F479725
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 764 | 380 | 760 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10127614|Ga0105242_101276142 |
| Length | 157 |
| Sequence | MLAGCNASPVGHRRWELLMAEEITIERVQQLVTRAPYHQWLGLKVIALHDDGIELTATWREEWVVNPDRRYTHGGVLATLVDLGADWAMVSKTGRGVPTIDLRIDYHAVAMPGDLTIRGKIVRMGSQFSTSEARVFDAEGKLLASGRGTYYTAPPKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 2 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 3 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 4 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 191 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 220 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 221 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 222 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 223 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 227 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 321 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 322 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 355 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 358 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 377 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.48 |
| Metatranscriptomes | 0 |
| Isolates | 0.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.68 |
| Nodule | 0 |
| Rhizoplane | 12.7 |
| Rhizosphere | 77.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10026211 | 3300001979 | Bacteria | 1955 |
| 2 | JGI24737J22298_10009842 | 3300001990 | Bacteria | 3167 |
| 3 | JGI24735J21928_10000063 | 3300002067 | Bacteria | 44257 |
| 4 | JGI24738J21930_10104526 | 3300002075 | Bacteria | 606 |
| 5 | JGI25153J46596_10003207 | 3300003215 | Bacteria | 9193 |
| 6 | JGI25405J52794_10067120 | 3300003911 | Bacteria | 780 |
| 7 | Ga0070683_100996181 | 3300005329 | Bacteria | 804 |
| 8 | Ga0070670_100040441 | 3300005331 | Bacteria | 4009 |
| 9 | Ga0070670_100257205 | 3300005331 | Bacteria | 1522 |
| 10 | Ga0070666_10063021 | 3300005335 | Bacteria | 2512 |
| 11 | Ga0068868_100032929 | 3300005338 | Bacteria | 3991 |
| 12 | Ga0070660_100135219 | 3300005339 | Bacteria | 1975 |
| 13 | Ga0070689_100051282 | 3300005340 | Bacteria | 3189 |
| 14 | Ga0070689_100658184 | 3300005340 | Bacteria | 912 |
| 15 | Ga0070691_10032118 | 3300005341 | Bacteria | 2465 |
| 16 | Ga0070692_10071972 | 3300005345 | Bacteria | 1843 |
| 17 | Ga0070668_101148732 | 3300005347 | Bacteria | 702 |
| 18 | Ga0070675_100492823 | 3300005354 | Unclassified | 1103 |
| 19 | Ga0070671_100641552 | 3300005355 | Unclassified | 919 |
| 20 | Ga0070674_100040160 | 3300005356 | Bacteria | 3164 |
| 21 | Ga0070673_100605052 | 3300005364 | Unclassified | 1000 |
| 22 | Ga0070673_101119336 | 3300005364 | Bacteria | 736 |
| 23 | Ga0070688_100204429 | 3300005365 | Bacteria | 1383 |
| 24 | Ga0070688_100235697 | 3300005365 | Bacteria | 1296 |
| 25 | Ga0070659_100059701 | 3300005366 | Bacteria | 3011 |
| 26 | Ga0070659_102156497 | 3300005366 | Bacteria | 501 |
| 27 | Ga0070709_10000668 | 3300005434 | Bacteria | 19554 |
| 28 | Ga0070709_10161926 | 3300005434 | Bacteria | 1557 |
| 29 | Ga0070714_100008660 | 3300005435 | Bacteria | 7956 |
| 30 | Ga0070714_100020634 | 3300005435 | Bacteria | 5384 |
| 31 | Ga0070714_100307868 | 3300005435 | Bacteria | 1478 |
| 32 | Ga0070714_100984824 | 3300005435 | Bacteria | 820 |
| 33 | Ga0070714_101420494 | 3300005435 | Bacteria | 678 |
| 34 | Ga0070713_100007357 | 3300005436 | Bacteria | 7718 |
| 35 | Ga0070713_100115158 | 3300005436 | Bacteria | 2350 |
| 36 | Ga0070713_100139774 | 3300005436 | Bacteria | 2144 |
| 37 | Ga0070713_100169877 | 3300005436 | Bacteria | 1953 |
| 38 | Ga0070713_100222760 | 3300005436 | Bacteria | 1711 |
| 39 | Ga0070713_100281357 | 3300005436 | Bacteria | 1526 |
| 40 | Ga0070713_100875628 | 3300005436 | Bacteria | 863 |
| 41 | Ga0070710_10004289 | 3300005437 | Bacteria | 6764 |
| 42 | Ga0070710_10210457 | 3300005437 | Bacteria | 1232 |
| 43 | Ga0070710_10332714 | 3300005437 | Bacteria | 1000 |
| 44 | Ga0070701_10052649 | 3300005438 | Bacteria | 2116 |
| 45 | Ga0070711_100021882 | 3300005439 | Bacteria | 4138 |
| 46 | Ga0070711_100107217 | 3300005439 | Bacteria | 2044 |
| 47 | Ga0070711_100119235 | 3300005439 | Bacteria | 1949 |
| 48 | Ga0070711_100448885 | 3300005439 | Bacteria | 1055 |
| 49 | Ga0070711_100916214 | 3300005439 | Bacteria | 749 |
| 50 | Ga0070711_101234659 | 3300005439 | Bacteria | 647 |
| 51 | Ga0070705_100750279 | 3300005440 | Bacteria | 772 |
| 52 | Ga0070700_100239820 | 3300005441 | Bacteria | 1295 |
| 53 | Ga0070694_100581299 | 3300005444 | Bacteria | 900 |
| 54 | Ga0070663_100206649 | 3300005455 | Bacteria | 1535 |
| 55 | Ga0070678_100046173 | 3300005456 | Bacteria | 3121 |
| 56 | Ga0070678_100288853 | 3300005456 | Bacteria | 1389 |
| 57 | Ga0070662_100148186 | 3300005457 | Bacteria | 1824 |
| 58 | Ga0070662_100670489 | 3300005457 | Bacteria | 876 |
| 59 | Ga0070681_10047951 | 3300005458 | Bacteria | 4269 |
| 60 | Ga0070681_10206021 | 3300005458 | Bacteria | 1884 |
| 61 | Ga0070681_11342937 | 3300005458 | Unclassified | 638 |
| 62 | Ga0070685_10341773 | 3300005466 | Unclassified | 1021 |
| 63 | Ga0070706_100398338 | 3300005467 | Bacteria | 1281 |
| 64 | Ga0070698_100895348 | 3300005471 | Bacteria | 833 |
| 65 | Ga0070699_100010309 | 3300005518 | Bacteria | 8081 |
| 66 | Ga0070679_100007416 | 3300005530 | Bacteria | 10250 |
| 67 | Ga0070679_100908494 | 3300005530 | Bacteria | 824 |
| 68 | Ga0070684_100417909 | 3300005535 | Bacteria | 1238 |
| 69 | Ga0070684_101168564 | 3300005535 | Bacteria | 724 |
| 70 | Ga0070672_100880305 | 3300005543 | Unclassified | 790 |
| 71 | Ga0070686_100058004 | 3300005544 | Bacteria | 2490 |
| 72 | Ga0070686_100642483 | 3300005544 | Bacteria | 840 |
| 73 | Ga0070696_100651791 | 3300005546 | Bacteria | 854 |
| 74 | Ga0070693_100357243 | 3300005547 | Bacteria | 1002 |
| 75 | Ga0070665_100934873 | 3300005548 | Bacteria | 879 |
| 76 | Ga0070665_101076589 | 3300005548 | Unclassified | 815 |
| 77 | Ga0070704_100336792 | 3300005549 | Bacteria | 1269 |
| 78 | Ga0068855_100211184 | 3300005563 | Bacteria | 2181 |
| 79 | Ga0070664_100175665 | 3300005564 | Bacteria | 1901 |
| 80 | Ga0070664_100546466 | 3300005564 | Bacteria | 1071 |
| 81 | Ga0068854_100003131 | 3300005578 | Bacteria | 10300 |
| 82 | Ga0070702_100122525 | 3300005615 | Bacteria | 1630 |
| 83 | Ga0070702_100209792 | 3300005615 | Bacteria | 1295 |
| 84 | Ga0068852_100172578 | 3300005616 | Bacteria | 2028 |
| 85 | Ga0068864_100065337 | 3300005618 | Bacteria | 3156 |
| 86 | Ga0068866_10333251 | 3300005718 | Unclassified | 958 |
| 87 | Ga0068861_100014501 | 3300005719 | Bacteria | 5532 |
| 88 | Ga0068851_10232951 | 3300005834 | Bacteria | 1039 |
| 89 | Ga0068870_10169873 | 3300005840 | Bacteria | 1300 |
| 90 | Ga0068863_100037605 | 3300005841 | Bacteria | 4608 |
| 91 | Ga0068863_101192282 | 3300005841 | Bacteria | 767 |
| 92 | Ga0068858_100981107 | 3300005842 | Unclassified | 827 |
| 93 | Ga0068860_100058618 | 3300005843 | Bacteria | 3660 |
| 94 | Ga0068862_101003728 | 3300005844 | Bacteria | 825 |
| 95 | Ga0081455_10001715 | 3300005937 | Bacteria | 26531 |
| 96 | Ga0081455_10034176 | 3300005937 | Bacteria | 4558 |
| 97 | Ga0081455_10060308 | 3300005937 | Bacteria | 3199 |
| 98 | Ga0081455_10752632 | 3300005937 | Bacteria | 616 |
| 99 | Ga0081538_10008299 | 3300005981 | Bacteria | 8845 |
| 100 | Ga0081540_1021808 | 3300005983 | Bacteria | 3800 |
| 101 | Ga0081540_1045750 | 3300005983 | Bacteria | 2218 |
| 102 | Ga0081540_1150335 | 3300005983 | Bacteria | 920 |
| 103 | Ga0070717_10309058 | 3300006028 | Bacteria | 1406 |
| 104 | Ga0070717_10406653 | 3300006028 | Bacteria | 1223 |
| 105 | Ga0070717_10543782 | 3300006028 | Bacteria | 1051 |
| 106 | Ga0070717_11131140 | 3300006028 | Bacteria | 713 |
| 107 | Ga0070717_11565076 | 3300006028 | Bacteria | 598 |
| 108 | Ga0070717_11793565 | 3300006028 | Bacteria | 555 |
| 109 | Ga0070717_11845860 | 3300006028 | Unclassified | 546 |
| 110 | Ga0075365_10002322 | 3300006038 | Bacteria | 9254 |
| 111 | Ga0075365_10035594 | 3300006038 | Bacteria | 3222 |
| 112 | Ga0075365_10040967 | 3300006038 | Bacteria | 3023 |
| 113 | Ga0075365_10068968 | 3300006038 | Bacteria | 2376 |
| 114 | Ga0075365_10220145 | 3300006038 | Bacteria | 1331 |
| 115 | Ga0075365_10556812 | 3300006038 | Bacteria | 811 |
| 116 | Ga0075365_10582484 | 3300006038 | Bacteria | 791 |
| 117 | Ga0075368_10073422 | 3300006042 | Bacteria | 1384 |
| 118 | Ga0075368_10192761 | 3300006042 | Bacteria | 861 |
| 119 | Ga0075368_10263255 | 3300006042 | Bacteria | 738 |
| 120 | Ga0075363_100170429 | 3300006048 | Bacteria | 1236 |
| 121 | Ga0075364_10104200 | 3300006051 | Bacteria | 1890 |
| 122 | Ga0075364_10522406 | 3300006051 | Bacteria | 811 |
| 123 | Ga0070715_10001202 | 3300006163 | Bacteria | 7448 |
| 124 | Ga0070715_10089758 | 3300006163 | Bacteria | 1412 |
| 125 | Ga0070716_100038436 | 3300006173 | Bacteria | 2650 |
| 126 | Ga0070716_100042820 | 3300006173 | Bacteria | 2529 |
| 127 | Ga0070716_100813815 | 3300006173 | Bacteria | 724 |
| 128 | Ga0070712_100003811 | 3300006175 | Bacteria | 9292 |
| 129 | Ga0070712_100008370 | 3300006175 | Bacteria | 6505 |
| 130 | Ga0070712_100382565 | 3300006175 | Bacteria | 1159 |
| 131 | Ga0070712_100670244 | 3300006175 | Bacteria | 882 |
| 132 | Ga0070712_100911496 | 3300006175 | Bacteria | 758 |
| 133 | Ga0070712_101653630 | 3300006175 | Bacteria | 560 |
| 134 | Ga0075362_10058692 | 3300006177 | Bacteria | 1736 |
| 135 | Ga0075362_10232933 | 3300006177 | Bacteria | 902 |
| 136 | Ga0075367_10131122 | 3300006178 | Bacteria | 1549 |
| 137 | Ga0075367_10149788 | 3300006178 | Bacteria | 1447 |
| 138 | Ga0075367_10180694 | 3300006178 | Bacteria | 1315 |
| 139 | Ga0075367_10264852 | 3300006178 | Bacteria | 1079 |
| 140 | Ga0075367_10456982 | 3300006178 | Bacteria | 809 |
| 141 | Ga0075369_10132171 | 3300006186 | Bacteria | 1135 |
| 142 | Ga0075366_10470019 | 3300006195 | Bacteria | 776 |
| 143 | Ga0075366_10586327 | 3300006195 | Bacteria | 691 |
| 144 | Ga0097621_100047516 | 3300006237 | Bacteria | 3479 |
| 145 | Ga0075370_10575639 | 3300006353 | Bacteria | 682 |
| 146 | Ga0068871_101066770 | 3300006358 | Unclassified | 754 |
| 147 | Ga0075428_100069715 | 3300006844 | Bacteria | 3844 |
| 148 | Ga0075428_100808228 | 3300006844 | Bacteria | 996 |
| 149 | Ga0075428_100985093 | 3300006844 | Bacteria | 893 |
| 150 | Ga0075428_101174079 | 3300006844 | Bacteria | 810 |
| 151 | Ga0075430_100000415 | 3300006846 | Bacteria | 31698 |
| 152 | Ga0075430_100130284 | 3300006846 | Bacteria | 2096 |
| 153 | Ga0075431_100185293 | 3300006847 | Bacteria | 2134 |
| 154 | Ga0075431_100345803 | 3300006847 | Bacteria | 1496 |
| 155 | Ga0075431_100387458 | 3300006847 | Bacteria | 1401 |
| 156 | Ga0075431_100665300 | 3300006847 | Bacteria | 1021 |
| 157 | Ga0075431_100719990 | 3300006847 | Bacteria | 975 |
| 158 | Ga0075433_10106011 | 3300006852 | Bacteria | 2491 |
| 159 | Ga0075434_100083910 | 3300006871 | Bacteria | 3184 |
| 160 | Ga0075434_100802066 | 3300006871 | Bacteria | 958 |
| 161 | Ga0075429_100057131 | 3300006880 | Bacteria | 3397 |
| 162 | Ga0068865_100366218 | 3300006881 | Bacteria | 1172 |
| 163 | Ga0068865_100550831 | 3300006881 | Unclassified | 968 |
| 164 | Ga0068865_100986063 | 3300006881 | Bacteria | 737 |
| 165 | Ga0075436_100143194 | 3300006914 | Bacteria | 1681 |
| 166 | Ga0075436_100211464 | 3300006914 | Bacteria | 1375 |
| 167 | Ga0075435_100027374 | 3300007076 | Bacteria | 4458 |
| 168 | Ga0099794_10015989 | 3300007265 | Bacteria | 3320 |
| 169 | Ga0099794_10024786 | 3300007265 | Bacteria | 2757 |
| 170 | Ga0099795_10075856 | 3300007788 | Bacteria | 1277 |
| 171 | Ga0099795_10104572 | 3300007788 | Bacteria | 1115 |
| 172 | Ga0099795_10222370 | 3300007788 | Bacteria | 804 |
| 173 | Ga0105251_10188292 | 3300009011 | Bacteria | 929 |
| 174 | Ga0111539_10011398 | 3300009094 | Bacteria | 11160 |
| 175 | Ga0111539_10145390 | 3300009094 | Bacteria | 2776 |
| 176 | Ga0111539_10443512 | 3300009094 | Bacteria | 1511 |
| 177 | Ga0111539_10626941 | 3300009094 | Bacteria | 1252 |
| 178 | Ga0111539_10682029 | 3300009094 | Bacteria | 1196 |
| 179 | Ga0111539_11786675 | 3300009094 | Bacteria | 713 |
| 180 | Ga0111539_12180598 | 3300009094 | Unclassified | 643 |
| 181 | Ga0105245_10478860 | 3300009098 | Bacteria | 1258 |
| 182 | Ga0105245_11574132 | 3300009098 | Bacteria | 709 |
| 183 | Ga0105247_10037846 | 3300009101 | Bacteria | 2943 |
| 184 | Ga0105247_10071680 | 3300009101 | Bacteria | 2168 |
| 185 | Ga0114129_10084911 | 3300009147 | Bacteria | 4393 |
| 186 | Ga0114129_10184782 | 3300009147 | Bacteria | 2834 |
| 187 | Ga0114129_10311334 | 3300009147 | Bacteria | 2096 |
| 188 | Ga0114129_10442771 | 3300009147 | Bacteria | 1705 |
| 189 | Ga0114129_10725485 | 3300009147 | Bacteria | 1275 |
| 190 | Ga0114129_11926580 | 3300009147 | Bacteria | 716 |
| 191 | Ga0114129_12149990 | 3300009147 | Bacteria | 672 |
| 192 | Ga0105243_10478429 | 3300009148 | Bacteria | 1175 |
| 193 | Ga0105243_11323375 | 3300009148 | Bacteria | 738 |
| 194 | Ga0105241_10615959 | 3300009174 | Bacteria | 982 |
| 195 | Ga0105242_10127614 | 3300009176 | Bacteria | 2191 |
| 196 | Ga0105242_11749776 | 3300009176 | Bacteria | 659 |
| 197 | Ga0105248_10496622 | 3300009177 | Bacteria | 1376 |
| 198 | Ga0105237_10229317 | 3300009545 | Bacteria | 1858 |
| 199 | Ga0105249_10442613 | 3300009553 | Bacteria | 1337 |
| 200 | Ga0105249_10513405 | 3300009553 | Bacteria | 1245 |
| 201 | Ga0105249_10874936 | 3300009553 | Bacteria | 965 |
| 202 | Ga0099796_10045114 | 3300010159 | Bacteria | 1509 |
| 203 | Ga0099796_10055402 | 3300010159 | Bacteria | 1389 |
| 204 | Ga0099796_10152577 | 3300010159 | Bacteria | 911 |
| 205 | Ga0105239_10350481 | 3300010375 | Bacteria | 1667 |
| 206 | Ga0105239_10494552 | 3300010375 | Bacteria | 1390 |
| 207 | Ga0105246_10057227 | 3300011119 | Bacteria | 2697 |
| 208 | Ga0105246_10201665 | 3300011119 | Bacteria | 1547 |
| 209 | Ga0105246_10749043 | 3300011119 | Bacteria | 861 |
| 210 | Ga0105246_11279359 | 3300011119 | Bacteria | 679 |
| 211 | Ga0157342_1019718 | 3300012507 | Unclassified | 774 |
| 212 | Ga0157369_10004170 | 3300013105 | Bacteria | 17125 |
| 213 | Ga0157374_10333944 | 3300013296 | Bacteria | 1504 |
| 214 | Ga0157374_11534609 | 3300013296 | Bacteria | 690 |
| 215 | Ga0157378_10418221 | 3300013297 | Bacteria | 1324 |
| 216 | Ga0163162_10427475 | 3300013306 | Bacteria | 1456 |
| 217 | Ga0163162_11100096 | 3300013306 | Bacteria | 900 |
| 218 | Ga0157375_10613567 | 3300013308 | Bacteria | 1246 |
| 219 | Ga0157375_10898303 | 3300013308 | Unclassified | 1030 |
| 220 | Ga0163163_10243969 | 3300014325 | Bacteria | 1846 |
| 221 | Ga0163163_10293202 | 3300014325 | Bacteria | 1679 |
| 222 | Ga0163163_10333760 | 3300014325 | Unclassified | 1571 |
| 223 | Ga0163163_11053408 | 3300014325 | Bacteria | 876 |
| 224 | Ga0157380_10054439 | 3300014326 | Bacteria | 3175 |
| 225 | Ga0157380_10785917 | 3300014326 | Bacteria | 967 |
| 226 | Ga0182008_10048561 | 3300014497 | Bacteria | 2107 |
| 227 | Ga0157377_10135919 | 3300014745 | Bacteria | 1506 |
| 228 | Ga0157377_10617164 | 3300014745 | Bacteria | 776 |
| 229 | Ga0157379_10268918 | 3300014968 | Bacteria | 1550 |
| 230 | Ga0157376_10040586 | 3300014969 | Bacteria | 3805 |
| 231 | Ga0163161_10248962 | 3300017792 | Bacteria | 1384 |
| 232 | Ga0163161_10595774 | 3300017792 | Bacteria | 911 |
| 233 | Ga0213872_10043676 | 3300021361 | Bacteria | 2042 |
| 234 | Ga0213874_10070323 | 3300021377 | Bacteria | 1115 |
| 235 | Ga0213876_10118109 | 3300021384 | Bacteria | 1408 |
| 236 | Ga0213876_10658730 | 3300021384 | Bacteria | 557 |
| 237 | Ga0209758_1002876 | 3300025297 | Bacteria | 16678 |
| 238 | Ga0207697_10059716 | 3300025315 | Bacteria | 1585 |
| 239 | Ga0207692_10079882 | 3300025898 | Bacteria | 1746 |
| 240 | Ga0207692_10095425 | 3300025898 | Bacteria | 1622 |
| 241 | Ga0207710_10093381 | 3300025900 | Bacteria | 1411 |
| 242 | Ga0207688_10028562 | 3300025901 | Bacteria | 3068 |
| 243 | Ga0207688_10252293 | 3300025901 | Bacteria | 1069 |
| 244 | Ga0207680_10128683 | 3300025903 | Bacteria | 1666 |
| 245 | Ga0207647_10007491 | 3300025904 | Bacteria | 7886 |
| 246 | Ga0207647_10085257 | 3300025904 | Bacteria | 1890 |
| 247 | Ga0207685_10000972 | 3300025905 | Bacteria | 5532 |
| 248 | Ga0207685_10023170 | 3300025905 | Bacteria | 2110 |
| 249 | Ga0207685_10410439 | 3300025905 | Unclassified | 696 |
| 250 | Ga0207699_10074924 | 3300025906 | Bacteria | 2080 |
| 251 | Ga0207645_10005079 | 3300025907 | Bacteria | 9637 |
| 252 | Ga0207643_10001128 | 3300025908 | Bacteria | 15876 |
| 253 | Ga0207705_10828753 | 3300025909 | Bacteria | 718 |
| 254 | Ga0207684_10217177 | 3300025910 | Bacteria | 1650 |
| 255 | Ga0207684_10280034 | 3300025910 | Bacteria | 1438 |
| 256 | Ga0207707_10078620 | 3300025912 | Bacteria | 2881 |
| 257 | Ga0207707_10083019 | 3300025912 | Bacteria | 2798 |
| 258 | Ga0207671_10076704 | 3300025914 | Bacteria | 2501 |
| 259 | Ga0207693_10000564 | 3300025915 | Bacteria | 33530 |
| 260 | Ga0207693_10001853 | 3300025915 | Bacteria | 18527 |
| 261 | Ga0207693_10011503 | 3300025915 | Bacteria | 7156 |
| 262 | Ga0207693_10082723 | 3300025915 | Bacteria | 2514 |
| 263 | Ga0207693_10201668 | 3300025915 | Bacteria | 1564 |
| 264 | Ga0207693_10353865 | 3300025915 | Bacteria | 1149 |
| 265 | Ga0207693_10404720 | 3300025915 | Bacteria | 1067 |
| 266 | Ga0207663_10002863 | 3300025916 | Bacteria | 8340 |
| 267 | Ga0207663_10042119 | 3300025916 | Bacteria | 2788 |
| 268 | Ga0207663_10135075 | 3300025916 | Bacteria | 1710 |
| 269 | Ga0207663_10386291 | 3300025916 | Bacteria | 1067 |
| 270 | Ga0207663_10645702 | 3300025916 | Bacteria | 835 |
| 271 | Ga0207660_10145978 | 3300025917 | Bacteria | 1813 |
| 272 | Ga0207662_10089026 | 3300025918 | Bacteria | 1896 |
| 273 | Ga0207657_10129109 | 3300025919 | Bacteria | 2073 |
| 274 | Ga0207657_10189770 | 3300025919 | Bacteria | 1658 |
| 275 | Ga0207652_10049692 | 3300025921 | Bacteria | 3591 |
| 276 | Ga0207652_10625871 | 3300025921 | Bacteria | 964 |
| 277 | Ga0207681_10148278 | 3300025923 | Bacteria | 1755 |
| 278 | Ga0207659_10023144 | 3300025926 | Bacteria | 4143 |
| 279 | Ga0207700_10001282 | 3300025928 | Bacteria | 14331 |
| 280 | Ga0207700_10059362 | 3300025928 | Bacteria | 2893 |
| 281 | Ga0207700_10240937 | 3300025928 | Bacteria | 1541 |
| 282 | Ga0207700_10359851 | 3300025928 | Bacteria | 1269 |
| 283 | Ga0207700_11590165 | 3300025928 | Bacteria | 578 |
| 284 | Ga0207664_10020726 | 3300025929 | Bacteria | 4879 |
| 285 | Ga0207664_10865021 | 3300025929 | Bacteria | 812 |
| 286 | Ga0207706_10004504 | 3300025933 | Bacteria | 13082 |
| 287 | Ga0207706_10670462 | 3300025933 | Unclassified | 887 |
| 288 | Ga0207706_11575269 | 3300025933 | Unclassified | 533 |
| 289 | Ga0207709_10020604 | 3300025935 | Bacteria | 3723 |
| 290 | Ga0207669_10066269 | 3300025937 | Bacteria | 2244 |
| 291 | Ga0207669_10291756 | 3300025937 | Bacteria | 1235 |
| 292 | Ga0207704_10039472 | 3300025938 | Bacteria | 2749 |
| 293 | Ga0207704_10266338 | 3300025938 | Bacteria | 1295 |
| 294 | Ga0207704_10639504 | 3300025938 | Bacteria | 875 |
| 295 | Ga0207665_10000864 | 3300025939 | Bacteria | 20479 |
| 296 | Ga0207665_10014272 | 3300025939 | Bacteria | 5230 |
| 297 | Ga0207665_10273603 | 3300025939 | Bacteria | 1255 |
| 298 | Ga0207691_10114700 | 3300025940 | Bacteria | 2393 |
| 299 | Ga0207691_10197038 | 3300025940 | Bacteria | 1754 |
| 300 | Ga0207711_10172441 | 3300025941 | Bacteria | 1963 |
| 301 | Ga0207689_10047702 | 3300025942 | Bacteria | 3534 |
| 302 | Ga0207689_10495676 | 3300025942 | Bacteria | 1023 |
| 303 | Ga0207661_11167429 | 3300025944 | Unclassified | 709 |
| 304 | Ga0207667_10544718 | 3300025949 | Bacteria | 1174 |
| 305 | Ga0207667_12049590 | 3300025949 | Bacteria | 532 |
| 306 | Ga0207712_10254309 | 3300025961 | Bacteria | 1422 |
| 307 | Ga0207712_10280071 | 3300025961 | Bacteria | 1361 |
| 308 | Ga0207640_10219980 | 3300025981 | Bacteria | 1453 |
| 309 | Ga0207658_10065917 | 3300025986 | Bacteria | 2722 |
| 310 | Ga0207658_10655185 | 3300025986 | Bacteria | 947 |
| 311 | Ga0207677_10230644 | 3300026023 | Bacteria | 1491 |
| 312 | Ga0207703_10077185 | 3300026035 | Bacteria | 2765 |
| 313 | Ga0207639_10933818 | 3300026041 | Bacteria | 811 |
| 314 | Ga0207678_10005216 | 3300026067 | Bacteria | 11644 |
| 315 | Ga0207708_10001094 | 3300026075 | Bacteria | 20325 |
| 316 | Ga0207708_10250468 | 3300026075 | Bacteria | 1427 |
| 317 | Ga0207708_10627320 | 3300026075 | Bacteria | 913 |
| 318 | Ga0207702_10148930 | 3300026078 | Bacteria | 2127 |
| 319 | Ga0207641_10151367 | 3300026088 | Bacteria | 2101 |
| 320 | Ga0207641_10744596 | 3300026088 | Bacteria | 967 |
| 321 | Ga0207648_10009306 | 3300026089 | Bacteria | 9419 |
| 322 | Ga0207648_11643681 | 3300026089 | Bacteria | 603 |
| 323 | Ga0207676_10077488 | 3300026095 | Bacteria | 2689 |
| 324 | Ga0207674_10023673 | 3300026116 | Bacteria | 6574 |
| 325 | Ga0207675_100011964 | 3300026118 | Bacteria | 8109 |
| 326 | Ga0207675_100638858 | 3300026118 | Bacteria | 1070 |
| 327 | Ga0207683_10041081 | 3300026121 | Bacteria | 4037 |
| 328 | Ga0207683_10136908 | 3300026121 | Bacteria | 2204 |
| 329 | Ga0207683_10305700 | 3300026121 | Bacteria | 1455 |
| 330 | Ga0207698_10077364 | 3300026142 | Bacteria | 2668 |
| 331 | Ga0207698_11204735 | 3300026142 | Bacteria | 771 |
| 332 | Ga0209179_1018933 | 3300027512 | Bacteria | 1320 |
| 333 | Ga0209179_1046447 | 3300027512 | Bacteria | 923 |
| 334 | Ga0209588_1007975 | 3300027671 | Bacteria | 3131 |
| 335 | Ga0209588_1068485 | 3300027671 | Bacteria | 1146 |
| 336 | Ga0209813_10220764 | 3300027866 | Bacteria | 709 |
| 337 | Ga0209813_10360442 | 3300027866 | Bacteria | 578 |
| 338 | Ga0268266_11680103 | 3300028379 | Bacteria | 610 |
| 339 | Ga0268265_10033639 | 3300028380 | Bacteria | 3729 |
| 340 | Ga0268265_11111993 | 3300028380 | Unclassified | 785 |
| 341 | Ga0268265_11627480 | 3300028380 | Unclassified | 651 |
| 342 | Ga0268264_10021384 | 3300028381 | Bacteria | 5283 |
| 343 | Ga0268264_11584430 | 3300028381 | Unclassified | 666 |
| 344 | Ga0265330_10044668 | 3300031235 | Bacteria | 1955 |
| 345 | Ga0265325_10000938 | 3300031241 | Bacteria | 21048 |
| 346 | Ga0265325_10130833 | 3300031241 | Unclassified | 1201 |
| 347 | Ga0265325_10133577 | 3300031241 | Bacteria | 1186 |
| 348 | Ga0265340_10065354 | 3300031247 | Bacteria | 1732 |
| 349 | Ga0265339_10016985 | 3300031249 | Bacteria | 4321 |
| 350 | Ga0265331_10099316 | 3300031250 | Bacteria | 1341 |
| 351 | Ga0265331_10259371 | 3300031250 | Unclassified | 779 |
| 352 | Ga0307408_100543838 | 3300031548 | Bacteria | 1024 |
| 353 | Ga0307406_10854759 | 3300031901 | Bacteria | 772 |
| 354 | Ga0307416_103154128 | 3300032002 | Bacteria | 552 |
| 355 | Ga0307411_12224723 | 3300032005 | Bacteria | 514 |
| 356 | Ga0373926_0010917 | 3300035083 | Bacteria | 3050 |
| 357 | Ga0373934_0079136 | 3300035086 | Bacteria | 1320 |
| 358 | Ga0373944_0009890 | 3300035089 | Bacteria | 2592 |
| 359 | Ga0373923_0001024 | 3300035111 | Bacteria | 7599 |
| 360 | Ga0373936_0004647 | 3300035113 | Bacteria | 5193 |
| 361 | Ga0373936_0106151 | 3300035113 | Bacteria | 1189 |
| 362 | Ga0373936_0340122 | 3300035113 | Bacteria | 682 |
| 363 | Ga0373941_0348862 | 3300035115 | Bacteria | 602 |
| 364 | Ga0373941_0454243 | 3300035115 | Bacteria | 538 |
| 365 | Ga0373945_0091474 | 3300035116 | Bacteria | 1179 |
| 366 | Ga0373945_0175937 | 3300035116 | Bacteria | 879 |
| 367 | Ga0373945_0190161 | 3300035116 | Bacteria | 848 |
| 368 | Ga0373953_0013416 | 3300035117 | Bacteria | 2926 |
| 369 | Ga0373953_0090213 | 3300035117 | Bacteria | 1281 |
| 370 | Ga0373954_0000987 | 3300035118 | Bacteria | 11217 |
| 371 | Ga0373954_0156234 | 3300035118 | Bacteria | 1115 |
| 372 | Ga0373957_0041360 | 3300035120 | Bacteria | 1735 |
| 373 | Ga0373943_0061659 | 3300035170 | Bacteria | 1875 |
| 374 | Ga0373943_0213064 | 3300035170 | Bacteria | 1073 |
| 375 | Ga0373946_0035882 | 3300035171 | Bacteria | 2007 |
| 376 | Ga0373946_0564806 | 3300035171 | Unclassified | 588 |
| 377 | Ga0373955_0002808 | 3300035172 | Bacteria | 7655 |
| 378 | Ga0373955_0553457 | 3300035172 | Unclassified | 704 |
| 379 | Ga0373961_0144478 | 3300035241 | Bacteria | 806 |
| 380 | Ga0373924_0002822 | 3300035410 | Bacteria | 5881 |
| 381 | Ga0373931_0445902 | 3300035691 | Bacteria | 827 |
| 382 | Ga0373935_0000123 | 3300035692 | Bacteria | 34798 |
| 383 | Ga0373935_0067566 | 3300035692 | Bacteria | 2298 |
| 384 | Ga0373927_0032738 | 3300035695 | Bacteria | 3386 |
| 385 | Ga0373927_0032887 | 3300035695 | Bacteria | 3377 |
| 386 | Ga0373927_0037224 | 3300035695 | Bacteria | 3163 |
| 387 | Ga0373927_0306971 | 3300035695 | Bacteria | 1044 |
| 388 | Ga0373947_0002728 | 3300035725 | Bacteria | 10581 |
| 389 | Ga0373947_0033365 | 3300035725 | Bacteria | 3038 |
| 390 | Ga0373947_0203653 | 3300035725 | Bacteria | 1296 |
| 391 | Ga0373947_0233033 | 3300035725 | Bacteria | 1213 |
| 392 | Ga0373937_0000007 | 3300036401 | Bacteria | 183537 |
| 393 | Ga0373937_0021571 | 3300036401 | Bacteria | 5779 |
| 394 | Ga0373925_0000011 | 3300037068 | Bacteria | 209840 |
| 395 | Ga0373925_0047614 | 3300037068 | Bacteria | 3192 |
| 396 | Ga0373925_0248980 | 3300037068 | Bacteria | 1425 |
| 397 | Ga0373925_0367137 | 3300037068 | Bacteria | 1171 |
| 398 | Ga0373925_0433732 | 3300037068 | Bacteria | 1075 |
| 399 | Ga0373925_0875446 | 3300037068 | Bacteria | 740 |
| 400 | Ga0395899_0179704 | 3300037312 | Bacteria | 1486 |
| 401 | Ga0395900_0384323 | 3300037418 | Bacteria | 1371 |
| 402 | Ga0395898_0125844 | 3300037466 | Bacteria | 2455 |
| 403 | Ga0395905_0705508 | 3300037471 | Bacteria | 911 |
| 404 | Ga0436364_0527040 | 3300037853 | Bacteria | 872 |
| 405 | Ga0436364_1527085 | 3300037853 | Bacteria | 1610 |
| 406 | Ga0395901_0939134 | 3300038443 | Bacteria | 844 |
| 407 | Ga0436365_0698136 | 3300039437 | Bacteria | 2351 |
| 408 | Ga0436365_1251157 | 3300039437 | Bacteria | 767 |
| 409 | Ga0436365_1251542 | 3300039437 | Bacteria | 810 |
| 410 | Ga0436365_1653913 | 3300039437 | Bacteria | 1069 |
| 411 | Ga0436365_1914251 | 3300039437 | Bacteria | 2041 |
| 412 | Ga0436360_0276015 | 3300039438 | Bacteria | 1634 |
| 413 | Ga0436361_0022907 | 3300039447 | Bacteria | 863 |
| 414 | Ga0436361_0028523 | 3300039447 | Bacteria | 1687 |
| 415 | Ga0436361_0317799 | 3300039447 | Bacteria | 6320 |
| 416 | Ga0436363_0092101 | 3300039450 | Bacteria | 1246 |
| 417 | Ga0436363_0525082 | 3300039450 | Bacteria | 874 |
| 418 | Ga0436363_1375367 | 3300039450 | Bacteria | 1097 |
| 419 | Ga0436362_0144763 | 3300039453 | Unclassified | 892 |
| 420 | Ga0439453_0052982 | 3300041408 | Unclassified | 824 |
| 421 | Ga0451789_1368216 | 3300041443 | Unclassified | 571 |
| 422 | Ga0451845_0687621 | 3300041501 | Bacteria | 567 |
| 423 | Ga0451853_3761155 | 3300041512 | Bacteria | 1507 |
| 424 | Ga0439441_015847 | 3300042001 | Unclassified | 1338 |
| 425 | Ga0439435_0064608 | 3300042436 | Unclassified | 1073 |
| 426 | Ga0466967_1278730 | 3300045976 | Bacteria | 731 |
| 427 | Ga0495592_0000511 | 3300046454 | Bacteria | 28178 |
| 428 | Ga0495603_0098394 | 3300046455 | Bacteria | 1708 |
| 429 | Ga0495590_0037400 | 3300046457 | Bacteria | 1693 |
| 430 | Ga0495629_0019790 | 3300046459 | Bacteria | 4804 |
| 431 | Ga0495629_0286130 | 3300046459 | Bacteria | 1130 |
| 432 | Ga0495638_0444727 | 3300046460 | Bacteria | 663 |
| 433 | Ga0495638_0656792 | 3300046460 | Bacteria | 509 |
| 434 | Ga0495651_0002325 | 3300046462 | Bacteria | 14671 |
| 435 | Ga0495653_0000190 | 3300046463 | Bacteria | 50144 |
| 436 | Ga0495580_0019951 | 3300046472 | Bacteria | 4970 |
| 437 | Ga0495582_0022972 | 3300046473 | Bacteria | 3411 |
| 438 | Ga0495582_0330861 | 3300046473 | Bacteria | 877 |
| 439 | Ga0495582_0574731 | 3300046473 | Bacteria | 652 |
| 440 | Ga0495605_0002800 | 3300046474 | Bacteria | 10600 |
| 441 | Ga0495605_0114750 | 3300046474 | Bacteria | 1226 |
| 442 | Ga0495639_0059680 | 3300046475 | Bacteria | 1746 |
| 443 | Ga0495639_0380701 | 3300046475 | Unclassified | 711 |
| 444 | Ga0495662_0005258 | 3300046476 | Bacteria | 6486 |
| 445 | Ga0495664_0000464 | 3300046477 | Bacteria | 20002 |
| 446 | Ga0495584_0019223 | 3300046491 | Bacteria | 3470 |
| 447 | Ga0495584_0144383 | 3300046491 | Bacteria | 1209 |
| 448 | Ga0495584_0200973 | 3300046491 | Bacteria | 1013 |
| 449 | Ga0495585_0055484 | 3300046492 | Bacteria | 2189 |
| 450 | Ga0495585_0131634 | 3300046492 | Bacteria | 1316 |
| 451 | Ga0495594_0009610 | 3300046499 | Bacteria | 4999 |
| 452 | Ga0495596_0073796 | 3300046500 | Unclassified | 1325 |
| 453 | Ga0495606_0003567 | 3300046507 | Bacteria | 16407 |
| 454 | Ga0495608_0000004 | 3300046511 | Bacteria | 355027 |
| 455 | Ga0495610_0005010 | 3300046512 | Bacteria | 9583 |
| 456 | Ga0495618_0000392 | 3300046514 | Bacteria | 31551 |
| 457 | Ga0495618_0109382 | 3300046514 | Bacteria | 1770 |
| 458 | Ga0495620_0084731 | 3300046515 | Bacteria | 1278 |
| 459 | Ga0495628_0000006 | 3300046516 | Bacteria | 306606 |
| 460 | Ga0495630_0003456 | 3300046517 | Bacteria | 10981 |
| 461 | Ga0495630_0467009 | 3300046517 | Bacteria | 967 |
| 462 | Ga0495631_0057609 | 3300046518 | Bacteria | 1691 |
| 463 | Ga0495632_0116706 | 3300046519 | Bacteria | 1250 |
| 464 | Ga0495637_0220301 | 3300046520 | Bacteria | 691 |
| 465 | Ga0495644_0023479 | 3300046523 | Bacteria | 2347 |
| 466 | Ga0495644_0209011 | 3300046523 | Bacteria | 753 |
| 467 | Ga0495663_0138501 | 3300046525 | Unclassified | 825 |
| 468 | Ga0495642_0440488 | 3300046528 | Bacteria | 575 |
| 469 | Ga0495652_0005358 | 3300046529 | Bacteria | 12091 |
| 470 | Ga0495665_0155331 | 3300046531 | Bacteria | 1193 |
| 471 | Ga0495640_0000013 | 3300046533 | Bacteria | 172438 |
| 472 | Ga0495640_0792259 | 3300046533 | Unclassified | 565 |
| 473 | Ga0495587_0000004 | 3300046536 | Bacteria | 358433 |
| 474 | Ga0495598_0019418 | 3300046537 | Bacteria | 1782 |
| 475 | Ga0495598_0456951 | 3300046537 | Unclassified | 506 |
| 476 | Ga0495609_0057540 | 3300046538 | Bacteria | 1721 |
| 477 | Ga0495621_0038709 | 3300046539 | Bacteria | 1665 |
| 478 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 479 | Ga0495645_0864302 | 3300046543 | Unclassified | 539 |
| 480 | Ga0495633_0105247 | 3300046558 | Bacteria | 1309 |
| 481 | Ga0495633_0199525 | 3300046558 | Bacteria | 919 |
| 482 | Ga0495667_0000084 | 3300046559 | Bacteria | 67342 |
| 483 | Ga0495656_0035412 | 3300046615 | Bacteria | 2051 |
| 484 | Ga0495656_0043815 | 3300046615 | Bacteria | 1881 |
| 485 | Ga0495668_0094183 | 3300046616 | Bacteria | 1640 |
| 486 | Ga0495668_0743960 | 3300046616 | Bacteria | 543 |
| 487 | Ga0495634_0000164 | 3300046642 | Bacteria | 60673 |
| 488 | Ga0495611_0034832 | 3300046648 | Bacteria | 2228 |
| 489 | Ga0495635_0000003 | 3300046663 | Bacteria | 390055 |
| 490 | Ga0495659_0034527 | 3300046664 | Bacteria | 1779 |
| 491 | Ga0495659_0102343 | 3300046664 | Bacteria | 1111 |
| 492 | Ga0495661_0264382 | 3300046665 | Bacteria | 873 |
| 493 | Ga0495588_0119793 | 3300046674 | Bacteria | 1387 |
| 494 | Ga0495657_0000248 | 3300046675 | Bacteria | 49080 |
| 495 | Ga0495599_0000014 | 3300046678 | Bacteria | 177414 |
| 496 | Ga0495623_0000006 | 3300046679 | Bacteria | 140385 |
| 497 | Ga0495646_0000005 | 3300046680 | Bacteria | 266899 |
| 498 | Ga0495647_0565094 | 3300046681 | Unclassified | 532 |
| 499 | Ga0495658_0077900 | 3300046683 | Bacteria | 1939 |
| 500 | Ga0495658_0212192 | 3300046683 | Bacteria | 1210 |
| 501 | Ga0495669_0610730 | 3300046684 | Bacteria | 530 |
| 502 | Ga0495624_0020517 | 3300046690 | Bacteria | 4396 |
| 503 | Ga0495624_0044123 | 3300046690 | Bacteria | 2843 |
| 504 | Ga0495624_0348626 | 3300046690 | Unclassified | 891 |
| 505 | Ga0495670_0251206 | 3300046691 | Bacteria | 943 |
| 506 | Ga0495670_0393065 | 3300046691 | Archaea | 749 |
| 507 | Ga0495670_0716058 | 3300046691 | Unclassified | 546 |
| 508 | Ga0495649_0102010 | 3300046694 | Bacteria | 1524 |
| 509 | Ga0495649_0149849 | 3300046694 | Bacteria | 1226 |
| 510 | Ga0495600_0000005 | 3300046809 | Bacteria | 171675 |
| 511 | Ga0495581_0027214 | 3300047315 | Bacteria | 3316 |
| 512 | Ga0495581_0092137 | 3300047315 | Bacteria | 1759 |
| 513 | Ga0495604_0000002 | 3300047317 | Bacteria | 530904 |
| 514 | Ga0495674_0000004 | 3300047319 | Bacteria | 531855 |
| 515 | Ga0495676_0025562 | 3300047321 | Bacteria | 5096 |
| 516 | Ga0495676_0123805 | 3300047321 | Bacteria | 1877 |
| 517 | Ga0495676_0126839 | 3300047321 | Bacteria | 1848 |
| 518 | Ga0495680_0000986 | 3300047322 | Bacteria | 31711 |
| 519 | Ga0495680_0833644 | 3300047322 | Unclassified | 600 |
| 520 | Ga0495683_0004622 | 3300047323 | Bacteria | 7764 |
| 521 | Ga0495675_0000053 | 3300047444 | Bacteria | 78760 |
| 522 | Ga0495675_0392612 | 3300047444 | Bacteria | 810 |
| 523 | Ga0495677_0064530 | 3300047445 | Bacteria | 1361 |
| 524 | Ga0495679_104971 | 3300047446 | Bacteria | 782 |
| 525 | Ga0495684_0000004 | 3300047471 | Bacteria | 307093 |
| 526 | Ga0495684_0131588 | 3300047471 | Bacteria | 1879 |
| 527 | Ga0495686_0290789 | 3300047472 | Bacteria | 905 |
| 528 | Ga0495593_0001912 | 3300047673 | Bacteria | 12413 |
| 529 | Ga0495602_0000001 | 3300048088 | Bacteria | 510904 |
| 530 | Ga0495626_0046564 | 3300048091 | Bacteria | 2020 |
| 531 | Ga0496100_0002815 | 3300048903 | Bacteria | 8916 |
| 532 | Ga0496100_0021590 | 3300048903 | Bacteria | 3881 |
| 533 | Ga0496100_0556602 | 3300048903 | Bacteria | 888 |
| 534 | Ga0496100_0882185 | 3300048903 | Bacteria | 702 |
| 535 | Ga0496101_0012301 | 3300048904 | Bacteria | 5708 |
| 536 | Ga0496101_0494373 | 3300048904 | Bacteria | 966 |
| 537 | Ga0496102_0010366 | 3300048905 | Bacteria | 8017 |
| 538 | Ga0496102_0191648 | 3300048905 | Bacteria | 1926 |
| 539 | Ga0496102_0405971 | 3300048905 | Bacteria | 1280 |
| 540 | Ga0496102_0897278 | 3300048905 | Bacteria | 808 |
| 541 | Ga0496102_1433031 | 3300048905 | Unclassified | 610 |
| 542 | Ga0496103_0004418 | 3300048906 | Bacteria | 8529 |
| 543 | Ga0496103_0011877 | 3300048906 | Bacteria | 5169 |
| 544 | Ga0496103_0126171 | 3300048906 | Bacteria | 1632 |
| 545 | Ga0496104_0000661 | 3300048907 | Bacteria | 29545 |
| 546 | Ga0496104_0000886 | 3300048907 | Bacteria | 25752 |
| 547 | Ga0496104_0003228 | 3300048907 | Bacteria | 14034 |
| 548 | Ga0496104_0010977 | 3300048907 | Bacteria | 8104 |
| 549 | Ga0496104_0021434 | 3300048907 | Bacteria | 5932 |
| 550 | Ga0496104_0225924 | 3300048907 | Bacteria | 1784 |
| 551 | Ga0496104_0301467 | 3300048907 | Bacteria | 1515 |
| 552 | Ga0496104_0336097 | 3300048907 | Bacteria | 1423 |
| 553 | Ga0496104_0677249 | 3300048907 | Bacteria | 940 |
| 554 | Ga0496105_0001513 | 3300048908 | Bacteria | 16428 |
| 555 | Ga0496105_0007189 | 3300048908 | Bacteria | 8592 |
| 556 | Ga0496105_0066324 | 3300048908 | Bacteria | 2979 |
| 557 | Ga0496105_0117253 | 3300048908 | Bacteria | 2196 |
| 558 | Ga0496105_0158605 | 3300048908 | Bacteria | 1858 |
| 559 | Ga0496105_0297667 | 3300048908 | Bacteria | 1298 |
| 560 | Ga0496105_0605996 | 3300048908 | Bacteria | 849 |
| 561 | Ga0496106_0003463 | 3300048909 | Bacteria | 11757 |
| 562 | Ga0496106_0025942 | 3300048909 | Bacteria | 4360 |
| 563 | Ga0496106_0036403 | 3300048909 | Bacteria | 3682 |
| 564 | Ga0496106_0077710 | 3300048909 | Bacteria | 2545 |
| 565 | Ga0496106_0207104 | 3300048909 | Bacteria | 1562 |
| 566 | Ga0496106_0332752 | 3300048909 | Bacteria | 1219 |
| 567 | Ga0496106_0643313 | 3300048909 | Unclassified | 847 |
| 568 | Ga0496106_0744486 | 3300048909 | Bacteria | 779 |
| 569 | Ga0496107_0003468 | 3300048910 | Bacteria | 10535 |
| 570 | Ga0496107_0049981 | 3300048910 | Bacteria | 3014 |
| 571 | Ga0496107_0112065 | 3300048910 | Bacteria | 2005 |
| 572 | Ga0496107_0149251 | 3300048910 | Bacteria | 1729 |
| 573 | Ga0496107_0223177 | 3300048910 | Bacteria | 1402 |
| 574 | Ga0496108_0001416 | 3300048911 | Bacteria | 18909 |
| 575 | Ga0496108_0033849 | 3300048911 | Bacteria | 4244 |
| 576 | Ga0496108_0044856 | 3300048911 | Bacteria | 3691 |
| 577 | Ga0496108_0160338 | 3300048911 | Bacteria | 1943 |
| 578 | Ga0496108_0238760 | 3300048911 | Bacteria | 1581 |
| 579 | Ga0496108_0406983 | 3300048911 | Bacteria | 1188 |
| 580 | Ga0496108_0975701 | 3300048911 | Bacteria | 725 |
| 581 | Ga0496109_0003855 | 3300048912 | Bacteria | 12525 |
| 582 | Ga0496109_0021144 | 3300048912 | Bacteria | 5752 |
| 583 | Ga0496109_0054892 | 3300048912 | Bacteria | 3633 |
| 584 | Ga0496109_0089895 | 3300048912 | Bacteria | 2840 |
| 585 | Ga0496109_0196191 | 3300048912 | Bacteria | 1898 |
| 586 | Ga0496109_0472279 | 3300048912 | Bacteria | 1184 |
| 587 | Ga0496109_0812157 | 3300048912 | Bacteria | 873 |
| 588 | Ga0496110_0000441 | 3300048913 | Bacteria | 28247 |
| 589 | Ga0496110_0006376 | 3300048913 | Bacteria | 9329 |
| 590 | Ga0496110_0056733 | 3300048913 | Bacteria | 3447 |
| 591 | Ga0496110_0092279 | 3300048913 | Bacteria | 2709 |
| 592 | Ga0496110_0092398 | 3300048913 | Bacteria | 2708 |
| 593 | Ga0496110_0111049 | 3300048913 | Bacteria | 2464 |
| 594 | Ga0496110_0392815 | 3300048913 | Bacteria | 1264 |
| 595 | Ga0496110_0699149 | 3300048913 | Unclassified | 915 |
| 596 | Ga0496110_0889436 | 3300048913 | Bacteria | 796 |
| 597 | Ga0496110_1033517 | 3300048913 | Unclassified | 729 |
| 598 | Ga0496110_1506172 | 3300048913 | Bacteria | 582 |
| 599 | Ga0496111_0000624 | 3300048914 | Bacteria | 18747 |
| 600 | Ga0496111_0000741 | 3300048914 | Bacteria | 17414 |
| 601 | Ga0496111_0002966 | 3300048914 | Bacteria | 10397 |
| 602 | Ga0496111_0453193 | 3300048914 | Bacteria | 946 |
| 603 | Ga0496111_0469143 | 3300048914 | Bacteria | 928 |
| 604 | Ga0496112_0004796 | 3300048915 | Bacteria | 11540 |
| 605 | Ga0496112_0006447 | 3300048915 | Bacteria | 10303 |
| 606 | Ga0496112_0015544 | 3300048915 | Bacteria | 7108 |
| 607 | Ga0496112_0031599 | 3300048915 | Bacteria | 5136 |
| 608 | Ga0496112_0229187 | 3300048915 | Bacteria | 1812 |
| 609 | Ga0496112_0457994 | 3300048915 | Bacteria | 1213 |
| 610 | Ga0496112_0702180 | 3300048915 | Unclassified | 939 |
| 611 | Ga0496112_1577809 | 3300048915 | Bacteria | 570 |
| 612 | Ga0496113_0002612 | 3300048916 | Bacteria | 10540 |
| 613 | Ga0496113_0084834 | 3300048916 | Bacteria | 2432 |
| 614 | Ga0496113_0106937 | 3300048916 | Bacteria | 2173 |
| 615 | Ga0496113_0213680 | 3300048916 | Bacteria | 1536 |
| 616 | Ga0496113_0299600 | 3300048916 | Bacteria | 1287 |
| 617 | Ga0496113_0581115 | 3300048916 | Bacteria | 897 |
| 618 | Ga0496113_1082806 | 3300048916 | Bacteria | 629 |
| 619 | Ga0496114_0044845 | 3300048917 | Bacteria | 3671 |
| 620 | Ga0496114_0058015 | 3300048917 | Bacteria | 3232 |
| 621 | Ga0496114_0106765 | 3300048917 | Bacteria | 2396 |
| 622 | Ga0496114_0195984 | 3300048917 | Bacteria | 1768 |
| 623 | Ga0496115_0008940 | 3300048918 | Bacteria | 7429 |
| 624 | Ga0496115_0202095 | 3300048918 | Bacteria | 1641 |
| 625 | Ga0496115_0452088 | 3300048918 | Unclassified | 1037 |
| 626 | Ga0496115_1138739 | 3300048918 | Bacteria | 589 |
| 627 | Ga0496117_0001630 | 3300048920 | Bacteria | 31646 |
| 628 | Ga0496117_0041352 | 3300048920 | Bacteria | 3378 |
| 629 | Ga0496118_0000198 | 3300048921 | Bacteria | 105857 |
| 630 | Ga0496118_0007169 | 3300048921 | Bacteria | 11920 |
| 631 | Ga0496123_0040147 | 3300048926 | Bacteria | 3264 |
| 632 | Ga0496125_0221221 | 3300048928 | Bacteria | 1220 |
| 633 | Ga0501031_0068408 | 3300049568 | Bacteria | 2313 |
| 634 | Ga0501031_0789523 | 3300049568 | Bacteria | 609 |
| 635 | Ga0501032_0033597 | 3300049569 | Bacteria | 3513 |
| 636 | Ga0501033_0008019 | 3300049570 | Bacteria | 8183 |
| 637 | Ga0501034_0027191 | 3300049571 | Bacteria | 5819 |
| 638 | Ga0501034_0654529 | 3300049571 | Bacteria | 952 |
| 639 | Ga0501036_0013392 | 3300049572 | Bacteria | 6815 |
| 640 | Ga0501036_0431761 | 3300049572 | Bacteria | 1098 |
| 641 | Ga0501037_0006901 | 3300049573 | Bacteria | 8291 |
| 642 | Ga0501038_0002228 | 3300049574 | Bacteria | 18040 |
| 643 | Ga0501038_0354442 | 3300049574 | Bacteria | 1142 |
| 644 | Ga0501038_0754527 | 3300049574 | Bacteria | 726 |
| 645 | Ga0501039_0016251 | 3300049575 | Bacteria | 5700 |
| 646 | Ga0501040_0265288 | 3300049576 | Bacteria | 1226 |
| 647 | Ga0501041_0776963 | 3300049577 | Unclassified | 614 |
| 648 | Ga0501042_0224241 | 3300049578 | Bacteria | 1356 |
| 649 | Ga0501042_1058885 | 3300049578 | Unclassified | 591 |
| 650 | Ga0501043_0011913 | 3300049579 | Bacteria | 6803 |
| 651 | Ga0501046_0010815 | 3300049580 | Bacteria | 7823 |
| 652 | Ga0501046_0512025 | 3300049580 | Bacteria | 859 |
| 653 | Ga0501047_0010793 | 3300049581 | Bacteria | 8636 |
| 654 | Ga0501048_0008167 | 3300049582 | Bacteria | 7916 |
| 655 | Ga0501048_0221018 | 3300049582 | Bacteria | 1344 |
| 656 | Ga0501067_0010362 | 3300049583 | Bacteria | 5158 |
| 657 | Ga0501067_0137532 | 3300049583 | Bacteria | 1360 |
| 658 | Ga0501067_0532963 | 3300049583 | Bacteria | 657 |
| 659 | Ga0501068_0004223 | 3300049584 | Bacteria | 7794 |
| 660 | Ga0501069_0005631 | 3300049585 | Bacteria | 6518 |
| 661 | Ga0501070_0014893 | 3300049586 | Bacteria | 6540 |
| 662 | Ga0501071_0013351 | 3300049587 | Bacteria | 5596 |
| 663 | Ga0501071_1305115 | 3300049587 | Bacteria | 561 |
| 664 | Ga0501072_0269019 | 3300049588 | Bacteria | 1356 |
| 665 | Ga0501072_0640286 | 3300049588 | Bacteria | 837 |
| 666 | Ga0501073_0012398 | 3300049589 | Bacteria | 6220 |
| 667 | Ga0501074_0000430 | 3300049590 | Bacteria | 25105 |
| 668 | Ga0501075_0144365 | 3300049591 | Bacteria | 1814 |
| 669 | Ga0501075_0689381 | 3300049591 | Bacteria | 778 |
| 670 | Ga0501076_0029352 | 3300049592 | Bacteria | 4277 |
| 671 | Ga0501079_0010782 | 3300049741 | Bacteria | 6959 |
| 672 | Ga0501079_0213358 | 3300049741 | Bacteria | 1508 |
| 673 | Ga0501079_0410062 | 3300049741 | Bacteria | 1063 |
| 674 | Ga0501079_0604874 | 3300049741 | Archaea | 863 |
| 675 | Ga0501079_0845630 | 3300049741 | Bacteria | 721 |
| 676 | Ga0501079_0988856 | 3300049741 | Unclassified | 663 |
| 677 | Ga0501080_0008809 | 3300049742 | Bacteria | 9169 |
| 678 | Ga0501081_0583907 | 3300049743 | Bacteria | 836 |
| 679 | Ga0501081_1047239 | 3300049743 | Bacteria | 617 |
| 680 | Ga0501083_0220725 | 3300049744 | Bacteria | 1235 |
| 681 | Ga0501083_1129736 | 3300049744 | Unclassified | 510 |
| 682 | Ga0501035_0013095 | 3300049822 | Bacteria | 7654 |
| 683 | Ga0501044_0001797 | 3300049823 | Bacteria | 25029 |
| 684 | Ga0501044_0017730 | 3300049823 | Bacteria | 7637 |
| 685 | Ga0501045_0005187 | 3300049824 | Bacteria | 9007 |
| 686 | nmdc:mga03683_170874_c1 | 3300050489 | Bacteria | 988 |
| 687 | nmdc:mga03683_218808_c1 | 3300050489 | Bacteria | 878 |
| 688 | nmdc:mga03683_403892_c1 | 3300050489 | Unclassified | 653 |
| 689 | nmdc:mga03683_477937_c1 | 3300050489 | Bacteria | 602 |
| 690 | nmdc:mga03683_70163_c1 | 3300050489 | Bacteria | 1496 |
| 691 | nmdc:mga00v17_271797_c1 | 3300050491 | Bacteria | 1100 |
| 692 | nmdc:mga0yw44_1131_c1 | 3300050492 | Bacteria | 10318 |
| 693 | nmdc:mga0yw44_136306_c1 | 3300050492 | Bacteria | 1593 |
| 694 | nmdc:mga0yw44_17009_c1 | 3300050492 | Unclassified | 3945 |
| 695 | nmdc:mga0yw44_668414_c1 | 3300050492 | Bacteria | 706 |
| 696 | nmdc:mga0yw44_96584_c1 | 3300050492 | Bacteria | 1876 |
| 697 | nmdc:mga0k408_5297_c1 | 3300050493 | Bacteria | 6850 |
| 698 | nmdc:mga06z11_166752_c1 | 3300050494 | Unclassified | 1262 |
| 699 | nmdc:mga06z11_176136_c1 | 3300050494 | Bacteria | 1231 |
| 700 | nmdc:mga06z11_179535_c1 | 3300050494 | Bacteria | 1220 |
| 701 | nmdc:mga06z11_247249_c1 | 3300050494 | Bacteria | 1049 |
| 702 | nmdc:mga06z11_73668_c1 | 3300050494 | Bacteria | 1814 |
| 703 | nmdc:mga04h51_250745_c1 | 3300050495 | Bacteria | 709 |
| 704 | nmdc:mga07m45_524849_c1 | 3300050496 | Bacteria | 685 |
| 705 | nmdc:mga05p37_1153149_c1 | 3300050507 | Bacteria | 806 |
| 706 | nmdc:mga05p37_43029_c1 | 3300050507 | Bacteria | 5553 |
| 707 | nmdc:mga05p37_462958_c1 | 3300050507 | Bacteria | 1465 |
| 708 | nmdc:mga05p37_4669_c1 | 3300050507 | Bacteria | 16011 |
| 709 | nmdc:mga05p37_508993_c1 | 3300050507 | Bacteria | 1380 |
| 710 | nmdc:mga05p37_775726_c1 | 3300050507 | Bacteria | 1053 |
| 711 | nmdc:mga09592_209277_c1 | 3300050508 | Bacteria | 1689 |
| 712 | nmdc:mga09592_247351_c1 | 3300050508 | Bacteria | 1545 |
| 713 | nmdc:mga09592_384510_c1 | 3300050508 | Bacteria | 1213 |
| 714 | nmdc:mga09592_87284_c1 | 3300050508 | Bacteria | 2663 |
| 715 | nmdc:mga0qj67_137374_c1 | 3300050509 | Bacteria | 1981 |
| 716 | nmdc:mga0qj67_19_c1 | 3300050509 | Bacteria | 112208 |
| 717 | nmdc:mga06r32_1175528_c1 | 3300050510 | Bacteria | 714 |
| 718 | nmdc:mga06r32_119432_c1 | 3300050510 | Bacteria | 2599 |
| 719 | nmdc:mga06r32_207328_c1 | 3300050510 | Bacteria | 1948 |
| 720 | nmdc:mga06r32_880464_c1 | 3300050510 | Bacteria | 853 |
| 721 | nmdc:mga08y16_1182556_c1 | 3300050511 | Bacteria | 736 |
| 722 | nmdc:mga08y16_1305796_c1 | 3300050511 | Bacteria | 692 |
| 723 | nmdc:mga08y16_17233_c1 | 3300050511 | Bacteria | 7603 |
| 724 | nmdc:mga08y16_600667_c1 | 3300050511 | Bacteria | 1109 |
| 725 | nmdc:mga08y16_790314_c1 | 3300050511 | Unclassified | 942 |
| 726 | nmdc:mga0n895_121384_c1 | 3300050512 | Bacteria | 2634 |
| 727 | nmdc:mga0n895_1350920_c1 | 3300050512 | Bacteria | 682 |
| 728 | nmdc:mga0rr50_1118859_c1 | 3300050513 | Unclassified | 670 |
| 729 | nmdc:mga0rr50_299314_c1 | 3300050513 | Bacteria | 1345 |
| 730 | nmdc:mga0rr50_347939_c1 | 3300050513 | Bacteria | 1246 |
| 731 | nmdc:mga08x19_102122_c1 | 3300050514 | Bacteria | 1904 |
| 732 | nmdc:mga08x19_59654_c1 | 3300050514 | Bacteria | 2470 |
| 733 | nmdc:mga0a205_167259_c1 | 3300050515 | Bacteria | 2094 |
| 734 | nmdc:mga0a205_535083_c1 | 3300050515 | Bacteria | 1027 |
| 735 | Ga0495601_0000078 | 3300053077 | Bacteria | 51996 |
| 736 | Ga0495601_0348976 | 3300053077 | Bacteria | 962 |
| 737 | Ga0495601_1045832 | 3300053077 | Unclassified | 512 |
| 738 | Ga0495612_0000005 | 3300053078 | Bacteria | 286943 |
| 739 | Ga0495612_0408690 | 3300053078 | Bacteria | 617 |
| 740 | Ga0495655_0010780 | 3300053083 | Bacteria | 1816 |
| 741 | Ga0495655_0067737 | 3300053083 | Bacteria | 990 |
| 742 | Ga0495595_0000065 | 3300053084 | Bacteria | 52635 |
| 743 | Ga0495595_0281379 | 3300053084 | Bacteria | 835 |
| 744 | Ga0495619_0000003 | 3300053085 | Bacteria | 515784 |
| 745 | Ga0495619_0090141 | 3300053085 | Bacteria | 2075 |
| 746 | Ga0495619_0475460 | 3300053085 | Bacteria | 860 |
| 747 | Ga0495619_0574633 | 3300053085 | Bacteria | 772 |
| 748 | Ga0495619_0666556 | 3300053085 | Bacteria | 709 |
| 749 | Ga0500641_0230864 | 3300053096 | Bacteria | 782 |
| 750 | Ga0500641_0248279 | 3300053096 | Unclassified | 747 |
| 751 | Ga0500595_005091 | 3300053119 | Bacteria | 5774 |
| 752 | Ga0500616_0230436 | 3300053153 | Bacteria | 802 |
| 753 | Ga0501084_0016675 | 3300054114 | Bacteria | 6102 |
| 754 | Ga0501084_0167468 | 3300054114 | Bacteria | 1855 |
| 755 | Ga0501084_0642877 | 3300054114 | Unclassified | 896 |
| 756 | Ga0501082_0018907 | 3300060353 | Bacteria | 5936 |
| 757 | Ga0501082_0102022 | 3300060353 | Bacteria | 2482 |
| 758 | Ga0530510_0046536 | 3300061734 | Bacteria | 3134 |
| 759 | Ga0530510_0066928 | 3300061734 | Bacteria | 2606 |
| 760 | Ga0530510_1247664 | 3300061734 | Bacteria | 570 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035171 | Ga0373946_0564806 | Ga0373946_0564806_17_400 | 125 |
| 2 | 3300046690 | Ga0495624_0348626 | Ga0495624_0348626_14_397 | 125 |
| 3 | 3300049578 | Ga0501042_1058885 | Ga0501042_1058885_18_419 | 131 |
| 4 | 3300050492 | nmdc:mga0yw44_668414_c1 | nmdc:mga0yw44_668414_c1_295_696 | 131 |
| 5 | 3300050510 | nmdc:mga06r32_880464_c1 | nmdc:mga06r32_880464_c1_435_836 | 131 |
| 6 | 3300031241 | Ga0265325_10133577 | Ga0265325_101335772 | 132 |
| 7 | 3300031247 | Ga0265340_10065354 | Ga0265340_100653542 | 132 |
| 8 | 3300009147 | Ga0114129_11926580 | Ga0114129_119265802 | 133 |
| 9 | 3300037068 | Ga0373925_0433732 | Ga0373925_0433732_239_664 | 133 |
| 10 | 3300050507 | nmdc:mga05p37_462958_c1 | nmdc:mga05p37_462958_c1_56_466 | 133 |
| 11 | 3300050508 | nmdc:mga09592_87284_c1 | nmdc:mga09592_87284_c1_1758_2168 | 133 |
| 12 | 3300050509 | nmdc:mga0qj67_137374_c1 | nmdc:mga0qj67_137374_c1_40_450 | 133 |
| 13 | 3300050510 | nmdc:mga06r32_207328_c1 | nmdc:mga06r32_207328_c1_393_803 | 133 |
| 14 | 3300009094 | Ga0111539_10011398 | Ga0111539_1001139812 | 134 |
| 15 | 3300025928 | Ga0207700_11590165 | Ga0207700_115901651 | 134 |
| 16 | 3300026142 | Ga0207698_11204735 | Ga0207698_112047352 | 134 |
| 17 | 3300035172 | Ga0373955_0553457 | Ga0373955_0553457_28_456 | 134 |
| 18 | 3300047444 | Ga0495675_0392612 | Ga0495675_0392612_160_588 | 134 |
| 19 | 3300048903 | Ga0496100_0021590 | Ga0496100_0021590_466_894 | 134 |
| 20 | 3300048907 | Ga0496104_0301467 | Ga0496104_0301467_34_462 | 134 |
| 21 | 3300048908 | Ga0496105_0158605 | Ga0496105_0158605_646_1074 | 134 |
| 22 | 3300048910 | Ga0496107_0049981 | Ga0496107_0049981_1542_1970 | 134 |
| 23 | 3300048911 | Ga0496108_0238760 | Ga0496108_0238760_473_901 | 134 |
| 24 | 3300048912 | Ga0496109_0089895 | Ga0496109_0089895_818_1246 | 134 |
| 25 | 3300048917 | Ga0496114_0058015 | Ga0496114_0058015_230_658 | 134 |
| 26 | 3300049583 | Ga0501067_0532963 | Ga0501067_0532963_169_597 | 134 |
| 27 | 3300049588 | Ga0501072_0640286 | Ga0501072_0640286_255_689 | 134 |
| 28 | 3300049741 | Ga0501079_0845630 | Ga0501079_0845630_121_552 | 134 |
| 29 | 3300050511 | nmdc:mga08y16_17233_c1 | nmdc:mga08y16_17233_c1_2179_2613 | 134 |
| 30 | 3300053077 | Ga0495601_0348976 | Ga0495601_0348976_286_714 | 134 |
| 31 | 3300005563 | Ga0068855_100211184 | Ga0068855_1002111842 | 135 |
| 32 | 3300025949 | Ga0207667_10544718 | Ga0207667_105447182 | 135 |
| 33 | 3300026089 | Ga0207648_11643681 | Ga0207648_116436811 | 135 |
| 34 | 3300005347 | Ga0070668_101148732 | Ga0070668_1011487321 | 136 |
| 35 | 3300005364 | Ga0070673_100605052 | Ga0070673_1006050522 | 136 |
| 36 | 3300005434 | Ga0070709_10000668 | Ga0070709_100006684 | 136 |
| 37 | 3300005435 | Ga0070714_100008660 | Ga0070714_1000086607 | 136 |
| 38 | 3300005435 | Ga0070714_100984824 | Ga0070714_1009848242 | 136 |
| 39 | 3300005436 | Ga0070713_100007357 | Ga0070713_1000073572 | 136 |
| 40 | 3300005437 | Ga0070710_10004289 | Ga0070710_100042895 | 136 |
| 41 | 3300005983 | Ga0081540_1045750 | Ga0081540_10457502 | 136 |
| 42 | 3300006028 | Ga0070717_10309058 | Ga0070717_103090582 | 136 |
| 43 | 3300006028 | Ga0070717_11793565 | Ga0070717_117935651 | 136 |
| 44 | 3300006163 | Ga0070715_10001202 | Ga0070715_100012028 | 136 |
| 45 | 3300006173 | Ga0070716_100038436 | Ga0070716_1000384362 | 136 |
| 46 | 3300006175 | Ga0070712_100008370 | Ga0070712_1000083706 | 136 |
| 47 | 3300006195 | Ga0075366_10586327 | Ga0075366_105863272 | 136 |
| 48 | 3300009147 | Ga0114129_10442771 | Ga0114129_104427712 | 136 |
| 49 | 3300009176 | Ga0105242_11749776 | Ga0105242_117497762 | 136 |
| 50 | 3300009553 | Ga0105249_10513405 | Ga0105249_105134052 | 136 |
| 51 | 3300025905 | Ga0207685_10023170 | Ga0207685_100231702 | 136 |
| 52 | 3300025915 | Ga0207693_10000564 | Ga0207693_100005647 | 136 |
| 53 | 3300025916 | Ga0207663_10002863 | Ga0207663_100028634 | 136 |
| 54 | 3300025928 | Ga0207700_10359851 | Ga0207700_103598511 | 136 |
| 55 | 3300025933 | Ga0207706_10670462 | Ga0207706_106704622 | 136 |
| 56 | 3300025933 | Ga0207706_11575269 | Ga0207706_115752691 | 136 |
| 57 | 3300025939 | Ga0207665_10000864 | Ga0207665_1000086415 | 136 |
| 58 | 3300025961 | Ga0207712_10254309 | Ga0207712_102543092 | 136 |
| 59 | 3300028380 | Ga0268265_11627480 | Ga0268265_116274801 | 136 |
| 60 | 3300035241 | Ga0373961_0144478 | Ga0373961_0144478_212_637 | 136 |
| 61 | 3300039437 | Ga0436365_1251157 | Ga0436365_1251157_41_502 | 136 |
| 62 | 3300046473 | Ga0495582_0574731 | Ga0495582_0574731_112_537 | 136 |
| 63 | 3300048913 | Ga0496110_1506172 | Ga0496110_1506172_41_457 | 136 |
| 64 | 3300048916 | Ga0496113_0213680 | Ga0496113_0213680_991_1407 | 136 |
| 65 | 3300050507 | nmdc:mga05p37_775726_c1 | nmdc:mga05p37_775726_c1_123_548 | 136 |
| 66 | 3300050508 | nmdc:mga09592_209277_c1 | nmdc:mga09592_209277_c1_1028_1453 | 136 |
| 67 | 3300050510 | nmdc:mga06r32_119432_c1 | nmdc:mga06r32_119432_c1_2064_2489 | 136 |
| 68 | 3300002075 | JGI24738J21930_10104526 | JGI24738J21930_101045261 | 137 |
| 69 | 3300003911 | JGI25405J52794_10067120 | JGI25405J52794_100671201 | 137 |
| 70 | 3300005329 | Ga0070683_100996181 | Ga0070683_1009961812 | 137 |
| 71 | 3300005331 | Ga0070670_100040441 | Ga0070670_1000404413 | 137 |
| 72 | 3300005331 | Ga0070670_100257205 | Ga0070670_1002572052 | 137 |
| 73 | 3300005335 | Ga0070666_10063021 | Ga0070666_100630212 | 137 |
| 74 | 3300005338 | Ga0068868_100032929 | Ga0068868_1000329292 | 137 |
| 75 | 3300005340 | Ga0070689_100051282 | Ga0070689_1000512822 | 137 |
| 76 | 3300005340 | Ga0070689_100658184 | Ga0070689_1006581842 | 137 |
| 77 | 3300005341 | Ga0070691_10032118 | Ga0070691_100321182 | 137 |
| 78 | 3300005345 | Ga0070692_10071972 | Ga0070692_100719722 | 137 |
| 79 | 3300005354 | Ga0070675_100492823 | Ga0070675_1004928232 | 137 |
| 80 | 3300005355 | Ga0070671_100641552 | Ga0070671_1006415521 | 137 |
| 81 | 3300005364 | Ga0070673_101119336 | Ga0070673_1011193361 | 137 |
| 82 | 3300005365 | Ga0070688_100235697 | Ga0070688_1002356972 | 137 |
| 83 | 3300005366 | Ga0070659_100059701 | Ga0070659_1000597013 | 137 |
| 84 | 3300005366 | Ga0070659_102156497 | Ga0070659_1021564971 | 137 |
| 85 | 3300005434 | Ga0070709_10161926 | Ga0070709_101619262 | 137 |
| 86 | 3300005435 | Ga0070714_100020634 | Ga0070714_1000206344 | 137 |
| 87 | 3300005435 | Ga0070714_100307868 | Ga0070714_1003078682 | 137 |
| 88 | 3300005435 | Ga0070714_101420494 | Ga0070714_1014204941 | 137 |
| 89 | 3300005436 | Ga0070713_100115158 | Ga0070713_1001151581 | 137 |
| 90 | 3300005436 | Ga0070713_100139774 | Ga0070713_1001397742 | 137 |
| 91 | 3300005436 | Ga0070713_100169877 | Ga0070713_1001698772 | 137 |
| 92 | 3300005436 | Ga0070713_100222760 | Ga0070713_1002227602 | 137 |
| 93 | 3300005436 | Ga0070713_100281357 | Ga0070713_1002813572 | 137 |
| 94 | 3300005436 | Ga0070713_100875628 | Ga0070713_1008756281 | 137 |
| 95 | 3300005437 | Ga0070710_10210457 | Ga0070710_102104571 | 137 |
| 96 | 3300005437 | Ga0070710_10332714 | Ga0070710_103327142 | 137 |
| 97 | 3300005438 | Ga0070701_10052649 | Ga0070701_100526492 | 137 |
| 98 | 3300005439 | Ga0070711_100021882 | Ga0070711_1000218822 | 137 |
| 99 | 3300005439 | Ga0070711_100107217 | Ga0070711_1001072172 | 137 |
| 100 | 3300005439 | Ga0070711_100119235 | Ga0070711_1001192352 | 137 |
| 101 | 3300005439 | Ga0070711_100448885 | Ga0070711_1004488851 | 137 |
| 102 | 3300005439 | Ga0070711_100916214 | Ga0070711_1009162141 | 137 |
| 103 | 3300005440 | Ga0070705_100750279 | Ga0070705_1007502791 | 137 |
| 104 | 3300005444 | Ga0070694_100581299 | Ga0070694_1005812992 | 137 |
| 105 | 3300005455 | Ga0070663_100206649 | Ga0070663_1002066491 | 137 |
| 106 | 3300005456 | Ga0070678_100288853 | Ga0070678_1002888532 | 137 |
| 107 | 3300005457 | Ga0070662_100148186 | Ga0070662_1001481862 | 137 |
| 108 | 3300005458 | Ga0070681_10206021 | Ga0070681_102060212 | 137 |
| 109 | 3300005458 | Ga0070681_11342937 | Ga0070681_113429371 | 137 |
| 110 | 3300005466 | Ga0070685_10341773 | Ga0070685_103417731 | 137 |
| 111 | 3300005467 | Ga0070706_100398338 | Ga0070706_1003983382 | 137 |
| 112 | 3300005471 | Ga0070698_100895348 | Ga0070698_1008953481 | 137 |
| 113 | 3300005518 | Ga0070699_100010309 | Ga0070699_1000103094 | 137 |
| 114 | 3300005530 | Ga0070679_100908494 | Ga0070679_1009084941 | 137 |
| 115 | 3300005535 | Ga0070684_100417909 | Ga0070684_1004179092 | 137 |
| 116 | 3300005544 | Ga0070686_100642483 | Ga0070686_1006424831 | 137 |
| 117 | 3300005546 | Ga0070696_100651791 | Ga0070696_1006517911 | 137 |
| 118 | 3300005547 | Ga0070693_100357243 | Ga0070693_1003572431 | 137 |
| 119 | 3300005548 | Ga0070665_100934873 | Ga0070665_1009348731 | 137 |
| 120 | 3300005548 | Ga0070665_101076589 | Ga0070665_1010765892 | 137 |
| 121 | 3300005549 | Ga0070704_100336792 | Ga0070704_1003367922 | 137 |
| 122 | 3300005564 | Ga0070664_100175665 | Ga0070664_1001756652 | 137 |
| 123 | 3300005578 | Ga0068854_100003131 | Ga0068854_1000031317 | 137 |
| 124 | 3300005615 | Ga0070702_100209792 | Ga0070702_1002097922 | 137 |
| 125 | 3300005616 | Ga0068852_100172578 | Ga0068852_1001725782 | 137 |
| 126 | 3300005618 | Ga0068864_100065337 | Ga0068864_1000653373 | 137 |
| 127 | 3300005718 | Ga0068866_10333251 | Ga0068866_103332512 | 137 |
| 128 | 3300005719 | Ga0068861_100014501 | Ga0068861_1000145014 | 137 |
| 129 | 3300005834 | Ga0068851_10232951 | Ga0068851_102329512 | 137 |
| 130 | 3300005840 | Ga0068870_10169873 | Ga0068870_101698732 | 137 |
| 131 | 3300005841 | Ga0068863_100037605 | Ga0068863_1000376052 | 137 |
| 132 | 3300005841 | Ga0068863_101192282 | Ga0068863_1011922821 | 137 |
| 133 | 3300005842 | Ga0068858_100981107 | Ga0068858_1009811072 | 137 |
| 134 | 3300005843 | Ga0068860_100058618 | Ga0068860_1000586182 | 137 |
| 135 | 3300005844 | Ga0068862_101003728 | Ga0068862_1010037283 | 137 |
| 136 | 3300005937 | Ga0081455_10001715 | Ga0081455_100017157 | 137 |
| 137 | 3300005937 | Ga0081455_10034176 | Ga0081455_100341761 | 137 |
| 138 | 3300005937 | Ga0081455_10060308 | Ga0081455_100603083 | 137 |
| 139 | 3300005937 | Ga0081455_10752632 | Ga0081455_107526321 | 137 |
| 140 | 3300005981 | Ga0081538_10008299 | Ga0081538_100082995 | 137 |
| 141 | 3300005983 | Ga0081540_1021808 | Ga0081540_10218083 | 137 |
| 142 | 3300005983 | Ga0081540_1150335 | Ga0081540_11503352 | 137 |
| 143 | 3300006028 | Ga0070717_10406653 | Ga0070717_104066532 | 137 |
| 144 | 3300006028 | Ga0070717_10543782 | Ga0070717_105437822 | 137 |
| 145 | 3300006028 | Ga0070717_11131140 | Ga0070717_111311401 | 137 |
| 146 | 3300006028 | Ga0070717_11565076 | Ga0070717_115650762 | 137 |
| 147 | 3300006028 | Ga0070717_11845860 | Ga0070717_118458601 | 137 |
| 148 | 3300006038 | Ga0075365_10002322 | Ga0075365_100023227 | 137 |
| 149 | 3300006038 | Ga0075365_10035594 | Ga0075365_100355943 | 137 |
| 150 | 3300006038 | Ga0075365_10040967 | Ga0075365_100409673 | 137 |
| 151 | 3300006038 | Ga0075365_10068968 | Ga0075365_100689682 | 137 |
| 152 | 3300006038 | Ga0075365_10220145 | Ga0075365_102201452 | 137 |
| 153 | 3300006038 | Ga0075365_10556812 | Ga0075365_105568122 | 137 |
| 154 | 3300006042 | Ga0075368_10263255 | Ga0075368_102632551 | 137 |
| 155 | 3300006048 | Ga0075363_100170429 | Ga0075363_1001704292 | 137 |
| 156 | 3300006051 | Ga0075364_10104200 | Ga0075364_101042001 | 137 |
| 157 | 3300006051 | Ga0075364_10522406 | Ga0075364_105224062 | 137 |
| 158 | 3300006163 | Ga0070715_10089758 | Ga0070715_100897582 | 137 |
| 159 | 3300006173 | Ga0070716_100042820 | Ga0070716_1000428202 | 137 |
| 160 | 3300006175 | Ga0070712_100003811 | Ga0070712_1000038118 | 137 |
| 161 | 3300006175 | Ga0070712_100382565 | Ga0070712_1003825652 | 137 |
| 162 | 3300006175 | Ga0070712_100670244 | Ga0070712_1006702442 | 137 |
| 163 | 3300006175 | Ga0070712_100911496 | Ga0070712_1009114962 | 137 |
| 164 | 3300006177 | Ga0075362_10058692 | Ga0075362_100586922 | 137 |
| 165 | 3300006178 | Ga0075367_10131122 | Ga0075367_101311222 | 137 |
| 166 | 3300006178 | Ga0075367_10149788 | Ga0075367_101497882 | 137 |
| 167 | 3300006178 | Ga0075367_10264852 | Ga0075367_102648522 | 137 |
| 168 | 3300006237 | Ga0097621_100047516 | Ga0097621_1000475162 | 137 |
| 169 | 3300006353 | Ga0075370_10575639 | Ga0075370_105756391 | 137 |
| 170 | 3300006358 | Ga0068871_101066770 | Ga0068871_1010667701 | 137 |
| 171 | 3300006844 | Ga0075428_100069715 | Ga0075428_1000697153 | 137 |
| 172 | 3300006844 | Ga0075428_100808228 | Ga0075428_1008082282 | 137 |
| 173 | 3300006844 | Ga0075428_100985093 | Ga0075428_1009850932 | 137 |
| 174 | 3300006844 | Ga0075428_101174079 | Ga0075428_1011740792 | 137 |
| 175 | 3300006847 | Ga0075431_100345803 | Ga0075431_1003458032 | 137 |
| 176 | 3300006847 | Ga0075431_100387458 | Ga0075431_1003874582 | 137 |
| 177 | 3300006847 | Ga0075431_100665300 | Ga0075431_1006653002 | 137 |
| 178 | 3300006847 | Ga0075431_100719990 | Ga0075431_1007199901 | 137 |
| 179 | 3300006852 | Ga0075433_10106011 | Ga0075433_101060111 | 137 |
| 180 | 3300006871 | Ga0075434_100083910 | Ga0075434_1000839102 | 137 |
| 181 | 3300006871 | Ga0075434_100802066 | Ga0075434_1008020662 | 137 |
| 182 | 3300006881 | Ga0068865_100550831 | Ga0068865_1005508312 | 137 |
| 183 | 3300006914 | Ga0075436_100143194 | Ga0075436_1001431942 | 137 |
| 184 | 3300006914 | Ga0075436_100211464 | Ga0075436_1002114642 | 137 |
| 185 | 3300007076 | Ga0075435_100027374 | Ga0075435_1000273745 | 137 |
| 186 | 3300007265 | Ga0099794_10015989 | Ga0099794_100159893 | 137 |
| 187 | 3300007265 | Ga0099794_10024786 | Ga0099794_100247862 | 137 |
| 188 | 3300007788 | Ga0099795_10075856 | Ga0099795_100758562 | 137 |
| 189 | 3300007788 | Ga0099795_10104572 | Ga0099795_101045722 | 137 |
| 190 | 3300007788 | Ga0099795_10222370 | Ga0099795_102223702 | 137 |
| 191 | 3300009094 | Ga0111539_10145390 | Ga0111539_101453902 | 137 |
| 192 | 3300009094 | Ga0111539_10443512 | Ga0111539_104435122 | 137 |
| 193 | 3300009094 | Ga0111539_10626941 | Ga0111539_106269412 | 137 |
| 194 | 3300009094 | Ga0111539_11786675 | Ga0111539_117866752 | 137 |
| 195 | 3300009094 | Ga0111539_12180598 | Ga0111539_121805981 | 137 |
| 196 | 3300009098 | Ga0105245_10478860 | Ga0105245_104788602 | 137 |
| 197 | 3300009101 | Ga0105247_10037846 | Ga0105247_100378463 | 137 |
| 198 | 3300009101 | Ga0105247_10071680 | Ga0105247_100716802 | 137 |
| 199 | 3300009147 | Ga0114129_10084911 | Ga0114129_100849112 | 137 |
| 200 | 3300009147 | Ga0114129_10311334 | Ga0114129_103113342 | 137 |
| 201 | 3300009147 | Ga0114129_10725485 | Ga0114129_107254852 | 137 |
| 202 | 3300009147 | Ga0114129_12149990 | Ga0114129_121499901 | 137 |
| 203 | 3300009174 | Ga0105241_10615959 | Ga0105241_106159591 | 137 |
| 204 | 3300009177 | Ga0105248_10496622 | Ga0105248_104966222 | 137 |
| 205 | 3300009553 | Ga0105249_10442613 | Ga0105249_104426132 | 137 |
| 206 | 3300009553 | Ga0105249_10874936 | Ga0105249_108749362 | 137 |
| 207 | 3300010159 | Ga0099796_10045114 | Ga0099796_100451142 | 137 |
| 208 | 3300010159 | Ga0099796_10055402 | Ga0099796_100554022 | 137 |
| 209 | 3300010159 | Ga0099796_10152577 | Ga0099796_101525771 | 137 |
| 210 | 3300010375 | Ga0105239_10494552 | Ga0105239_104945522 | 137 |
| 211 | 3300011119 | Ga0105246_10201665 | Ga0105246_102016652 | 137 |
| 212 | 3300011119 | Ga0105246_11279359 | Ga0105246_112793591 | 137 |
| 213 | 3300012507 | Ga0157342_1019718 | Ga0157342_10197181 | 137 |
| 214 | 3300013306 | Ga0163162_11100096 | Ga0163162_111000962 | 137 |
| 215 | 3300014325 | Ga0163163_10243969 | Ga0163163_102439692 | 137 |
| 216 | 3300014325 | Ga0163163_11053408 | Ga0163163_110534081 | 137 |
| 217 | 3300014745 | Ga0157377_10135919 | Ga0157377_101359191 | 137 |
| 218 | 3300014745 | Ga0157377_10617164 | Ga0157377_106171642 | 137 |
| 219 | 3300017792 | Ga0163161_10248962 | Ga0163161_102489621 | 137 |
| 220 | 3300021361 | Ga0213872_10043676 | Ga0213872_100436762 | 137 |
| 221 | 3300021377 | Ga0213874_10070323 | Ga0213874_100703232 | 137 |
| 222 | 3300021384 | Ga0213876_10118109 | Ga0213876_101181091 | 137 |
| 223 | 3300021384 | Ga0213876_10658730 | Ga0213876_106587301 | 137 |
| 224 | 3300025315 | Ga0207697_10059716 | Ga0207697_100597162 | 137 |
| 225 | 3300025898 | Ga0207692_10079882 | Ga0207692_100798822 | 137 |
| 226 | 3300025898 | Ga0207692_10095425 | Ga0207692_100954252 | 137 |
| 227 | 3300025900 | Ga0207710_10093381 | Ga0207710_100933811 | 137 |
| 228 | 3300025901 | Ga0207688_10028562 | Ga0207688_100285623 | 137 |
| 229 | 3300025903 | Ga0207680_10128683 | Ga0207680_101286832 | 137 |
| 230 | 3300025904 | Ga0207647_10085257 | Ga0207647_100852572 | 137 |
| 231 | 3300025905 | Ga0207685_10000972 | Ga0207685_100009722 | 137 |
| 232 | 3300025905 | Ga0207685_10410439 | Ga0207685_104104391 | 137 |
| 233 | 3300025906 | Ga0207699_10074924 | Ga0207699_100749242 | 137 |
| 234 | 3300025907 | Ga0207645_10005079 | Ga0207645_100050794 | 137 |
| 235 | 3300025908 | Ga0207643_10001128 | Ga0207643_100011286 | 137 |
| 236 | 3300025910 | Ga0207684_10217177 | Ga0207684_102171772 | 137 |
| 237 | 3300025910 | Ga0207684_10280034 | Ga0207684_102800342 | 137 |
| 238 | 3300025912 | Ga0207707_10078620 | Ga0207707_100786203 | 137 |
| 239 | 3300025914 | Ga0207671_10076704 | Ga0207671_100767042 | 137 |
| 240 | 3300025915 | Ga0207693_10001853 | Ga0207693_1000185315 | 137 |
| 241 | 3300025915 | Ga0207693_10011503 | Ga0207693_100115032 | 137 |
| 242 | 3300025915 | Ga0207693_10082723 | Ga0207693_100827231 | 137 |
| 243 | 3300025915 | Ga0207693_10201668 | Ga0207693_102016682 | 137 |
| 244 | 3300025915 | Ga0207693_10353865 | Ga0207693_103538652 | 137 |
| 245 | 3300025916 | Ga0207663_10042119 | Ga0207663_100421193 | 137 |
| 246 | 3300025916 | Ga0207663_10135075 | Ga0207663_101350752 | 137 |
| 247 | 3300025916 | Ga0207663_10386291 | Ga0207663_103862912 | 137 |
| 248 | 3300025916 | Ga0207663_10645702 | Ga0207663_106457021 | 137 |
| 249 | 3300025918 | Ga0207662_10089026 | Ga0207662_100890262 | 137 |
| 250 | 3300025921 | Ga0207652_10625871 | Ga0207652_106258712 | 137 |
| 251 | 3300025923 | Ga0207681_10148278 | Ga0207681_101482782 | 137 |
| 252 | 3300025926 | Ga0207659_10023144 | Ga0207659_100231443 | 137 |
| 253 | 3300025928 | Ga0207700_10001282 | Ga0207700_100012822 | 137 |
| 254 | 3300025928 | Ga0207700_10059362 | Ga0207700_100593622 | 137 |
| 255 | 3300025928 | Ga0207700_10240937 | Ga0207700_102409372 | 137 |
| 256 | 3300025929 | Ga0207664_10020726 | Ga0207664_100207264 | 137 |
| 257 | 3300025929 | Ga0207664_10865021 | Ga0207664_108650211 | 137 |
| 258 | 3300025933 | Ga0207706_10004504 | Ga0207706_100045043 | 137 |
| 259 | 3300025935 | Ga0207709_10020604 | Ga0207709_100206041 | 137 |
| 260 | 3300025937 | Ga0207669_10066269 | Ga0207669_100662692 | 137 |
| 261 | 3300025938 | Ga0207704_10039472 | Ga0207704_100394722 | 137 |
| 262 | 3300025938 | Ga0207704_10266338 | Ga0207704_102663382 | 137 |
| 263 | 3300025939 | Ga0207665_10014272 | Ga0207665_100142724 | 137 |
| 264 | 3300025940 | Ga0207691_10197038 | Ga0207691_101970382 | 137 |
| 265 | 3300025941 | Ga0207711_10172441 | Ga0207711_101724412 | 137 |
| 266 | 3300025942 | Ga0207689_10047702 | Ga0207689_100477023 | 137 |
| 267 | 3300025942 | Ga0207689_10495676 | Ga0207689_104956761 | 137 |
| 268 | 3300025949 | Ga0207667_12049590 | Ga0207667_120495901 | 137 |
| 269 | 3300025961 | Ga0207712_10280071 | Ga0207712_102800712 | 137 |
| 270 | 3300025981 | Ga0207640_10219980 | Ga0207640_102199802 | 137 |
| 271 | 3300025986 | Ga0207658_10065917 | Ga0207658_100659171 | 137 |
| 272 | 3300025986 | Ga0207658_10655185 | Ga0207658_106551852 | 137 |
| 273 | 3300026023 | Ga0207677_10230644 | Ga0207677_102306442 | 137 |
| 274 | 3300026035 | Ga0207703_10077185 | Ga0207703_100771853 | 137 |
| 275 | 3300026041 | Ga0207639_10933818 | Ga0207639_109338182 | 137 |
| 276 | 3300026067 | Ga0207678_10005216 | Ga0207678_100052168 | 137 |
| 277 | 3300026075 | Ga0207708_10001094 | Ga0207708_100010946 | 137 |
| 278 | 3300026078 | Ga0207702_10148930 | Ga0207702_101489302 | 137 |
| 279 | 3300026088 | Ga0207641_10151367 | Ga0207641_101513671 | 137 |
| 280 | 3300026088 | Ga0207641_10744596 | Ga0207641_107445962 | 137 |
| 281 | 3300026089 | Ga0207648_10009306 | Ga0207648_100093064 | 137 |
| 282 | 3300026095 | Ga0207676_10077488 | Ga0207676_100774882 | 137 |
| 283 | 3300026116 | Ga0207674_10023673 | Ga0207674_100236734 | 137 |
| 284 | 3300026118 | Ga0207675_100011964 | Ga0207675_1000119645 | 137 |
| 285 | 3300026121 | Ga0207683_10136908 | Ga0207683_101369082 | 137 |
| 286 | 3300026121 | Ga0207683_10305700 | Ga0207683_103057002 | 137 |
| 287 | 3300026142 | Ga0207698_10077364 | Ga0207698_100773642 | 137 |
| 288 | 3300027512 | Ga0209179_1018933 | Ga0209179_10189332 | 137 |
| 289 | 3300027512 | Ga0209179_1046447 | Ga0209179_10464472 | 137 |
| 290 | 3300027671 | Ga0209588_1007975 | Ga0209588_10079752 | 137 |
| 291 | 3300027671 | Ga0209588_1068485 | Ga0209588_10684852 | 137 |
| 292 | 3300028379 | Ga0268266_11680103 | Ga0268266_116801032 | 137 |
| 293 | 3300028380 | Ga0268265_10033639 | Ga0268265_100336391 | 137 |
| 294 | 3300028380 | Ga0268265_11111993 | Ga0268265_111119932 | 137 |
| 295 | 3300028381 | Ga0268264_10021384 | Ga0268264_100213843 | 137 |
| 296 | 3300028381 | Ga0268264_11584430 | Ga0268264_115844302 | 137 |
| 297 | 3300031235 | Ga0265330_10044668 | Ga0265330_100446682 | 137 |
| 298 | 3300031241 | Ga0265325_10130833 | Ga0265325_101308332 | 137 |
| 299 | 3300031249 | Ga0265339_10016985 | Ga0265339_100169852 | 137 |
| 300 | 3300031250 | Ga0265331_10259371 | Ga0265331_102593712 | 137 |
| 301 | 3300035083 | Ga0373926_0010917 | Ga0373926_0010917_753_1172 | 137 |
| 302 | 3300035086 | Ga0373934_0079136 | Ga0373934_0079136_154_573 | 137 |
| 303 | 3300035089 | Ga0373944_0009890 | Ga0373944_0009890_116_535 | 137 |
| 304 | 3300035111 | Ga0373923_0001024 | Ga0373923_0001024_1338_1757 | 137 |
| 305 | 3300035113 | Ga0373936_0004647 | Ga0373936_0004647_1827_2246 | 137 |
| 306 | 3300035113 | Ga0373936_0106151 | Ga0373936_0106151_20_439 | 137 |
| 307 | 3300035113 | Ga0373936_0340122 | Ga0373936_0340122_247_666 | 137 |
| 308 | 3300035115 | Ga0373941_0348862 | Ga0373941_0348862_119_550 | 137 |
| 309 | 3300035115 | Ga0373941_0454243 | Ga0373941_0454243_64_483 | 137 |
| 310 | 3300035116 | Ga0373945_0091474 | Ga0373945_0091474_693_1112 | 137 |
| 311 | 3300035116 | Ga0373945_0175937 | Ga0373945_0175937_334_753 | 137 |
| 312 | 3300035116 | Ga0373945_0190161 | Ga0373945_0190161_135_554 | 137 |
| 313 | 3300035117 | Ga0373953_0013416 | Ga0373953_0013416_1879_2298 | 137 |
| 314 | 3300035117 | Ga0373953_0090213 | Ga0373953_0090213_185_604 | 137 |
| 315 | 3300035118 | Ga0373954_0000987 | Ga0373954_0000987_6955_7374 | 137 |
| 316 | 3300035118 | Ga0373954_0156234 | Ga0373954_0156234_628_1047 | 137 |
| 317 | 3300035120 | Ga0373957_0041360 | Ga0373957_0041360_608_1027 | 137 |
| 318 | 3300035170 | Ga0373943_0061659 | Ga0373943_0061659_1018_1437 | 137 |
| 319 | 3300035170 | Ga0373943_0213064 | Ga0373943_0213064_16_435 | 137 |
| 320 | 3300035171 | Ga0373946_0035882 | Ga0373946_0035882_840_1259 | 137 |
| 321 | 3300035172 | Ga0373955_0002808 | Ga0373955_0002808_4644_5063 | 137 |
| 322 | 3300035410 | Ga0373924_0002822 | Ga0373924_0002822_4697_5116 | 137 |
| 323 | 3300035692 | Ga0373935_0000123 | Ga0373935_0000123_7269_7688 | 137 |
| 324 | 3300035692 | Ga0373935_0067566 | Ga0373935_0067566_1104_1523 | 137 |
| 325 | 3300035695 | Ga0373927_0032738 | Ga0373927_0032738_1840_2259 | 137 |
| 326 | 3300035695 | Ga0373927_0032887 | Ga0373927_0032887_957_1376 | 137 |
| 327 | 3300035695 | Ga0373927_0037224 | Ga0373927_0037224_1984_2403 | 137 |
| 328 | 3300035695 | Ga0373927_0306971 | Ga0373927_0306971_208_627 | 137 |
| 329 | 3300035725 | Ga0373947_0002728 | Ga0373947_0002728_3034_3453 | 137 |
| 330 | 3300035725 | Ga0373947_0033365 | Ga0373947_0033365_1639_2058 | 137 |
| 331 | 3300035725 | Ga0373947_0203653 | Ga0373947_0203653_612_1031 | 137 |
| 332 | 3300036401 | Ga0373937_0000007 | Ga0373937_0000007_50712_51131 | 137 |
| 333 | 3300036401 | Ga0373937_0021571 | Ga0373937_0021571_5200_5619 | 137 |
| 334 | 3300037068 | Ga0373925_0000011 | Ga0373925_0000011_41963_42382 | 137 |
| 335 | 3300037068 | Ga0373925_0047614 | Ga0373925_0047614_1070_1489 | 137 |
| 336 | 3300037068 | Ga0373925_0248980 | Ga0373925_0248980_24_443 | 137 |
| 337 | 3300037068 | Ga0373925_0367137 | Ga0373925_0367137_559_978 | 137 |
| 338 | 3300037312 | Ga0395899_0179704 | Ga0395899_0179704_165_584 | 137 |
| 339 | 3300037418 | Ga0395900_0384323 | Ga0395900_0384323_746_1165 | 137 |
| 340 | 3300037466 | Ga0395898_0125844 | Ga0395898_0125844_1904_2323 | 137 |
| 341 | 3300037471 | Ga0395905_0705508 | Ga0395905_0705508_35_454 | 137 |
| 342 | 3300037853 | Ga0436364_0527040 | Ga0436364_0527040_386_808 | 137 |
| 343 | 3300037853 | Ga0436364_1527085 | Ga0436364_1527085_445_864 | 137 |
| 344 | 3300038443 | Ga0395901_0939134 | Ga0395901_0939134_94_513 | 137 |
| 345 | 3300039437 | Ga0436365_0698136 | Ga0436365_0698136_1537_1956 | 137 |
| 346 | 3300039437 | Ga0436365_1251542 | Ga0436365_1251542_353_775 | 137 |
| 347 | 3300039437 | Ga0436365_1914251 | Ga0436365_1914251_895_1317 | 137 |
| 348 | 3300039438 | Ga0436360_0276015 | Ga0436360_0276015_461_880 | 137 |
| 349 | 3300039447 | Ga0436361_0022907 | Ga0436361_0022907_402_821 | 137 |
| 350 | 3300039447 | Ga0436361_0317799 | Ga0436361_0317799_5580_5999 | 137 |
| 351 | 3300039450 | Ga0436363_0092101 | Ga0436363_0092101_649_1068 | 137 |
| 352 | 3300039450 | Ga0436363_0525082 | Ga0436363_0525082_125_547 | 137 |
| 353 | 3300039450 | Ga0436363_1375367 | Ga0436363_1375367_509_928 | 137 |
| 354 | 3300039453 | Ga0436362_0144763 | Ga0436362_0144763_162_584 | 137 |
| 355 | 3300041512 | Ga0451853_3761155 | Ga0451853_3761155_958_1377 | 137 |
| 356 | 3300045976 | Ga0466967_1278730 | Ga0466967_1278730_196_627 | 137 |
| 357 | 3300046454 | Ga0495592_0000511 | Ga0495592_0000511_7193_7612 | 137 |
| 358 | 3300046455 | Ga0495603_0098394 | Ga0495603_0098394_58_477 | 137 |
| 359 | 3300046457 | Ga0495590_0037400 | Ga0495590_0037400_231_650 | 137 |
| 360 | 3300046459 | Ga0495629_0019790 | Ga0495629_0019790_196_615 | 137 |
| 361 | 3300046459 | Ga0495629_0286130 | Ga0495629_0286130_605_1024 | 137 |
| 362 | 3300046460 | Ga0495638_0444727 | Ga0495638_0444727_38_457 | 137 |
| 363 | 3300046460 | Ga0495638_0656792 | Ga0495638_0656792_13_432 | 137 |
| 364 | 3300046462 | Ga0495651_0002325 | Ga0495651_0002325_13020_13439 | 137 |
| 365 | 3300046463 | Ga0495653_0000190 | Ga0495653_0000190_43885_44304 | 137 |
| 366 | 3300046472 | Ga0495580_0019951 | Ga0495580_0019951_3119_3538 | 137 |
| 367 | 3300046473 | Ga0495582_0022972 | Ga0495582_0022972_1902_2321 | 137 |
| 368 | 3300046473 | Ga0495582_0330861 | Ga0495582_0330861_31_450 | 137 |
| 369 | 3300046474 | Ga0495605_0114750 | Ga0495605_0114750_526_945 | 137 |
| 370 | 3300046475 | Ga0495639_0059680 | Ga0495639_0059680_530_949 | 137 |
| 371 | 3300046475 | Ga0495639_0380701 | Ga0495639_0380701_72_491 | 137 |
| 372 | 3300046476 | Ga0495662_0005258 | Ga0495662_0005258_5836_6255 | 137 |
| 373 | 3300046477 | Ga0495664_0000464 | Ga0495664_0000464_15067_15486 | 137 |
| 374 | 3300046491 | Ga0495584_0019223 | Ga0495584_0019223_2755_3174 | 137 |
| 375 | 3300046491 | Ga0495584_0144383 | Ga0495584_0144383_249_677 | 137 |
| 376 | 3300046491 | Ga0495584_0200973 | Ga0495584_0200973_579_1001 | 137 |
| 377 | 3300046492 | Ga0495585_0055484 | Ga0495585_0055484_1225_1647 | 137 |
| 378 | 3300046492 | Ga0495585_0131634 | Ga0495585_0131634_19_438 | 137 |
| 379 | 3300046499 | Ga0495594_0009610 | Ga0495594_0009610_2667_3086 | 137 |
| 380 | 3300046500 | Ga0495596_0073796 | Ga0495596_0073796_360_779 | 137 |
| 381 | 3300046511 | Ga0495608_0000004 | Ga0495608_0000004_11624_12043 | 137 |
| 382 | 3300046514 | Ga0495618_0000392 | Ga0495618_0000392_15079_15498 | 137 |
| 383 | 3300046514 | Ga0495618_0109382 | Ga0495618_0109382_230_649 | 137 |
| 384 | 3300046515 | Ga0495620_0084731 | Ga0495620_0084731_685_1104 | 137 |
| 385 | 3300046516 | Ga0495628_0000006 | Ga0495628_0000006_138690_139109 | 137 |
| 386 | 3300046517 | Ga0495630_0003456 | Ga0495630_0003456_4692_5111 | 137 |
| 387 | 3300046517 | Ga0495630_0467009 | Ga0495630_0467009_15_434 | 137 |
| 388 | 3300046518 | Ga0495631_0057609 | Ga0495631_0057609_497_916 | 137 |
| 389 | 3300046519 | Ga0495632_0116706 | Ga0495632_0116706_761_1180 | 137 |
| 390 | 3300046520 | Ga0495637_0220301 | Ga0495637_0220301_242_661 | 137 |
| 391 | 3300046523 | Ga0495644_0023479 | Ga0495644_0023479_1374_1793 | 137 |
| 392 | 3300046523 | Ga0495644_0209011 | Ga0495644_0209011_47_466 | 137 |
| 393 | 3300046525 | Ga0495663_0138501 | Ga0495663_0138501_286_705 | 137 |
| 394 | 3300046529 | Ga0495652_0005358 | Ga0495652_0005358_7156_7575 | 137 |
| 395 | 3300046531 | Ga0495665_0155331 | Ga0495665_0155331_285_704 | 137 |
| 396 | 3300046533 | Ga0495640_0000013 | Ga0495640_0000013_39537_39956 | 137 |
| 397 | 3300046533 | Ga0495640_0792259 | Ga0495640_0792259_47_478 | 137 |
| 398 | 3300046536 | Ga0495587_0000004 | Ga0495587_0000004_15089_15508 | 137 |
| 399 | 3300046537 | Ga0495598_0019418 | Ga0495598_0019418_1130_1549 | 137 |
| 400 | 3300046537 | Ga0495598_0456951 | Ga0495598_0456951_77_496 | 137 |
| 401 | 3300046538 | Ga0495609_0057540 | Ga0495609_0057540_810_1229 | 137 |
| 402 | 3300046539 | Ga0495621_0038709 | Ga0495621_0038709_698_1117 | 137 |
| 403 | 3300046543 | Ga0495645_0000001 | Ga0495645_0000001_343073_343492 | 137 |
| 404 | 3300046543 | Ga0495645_0864302 | Ga0495645_0864302_53_472 | 137 |
| 405 | 3300046558 | Ga0495633_0105247 | Ga0495633_0105247_458_880 | 137 |
| 406 | 3300046558 | Ga0495633_0199525 | Ga0495633_0199525_419_838 | 137 |
| 407 | 3300046559 | Ga0495667_0000084 | Ga0495667_0000084_59735_60154 | 137 |
| 408 | 3300046615 | Ga0495656_0035412 | Ga0495656_0035412_1338_1757 | 137 |
| 409 | 3300046615 | Ga0495656_0043815 | Ga0495656_0043815_387_806 | 137 |
| 410 | 3300046616 | Ga0495668_0094183 | Ga0495668_0094183_671_1090 | 137 |
| 411 | 3300046616 | Ga0495668_0743960 | Ga0495668_0743960_59_487 | 137 |
| 412 | 3300046642 | Ga0495634_0000164 | Ga0495634_0000164_37177_37596 | 137 |
| 413 | 3300046648 | Ga0495611_0034832 | Ga0495611_0034832_439_858 | 137 |
| 414 | 3300046663 | Ga0495635_0000003 | Ga0495635_0000003_342704_343123 | 137 |
| 415 | 3300046664 | Ga0495659_0034527 | Ga0495659_0034527_891_1313 | 137 |
| 416 | 3300046664 | Ga0495659_0102343 | Ga0495659_0102343_576_995 | 137 |
| 417 | 3300046665 | Ga0495661_0264382 | Ga0495661_0264382_225_647 | 137 |
| 418 | 3300046674 | Ga0495588_0119793 | Ga0495588_0119793_667_1086 | 137 |
| 419 | 3300046675 | Ga0495657_0000248 | Ga0495657_0000248_7113_7532 | 137 |
| 420 | 3300046678 | Ga0495599_0000014 | Ga0495599_0000014_132526_132945 | 137 |
| 421 | 3300046679 | Ga0495623_0000006 | Ga0495623_0000006_7367_7786 | 137 |
| 422 | 3300046680 | Ga0495646_0000005 | Ga0495646_0000005_255244_255663 | 137 |
| 423 | 3300046681 | Ga0495647_0565094 | Ga0495647_0565094_34_453 | 137 |
| 424 | 3300046683 | Ga0495658_0077900 | Ga0495658_0077900_145_564 | 137 |
| 425 | 3300046683 | Ga0495658_0212192 | Ga0495658_0212192_271_690 | 137 |
| 426 | 3300046690 | Ga0495624_0020517 | Ga0495624_0020517_3866_4285 | 137 |
| 427 | 3300046690 | Ga0495624_0044123 | Ga0495624_0044123_392_811 | 137 |
| 428 | 3300046691 | Ga0495670_0251206 | Ga0495670_0251206_258_680 | 137 |
| 429 | 3300046691 | Ga0495670_0393065 | Ga0495670_0393065_128_547 | 137 |
| 430 | 3300046694 | Ga0495649_0149849 | Ga0495649_0149849_672_1091 | 137 |
| 431 | 3300046809 | Ga0495600_0000005 | Ga0495600_0000005_38702_39121 | 137 |
| 432 | 3300047315 | Ga0495581_0027214 | Ga0495581_0027214_1038_1457 | 137 |
| 433 | 3300047315 | Ga0495581_0092137 | Ga0495581_0092137_354_773 | 137 |
| 434 | 3300047317 | Ga0495604_0000002 | Ga0495604_0000002_187527_187946 | 137 |
| 435 | 3300047319 | Ga0495674_0000004 | Ga0495674_0000004_187075_187494 | 137 |
| 436 | 3300047321 | Ga0495676_0025562 | Ga0495676_0025562_3893_4312 | 137 |
| 437 | 3300047321 | Ga0495676_0123805 | Ga0495676_0123805_812_1231 | 137 |
| 438 | 3300047321 | Ga0495676_0126839 | Ga0495676_0126839_846_1265 | 137 |
| 439 | 3300047322 | Ga0495680_0000986 | Ga0495680_0000986_24165_24584 | 137 |
| 440 | 3300047322 | Ga0495680_0833644 | Ga0495680_0833644_150_581 | 137 |
| 441 | 3300047444 | Ga0495675_0000053 | Ga0495675_0000053_71136_71555 | 137 |
| 442 | 3300047445 | Ga0495677_0064530 | Ga0495677_0064530_862_1281 | 137 |
| 443 | 3300047446 | Ga0495679_104971 | Ga0495679_104971_274_693 | 137 |
| 444 | 3300047471 | Ga0495684_0000004 | Ga0495684_0000004_167951_168370 | 137 |
| 445 | 3300047471 | Ga0495684_0131588 | Ga0495684_0131588_1167_1586 | 137 |
| 446 | 3300047673 | Ga0495593_0001912 | Ga0495593_0001912_4971_5390 | 137 |
| 447 | 3300048088 | Ga0495602_0000001 | Ga0495602_0000001_342746_343165 | 137 |
| 448 | 3300048904 | Ga0496101_0494373 | Ga0496101_0494373_83_502 | 137 |
| 449 | 3300048905 | Ga0496102_0405971 | Ga0496102_0405971_145_564 | 137 |
| 450 | 3300048905 | Ga0496102_0897278 | Ga0496102_0897278_126_545 | 137 |
| 451 | 3300048906 | Ga0496103_0011877 | Ga0496103_0011877_205_624 | 137 |
| 452 | 3300048906 | Ga0496103_0126171 | Ga0496103_0126171_1016_1435 | 137 |
| 453 | 3300048907 | Ga0496104_0000661 | Ga0496104_0000661_16782_17201 | 137 |
| 454 | 3300048907 | Ga0496104_0000886 | Ga0496104_0000886_3615_4034 | 137 |
| 455 | 3300048907 | Ga0496104_0021434 | Ga0496104_0021434_5115_5534 | 137 |
| 456 | 3300048907 | Ga0496104_0677249 | Ga0496104_0677249_491_910 | 137 |
| 457 | 3300048908 | Ga0496105_0001513 | Ga0496105_0001513_10414_10833 | 137 |
| 458 | 3300048908 | Ga0496105_0007189 | Ga0496105_0007189_3526_3945 | 137 |
| 459 | 3300048909 | Ga0496106_0025942 | Ga0496106_0025942_3838_4257 | 137 |
| 460 | 3300048909 | Ga0496106_0036403 | Ga0496106_0036403_1453_1872 | 137 |
| 461 | 3300048909 | Ga0496106_0077710 | Ga0496106_0077710_591_1010 | 137 |
| 462 | 3300048909 | Ga0496106_0744486 | Ga0496106_0744486_104_523 | 137 |
| 463 | 3300048910 | Ga0496107_0149251 | Ga0496107_0149251_359_778 | 137 |
| 464 | 3300048911 | Ga0496108_0033849 | Ga0496108_0033849_3642_4061 | 137 |
| 465 | 3300048911 | Ga0496108_0975701 | Ga0496108_0975701_68_499 | 137 |
| 466 | 3300048912 | Ga0496109_0021144 | Ga0496109_0021144_1168_1587 | 137 |
| 467 | 3300048912 | Ga0496109_0472279 | Ga0496109_0472279_365_784 | 137 |
| 468 | 3300048912 | Ga0496109_0812157 | Ga0496109_0812157_244_663 | 137 |
| 469 | 3300048913 | Ga0496110_0056733 | Ga0496110_0056733_800_1219 | 137 |
| 470 | 3300048913 | Ga0496110_0092279 | Ga0496110_0092279_1030_1449 | 137 |
| 471 | 3300048913 | Ga0496110_0092398 | Ga0496110_0092398_1413_1832 | 137 |
| 472 | 3300048913 | Ga0496110_0392815 | Ga0496110_0392815_445_864 | 137 |
| 473 | 3300048913 | Ga0496110_0699149 | Ga0496110_0699149_179_598 | 137 |
| 474 | 3300048913 | Ga0496110_0889436 | Ga0496110_0889436_109_528 | 137 |
| 475 | 3300048913 | Ga0496110_1033517 | Ga0496110_1033517_179_607 | 137 |
| 476 | 3300048914 | Ga0496111_0000624 | Ga0496111_0000624_17846_18265 | 137 |
| 477 | 3300048914 | Ga0496111_0453193 | Ga0496111_0453193_40_459 | 137 |
| 478 | 3300048914 | Ga0496111_0469143 | Ga0496111_0469143_82_501 | 137 |
| 479 | 3300048915 | Ga0496112_0004796 | Ga0496112_0004796_4166_4585 | 137 |
| 480 | 3300048915 | Ga0496112_0702180 | Ga0496112_0702180_379_798 | 137 |
| 481 | 3300048915 | Ga0496112_1577809 | Ga0496112_1577809_44_475 | 137 |
| 482 | 3300048916 | Ga0496113_0002612 | Ga0496113_0002612_7622_8041 | 137 |
| 483 | 3300048916 | Ga0496113_0299600 | Ga0496113_0299600_759_1178 | 137 |
| 484 | 3300048916 | Ga0496113_1082806 | Ga0496113_1082806_147_578 | 137 |
| 485 | 3300048917 | Ga0496114_0195984 | Ga0496114_0195984_625_1044 | 137 |
| 486 | 3300048918 | Ga0496115_0008940 | Ga0496115_0008940_4271_4690 | 137 |
| 487 | 3300048918 | Ga0496115_0452088 | Ga0496115_0452088_175_594 | 137 |
| 488 | 3300048918 | Ga0496115_1138739 | Ga0496115_1138739_109_528 | 137 |
| 489 | 3300049568 | Ga0501031_0789523 | Ga0501031_0789523_113_532 | 137 |
| 490 | 3300049572 | Ga0501036_0431761 | Ga0501036_0431761_215_634 | 137 |
| 491 | 3300049574 | Ga0501038_0754527 | Ga0501038_0754527_79_498 | 137 |
| 492 | 3300049576 | Ga0501040_0265288 | Ga0501040_0265288_690_1109 | 137 |
| 493 | 3300049577 | Ga0501041_0776963 | Ga0501041_0776963_85_504 | 137 |
| 494 | 3300049578 | Ga0501042_0224241 | Ga0501042_0224241_250_669 | 137 |
| 495 | 3300049582 | Ga0501048_0221018 | Ga0501048_0221018_849_1268 | 137 |
| 496 | 3300049587 | Ga0501071_1305115 | Ga0501071_1305115_122_541 | 137 |
| 497 | 3300049588 | Ga0501072_0269019 | Ga0501072_0269019_651_1070 | 137 |
| 498 | 3300049591 | Ga0501075_0144365 | Ga0501075_0144365_1069_1488 | 137 |
| 499 | 3300049591 | Ga0501075_0689381 | Ga0501075_0689381_294_713 | 137 |
| 500 | 3300049741 | Ga0501079_0213358 | Ga0501079_0213358_550_969 | 137 |
| 501 | 3300049741 | Ga0501079_0410062 | Ga0501079_0410062_298_726 | 137 |
| 502 | 3300049741 | Ga0501079_0604874 | Ga0501079_0604874_77_496 | 137 |
| 503 | 3300049743 | Ga0501081_1047239 | Ga0501081_1047239_53_481 | 137 |
| 504 | 3300049744 | Ga0501083_0220725 | Ga0501083_0220725_96_515 | 137 |
| 505 | 3300049744 | Ga0501083_1129736 | Ga0501083_1129736_27_446 | 137 |
| 506 | 3300050489 | nmdc:mga03683_403892_c1 | nmdc:mga03683_403892_c1_179_598 | 137 |
| 507 | 3300050489 | nmdc:mga03683_70163_c1 | nmdc:mga03683_70163_c1_83_502 | 137 |
| 508 | 3300050492 | nmdc:mga0yw44_1131_c1 | nmdc:mga0yw44_1131_c1_8566_8985 | 137 |
| 509 | 3300050492 | nmdc:mga0yw44_136306_c1 | nmdc:mga0yw44_136306_c1_939_1358 | 137 |
| 510 | 3300050492 | nmdc:mga0yw44_17009_c1 | nmdc:mga0yw44_17009_c1_3281_3700 | 137 |
| 511 | 3300050492 | nmdc:mga0yw44_96584_c1 | nmdc:mga0yw44_96584_c1_1109_1528 | 137 |
| 512 | 3300050494 | nmdc:mga06z11_166752_c1 | nmdc:mga06z11_166752_c1_355_774 | 137 |
| 513 | 3300050494 | nmdc:mga06z11_176136_c1 | nmdc:mga06z11_176136_c1_92_511 | 137 |
| 514 | 3300050494 | nmdc:mga06z11_247249_c1 | nmdc:mga06z11_247249_c1_234_653 | 137 |
| 515 | 3300050494 | nmdc:mga06z11_73668_c1 | nmdc:mga06z11_73668_c1_1081_1500 | 137 |
| 516 | 3300050496 | nmdc:mga07m45_524849_c1 | nmdc:mga07m45_524849_c1_191_610 | 137 |
| 517 | 3300050507 | nmdc:mga05p37_1153149_c1 | nmdc:mga05p37_1153149_c1_88_507 | 137 |
| 518 | 3300050507 | nmdc:mga05p37_43029_c1 | nmdc:mga05p37_43029_c1_1572_1991 | 137 |
| 519 | 3300050507 | nmdc:mga05p37_4669_c1 | nmdc:mga05p37_4669_c1_14921_15340 | 137 |
| 520 | 3300050507 | nmdc:mga05p37_508993_c1 | nmdc:mga05p37_508993_c1_786_1205 | 137 |
| 521 | 3300050508 | nmdc:mga09592_247351_c1 | nmdc:mga09592_247351_c1_70_489 | 137 |
| 522 | 3300050508 | nmdc:mga09592_384510_c1 | nmdc:mga09592_384510_c1_462_881 | 137 |
| 523 | 3300050510 | nmdc:mga06r32_1175528_c1 | nmdc:mga06r32_1175528_c1_237_665 | 137 |
| 524 | 3300050511 | nmdc:mga08y16_1182556_c1 | nmdc:mga08y16_1182556_c1_106_525 | 137 |
| 525 | 3300050511 | nmdc:mga08y16_1305796_c1 | nmdc:mga08y16_1305796_c1_108_527 | 137 |
| 526 | 3300050511 | nmdc:mga08y16_600667_c1 | nmdc:mga08y16_600667_c1_517_936 | 137 |
| 527 | 3300050511 | nmdc:mga08y16_790314_c1 | nmdc:mga08y16_790314_c1_243_665 | 137 |
| 528 | 3300050512 | nmdc:mga0n895_121384_c1 | nmdc:mga0n895_121384_c1_1658_2077 | 137 |
| 529 | 3300050512 | nmdc:mga0n895_1350920_c1 | nmdc:mga0n895_1350920_c1_53_472 | 137 |
| 530 | 3300050513 | nmdc:mga0rr50_1118859_c1 | nmdc:mga0rr50_1118859_c1_174_593 | 137 |
| 531 | 3300050513 | nmdc:mga0rr50_299314_c1 | nmdc:mga0rr50_299314_c1_758_1177 | 137 |
| 532 | 3300050514 | nmdc:mga08x19_102122_c1 | nmdc:mga08x19_102122_c1_709_1128 | 137 |
| 533 | 3300050515 | nmdc:mga0a205_167259_c1 | nmdc:mga0a205_167259_c1_290_709 | 137 |
| 534 | 3300053077 | Ga0495601_0000078 | Ga0495601_0000078_4645_5064 | 137 |
| 535 | 3300053077 | Ga0495601_1045832 | Ga0495601_1045832_71_502 | 137 |
| 536 | 3300053078 | Ga0495612_0000005 | Ga0495612_0000005_119027_119446 | 137 |
| 537 | 3300053078 | Ga0495612_0408690 | Ga0495612_0408690_119_538 | 137 |
| 538 | 3300053084 | Ga0495595_0000065 | Ga0495595_0000065_7198_7617 | 137 |
| 539 | 3300053084 | Ga0495595_0281379 | Ga0495595_0281379_336_755 | 137 |
| 540 | 3300053085 | Ga0495619_0000003 | Ga0495619_0000003_347868_348287 | 137 |
| 541 | 3300053085 | Ga0495619_0090141 | Ga0495619_0090141_468_887 | 137 |
| 542 | 3300053085 | Ga0495619_0475460 | Ga0495619_0475460_332_751 | 137 |
| 543 | 3300053085 | Ga0495619_0574633 | Ga0495619_0574633_161_580 | 137 |
| 544 | 3300053096 | Ga0500641_0230864 | Ga0500641_0230864_27_461 | 137 |
| 545 | 3300053096 | Ga0500641_0248279 | Ga0500641_0248279_295_714 | 137 |
| 546 | 3300053119 | Ga0500595_005091 | Ga0500595_005091_3412_3846 | 137 |
| 547 | 3300053153 | Ga0500616_0230436 | Ga0500616_0230436_91_525 | 137 |
| 548 | 3300054114 | Ga0501084_0167468 | Ga0501084_0167468_1335_1754 | 137 |
| 549 | 3300054114 | Ga0501084_0642877 | Ga0501084_0642877_272_691 | 137 |
| 550 | 3300060353 | Ga0501082_0102022 | Ga0501082_0102022_1650_2069 | 137 |
| 551 | 3300061734 | Ga0530510_0046536 | Ga0530510_0046536_296_715 | 137 |
| 552 | 3300061734 | Ga0530510_1247664 | Ga0530510_1247664_125_544 | 137 |
| 553 | iso_pu_bacteria | 2738541298 | 2738831271 | 137 |
| 554 | iso_pu_bacteria | 2738541306 | 2738872799 | 137 |
| 555 | iso_pu_bacteria | 2738543002 | 2739184429 | 137 |
| 556 | iso_pu_bacteria | 2738543008 | 2739219398 | 137 |
| 557 | 3300006173 | Ga0070716_100813815 | Ga0070716_1008138152 | 138 |
| 558 | 3300006175 | Ga0070712_101653630 | Ga0070712_1016536302 | 138 |
| 559 | 3300013296 | Ga0157374_11534609 | Ga0157374_115346092 | 138 |
| 560 | 3300025915 | Ga0207693_10404720 | Ga0207693_104047202 | 138 |
| 561 | 3300026075 | Ga0207708_10627320 | Ga0207708_106273202 | 138 |
| 562 | 3300041408 | Ga0439453_0052982 | Ga0439453_0052982_39_464 | 138 |
| 563 | 3300048903 | Ga0496100_0002815 | Ga0496100_0002815_7690_8112 | 138 |
| 564 | 3300048903 | Ga0496100_0882185 | Ga0496100_0882185_43_465 | 138 |
| 565 | 3300048904 | Ga0496101_0012301 | Ga0496101_0012301_3462_3884 | 138 |
| 566 | 3300048905 | Ga0496102_0010366 | Ga0496102_0010366_2721_3143 | 138 |
| 567 | 3300048907 | Ga0496104_0003228 | Ga0496104_0003228_12764_13186 | 138 |
| 568 | 3300048907 | Ga0496104_0225924 | Ga0496104_0225924_1226_1648 | 138 |
| 569 | 3300048908 | Ga0496105_0117253 | Ga0496105_0117253_1731_2153 | 138 |
| 570 | 3300048908 | Ga0496105_0297667 | Ga0496105_0297667_81_503 | 138 |
| 571 | 3300048909 | Ga0496106_0003463 | Ga0496106_0003463_1010_1432 | 138 |
| 572 | 3300048909 | Ga0496106_0332752 | Ga0496106_0332752_454_876 | 138 |
| 573 | 3300048910 | Ga0496107_0003468 | Ga0496107_0003468_6774_7196 | 138 |
| 574 | 3300048911 | Ga0496108_0001416 | Ga0496108_0001416_6535_6957 | 138 |
| 575 | 3300048911 | Ga0496108_0044856 | Ga0496108_0044856_791_1213 | 138 |
| 576 | 3300048911 | Ga0496108_0406983 | Ga0496108_0406983_431_853 | 138 |
| 577 | 3300048912 | Ga0496109_0003855 | Ga0496109_0003855_5586_6008 | 138 |
| 578 | 3300048912 | Ga0496109_0196191 | Ga0496109_0196191_1359_1781 | 138 |
| 579 | 3300048913 | Ga0496110_0000441 | Ga0496110_0000441_18626_19048 | 138 |
| 580 | 3300048913 | Ga0496110_0006376 | Ga0496110_0006376_3932_4354 | 138 |
| 581 | 3300048914 | Ga0496111_0000741 | Ga0496111_0000741_11402_11824 | 138 |
| 582 | 3300048914 | Ga0496111_0002966 | Ga0496111_0002966_6600_7022 | 138 |
| 583 | 3300048915 | Ga0496112_0006447 | Ga0496112_0006447_8435_8857 | 138 |
| 584 | 3300048915 | Ga0496112_0015544 | Ga0496112_0015544_5601_6023 | 138 |
| 585 | 3300048915 | Ga0496112_0457994 | Ga0496112_0457994_171_593 | 138 |
| 586 | 3300048916 | Ga0496113_0084834 | Ga0496113_0084834_1731_2153 | 138 |
| 587 | 3300048916 | Ga0496113_0106937 | Ga0496113_0106937_1400_1822 | 138 |
| 588 | 3300048917 | Ga0496114_0044845 | Ga0496114_0044845_475_897 | 138 |
| 589 | 3300049583 | Ga0501067_0137532 | Ga0501067_0137532_759_1181 | 138 |
| 590 | 3300003215 | JGI25153J46596_10003207 | JGI25153J46596_100032078 | 139 |
| 591 | 3300005356 | Ga0070674_100040160 | Ga0070674_1000401602 | 139 |
| 592 | 3300005365 | Ga0070688_100204429 | Ga0070688_1002044292 | 139 |
| 593 | 3300005439 | Ga0070711_101234659 | Ga0070711_1012346591 | 139 |
| 594 | 3300005441 | Ga0070700_100239820 | Ga0070700_1002398202 | 139 |
| 595 | 3300005456 | Ga0070678_100046173 | Ga0070678_1000461731 | 139 |
| 596 | 3300005457 | Ga0070662_100670489 | Ga0070662_1006704892 | 139 |
| 597 | 3300005543 | Ga0070672_100880305 | Ga0070672_1008803052 | 139 |
| 598 | 3300005544 | Ga0070686_100058004 | Ga0070686_1000580042 | 139 |
| 599 | 3300005564 | Ga0070664_100546466 | Ga0070664_1005464662 | 139 |
| 600 | 3300005615 | Ga0070702_100122525 | Ga0070702_1001225253 | 139 |
| 601 | 3300006038 | Ga0075365_10582484 | Ga0075365_105824842 | 139 |
| 602 | 3300006042 | Ga0075368_10073422 | Ga0075368_100734222 | 139 |
| 603 | 3300006042 | Ga0075368_10192761 | Ga0075368_101927612 | 139 |
| 604 | 3300006177 | Ga0075362_10232933 | Ga0075362_102329332 | 139 |
| 605 | 3300006178 | Ga0075367_10180694 | Ga0075367_101806942 | 139 |
| 606 | 3300006178 | Ga0075367_10456982 | Ga0075367_104569821 | 139 |
| 607 | 3300006186 | Ga0075369_10132171 | Ga0075369_101321712 | 139 |
| 608 | 3300006195 | Ga0075366_10470019 | Ga0075366_104700192 | 139 |
| 609 | 3300006846 | Ga0075430_100000415 | Ga0075430_10000041521 | 139 |
| 610 | 3300006846 | Ga0075430_100130284 | Ga0075430_1001302843 | 139 |
| 611 | 3300006847 | Ga0075431_100185293 | Ga0075431_1001852932 | 139 |
| 612 | 3300006880 | Ga0075429_100057131 | Ga0075429_1000571313 | 139 |
| 613 | 3300006881 | Ga0068865_100366218 | Ga0068865_1003662182 | 139 |
| 614 | 3300006881 | Ga0068865_100986063 | Ga0068865_1009860632 | 139 |
| 615 | 3300009011 | Ga0105251_10188292 | Ga0105251_101882922 | 139 |
| 616 | 3300009094 | Ga0111539_10682029 | Ga0111539_106820292 | 139 |
| 617 | 3300009098 | Ga0105245_11574132 | Ga0105245_115741321 | 139 |
| 618 | 3300009147 | Ga0114129_10184782 | Ga0114129_101847822 | 139 |
| 619 | 3300009148 | Ga0105243_10478429 | Ga0105243_104784292 | 139 |
| 620 | 3300009148 | Ga0105243_11323375 | Ga0105243_113233751 | 139 |
| 621 | 3300009176 | Ga0105242_10127614 | Ga0105242_101276142 | 139 |
| 622 | 3300009545 | Ga0105237_10229317 | Ga0105237_102293172 | 139 |
| 623 | 3300010375 | Ga0105239_10350481 | Ga0105239_103504812 | 139 |
| 624 | 3300011119 | Ga0105246_10057227 | Ga0105246_100572272 | 139 |
| 625 | 3300011119 | Ga0105246_10749043 | Ga0105246_107490432 | 139 |
| 626 | 3300013296 | Ga0157374_10333944 | Ga0157374_103339442 | 139 |
| 627 | 3300013297 | Ga0157378_10418221 | Ga0157378_104182212 | 139 |
| 628 | 3300013306 | Ga0163162_10427475 | Ga0163162_104274752 | 139 |
| 629 | 3300013308 | Ga0157375_10613567 | Ga0157375_106135672 | 139 |
| 630 | 3300013308 | Ga0157375_10898303 | Ga0157375_108983032 | 139 |
| 631 | 3300014325 | Ga0163163_10293202 | Ga0163163_102932022 | 139 |
| 632 | 3300014325 | Ga0163163_10333760 | Ga0163163_103337604 | 139 |
| 633 | 3300014326 | Ga0157380_10054439 | Ga0157380_100544394 | 139 |
| 634 | 3300014326 | Ga0157380_10785917 | Ga0157380_107859172 | 139 |
| 635 | 3300014497 | Ga0182008_10048561 | Ga0182008_100485612 | 139 |
| 636 | 3300014968 | Ga0157379_10268918 | Ga0157379_102689182 | 139 |
| 637 | 3300014969 | Ga0157376_10040586 | Ga0157376_100405862 | 139 |
| 638 | 3300025297 | Ga0209758_1002876 | Ga0209758_100287613 | 139 |
| 639 | 3300025901 | Ga0207688_10252293 | Ga0207688_102522932 | 139 |
| 640 | 3300025937 | Ga0207669_10291756 | Ga0207669_102917562 | 139 |
| 641 | 3300025938 | Ga0207704_10639504 | Ga0207704_106395042 | 139 |
| 642 | 3300025939 | Ga0207665_10273603 | Ga0207665_102736031 | 139 |
| 643 | 3300025940 | Ga0207691_10114700 | Ga0207691_101147003 | 139 |
| 644 | 3300025944 | Ga0207661_11167429 | Ga0207661_111674291 | 139 |
| 645 | 3300026075 | Ga0207708_10250468 | Ga0207708_102504682 | 139 |
| 646 | 3300026118 | Ga0207675_100638858 | Ga0207675_1006388582 | 139 |
| 647 | 3300026121 | Ga0207683_10041081 | Ga0207683_100410814 | 139 |
| 648 | 3300027866 | Ga0209813_10220764 | Ga0209813_102207642 | 139 |
| 649 | 3300027866 | Ga0209813_10360442 | Ga0209813_103604421 | 139 |
| 650 | 3300031548 | Ga0307408_100543838 | Ga0307408_1005438382 | 139 |
| 651 | 3300031901 | Ga0307406_10854759 | Ga0307406_108547592 | 139 |
| 652 | 3300032002 | Ga0307416_103154128 | Ga0307416_1031541281 | 139 |
| 653 | 3300032005 | Ga0307411_12224723 | Ga0307411_122247231 | 139 |
| 654 | 3300035691 | Ga0373931_0445902 | Ga0373931_0445902_340_813 | 139 |
| 655 | 3300037068 | Ga0373925_0875446 | Ga0373925_0875446_72_545 | 139 |
| 656 | 3300039437 | Ga0436365_1653913 | Ga0436365_1653913_49_498 | 139 |
| 657 | 3300039447 | Ga0436361_0028523 | Ga0436361_0028523_995_1435 | 139 |
| 658 | 3300041443 | Ga0451789_1368216 | Ga0451789_1368216_98_559 | 139 |
| 659 | 3300041501 | Ga0451845_0687621 | Ga0451845_0687621_22_471 | 139 |
| 660 | 3300042001 | Ga0439441_015847 | Ga0439441_015847_365_799 | 139 |
| 661 | 3300042436 | Ga0439435_0064608 | Ga0439435_0064608_27_461 | 139 |
| 662 | 3300046684 | Ga0495669_0610730 | Ga0495669_0610730_15_488 | 139 |
| 663 | 3300046691 | Ga0495670_0716058 | Ga0495670_0716058_24_482 | 139 |
| 664 | 3300048903 | Ga0496100_0556602 | Ga0496100_0556602_92_523 | 139 |
| 665 | 3300048905 | Ga0496102_0191648 | Ga0496102_0191648_346_819 | 139 |
| 666 | 3300048905 | Ga0496102_1433031 | Ga0496102_1433031_11_442 | 139 |
| 667 | 3300048907 | Ga0496104_0010977 | Ga0496104_0010977_4655_5128 | 139 |
| 668 | 3300048907 | Ga0496104_0336097 | Ga0496104_0336097_414_845 | 139 |
| 669 | 3300048908 | Ga0496105_0066324 | Ga0496105_0066324_1322_1795 | 139 |
| 670 | 3300048908 | Ga0496105_0605996 | Ga0496105_0605996_57_488 | 139 |
| 671 | 3300048909 | Ga0496106_0207104 | Ga0496106_0207104_478_909 | 139 |
| 672 | 3300048909 | Ga0496106_0643313 | Ga0496106_0643313_92_565 | 139 |
| 673 | 3300048910 | Ga0496107_0112065 | Ga0496107_0112065_545_1018 | 139 |
| 674 | 3300048910 | Ga0496107_0223177 | Ga0496107_0223177_196_627 | 139 |
| 675 | 3300048911 | Ga0496108_0160338 | Ga0496108_0160338_1320_1793 | 139 |
| 676 | 3300048912 | Ga0496109_0054892 | Ga0496109_0054892_1966_2439 | 139 |
| 677 | 3300048913 | Ga0496110_0111049 | Ga0496110_0111049_1939_2370 | 139 |
| 678 | 3300048915 | Ga0496112_0031599 | Ga0496112_0031599_3454_3927 | 139 |
| 679 | 3300048915 | Ga0496112_0229187 | Ga0496112_0229187_547_978 | 139 |
| 680 | 3300048916 | Ga0496113_0581115 | Ga0496113_0581115_47_520 | 139 |
| 681 | 3300048917 | Ga0496114_0106765 | Ga0496114_0106765_1720_2151 | 139 |
| 682 | 3300048918 | Ga0496115_0202095 | Ga0496115_0202095_295_726 | 139 |
| 683 | 3300049571 | Ga0501034_0654529 | Ga0501034_0654529_295_756 | 139 |
| 684 | 3300050489 | nmdc:mga03683_170874_c1 | nmdc:mga03683_170874_c1_419_853 | 139 |
| 685 | 3300050489 | nmdc:mga03683_218808_c1 | nmdc:mga03683_218808_c1_394_828 | 139 |
| 686 | 3300050489 | nmdc:mga03683_477937_c1 | nmdc:mga03683_477937_c1_85_519 | 139 |
| 687 | 3300050491 | nmdc:mga00v17_271797_c1 | nmdc:mga00v17_271797_c1_531_965 | 139 |
| 688 | 3300050493 | nmdc:mga0k408_5297_c1 | nmdc:mga0k408_5297_c1_6161_6610 | 139 |
| 689 | 3300050494 | nmdc:mga06z11_179535_c1 | nmdc:mga06z11_179535_c1_93_527 | 139 |
| 690 | 3300050495 | nmdc:mga04h51_250745_c1 | nmdc:mga04h51_250745_c1_202_651 | 139 |
| 691 | 3300050509 | nmdc:mga0qj67_19_c1 | nmdc:mga0qj67_19_c1_72341_72769 | 139 |
| 692 | 3300050513 | nmdc:mga0rr50_347939_c1 | nmdc:mga0rr50_347939_c1_439_912 | 139 |
| 693 | 3300050514 | nmdc:mga08x19_59654_c1 | nmdc:mga08x19_59654_c1_1121_1594 | 139 |
| 694 | 3300050515 | nmdc:mga0a205_535083_c1 | nmdc:mga0a205_535083_c1_327_800 | 139 |
| 695 | 3300053083 | Ga0495655_0010780 | Ga0495655_0010780_31_480 | 139 |
| 696 | 3300053083 | Ga0495655_0067737 | Ga0495655_0067737_395_868 | 139 |
| 697 | 3300053085 | Ga0495619_0666556 | Ga0495619_0666556_186_614 | 139 |
| 698 | 3300061734 | Ga0530510_0066928 | Ga0530510_0066928_1059_1499 | 139 |
| 699 | 3300005339 | Ga0070660_100135219 | Ga0070660_1001352191 | 140 |
| 700 | 3300005458 | Ga0070681_10047951 | Ga0070681_100479513 | 140 |
| 701 | 3300005530 | Ga0070679_100007416 | Ga0070679_1000074164 | 140 |
| 702 | 3300025909 | Ga0207705_10828753 | Ga0207705_108287531 | 140 |
| 703 | 3300025912 | Ga0207707_10083019 | Ga0207707_100830193 | 140 |
| 704 | 3300025917 | Ga0207660_10145978 | Ga0207660_101459782 | 140 |
| 705 | 3300025919 | Ga0207657_10129109 | Ga0207657_101291092 | 140 |
| 706 | 3300025921 | Ga0207652_10049692 | Ga0207652_100496923 | 140 |
| 707 | 3300049568 | Ga0501031_0068408 | Ga0501031_0068408_170_622 | 140 |
| 708 | 3300049569 | Ga0501032_0033597 | Ga0501032_0033597_1887_2339 | 140 |
| 709 | 3300049570 | Ga0501033_0008019 | Ga0501033_0008019_4061_4513 | 140 |
| 710 | 3300049571 | Ga0501034_0027191 | Ga0501034_0027191_4007_4459 | 140 |
| 711 | 3300049572 | Ga0501036_0013392 | Ga0501036_0013392_1896_2348 | 140 |
| 712 | 3300049573 | Ga0501037_0006901 | Ga0501037_0006901_4529_4981 | 140 |
| 713 | 3300049574 | Ga0501038_0002228 | Ga0501038_0002228_4148_4600 | 140 |
| 714 | 3300049574 | Ga0501038_0354442 | Ga0501038_0354442_461_913 | 140 |
| 715 | 3300049575 | Ga0501039_0016251 | Ga0501039_0016251_5039_5491 | 140 |
| 716 | 3300049579 | Ga0501043_0011913 | Ga0501043_0011913_5177_5629 | 140 |
| 717 | 3300049580 | Ga0501046_0010815 | Ga0501046_0010815_5538_5990 | 140 |
| 718 | 3300049580 | Ga0501046_0512025 | Ga0501046_0512025_224_679 | 140 |
| 719 | 3300049581 | Ga0501047_0010793 | Ga0501047_0010793_4700_5152 | 140 |
| 720 | 3300049582 | Ga0501048_0008167 | Ga0501048_0008167_5767_6219 | 140 |
| 721 | 3300049583 | Ga0501067_0010362 | Ga0501067_0010362_1766_2218 | 140 |
| 722 | 3300049584 | Ga0501068_0004223 | Ga0501068_0004223_5419_5871 | 140 |
| 723 | 3300049585 | Ga0501069_0005631 | Ga0501069_0005631_2011_2463 | 140 |
| 724 | 3300049586 | Ga0501070_0014893 | Ga0501070_0014893_4468_4920 | 140 |
| 725 | 3300049587 | Ga0501071_0013351 | Ga0501071_0013351_181_633 | 140 |
| 726 | 3300049589 | Ga0501073_0012398 | Ga0501073_0012398_4148_4600 | 140 |
| 727 | 3300049590 | Ga0501074_0000430 | Ga0501074_0000430_7136_7588 | 140 |
| 728 | 3300049592 | Ga0501076_0029352 | Ga0501076_0029352_2172_2624 | 140 |
| 729 | 3300049741 | Ga0501079_0010782 | Ga0501079_0010782_4024_4476 | 140 |
| 730 | 3300049741 | Ga0501079_0988856 | Ga0501079_0988856_10_450 | 140 |
| 731 | 3300049742 | Ga0501080_0008809 | Ga0501080_0008809_3179_3631 | 140 |
| 732 | 3300049743 | Ga0501081_0583907 | Ga0501081_0583907_72_524 | 140 |
| 733 | 3300049822 | Ga0501035_0013095 | Ga0501035_0013095_3343_3795 | 140 |
| 734 | 3300049823 | Ga0501044_0001797 | Ga0501044_0001797_23649_24101 | 140 |
| 735 | 3300049823 | Ga0501044_0017730 | Ga0501044_0017730_3179_3631 | 140 |
| 736 | 3300049824 | Ga0501045_0005187 | Ga0501045_0005187_4061_4513 | 140 |
| 737 | 3300054114 | Ga0501084_0016675 | Ga0501084_0016675_565_1017 | 140 |
| 738 | 3300060353 | Ga0501082_0018907 | Ga0501082_0018907_539_991 | 140 |
| 739 | 3300001979 | JGI24740J21852_10026211 | JGI24740J21852_100262112 | 141 |
| 740 | 3300001990 | JGI24737J22298_10009842 | JGI24737J22298_100098422 | 141 |
| 741 | 3300002067 | JGI24735J21928_10000063 | JGI24735J21928_1000006328 | 141 |
| 742 | 3300005535 | Ga0070684_101168564 | Ga0070684_1011685641 | 141 |
| 743 | 3300013105 | Ga0157369_10004170 | Ga0157369_1000417016 | 141 |
| 744 | 3300017792 | Ga0163161_10595774 | Ga0163161_105957741 | 141 |
| 745 | 3300025904 | Ga0207647_10007491 | Ga0207647_100074915 | 141 |
| 746 | 3300025919 | Ga0207657_10189770 | Ga0207657_101897702 | 141 |
| 747 | 3300031241 | Ga0265325_10000938 | Ga0265325_100009384 | 141 |
| 748 | 3300031250 | Ga0265331_10099316 | Ga0265331_100993162 | 141 |
| 749 | 3300035725 | Ga0373947_0233033 | Ga0373947_0233033_701_1162 | 141 |
| 750 | 3300046474 | Ga0495605_0002800 | Ga0495605_0002800_2604_3074 | 141 |
| 751 | 3300046507 | Ga0495606_0003567 | Ga0495606_0003567_7281_7751 | 141 |
| 752 | 3300046512 | Ga0495610_0005010 | Ga0495610_0005010_5191_5661 | 141 |
| 753 | 3300046528 | Ga0495642_0440488 | Ga0495642_0440488_54_524 | 141 |
| 754 | 3300046694 | Ga0495649_0102010 | Ga0495649_0102010_546_1016 | 141 |
| 755 | 3300047323 | Ga0495683_0004622 | Ga0495683_0004622_3137_3607 | 141 |
| 756 | 3300047472 | Ga0495686_0290789 | Ga0495686_0290789_218_688 | 141 |
| 757 | 3300048091 | Ga0495626_0046564 | Ga0495626_0046564_554_1024 | 141 |
| 758 | 3300048906 | Ga0496103_0004418 | Ga0496103_0004418_7004_7459 | 141 |
| 759 | 3300048920 | Ga0496117_0001630 | Ga0496117_0001630_23005_23460 | 141 |
| 760 | 3300048920 | Ga0496117_0041352 | Ga0496117_0041352_1762_2232 | 141 |
| 761 | 3300048921 | Ga0496118_0000198 | Ga0496118_0000198_29616_30071 | 141 |
| 762 | 3300048921 | Ga0496118_0007169 | Ga0496118_0007169_4325_4795 | 141 |
| 763 | 3300048926 | Ga0496123_0040147 | Ga0496123_0040147_1891_2361 | 141 |
| 764 | 3300048928 | Ga0496125_0221221 | Ga0496125_0221221_225_695 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e29-assembly1.cif.gz_D | x-ray structure of the protein q7we92_borbr from thioesterase superfamily. northeast structural genomics consortium target bor214a. | 0.9293 | 9 | 135 |
| 3e29-assembly1.cif.gz_D | x-ray structure of the protein q7we92_borbr from thioesterase superfamily. northeast structural genomics consortium target bor214a. | 0.8896 | 9 | 135 |
| 3dkz-assembly1.cif.gz_A | crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. | 0.8814 | 19 | 135 |
| 4qda-assembly4.cif.gz_E | crystal structure of mutant thioesterase pa1618 (e64a) from pseudomonas aeruginosa | 0.8693 | 7 | 135 |
| 4k4c-assembly1.cif.gz_D | x-ray crystal structure of e. coli ybdb complexed with phenacyl-coa | 0.8667 | 7 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e29D00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9229 | 11 | 135 | 3.10.129.10 |
| af_P0ADP2_3_154_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.884 | 13 | 135 | 3.10.129.10 |
| 3e29D00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8754 | 11 | 135 | 3.10.129.10 |
| 3dkzB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8664 | 19 | 135 | 3.10.129.10 |
| 2fs2B00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8611 | 9 | 135 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G9LQ64-F1-model_v4 | Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) | 0.9594 | 5 | 136 |
GO:0016790
|
| AF-A0A0P7YBV9-F1-model_v4 | Thioesterase domain-containing protein | 0.9444 | 7 | 139 |
GO:0047617
|
| AF-A0A3S8ZAL1-F1-model_v4 | PaaI family thioesterase | 0.9431 | 7 | 136 |
GO:0016790
|
| AF-A0A2N3Y3H6-F1-model_v4 | Uncharacterized protein (TIGR00369 family) | 0.9393 | 5 | 140 |
GO:0047617
|
| AF-A0A2E7RE06-F1-model_v4 | Phenylacetic acid degradation protein | 0.9382 | 7 | 136 |
GO:0047617
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar