163 | 190 |
| 347 | 3300048917 | Ga0496114_0266760 | Ga0496114_0266760_321_950 | 190 |
| 348 | 3300048918 | Ga0496115_0160232 | Ga0496115_0160232_478_1107 | 190 |
| 349 | 3300049127 | Ga0501306_027319 | Ga0501306_027319_150_788 | 190 |
| 350 | 3300049129 | Ga0501309_000235 | Ga0501309_000235_1282_1920 | 190 |
| 351 | 3300049130 | Ga0501310_000547 | Ga0501310_000547_1456_2094 | 190 |
| 352 | 3300049160 | Ga0501304_005516 | Ga0501304_005516_242_880 | 190 |
| 353 | 3300049162 | Ga0501307_007500 | Ga0501307_007500_204_842 | 190 |
| 354 | 3300049517 | Ga0501294_004193 | Ga0501294_004193_178_816 | 190 |
| 355 | 3300049523 | Ga0501300_023207 | Ga0501300_023207_230_868 | 190 |
| 356 | 3300049524 | Ga0501301_003010 | Ga0501301_003010_414_1013 | 190 |
| 357 | 3300049527 | Ga0501311_010619 | Ga0501311_010619_241_879 | 190 |
| 358 | 3300049528 | Ga0501312_018143 | Ga0501312_018143_231_869 | 190 |
| 359 | 3300049530 | Ga0501314_001724 | Ga0501314_001724_777_1415 | 190 |
| 360 | 3300049531 | Ga0501315_002842 | Ga0501315_002842_728_1366 | 190 |
| 361 | 3300049533 | Ga0501317_023975 | Ga0501317_023975_111_749 | 190 |
| 362 | 3300049534 | Ga0501318_016293 | Ga0501318_016293_42_680 | 190 |
| 363 | 3300049538 | Ga0501322_004543 | Ga0501322_004543_109_747 | 190 |
| 364 | 3300049539 | Ga0501323_010154 | Ga0501323_010154_125_763 | 190 |
| 365 | 3300049649 | Ga0501198_000024 | Ga0501198_000024_37639_38271 | 190 |
| 366 | 3300049650 | Ga0501199_011061 | Ga0501199_011061_34_672 | 190 |
| 367 | 3300049653 | Ga0501206_002409 | Ga0501206_002409_293_892 | 190 |
| 368 | 3300049654 | Ga0501207_053800 | Ga0501207_053800_13_651 | 190 |
| 369 | 3300049658 | Ga0501211_002221 | Ga0501211_002221_1356_1994 | 190 |
| 370 | 3300049662 | Ga0501222_000020 | Ga0501222_000020_28919_29551 | 190 |
| 371 | 3300049662 | Ga0501222_001970 | Ga0501222_001970_1870_2508 | 190 |
| 372 | 3300049665 | Ga0501227_018678 | Ga0501227_018678_440_1078 | 190 |
| 373 | 3300049669 | Ga0501235_004234 | Ga0501235_004234_2102_2740 | 190 |
| 374 | 3300049670 | Ga0501236_016828 | Ga0501236_016828_302_940 | 190 |
| 375 | 3300049682 | Ga0501252_009169 | Ga0501252_009169_396_1034 | 190 |
| 376 | 3300049687 | Ga0501258_000428 | Ga0501258_000428_440_1078 | 190 |
| 377 | 3300049704 | Ga0501221_000262 | Ga0501221_000262_3119_3757 | 190 |
| 378 | 3300049706 | Ga0501229_000047 | Ga0501229_000047_9597_10235 | 190 |
| 379 | 3300049757 | Ga0501232_002169 | Ga0501232_002169_695_1333 | 190 |
| 380 | 3300049759 | Ga0501262_005168 | Ga0501262_005168_468_1106 | 190 |
| 381 | 3300049759 | Ga0501262_009579 | Ga0501262_009579_192_791 | 190 |
| 382 | 3300049764 | Ga0501267_000585 | Ga0501267_000585_363_1001 | 190 |
| 383 | 3300050493 | nmdc:mga0k408_100269_c1 | nmdc:mga0k408_100269_c1_488_1126 | 190 |
| 384 | 3300050493 | nmdc:mga0k408_132241_c1 | nmdc:mga0k408_132241_c1_633_1250 | 190 |
| 385 | 3300050493 | nmdc:mga0k408_830_c1 | nmdc:mga0k408_830_c1_4301_4921 | 190 |
| 386 | 3300050496 | nmdc:mga07m45_23681_c1 | nmdc:mga07m45_23681_c1_1474_2121 | 190 |
| 387 | 3300050512 | nmdc:mga0n895_650250_c1 | nmdc:mga0n895_650250_c1_181_810 | 190 |
| 388 | 3300050513 | nmdc:mga0rr50_727903_c1 | nmdc:mga0rr50_727903_c1_162_791 | 190 |
| 389 | iso_pu_bacteria | 2643221544 | 2643743076 | 190 |
| 390 | iso_pu_bacteria | 2643221585 | 2643932898 | 190 |
| 391 | iso_pu_bacteria | 2643221639 | 2644218507 | 190 |
| 392 | iso_pu_bacteria | 2643221646 | 2644260402 | 190 |
| 393 | iso_pu_bacteria | 2643221656 | 2644314148 | 190 |
| 394 | iso_pu_bacteria | 2738541337 | 2739055937 | 190 |
| 395 | 3300005293 | Ga0065715_10049568 | Ga0065715_100495682 | 191 |
| 396 | 3300005328 | Ga0070676_10010818 | Ga0070676_100108186 | 191 |
| 397 | 3300005328 | Ga0070676_10017134 | Ga0070676_100171343 | 191 |
| 398 | 3300005331 | Ga0070670_100005993 | Ga0070670_1000059937 | 191 |
| 399 | 3300005331 | Ga0070670_100013611 | Ga0070670_1000136113 | 191 |
| 400 | 3300005331 | Ga0070670_100080193 | Ga0070670_1000801934 | 191 |
| 401 | 3300005331 | Ga0070670_100287372 | Ga0070670_1002873722 | 191 |
| 402 | 3300005333 | Ga0070677_10018747 | Ga0070677_100187473 | 191 |
| 403 | 3300005334 | Ga0068869_100003409 | Ga0068869_1000034095 | 191 |
| 404 | 3300005335 | Ga0070666_10055778 | Ga0070666_100557782 | 191 |
| 405 | 3300005336 | Ga0070680_100007060 | Ga0070680_1000070607 | 191 |
| 406 | 3300005338 | Ga0068868_100712822 | Ga0068868_1007128222 | 191 |
| 407 | 3300005339 | Ga0070660_100383928 | Ga0070660_1003839281 | 191 |
| 408 | 3300005343 | Ga0070687_100100759 | Ga0070687_1001007593 | 191 |
| 409 | 3300005344 | Ga0070661_100159403 | Ga0070661_1001594032 | 191 |
| 410 | 3300005347 | Ga0070668_100658652 | Ga0070668_1006586522 | 191 |
| 411 | 3300005353 | Ga0070669_100508065 | Ga0070669_1005080652 | 191 |
| 412 | 3300005354 | Ga0070675_100003929 | Ga0070675_1000039297 | 191 |
| 413 | 3300005354 | Ga0070675_100011240 | Ga0070675_1000112402 | 191 |
| 414 | 3300005354 | Ga0070675_100281933 | Ga0070675_1002819333 | 191 |
| 415 | 3300005355 | Ga0070671_100020098 | Ga0070671_1000200986 | 191 |
| 416 | 3300005364 | Ga0070673_100011725 | Ga0070673_1000117255 | 191 |
| 417 | 3300005364 | Ga0070673_100273123 | Ga0070673_1002731232 | 191 |
| 418 | 3300005366 | Ga0070659_100481927 | Ga0070659_1004819272 | 191 |
| 419 | 3300005367 | Ga0070667_100032917 | Ga0070667_1000329175 | 191 |
| 420 | 3300005367 | Ga0070667_100135496 | Ga0070667_1001354962 | 191 |
| 421 | 3300005367 | Ga0070667_100714862 | Ga0070667_1007148621 | 191 |
| 422 | 3300005441 | Ga0070700_100067380 | Ga0070700_1000673802 | 191 |
| 423 | 3300005455 | Ga0070663_100624401 | Ga0070663_1006244011 | 191 |
| 424 | 3300005456 | Ga0070678_100081202 | Ga0070678_1000812021 | 191 |
| 425 | 3300005456 | Ga0070678_100139871 | Ga0070678_1001398713 | 191 |
| 426 | 3300005457 | Ga0070662_100031932 | Ga0070662_1000319323 | 191 |
| 427 | 3300005457 | Ga0070662_100096975 | Ga0070662_1000969751 | 191 |
| 428 | 3300005458 | Ga0070681_10017630 | Ga0070681_100176303 | 191 |
| 429 | 3300005459 | Ga0068867_100011577 | Ga0068867_1000115776 | 191 |
| 430 | 3300005459 | Ga0068867_100011992 | Ga0068867_1000119924 | 191 |
| 431 | 3300005459 | Ga0068867_100064789 | Ga0068867_1000647893 | 191 |
| 432 | 3300005468 | Ga0070707_100527591 | Ga0070707_1005275912 | 191 |
| 433 | 3300005530 | Ga0070679_100000726 | Ga0070679_10000072626 | 191 |
| 434 | 3300005539 | Ga0068853_100727613 | Ga0068853_1007276132 | 191 |
| 435 | 3300005543 | Ga0070672_100004529 | Ga0070672_1000045297 | 191 |
| 436 | 3300005543 | Ga0070672_100017872 | Ga0070672_1000178726 | 191 |
| 437 | 3300005548 | Ga0070665_100183680 | Ga0070665_1001836802 | 191 |
| 438 | 3300005548 | Ga0070665_100331876 | Ga0070665_1003318762 | 191 |
| 439 | 3300005564 | Ga0070664_100082566 | Ga0070664_1000825662 | 191 |
| 440 | 3300005564 | Ga0070664_100226738 | Ga0070664_1002267383 | 191 |
| 441 | 3300005577 | Ga0068857_100058624 | Ga0068857_1000586244 | 191 |
| 442 | 3300005577 | Ga0068857_100916614 | Ga0068857_1009166141 | 191 |
| 443 | 3300005578 | Ga0068854_100815238 | Ga0068854_1008152382 | 191 |
| 444 | 3300005614 | Ga0068856_100531048 | Ga0068856_1005310483 | 191 |
| 445 | 3300005616 | Ga0068852_100145938 | Ga0068852_1001459384 | 191 |
| 446 | 3300005616 | Ga0068852_100566609 | Ga0068852_1005666092 | 191 |
| 447 | 3300005617 | Ga0068859_100051040 | Ga0068859_1000510402 | 191 |
| 448 | 3300005618 | Ga0068864_100027497 | Ga0068864_1000274976 | 191 |
| 449 | 3300005618 | Ga0068864_100382206 | Ga0068864_1003822061 | 191 |
| 450 | 3300005718 | Ga0068866_10019689 | Ga0068866_100196894 | 191 |
| 451 | 3300005719 | Ga0068861_100013781 | Ga0068861_1000137816 | 191 |
| 452 | 3300005719 | Ga0068861_100448370 | Ga0068861_1004483702 | 191 |
| 453 | 3300005834 | Ga0068851_10095413 | Ga0068851_100954131 | 191 |
| 454 | 3300005834 | Ga0068851_10361589 | Ga0068851_103615891 | 191 |
| 455 | 3300005840 | Ga0068870_10076234 | Ga0068870_100762344 | 191 |
| 456 | 3300005840 | Ga0068870_10107103 | Ga0068870_101071032 | 191 |
| 457 | 3300005840 | Ga0068870_10203098 | Ga0068870_102030982 | 191 |
| 458 | 3300005841 | Ga0068863_100018287 | Ga0068863_1000182876 | 191 |
| 459 | 3300005843 | Ga0068860_100039824 | Ga0068860_1000398242 | 191 |
| 460 | 3300006195 | Ga0075366_10008552 | Ga0075366_100085526 | 191 |
| 461 | 3300006195 | Ga0075366_10016010 | Ga0075366_100160105 | 191 |
| 462 | 3300006195 | Ga0075366_10021753 | Ga0075366_100217534 | 191 |
| 463 | 3300006195 | Ga0075366_10042018 | Ga0075366_100420185 | 191 |
| 464 | 3300006353 | Ga0075370_10007324 | Ga0075370_100073244 | 191 |
| 465 | 3300006353 | Ga0075370_10029066 | Ga0075370_100290663 | 191 |
| 466 | 3300006353 | Ga0075370_10049991 | Ga0075370_100499913 | 191 |
| 467 | 3300006358 | Ga0068871_100021762 | Ga0068871_1000217626 | 191 |
| 468 | 3300006846 | Ga0075430_100024549 | Ga0075430_1000245493 | 191 |
| 469 | 3300006881 | Ga0068865_100041024 | Ga0068865_1000410243 | 191 |
| 470 | 3300006881 | Ga0068865_100408227 | Ga0068865_1004082272 | 191 |
| 471 | 3300006931 | Ga0097620_100051038 | Ga0097620_1000510386 | 191 |
| 472 | 3300009098 | Ga0105245_10371842 | Ga0105245_103718422 | 191 |
| 473 | 3300009147 | Ga0114129_11755964 | Ga0114129_117559641 | 191 |
| 474 | 3300009148 | Ga0105243_10178693 | Ga0105243_101786931 | 191 |
| 475 | 3300009148 | Ga0105243_10429104 | Ga0105243_104291041 | 191 |
| 476 | 3300009176 | Ga0105242_10084716 | Ga0105242_100847164 | 191 |
| 477 | 3300009177 | Ga0105248_10347566 | Ga0105248_103475662 | 191 |
| 478 | 3300009177 | Ga0105248_10415963 | Ga0105248_104159632 | 191 |
| 479 | 3300009553 | Ga0105249_10074684 | Ga0105249_100746844 | 191 |
| 480 | 3300009553 | Ga0105249_11515953 | Ga0105249_115159531 | 191 |
| 481 | 3300011119 | Ga0105246_10097110 | Ga0105246_100971103 | 191 |
| 482 | 3300013102 | Ga0157371_10109439 | Ga0157371_101094394 | 191 |
| 483 | 3300013104 | Ga0157370_10576582 | Ga0157370_105765822 | 191 |
| 484 | 3300013296 | Ga0157374_10344983 | Ga0157374_103449832 | 191 |
| 485 | 3300013297 | Ga0157378_10389624 | Ga0157378_103896242 | 191 |
| 486 | 3300013297 | Ga0157378_10689578 | Ga0157378_106895781 | 191 |
| 487 | 3300013306 | Ga0163162_10262578 | Ga0163162_102625783 | 191 |
| 488 | 3300013306 | Ga0163162_10335040 | Ga0163162_103350402 | 191 |
| 489 | 3300013308 | Ga0157375_10014262 | Ga0157375_100142624 | 191 |
| 490 | 3300013308 | Ga0157375_10018621 | Ga0157375_100186216 | 191 |
| 491 | 3300014325 | Ga0163163_10558172 | Ga0163163_105581722 | 191 |
| 492 | 3300014326 | Ga0157380_10088041 | Ga0157380_100880414 | 191 |
| 493 | 3300014326 | Ga0157380_10173230 | Ga0157380_101732303 | 191 |
| 494 | 3300014745 | Ga0157377_10278963 | Ga0157377_102789632 | 191 |
| 495 | 3300014968 | Ga0157379_10589571 | Ga0157379_105895712 | 191 |
| 496 | 3300014968 | Ga0157379_10697595 | Ga0157379_106975951 | 191 |
| 497 | 3300014969 | Ga0157376_10007305 | Ga0157376_100073057 | 191 |
| 498 | 3300014969 | Ga0157376_10418916 | Ga0157376_104189162 | 191 |
| 499 | 3300014969 | Ga0157376_10625128 | Ga0157376_106251282 | 191 |
| 500 | 3300014969 | Ga0157376_10713108 | Ga0157376_107131081 | 191 |
| 501 | 3300017792 | Ga0163161_10086351 | Ga0163161_100863512 | 191 |
| 502 | 3300025303 | Ga0209051_1016706 | Ga0209051_10167064 | 191 |
| 503 | 3300025304 | Ga0209257_1000033 | Ga0209257_100003315 | 191 |
| 504 | 3300025321 | Ga0207656_10024202 | Ga0207656_100242024 | 191 |
| 505 | 3300025893 | Ga0207682_10050682 | Ga0207682_100506823 | 191 |
| 506 | 3300025899 | Ga0207642_10010828 | Ga0207642_100108284 | 191 |
| 507 | 3300025901 | Ga0207688_10041571 | Ga0207688_100415712 | 191 |
| 508 | 3300025903 | Ga0207680_10123684 | Ga0207680_101236843 | 191 |
| 509 | 3300025907 | Ga0207645_10004979 | Ga0207645_100049796 | 191 |
| 510 | 3300025907 | Ga0207645_10049830 | Ga0207645_100498303 | 191 |
| 511 | 3300025908 | Ga0207643_10042410 | Ga0207643_100424103 | 191 |
| 512 | 3300025908 | Ga0207643_10397455 | Ga0207643_103974552 | 191 |
| 513 | 3300025917 | Ga0207660_10056055 | Ga0207660_100560553 | 191 |
| 514 | 3300025918 | Ga0207662_10006607 | Ga0207662_100066076 | 191 |
| 515 | 3300025920 | Ga0207649_10063732 | Ga0207649_100637323 | 191 |
| 516 | 3300025920 | Ga0207649_10417669 | Ga0207649_104176691 | 191 |
| 517 | 3300025921 | Ga0207652_10009072 | Ga0207652_100090726 | 191 |
| 518 | 3300025923 | Ga0207681_10037074 | Ga0207681_100370742 | 191 |
| 519 | 3300025925 | Ga0207650_10004871 | Ga0207650_100048716 | 191 |
| 520 | 3300025925 | Ga0207650_10007499 | Ga0207650_100074997 | 191 |
| 521 | 3300025926 | Ga0207659_10016592 | Ga0207659_100165925 | 191 |
| 522 | 3300025926 | Ga0207659_10058923 | Ga0207659_100589234 | 191 |
| 523 | 3300025926 | Ga0207659_10087452 | Ga0207659_100874523 | 191 |
| 524 | 3300025931 | Ga0207644_10057199 | Ga0207644_100571993 | 191 |
| 525 | 3300025933 | Ga0207706_10006211 | Ga0207706_100062117 | 191 |
| 526 | 3300025933 | Ga0207706_10107644 | Ga0207706_101076442 | 191 |
| 527 | 3300025934 | Ga0207686_10406895 | Ga0207686_104068951 | 191 |
| 528 | 3300025935 | Ga0207709_10070679 | Ga0207709_100706793 | 191 |
| 529 | 3300025938 | Ga0207704_10032069 | Ga0207704_100320693 | 191 |
| 530 | 3300025938 | Ga0207704_10070145 | Ga0207704_100701452 | 191 |
| 531 | 3300025938 | Ga0207704_10171053 | Ga0207704_101710532 | 191 |
| 532 | 3300025940 | Ga0207691_10010897 | Ga0207691_100108975 | 191 |
| 533 | 3300025940 | Ga0207691_10020835 | Ga0207691_100208354 | 191 |
| 534 | 3300025941 | Ga0207711_10191886 | Ga0207711_101918863 | 191 |
| 535 | 3300025941 | Ga0207711_10923208 | Ga0207711_109232081 | 191 |
| 536 | 3300025942 | Ga0207689_10020357 | Ga0207689_100203573 | 191 |
| 537 | 3300025942 | Ga0207689_10035048 | Ga0207689_100350484 | 191 |
| 538 | 3300025945 | Ga0207679_10178370 | Ga0207679_101783702 | 191 |
| 539 | 3300025945 | Ga0207679_10226789 | Ga0207679_102267892 | 191 |
| 540 | 3300025960 | Ga0207651_10013666 | Ga0207651_100136665 | 191 |
| 541 | 3300025972 | Ga0207668_10490701 | Ga0207668_104907012 | 191 |
| 542 | 3300025986 | Ga0207658_10016179 | Ga0207658_100161795 | 191 |
| 543 | 3300025986 | Ga0207658_10066551 | Ga0207658_100665512 | 191 |
| 544 | 3300026023 | Ga0207677_10062293 | Ga0207677_100622934 | 191 |
| 545 | 3300026035 | Ga0207703_10266864 | Ga0207703_102668643 | 191 |
| 546 | 3300026067 | Ga0207678_10154674 | Ga0207678_101546742 | 191 |
| 547 | 3300026075 | Ga0207708_10012477 | Ga0207708_100124773 | 191 |
| 548 | 3300026088 | Ga0207641_10009103 | Ga0207641_100091035 | 191 |
| 549 | 3300026089 | Ga0207648_10009368 | Ga0207648_100093687 | 191 |
| 550 | 3300026095 | Ga0207676_10714046 | Ga0207676_107140462 | 191 |
| 551 | 3300026116 | Ga0207674_10031922 | Ga0207674_100319223 | 191 |
| 552 | 3300026118 | Ga0207675_100008151 | Ga0207675_1000081513 | 191 |
| 553 | 3300028379 | Ga0268266_10166821 | Ga0268266_101668212 | 191 |
| 554 | 3300028379 | Ga0268266_10590786 | Ga0268266_105907862 | 191 |
| 555 | 3300028380 | Ga0268265_10106367 | Ga0268265_101063673 | 191 |
| 556 | 3300028786 | Ga0307517_10001980 | Ga0307517_100019805 | 191 |
| 557 | 3300028794 | Ga0307515_10028743 | Ga0307515_100287435 | 191 |
| 558 | 3300028794 | Ga0307515_10065408 | Ga0307515_100654085 | 191 |
| 559 | 3300030522 | Ga0307512_10097071 | Ga0307512_100970714 | 191 |
| 560 | 3300030522 | Ga0307512_10109888 | Ga0307512_101098883 | 191 |
| 561 | 3300030522 | Ga0307512_10182862 | Ga0307512_101828621 | 191 |
| 562 | 3300031456 | Ga0307513_10195204 | Ga0307513_101952042 | 191 |
| 563 | 3300031507 | Ga0307509_10000249 | Ga0307509_1000024970 | 191 |
| 564 | 3300031507 | Ga0307509_10003703 | Ga0307509_1000370313 | 191 |
| 565 | 3300031507 | Ga0307509_10012634 | Ga0307509_100126346 | 191 |
| 566 | 3300031507 | Ga0307509_10074077 | Ga0307509_100740775 | 191 |
| 567 | 3300031507 | Ga0307509_10108879 | Ga0307509_101088793 | 191 |
| 568 | 3300031507 | Ga0307509_10375294 | Ga0307509_103752941 | 191 |
| 569 | 3300031616 | Ga0307508_10004816 | Ga0307508_100048167 | 191 |
| 570 | 3300031616 | Ga0307508_10006698 | Ga0307508_100066984 | 191 |
| 571 | 3300031616 | Ga0307508_10216955 | Ga0307508_102169551 | 191 |
| 572 | 3300031649 | Ga0307514_10075735 | Ga0307514_100757353 | 191 |
| 573 | 3300031649 | Ga0307514_10089643 | Ga0307514_100896433 | 191 |
| 574 | 3300031649 | Ga0307514_10141807 | Ga0307514_101418072 | 191 |
| 575 | 3300031730 | Ga0307516_10285416 | Ga0307516_102854162 | 191 |
| 576 | 3300031730 | Ga0307516_10332005 | Ga0307516_103320053 | 191 |
| 577 | 3300031730 | Ga0307516_10433851 | Ga0307516_104338511 | 191 |
| 578 | 3300031911 | Ga0307412_10034896 | Ga0307412_100348964 | 191 |
| 579 | 3300032002 | Ga0307416_100014114 | Ga0307416_1000141143 | 191 |
| 580 | 3300032005 | Ga0307411_10026501 | Ga0307411_100265012 | 191 |
| 581 | 3300032126 | Ga0307415_100116794 | Ga0307415_1001167943 | 191 |
| 582 | 3300033180 | Ga0307510_10043278 | Ga0307510_100432786 | 191 |
| 583 | 3300033180 | Ga0307510_10072075 | Ga0307510_100720754 | 191 |
| 584 | 3300035091 | Ga0373951_0064691 | Ga0373951_0064691_18_671 | 191 |
| 585 | 3300035112 | Ga0373932_0018150 | Ga0373932_0018150_978_1604 | 191 |
| 586 | 3300035113 | Ga0373936_0095384 | Ga0373936_0095384_343_960 | 191 |
| 587 | 3300035114 | Ga0373939_0000184 | Ga0373939_0000184_11770_12423 | 191 |
| 588 | 3300035116 | Ga0373945_0165722 | Ga0373945_0165722_28_645 | 191 |
| 589 | 3300035121 | Ga0373960_0069961 | Ga0373960_0069961_217_870 | 191 |
| 590 | 3300035691 | Ga0373931_0000092 | Ga0373931_0000092_30428_31081 | 191 |
| 591 | 3300035691 | Ga0373931_0009750 | Ga0373931_0009750_2126_2752 | 191 |
| 592 | 3300035695 | Ga0373927_0678656 | Ga0373927_0678656_35_661 | 191 |
| 593 | 3300036401 | Ga0373937_0180302 | Ga0373937_0180302_924_1541 | 191 |
| 594 | 3300037068 | Ga0373925_0221711 | Ga0373925_0221711_135_761 | 191 |
| 595 | 3300037068 | Ga0373925_0392936 | Ga0373925_0392936_341_958 | 191 |
| 596 | 3300037471 | Ga0395905_0000151 | Ga0395905_0000151_42823_43464 | 191 |
| 597 | 3300041512 | Ga0451853_0566426 | Ga0451853_0566426_43_669 | 191 |
| 598 | 3300044712 | Ga0453684_0020128 | Ga0453684_0020128_1275_1907 | 191 |
| 599 | 3300046454 | Ga0495592_0001883 | Ga0495592_0001883_8069_8695 | 191 |
| 600 | 3300046460 | Ga0495638_0279367 | Ga0495638_0279367_132_758 | 191 |
| 601 | 3300046471 | Ga0495650_0060731 | Ga0495650_0060731_880_1506 | 191 |
| 602 | 3300046475 | Ga0495639_0111302 | Ga0495639_0111302_279_896 | 191 |
| 603 | 3300046512 | Ga0495610_0038724 | Ga0495610_0038724_1048_1674 | 191 |
| 604 | 3300046517 | Ga0495630_0448757 | Ga0495630_0448757_59_685 | 191 |
| 605 | 3300046526 | Ga0495666_0098757 | Ga0495666_0098757_313_939 | 191 |
| 606 | 3300046537 | Ga0495598_0016283 | Ga0495598_0016283_267_902 | 191 |
| 607 | 3300046615 | Ga0495656_0328626 | Ga0495656_0328626_47_673 | 191 |
| 608 | 3300046678 | Ga0495599_0135816 | Ga0495599_0135816_857_1474 | 191 |
| 609 | 3300046683 | Ga0495658_0269335 | Ga0495658_0269335_227_853 | 191 |
| 610 | 3300046690 | Ga0495624_0207403 | Ga0495624_0207403_348_974 | 191 |
| 611 | 3300046692 | Ga0495671_0129216 | Ga0495671_0129216_57_686 | 191 |
| 612 | 3300047317 | Ga0495604_0523462 | Ga0495604_0523462_113_724 | 191 |
| 613 | 3300047321 | Ga0495676_0052751 | Ga0495676_0052751_1726_2352 | 191 |
| 614 | 3300047471 | Ga0495684_0260937 | Ga0495684_0260937_361_978 | 191 |
| 615 | 3300048917 | Ga0496114_0322005 | Ga0496114_0322005_643_1269 | 191 |
| 616 | 3300048924 | Ga0496121_0494783 | Ga0496121_0494783_30_656 | 191 |
| 617 | 3300050489 | nmdc:mga03683_281610_c1 | nmdc:mga03683_281610_c1_25_678 | 191 |
| 618 | 3300050491 | nmdc:mga00v17_200339_c1 | nmdc:mga00v17_200339_c1_536_1168 | 191 |
| 619 | 3300050493 | nmdc:mga0k408_35485_c1 | nmdc:mga0k408_35485_c1_926_1558 | 191 |
| 620 | 3300050493 | nmdc:mga0k408_4061_c1 | nmdc:mga0k408_4061_c1_2450_3082 | 191 |
| 621 | 3300050493 | nmdc:mga0k408_67442_c1 | nmdc:mga0k408_67442_c1_1271_1897 | 191 |
| 622 | 3300050493 | nmdc:mga0k408_7292_c1 | nmdc:mga0k408_7292_c1_702_1364 | 191 |
| 623 | 3300050508 | nmdc:mga09592_1397_c1 | nmdc:mga09592_1397_c1_8232_8870 | 191 |
| 624 | 3300050509 | nmdc:mga0qj67_17079_c1 | nmdc:mga0qj67_17079_c1_3921_4559 | 191 |
| 625 | 3300053077 | Ga0495601_0032063 | Ga0495601_0032063_2028_2645 | 191 |
| 626 | 3300053084 | Ga0495595_0058158 | Ga0495595_0058158_405_1022 | 191 |
| 627 | 3300053086 | Ga0500578_0037319 | Ga0500578_0037319_1269_1895 | 191 |
| 628 | 3300053088 | Ga0500644_0004099 | Ga0500644_0004099_1716_2342 | 191 |
| 629 | 3300053093 | Ga0500651_0030909 | Ga0500651_0030909_1823_2449 | 191 |
| 630 | 3300053118 | Ga0500594_0000665 | Ga0500594_0000665_5886_6512 | 191 |
| 631 | 3300053131 | Ga0500652_080915 | Ga0500652_080915_339_965 | 191 |
| 632 | 3300053133 | Ga0500655_029846 | Ga0500655_029846_278_904 | 191 |
| 633 | 3300053136 | Ga0500559_0000032 | Ga0500559_0000032_34505_35131 | 191 |
| 634 | 3300053138 | Ga0500564_056359 | Ga0500564_056359_1080_1706 | 191 |
| 635 | 3300053154 | Ga0500619_009997 | Ga0500619_009997_1008_1634 | 191 |
| 636 | 3300053156 | Ga0500622_0001884 | Ga0500622_0001884_6019_6645 | 191 |
| 637 | 3300053177 | Ga0500636_0173770 | Ga0500636_0173770_85_711 | 191 |
| 638 | 3300053730 | Ga0500645_002942 | Ga0500645_002942_4475_5101 | 191 |
| 639 | 3300053739 | Ga0500587_012117 | Ga0500587_012117_80_706 | 191 |
| 640 | iso_pu_bacteria | 2643221654 | 2644301238 | 191 |
| 641 | 3300005290 | Ga0065712_10084099 | Ga0065712_100840994 | 192 |
| 642 | 3300005293 | Ga0065715_10104338 | Ga0065715_101043381 | 192 |
| 643 | 3300005328 | Ga0070676_10033533 | Ga0070676_100335332 | 192 |
| 644 | 3300005328 | Ga0070676_10034601 | Ga0070676_100346014 | 192 |
| 645 | 3300005328 | Ga0070676_10108413 | Ga0070676_101084132 | 192 |
| 646 | 3300005330 | Ga0070690_100319948 | Ga0070690_1003199483 | 192 |
| 647 | 3300005331 | Ga0070670_100021917 | Ga0070670_1000219174 | 192 |
| 648 | 3300005331 | Ga0070670_100034305 | Ga0070670_1000343054 | 192 |
| 649 | 3300005331 | Ga0070670_100099934 | Ga0070670_1000999342 | 192 |
| 650 | 3300005331 | Ga0070670_100178991 | Ga0070670_1001789912 | 192 |
| 651 | 3300005331 | Ga0070670_100225662 | Ga0070670_1002256621 | 192 |
| 652 | 3300005331 | Ga0070670_100319287 | Ga0070670_1003192872 | 192 |
| 653 | 3300005331 | Ga0070670_100868375 | Ga0070670_1008683751 | 192 |
| 654 | 3300005333 | Ga0070677_10042845 | Ga0070677_100428452 | 192 |
| 655 | 3300005335 | Ga0070666_10200545 | Ga0070666_102005451 | 192 |
| 656 | 3300005338 | Ga0068868_100242372 | Ga0068868_1002423723 | 192 |
| 657 | 3300005347 | Ga0070668_100338802 | Ga0070668_1003388021 | 192 |
| 658 | 3300005353 | Ga0070669_100050718 | Ga0070669_1000507182 | 192 |
| 659 | 3300005355 | Ga0070671_100211408 | Ga0070671_1002114082 | 192 |
| 660 | 3300005355 | Ga0070671_100624712 | Ga0070671_1006247121 | 192 |
| 661 | 3300005356 | Ga0070674_100020881 | Ga0070674_1000208811 | 192 |
| 662 | 3300005356 | Ga0070674_100088341 | Ga0070674_1000883412 | 192 |
| 663 | 3300005364 | Ga0070673_100002371 | Ga0070673_1000023717 | 192 |
| 664 | 3300005365 | Ga0070688_100099803 | Ga0070688_1000998032 | 192 |
| 665 | 3300005367 | Ga0070667_100222831 | Ga0070667_1002228311 | 192 |
| 666 | 3300005456 | Ga0070678_100006062 | Ga0070678_1000060624 | 192 |
| 667 | 3300005456 | Ga0070678_100224568 | Ga0070678_1002245681 | 192 |
| 668 | 3300005457 | Ga0070662_100066091 | Ga0070662_1000660914 | 192 |
| 669 | 3300005459 | Ga0068867_100005426 | Ga0068867_1000054264 | 192 |
| 670 | 3300005459 | Ga0068867_100030867 | Ga0068867_1000308673 | 192 |
| 671 | 3300005459 | Ga0068867_100088852 | Ga0068867_1000888523 | 192 |
| 672 | 3300005543 | Ga0070672_100026382 | Ga0070672_1000263825 | 192 |
| 673 | 3300005543 | Ga0070672_100086298 | Ga0070672_1000862983 | 192 |
| 674 | 3300005543 | Ga0070672_100585351 | Ga0070672_1005853512 | 192 |
| 675 | 3300005564 | Ga0070664_100484406 | Ga0070664_1004844062 | 192 |
| 676 | 3300005564 | Ga0070664_100499843 | Ga0070664_1004998433 | 192 |
| 677 | 3300005614 | Ga0068856_100154716 | Ga0068856_1001547164 | 192 |
| 678 | 3300005618 | Ga0068864_100030416 | Ga0068864_1000304162 | 192 |
| 679 | 3300005618 | Ga0068864_100245098 | Ga0068864_1002450982 | 192 |
| 680 | 3300005618 | Ga0068864_100609456 | Ga0068864_1006094562 | 192 |
| 681 | 3300005719 | Ga0068861_101123611 | Ga0068861_1011236111 | 192 |
| 682 | 3300005834 | Ga0068851_10008150 | Ga0068851_100081504 | 192 |
| 683 | 3300005834 | Ga0068851_10044727 | Ga0068851_100447271 | 192 |
| 684 | 3300005840 | Ga0068870_10142605 | Ga0068870_101426052 | 192 |
| 685 | 3300006177 | Ga0075362_10185197 | Ga0075362_101851972 | 192 |
| 686 | 3300006237 | Ga0097621_100044849 | Ga0097621_1000448493 | 192 |
| 687 | 3300006358 | Ga0068871_100006200 | Ga0068871_1000062008 | 192 |
| 688 | 3300009551 | Ga0105238_10334890 | Ga0105238_103348902 | 192 |
| 689 | 3300013297 | Ga0157378_10480928 | Ga0157378_104809281 | 192 |
| 690 | 3300013306 | Ga0163162_10585832 | Ga0163162_105858323 | 192 |
| 691 | 3300013308 | Ga0157375_10012252 | Ga0157375_100122528 | 192 |
| 692 | 3300014325 | Ga0163163_10868387 | Ga0163163_108683871 | 192 |
| 693 | 3300014326 | Ga0157380_10471894 | Ga0157380_104718941 | 192 |
| 694 | 3300014969 | Ga0157376_10077851 | Ga0157376_100778514 | 192 |
| 695 | 3300017792 | Ga0163161_10009331 | Ga0163161_100093315 | 192 |
| 696 | 3300025315 | Ga0207697_10003064 | Ga0207697_100030645 | 192 |
| 697 | 3300025321 | Ga0207656_10128452 | Ga0207656_101284522 | 192 |
| 698 | 3300025893 | Ga0207682_10002801 | Ga0207682_100028014 | 192 |
| 699 | 3300025893 | Ga0207682_10011716 | Ga0207682_100117163 | 192 |
| 700 | 3300025907 | Ga0207645_10023445 | Ga0207645_100234454 | 192 |
| 701 | 3300025907 | Ga0207645_10024932 | Ga0207645_100249325 | 192 |
| 702 | 3300025907 | Ga0207645_10421549 | Ga0207645_104215492 | 192 |
| 703 | 3300025908 | Ga0207643_10084950 | Ga0207643_100849502 | 192 |
| 704 | 3300025923 | Ga0207681_10003514 | Ga0207681_100035147 | 192 |
| 705 | 3300025925 | Ga0207650_10001276 | Ga0207650_1000127610 | 192 |
| 706 | 3300025925 | Ga0207650_10023626 | Ga0207650_100236264 | 192 |
| 707 | 3300025925 | Ga0207650_10048255 | Ga0207650_100482555 | 192 |
| 708 | 3300025925 | Ga0207650_10255958 | Ga0207650_102559582 | 192 |
| 709 | 3300025926 | Ga0207659_10014054 | Ga0207659_100140543 | 192 |
| 710 | 3300025926 | Ga0207659_10057723 | Ga0207659_100577234 | 192 |
| 711 | 3300025931 | Ga0207644_10000523 | Ga0207644_1000052315 | 192 |
| 712 | 3300025933 | Ga0207706_10419226 | Ga0207706_104192262 | 192 |
| 713 | 3300025937 | Ga0207669_10016372 | Ga0207669_100163724 | 192 |
| 714 | 3300025937 | Ga0207669_10058535 | Ga0207669_100585353 | 192 |
| 715 | 3300025938 | Ga0207704_10107692 | Ga0207704_101076923 | 192 |
| 716 | 3300025940 | Ga0207691_10003381 | Ga0207691_1000338111 | 192 |
| 717 | 3300025940 | Ga0207691_10101973 | Ga0207691_101019733 | 192 |
| 718 | 3300025940 | Ga0207691_10175300 | Ga0207691_101753003 | 192 |
| 719 | 3300025960 | Ga0207651_10014368 | Ga0207651_100143683 | 192 |
| 720 | 3300025960 | Ga0207651_10128790 | Ga0207651_101287903 | 192 |
| 721 | 3300025972 | Ga0207668_10654983 | Ga0207668_106549832 | 192 |
| 722 | 3300025986 | Ga0207658_10530481 | Ga0207658_105304812 | 192 |
| 723 | 3300026023 | Ga0207677_10223449 | Ga0207677_102234493 | 192 |
| 724 | 3300026078 | Ga0207702_10121229 | Ga0207702_101212292 | 192 |
| 725 | 3300026089 | Ga0207648_10004239 | Ga0207648_100042394 | 192 |
| 726 | 3300026089 | Ga0207648_10010311 | Ga0207648_100103117 | 192 |
| 727 | 3300026095 | Ga0207676_10079068 | Ga0207676_100790682 | 192 |
| 728 | 3300026095 | Ga0207676_10426881 | Ga0207676_104268812 | 192 |
| 729 | 3300026121 | Ga0207683_10025450 | Ga0207683_100254503 | 192 |
| 730 | 3300026121 | Ga0207683_10083536 | Ga0207683_100835363 | 192 |
| 731 | 3300026142 | Ga0207698_10202437 | Ga0207698_102024372 | 192 |
| 732 | 3300026142 | Ga0207698_10338146 | Ga0207698_103381462 | 192 |
| 733 | 3300026142 | Ga0207698_10679887 | Ga0207698_106798871 | 192 |
| 734 | 3300028379 | Ga0268266_10072607 | Ga0268266_100726072 | 192 |
| 735 | 3300028379 | Ga0268266_10581397 | Ga0268266_105813972 | 192 |
| 736 | 3300031548 | Ga0307408_100015636 | Ga0307408_1000156363 | 192 |
| 737 | 3300031548 | Ga0307408_100196020 | Ga0307408_1001960202 | 192 |
| 738 | 3300031730 | Ga0307516_10000237 | Ga0307516_1000023745 | 192 |
| 739 | 3300031824 | Ga0307413_10057428 | Ga0307413_100574283 | 192 |
| 740 | 3300031824 | Ga0307413_10168485 | Ga0307413_101684851 | 192 |
| 741 | 3300031824 | Ga0307413_10318493 | Ga0307413_103184932 | 192 |
| 742 | 3300031824 | Ga0307413_10423715 | Ga0307413_104237151 | 192 |
| 743 | 3300031852 | Ga0307410_10234165 | Ga0307410_102341651 | 192 |
| 744 | 3300031852 | Ga0307410_10439420 | Ga0307410_104394202 | 192 |
| 745 | 3300031901 | Ga0307406_10023123 | Ga0307406_100231233 | 192 |
| 746 | 3300031901 | Ga0307406_10984675 | Ga0307406_109846751 | 192 |
| 747 | 3300031903 | Ga0307407_10468201 | Ga0307407_104682011 | 192 |
| 748 | 3300031911 | Ga0307412_10027498 | Ga0307412_100274983 | 192 |
| 749 | 3300031911 | Ga0307412_10100837 | Ga0307412_101008372 | 192 |
| 750 | 3300032002 | Ga0307416_100061065 | Ga0307416_1000610653 | 192 |
| 751 | 3300032004 | Ga0307414_10240025 | Ga0307414_102400252 | 192 |
| 752 | 3300032005 | Ga0307411_10012282 | Ga0307411_100122823 | 192 |
| 753 | 3300032005 | Ga0307411_10016314 | Ga0307411_100163144 | 192 |
| 754 | 3300032126 | Ga0307415_100068180 | Ga0307415_1000681803 | 192 |
| 755 | 3300041458 | Ga0451798_0362761 | Ga0451798_0362761_1231_1863 | 192 |
| 756 | 3300003162 | Ga0006778J45830_1077259 | Ga0006778J45830_10772592 | 193 |
| 757 | 3300005455 | Ga0070663_100019470 | Ga0070663_1000194704 | 193 |
| 758 | 3300005843 | Ga0068860_100126165 | Ga0068860_1001261652 | 193 |
| 759 | 3300014968 | Ga0157379_10004002 | Ga0157379_1000400211 | 193 |
| 760 | 3300026067 | Ga0207678_10015684 | Ga0207678_100156843 | 193 |
| 761 | 3300028381 | Ga0268264_10117505 | Ga0268264_101175053 | 193 |
| 762 | 3300034820 | Ga0373959_0010617 | Ga0373959_0010617_173_799 | 193 |
| 763 | 3300042876 | Ga0451577_0273095 | Ga0451577_0273095_747_1403 | 193 |
| 764 | 3300044712 | Ga0453684_0086122 | Ga0453684_0086122_763_1401 | 193 |
| 765 | 3300053161 | Ga0500634_0010236 | Ga0500634_0010236_3352_4047 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qgu-assembly1.cif.gz_A | three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89 | 0.9476 | 17 | 190 |
| 2qgu-assembly1.cif.gz_A | three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89 | 0.917 | 17 | 190 |
| 6x04-assembly1.cif.gz_I | nup133 (aa55-481) from s. cerevisiae bound by vhh-san5 | 0.8883 | 105 | 154 |
| 6x04-assembly1.cif.gz_G | nup133 (aa55-481) from s. cerevisiae bound by vhh-san5 | 0.8842 | 105 | 154 |
| 6x04-assembly1.cif.gz_C | nup133 (aa55-481) from s. cerevisiae bound by vhh-san5 | 0.8817 | 105 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qguA01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9112 | 17 | 157 | 3.10.450.50 |
| 2qguA01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8772 | 17 | 157 | 3.10.450.50 |
| af_P0ADV7_24_204_3.10.450.710 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC | 0.8718 | 16 | 186 | 3.10.450.710 |
| 4fczA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC | 0.8348 | 14 | 187 | 3.10.450.710 |
| af_P0ADV7_24_204_3.10.450.710 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC | 0.8232 | 16 | 186 | 3.10.450.710 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257KGL5-F1-model_v4 | Toluene tolerance protein | 0.9456 | 74 | 192 |
|
| AF-A0A537AV23-F1-model_v4 | ABC transporter substrate-binding protein | 0.9408 | 3 | 191 |
|
| AF-A0A2N4U5J0-F1-model_v4 | ABC transporter | 0.9302 | 5 | 186 |
|
| AF-A0A0N0JKE2-F1-model_v4 | Uncharacterized protein | 0.9281 | 2 | 190 |
|
| AF-A0A3P4B2E5-F1-model_v4 | Putative phospholipid-binding protein MlaC | 0.9253 | 11 | 182 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar