F479725

General Info

Members Datasets Scaffolds Average Seq Length
764 380 760 141

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10127614|Ga0105242_101276142
Length 157
Sequence MLAGCNASPVGHRRWELLMAEEITIERVQQLVTRAPYHQWLGLKVIALHDDGIELTATWREEWVVNPDRRYTHGGVLATLVDLGADWAMVSKTGRGVPTIDLRIDYHAVAMPGDLTIRGKIVRMGSQFSTSEARVFDAEGKLLASGRGTYYTAPPKA

Samples

Sample ID Description Type Environment
1 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
2 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
3 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
4 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
223 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
224 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
227 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
255 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
296 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
354 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
373 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
376 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
377 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
380 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.68
Nodule 0
Rhizoplane 12.7
Rhizosphere 77.36
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10026211 3300001979 Bacteria 1955
2 JGI24737J22298_10009842 3300001990 Bacteria 3167
3 JGI24735J21928_10000063 3300002067 Bacteria 44257
4 JGI24738J21930_10104526 3300002075 Bacteria 606
5 JGI25153J46596_10003207 3300003215 Bacteria 9193
6 JGI25405J52794_10067120 3300003911 Bacteria 780
7 Ga0070683_100996181 3300005329 Bacteria 804
8 Ga0070670_100040441 3300005331 Bacteria 4009
9 Ga0070670_100257205 3300005331 Bacteria 1522
10 Ga0070666_10063021 3300005335 Bacteria 2512
11 Ga0068868_100032929 3300005338 Bacteria 3991
12 Ga0070660_100135219 3300005339 Bacteria 1975
13 Ga0070689_100051282 3300005340 Bacteria 3189
14 Ga0070689_100658184 3300005340 Bacteria 912
15 Ga0070691_10032118 3300005341 Bacteria 2465
16 Ga0070692_10071972 3300005345 Bacteria 1843
17 Ga0070668_101148732 3300005347 Bacteria 702
18 Ga0070675_100492823 3300005354 Unclassified 1103
19 Ga0070671_100641552 3300005355 Unclassified 919
20 Ga0070674_100040160 3300005356 Bacteria 3164
21 Ga0070673_100605052 3300005364 Unclassified 1000
22 Ga0070673_101119336 3300005364 Bacteria 736
23 Ga0070688_100204429 3300005365 Bacteria 1383
24 Ga0070688_100235697 3300005365 Bacteria 1296
25 Ga0070659_100059701 3300005366 Bacteria 3011
26 Ga0070659_102156497 3300005366 Bacteria 501
27 Ga0070709_10000668 3300005434 Bacteria 19554
28 Ga0070709_10161926 3300005434 Bacteria 1557
29 Ga0070714_100008660 3300005435 Bacteria 7956
30 Ga0070714_100020634 3300005435 Bacteria 5384
31 Ga0070714_100307868 3300005435 Bacteria 1478
32 Ga0070714_100984824 3300005435 Bacteria 820
33 Ga0070714_101420494 3300005435 Bacteria 678
34 Ga0070713_100007357 3300005436 Bacteria 7718
35 Ga0070713_100115158 3300005436 Bacteria 2350
36 Ga0070713_100139774 3300005436 Bacteria 2144
37 Ga0070713_100169877 3300005436 Bacteria 1953
38 Ga0070713_100222760 3300005436 Bacteria 1711
39 Ga0070713_100281357 3300005436 Bacteria 1526
40 Ga0070713_100875628 3300005436 Bacteria 863
41 Ga0070710_10004289 3300005437 Bacteria 6764
42 Ga0070710_10210457 3300005437 Bacteria 1232
43 Ga0070710_10332714 3300005437 Bacteria 1000
44 Ga0070701_10052649 3300005438 Bacteria 2116
45 Ga0070711_100021882 3300005439 Bacteria 4138
46 Ga0070711_100107217 3300005439 Bacteria 2044
47 Ga0070711_100119235 3300005439 Bacteria 1949
48 Ga0070711_100448885 3300005439 Bacteria 1055
49 Ga0070711_100916214 3300005439 Bacteria 749
50 Ga0070711_101234659 3300005439 Bacteria 647
51 Ga0070705_100750279 3300005440 Bacteria 772
52 Ga0070700_100239820 3300005441 Bacteria 1295
53 Ga0070694_100581299 3300005444 Bacteria 900
54 Ga0070663_100206649 3300005455 Bacteria 1535
55 Ga0070678_100046173 3300005456 Bacteria 3121
56 Ga0070678_100288853 3300005456 Bacteria 1389
57 Ga0070662_100148186 3300005457 Bacteria 1824
58 Ga0070662_100670489 3300005457 Bacteria 876
59 Ga0070681_10047951 3300005458 Bacteria 4269
60 Ga0070681_10206021 3300005458 Bacteria 1884
61 Ga0070681_11342937 3300005458 Unclassified 638
62 Ga0070685_10341773 3300005466 Unclassified 1021
63 Ga0070706_100398338 3300005467 Bacteria 1281
64 Ga0070698_100895348 3300005471 Bacteria 833
65 Ga0070699_100010309 3300005518 Bacteria 8081
66 Ga0070679_100007416 3300005530 Bacteria 10250
67 Ga0070679_100908494 3300005530 Bacteria 824
68 Ga0070684_100417909 3300005535 Bacteria 1238
69 Ga0070684_101168564 3300005535 Bacteria 724
70 Ga0070672_100880305 3300005543 Unclassified 790
71 Ga0070686_100058004 3300005544 Bacteria 2490
72 Ga0070686_100642483 3300005544 Bacteria 840
73 Ga0070696_100651791 3300005546 Bacteria 854
74 Ga0070693_100357243 3300005547 Bacteria 1002
75 Ga0070665_100934873 3300005548 Bacteria 879
76 Ga0070665_101076589 3300005548 Unclassified 815
77 Ga0070704_100336792 3300005549 Bacteria 1269
78 Ga0068855_100211184 3300005563 Bacteria 2181
79 Ga0070664_100175665 3300005564 Bacteria 1901
80 Ga0070664_100546466 3300005564 Bacteria 1071
81 Ga0068854_100003131 3300005578 Bacteria 10300
82 Ga0070702_100122525 3300005615 Bacteria 1630
83 Ga0070702_100209792 3300005615 Bacteria 1295
84 Ga0068852_100172578 3300005616 Bacteria 2028
85 Ga0068864_100065337 3300005618 Bacteria 3156
86 Ga0068866_10333251 3300005718 Unclassified 958
87 Ga0068861_100014501 3300005719 Bacteria 5532
88 Ga0068851_10232951 3300005834 Bacteria 1039
89 Ga0068870_10169873 3300005840 Bacteria 1300
90 Ga0068863_100037605 3300005841 Bacteria 4608
91 Ga0068863_101192282 3300005841 Bacteria 767
92 Ga0068858_100981107 3300005842 Unclassified 827
93 Ga0068860_100058618 3300005843 Bacteria 3660
94 Ga0068862_101003728 3300005844 Bacteria 825
95 Ga0081455_10001715 3300005937 Bacteria 26531
96 Ga0081455_10034176 3300005937 Bacteria 4558
97 Ga0081455_10060308 3300005937 Bacteria 3199
98 Ga0081455_10752632 3300005937 Bacteria 616
99 Ga0081538_10008299 3300005981 Bacteria 8845
100 Ga0081540_1021808 3300005983 Bacteria 3800
101 Ga0081540_1045750 3300005983 Bacteria 2218
102 Ga0081540_1150335 3300005983 Bacteria 920
103 Ga0070717_10309058 3300006028 Bacteria 1406
104 Ga0070717_10406653 3300006028 Bacteria 1223
105 Ga0070717_10543782 3300006028 Bacteria 1051
106 Ga0070717_11131140 3300006028 Bacteria 713
107 Ga0070717_11565076 3300006028 Bacteria 598
108 Ga0070717_11793565 3300006028 Bacteria 555
109 Ga0070717_11845860 3300006028 Unclassified 546
110 Ga0075365_10002322 3300006038 Bacteria 9254
111 Ga0075365_10035594 3300006038 Bacteria 3222
112 Ga0075365_10040967 3300006038 Bacteria 3023
113 Ga0075365_10068968 3300006038 Bacteria 2376
114 Ga0075365_10220145 3300006038 Bacteria 1331
115 Ga0075365_10556812 3300006038 Bacteria 811
116 Ga0075365_10582484 3300006038 Bacteria 791
117 Ga0075368_10073422 3300006042 Bacteria 1384
118 Ga0075368_10192761 3300006042 Bacteria 861
119 Ga0075368_10263255 3300006042 Bacteria 738
120 Ga0075363_100170429 3300006048 Bacteria 1236
121 Ga0075364_10104200 3300006051 Bacteria 1890
122 Ga0075364_10522406 3300006051 Bacteria 811
123 Ga0070715_10001202 3300006163 Bacteria 7448
124 Ga0070715_10089758 3300006163 Bacteria 1412
125 Ga0070716_100038436 3300006173 Bacteria 2650
126 Ga0070716_100042820 3300006173 Bacteria 2529
127 Ga0070716_100813815 3300006173 Bacteria 724
128 Ga0070712_100003811 3300006175 Bacteria 9292
129 Ga0070712_100008370 3300006175 Bacteria 6505
130 Ga0070712_100382565 3300006175 Bacteria 1159
131 Ga0070712_100670244 3300006175 Bacteria 882
132 Ga0070712_100911496 3300006175 Bacteria 758
133 Ga0070712_101653630 3300006175 Bacteria 560
134 Ga0075362_10058692 3300006177 Bacteria 1736
135 Ga0075362_10232933 3300006177 Bacteria 902
136 Ga0075367_10131122 3300006178 Bacteria 1549
137 Ga0075367_10149788 3300006178 Bacteria 1447
138 Ga0075367_10180694 3300006178 Bacteria 1315
139 Ga0075367_10264852 3300006178 Bacteria 1079
140 Ga0075367_10456982 3300006178 Bacteria 809
141 Ga0075369_10132171 3300006186 Bacteria 1135
142 Ga0075366_10470019 3300006195 Bacteria 776
143 Ga0075366_10586327 3300006195 Bacteria 691
144 Ga0097621_100047516 3300006237 Bacteria 3479
145 Ga0075370_10575639 3300006353 Bacteria 682
146 Ga0068871_101066770 3300006358 Unclassified 754
147 Ga0075428_100069715 3300006844 Bacteria 3844
148 Ga0075428_100808228 3300006844 Bacteria 996
149 Ga0075428_100985093 3300006844 Bacteria 893
150 Ga0075428_101174079 3300006844 Bacteria 810
151 Ga0075430_100000415 3300006846 Bacteria 31698
152 Ga0075430_100130284 3300006846 Bacteria 2096
153 Ga0075431_100185293 3300006847 Bacteria 2134
154 Ga0075431_100345803 3300006847 Bacteria 1496
155 Ga0075431_100387458 3300006847 Bacteria 1401
156 Ga0075431_100665300 3300006847 Bacteria 1021
157 Ga0075431_100719990 3300006847 Bacteria 975
158 Ga0075433_10106011 3300006852 Bacteria 2491
159 Ga0075434_100083910 3300006871 Bacteria 3184
160 Ga0075434_100802066 3300006871 Bacteria 958
161 Ga0075429_100057131 3300006880 Bacteria 3397
162 Ga0068865_100366218 3300006881 Bacteria 1172
163 Ga0068865_100550831 3300006881 Unclassified 968
164 Ga0068865_100986063 3300006881 Bacteria 737
165 Ga0075436_100143194 3300006914 Bacteria 1681
166 Ga0075436_100211464 3300006914 Bacteria 1375
167 Ga0075435_100027374 3300007076 Bacteria 4458
168 Ga0099794_10015989 3300007265 Bacteria 3320
169 Ga0099794_10024786 3300007265 Bacteria 2757
170 Ga0099795_10075856 3300007788 Bacteria 1277
171 Ga0099795_10104572 3300007788 Bacteria 1115
172 Ga0099795_10222370 3300007788 Bacteria 804
173 Ga0105251_10188292 3300009011 Bacteria 929
174 Ga0111539_10011398 3300009094 Bacteria 11160
175 Ga0111539_10145390 3300009094 Bacteria 2776
176 Ga0111539_10443512 3300009094 Bacteria 1511
177 Ga0111539_10626941 3300009094 Bacteria 1252
178 Ga0111539_10682029 3300009094 Bacteria 1196
179 Ga0111539_11786675 3300009094 Bacteria 713
180 Ga0111539_12180598 3300009094 Unclassified 643
181 Ga0105245_10478860 3300009098 Bacteria 1258
182 Ga0105245_11574132 3300009098 Bacteria 709
183 Ga0105247_10037846 3300009101 Bacteria 2943
184 Ga0105247_10071680 3300009101 Bacteria 2168
185 Ga0114129_10084911 3300009147 Bacteria 4393
186 Ga0114129_10184782 3300009147 Bacteria 2834
187 Ga0114129_10311334 3300009147 Bacteria 2096
188 Ga0114129_10442771 3300009147 Bacteria 1705
189 Ga0114129_10725485 3300009147 Bacteria 1275
190 Ga0114129_11926580 3300009147 Bacteria 716
191 Ga0114129_12149990 3300009147 Bacteria 672
192 Ga0105243_10478429 3300009148 Bacteria 1175
193 Ga0105243_11323375 3300009148 Bacteria 738
194 Ga0105241_10615959 3300009174 Bacteria 982
195 Ga0105242_10127614 3300009176 Bacteria 2191
196 Ga0105242_11749776 3300009176 Bacteria 659
197 Ga0105248_10496622 3300009177 Bacteria 1376
198 Ga0105237_10229317 3300009545 Bacteria 1858
199 Ga0105249_10442613 3300009553 Bacteria 1337
200 Ga0105249_10513405 3300009553 Bacteria 1245
201 Ga0105249_10874936 3300009553 Bacteria 965
202 Ga0099796_10045114 3300010159 Bacteria 1509
203 Ga0099796_10055402 3300010159 Bacteria 1389
204 Ga0099796_10152577 3300010159 Bacteria 911
205 Ga0105239_10350481 3300010375 Bacteria 1667
206 Ga0105239_10494552 3300010375 Bacteria 1390
207 Ga0105246_10057227 3300011119 Bacteria 2697
208 Ga0105246_10201665 3300011119 Bacteria 1547
209 Ga0105246_10749043 3300011119 Bacteria 861
210 Ga0105246_11279359 3300011119 Bacteria 679
211 Ga0157342_1019718 3300012507 Unclassified 774
212 Ga0157369_10004170 3300013105 Bacteria 17125
213 Ga0157374_10333944 3300013296 Bacteria 1504
214 Ga0157374_11534609 3300013296 Bacteria 690
215 Ga0157378_10418221 3300013297 Bacteria 1324
216 Ga0163162_10427475 3300013306 Bacteria 1456
217 Ga0163162_11100096 3300013306 Bacteria 900
218 Ga0157375_10613567 3300013308 Bacteria 1246
219 Ga0157375_10898303 3300013308 Unclassified 1030
220 Ga0163163_10243969 3300014325 Bacteria 1846
221 Ga0163163_10293202 3300014325 Bacteria 1679
222 Ga0163163_10333760 3300014325 Unclassified 1571
223 Ga0163163_11053408 3300014325 Bacteria 876
224 Ga0157380_10054439 3300014326 Bacteria 3175
225 Ga0157380_10785917 3300014326 Bacteria 967
226 Ga0182008_10048561 3300014497 Bacteria 2107
227 Ga0157377_10135919 3300014745 Bacteria 1506
228 Ga0157377_10617164 3300014745 Bacteria 776
229 Ga0157379_10268918 3300014968 Bacteria 1550
230 Ga0157376_10040586 3300014969 Bacteria 3805
231 Ga0163161_10248962 3300017792 Bacteria 1384
232 Ga0163161_10595774 3300017792 Bacteria 911
233 Ga0213872_10043676 3300021361 Bacteria 2042
234 Ga0213874_10070323 3300021377 Bacteria 1115
235 Ga0213876_10118109 3300021384 Bacteria 1408
236 Ga0213876_10658730 3300021384 Bacteria 557
237 Ga0209758_1002876 3300025297 Bacteria 16678
238 Ga0207697_10059716 3300025315 Bacteria 1585
239 Ga0207692_10079882 3300025898 Bacteria 1746
240 Ga0207692_10095425 3300025898 Bacteria 1622
241 Ga0207710_10093381 3300025900 Bacteria 1411
242 Ga0207688_10028562 3300025901 Bacteria 3068
243 Ga0207688_10252293 3300025901 Bacteria 1069
244 Ga0207680_10128683 3300025903 Bacteria 1666
245 Ga0207647_10007491 3300025904 Bacteria 7886
246 Ga0207647_10085257 3300025904 Bacteria 1890
247 Ga0207685_10000972 3300025905 Bacteria 5532
248 Ga0207685_10023170 3300025905 Bacteria 2110
249 Ga0207685_10410439 3300025905 Unclassified 696
250 Ga0207699_10074924 3300025906 Bacteria 2080
251 Ga0207645_10005079 3300025907 Bacteria 9637
252 Ga0207643_10001128 3300025908 Bacteria 15876
253 Ga0207705_10828753 3300025909 Bacteria 718
254 Ga0207684_10217177 3300025910 Bacteria 1650
255 Ga0207684_10280034 3300025910 Bacteria 1438
256 Ga0207707_10078620 3300025912 Bacteria 2881
257 Ga0207707_10083019 3300025912 Bacteria 2798
258 Ga0207671_10076704 3300025914 Bacteria 2501
259 Ga0207693_10000564 3300025915 Bacteria 33530
260 Ga0207693_10001853 3300025915 Bacteria 18527
261 Ga0207693_10011503 3300025915 Bacteria 7156
262 Ga0207693_10082723 3300025915 Bacteria 2514
263 Ga0207693_10201668 3300025915 Bacteria 1564
264 Ga0207693_10353865 3300025915 Bacteria 1149
265 Ga0207693_10404720 3300025915 Bacteria 1067
266 Ga0207663_10002863 3300025916 Bacteria 8340
267 Ga0207663_10042119 3300025916 Bacteria 2788
268 Ga0207663_10135075 3300025916 Bacteria 1710
269 Ga0207663_10386291 3300025916 Bacteria 1067
270 Ga0207663_10645702 3300025916 Bacteria 835
271 Ga0207660_10145978 3300025917 Bacteria 1813
272 Ga0207662_10089026 3300025918 Bacteria 1896
273 Ga0207657_10129109 3300025919 Bacteria 2073
274 Ga0207657_10189770 3300025919 Bacteria 1658
275 Ga0207652_10049692 3300025921 Bacteria 3591
276 Ga0207652_10625871 3300025921 Bacteria 964
277 Ga0207681_10148278 3300025923 Bacteria 1755
278 Ga0207659_10023144 3300025926 Bacteria 4143
279 Ga0207700_10001282 3300025928 Bacteria 14331
280 Ga0207700_10059362 3300025928 Bacteria 2893
281 Ga0207700_10240937 3300025928 Bacteria 1541
282 Ga0207700_10359851 3300025928 Bacteria 1269
283 Ga0207700_11590165 3300025928 Bacteria 578
284 Ga0207664_10020726 3300025929 Bacteria 4879
285 Ga0207664_10865021 3300025929 Bacteria 812
286 Ga0207706_10004504 3300025933 Bacteria 13082
287 Ga0207706_10670462 3300025933 Unclassified 887
288 Ga0207706_11575269 3300025933 Unclassified 533
289 Ga0207709_10020604 3300025935 Bacteria 3723
290 Ga0207669_10066269 3300025937 Bacteria 2244
291 Ga0207669_10291756 3300025937 Bacteria 1235
292 Ga0207704_10039472 3300025938 Bacteria 2749
293 Ga0207704_10266338 3300025938 Bacteria 1295
294 Ga0207704_10639504 3300025938 Bacteria 875
295 Ga0207665_10000864 3300025939 Bacteria 20479
296 Ga0207665_10014272 3300025939 Bacteria 5230
297 Ga0207665_10273603 3300025939 Bacteria 1255
298 Ga0207691_10114700 3300025940 Bacteria 2393
299 Ga0207691_10197038 3300025940 Bacteria 1754
300 Ga0207711_10172441 3300025941 Bacteria 1963
301 Ga0207689_10047702 3300025942 Bacteria 3534
302 Ga0207689_10495676 3300025942 Bacteria 1023
303 Ga0207661_11167429 3300025944 Unclassified 709
304 Ga0207667_10544718 3300025949 Bacteria 1174
305 Ga0207667_12049590 3300025949 Bacteria 532
306 Ga0207712_10254309 3300025961 Bacteria 1422
307 Ga0207712_10280071 3300025961 Bacteria 1361
308 Ga0207640_10219980 3300025981 Bacteria 1453
309 Ga0207658_10065917 3300025986 Bacteria 2722
310 Ga0207658_10655185 3300025986 Bacteria 947
311 Ga0207677_10230644 3300026023 Bacteria 1491
312 Ga0207703_10077185 3300026035 Bacteria 2765
313 Ga0207639_10933818 3300026041 Bacteria 811
314 Ga0207678_10005216 3300026067 Bacteria 11644
315 Ga0207708_10001094 3300026075 Bacteria 20325
316 Ga0207708_10250468 3300026075 Bacteria 1427
317 Ga0207708_10627320 3300026075 Bacteria 913
318 Ga0207702_10148930 3300026078 Bacteria 2127
319 Ga0207641_10151367 3300026088 Bacteria 2101
320 Ga0207641_10744596 3300026088 Bacteria 967
321 Ga0207648_10009306 3300026089 Bacteria 9419
322 Ga0207648_11643681 3300026089 Bacteria 603
323 Ga0207676_10077488 3300026095 Bacteria 2689
324 Ga0207674_10023673 3300026116 Bacteria 6574
325 Ga0207675_100011964 3300026118 Bacteria 8109
326 Ga0207675_100638858 3300026118 Bacteria 1070
327 Ga0207683_10041081 3300026121 Bacteria 4037
328 Ga0207683_10136908 3300026121 Bacteria 2204
329 Ga0207683_10305700 3300026121 Bacteria 1455
330 Ga0207698_10077364 3300026142 Bacteria 2668
331 Ga0207698_11204735 3300026142 Bacteria 771
332 Ga0209179_1018933 3300027512 Bacteria 1320
333 Ga0209179_1046447 3300027512 Bacteria 923
334 Ga0209588_1007975 3300027671 Bacteria 3131
335 Ga0209588_1068485 3300027671 Bacteria 1146
336 Ga0209813_10220764 3300027866 Bacteria 709
337 Ga0209813_10360442 3300027866 Bacteria 578
338 Ga0268266_11680103 3300028379 Bacteria 610
339 Ga0268265_10033639 3300028380 Bacteria 3729
340 Ga0268265_11111993 3300028380 Unclassified 785
341 Ga0268265_11627480 3300028380 Unclassified 651
342 Ga0268264_10021384 3300028381 Bacteria 5283
343 Ga0268264_11584430 3300028381 Unclassified 666
344 Ga0265330_10044668 3300031235 Bacteria 1955
345 Ga0265325_10000938 3300031241 Bacteria 21048
346 Ga0265325_10130833 3300031241 Unclassified 1201
347 Ga0265325_10133577 3300031241 Bacteria 1186
348 Ga0265340_10065354 3300031247 Bacteria 1732
349 Ga0265339_10016985 3300031249 Bacteria 4321
350 Ga0265331_10099316 3300031250 Bacteria 1341
351 Ga0265331_10259371 3300031250 Unclassified 779
352 Ga0307408_100543838 3300031548 Bacteria 1024
353 Ga0307406_10854759 3300031901 Bacteria 772
354 Ga0307416_103154128 3300032002 Bacteria 552
355 Ga0307411_12224723 3300032005 Bacteria 514
356 Ga0373926_0010917 3300035083 Bacteria 3050
357 Ga0373934_0079136 3300035086 Bacteria 1320
358 Ga0373944_0009890 3300035089 Bacteria 2592
359 Ga0373923_0001024 3300035111 Bacteria 7599
360 Ga0373936_0004647 3300035113 Bacteria 5193
361 Ga0373936_0106151 3300035113 Bacteria 1189
362 Ga0373936_0340122 3300035113 Bacteria 682
363 Ga0373941_0348862 3300035115 Bacteria 602
364 Ga0373941_0454243 3300035115 Bacteria 538
365 Ga0373945_0091474 3300035116 Bacteria 1179
366 Ga0373945_0175937 3300035116 Bacteria 879
367 Ga0373945_0190161 3300035116 Bacteria 848
368 Ga0373953_0013416 3300035117 Bacteria 2926
369 Ga0373953_0090213 3300035117 Bacteria 1281
370 Ga0373954_0000987 3300035118 Bacteria 11217
371 Ga0373954_0156234 3300035118 Bacteria 1115
372 Ga0373957_0041360 3300035120 Bacteria 1735
373 Ga0373943_0061659 3300035170 Bacteria 1875
374 Ga0373943_0213064 3300035170 Bacteria 1073
375 Ga0373946_0035882 3300035171 Bacteria 2007
376 Ga0373946_0564806 3300035171 Unclassified 588
377 Ga0373955_0002808 3300035172 Bacteria 7655
378 Ga0373955_0553457 3300035172 Unclassified 704
379 Ga0373961_0144478 3300035241 Bacteria 806
380 Ga0373924_0002822 3300035410 Bacteria 5881
381 Ga0373931_0445902 3300035691 Bacteria 827
382 Ga0373935_0000123 3300035692 Bacteria 34798
383 Ga0373935_0067566 3300035692 Bacteria 2298
384 Ga0373927_0032738 3300035695 Bacteria 3386
385 Ga0373927_0032887 3300035695 Bacteria 3377
386 Ga0373927_0037224 3300035695 Bacteria 3163
387 Ga0373927_0306971 3300035695 Bacteria 1044
388 Ga0373947_0002728 3300035725 Bacteria 10581
389 Ga0373947_0033365 3300035725 Bacteria 3038
390 Ga0373947_0203653 3300035725 Bacteria 1296
391 Ga0373947_0233033 3300035725 Bacteria 1213
392 Ga0373937_0000007 3300036401 Bacteria 183537
393 Ga0373937_0021571 3300036401 Bacteria 5779
394 Ga0373925_0000011 3300037068 Bacteria 209840
395 Ga0373925_0047614 3300037068 Bacteria 3192
396 Ga0373925_0248980 3300037068 Bacteria 1425
397 Ga0373925_0367137 3300037068 Bacteria 1171
398 Ga0373925_0433732 3300037068 Bacteria 1075
399 Ga0373925_0875446 3300037068 Bacteria 740
400 Ga0395899_0179704 3300037312 Bacteria 1486
401 Ga0395900_0384323 3300037418 Bacteria 1371
402 Ga0395898_0125844 3300037466 Bacteria 2455
403 Ga0395905_0705508 3300037471 Bacteria 911
404 Ga0436364_0527040 3300037853 Bacteria 872
405 Ga0436364_1527085 3300037853 Bacteria 1610
406 Ga0395901_0939134 3300038443 Bacteria 844
407 Ga0436365_0698136 3300039437 Bacteria 2351
408 Ga0436365_1251157 3300039437 Bacteria 767
409 Ga0436365_1251542 3300039437 Bacteria 810
410 Ga0436365_1653913 3300039437 Bacteria 1069
411 Ga0436365_1914251 3300039437 Bacteria 2041
412 Ga0436360_0276015 3300039438 Bacteria 1634
413 Ga0436361_0022907 3300039447 Bacteria 863
414 Ga0436361_0028523 3300039447 Bacteria 1687
415 Ga0436361_0317799 3300039447 Bacteria 6320
416 Ga0436363_0092101 3300039450 Bacteria 1246
417 Ga0436363_0525082 3300039450 Bacteria 874
418 Ga0436363_1375367 3300039450 Bacteria 1097
419 Ga0436362_0144763 3300039453 Unclassified 892
420 Ga0439453_0052982 3300041408 Unclassified 824
421 Ga0451789_1368216 3300041443 Unclassified 571
422 Ga0451845_0687621 3300041501 Bacteria 567
423 Ga0451853_3761155 3300041512 Bacteria 1507
424 Ga0439441_015847 3300042001 Unclassified 1338
425 Ga0439435_0064608 3300042436 Unclassified 1073
426 Ga0466967_1278730 3300045976 Bacteria 731
427 Ga0495592_0000511 3300046454 Bacteria 28178
428 Ga0495603_0098394 3300046455 Bacteria 1708
429 Ga0495590_0037400 3300046457 Bacteria 1693
430 Ga0495629_0019790 3300046459 Bacteria 4804
431 Ga0495629_0286130 3300046459 Bacteria 1130
432 Ga0495638_0444727 3300046460 Bacteria 663
433 Ga0495638_0656792 3300046460 Bacteria 509
434 Ga0495651_0002325 3300046462 Bacteria 14671
435 Ga0495653_0000190 3300046463 Bacteria 50144
436 Ga0495580_0019951 3300046472 Bacteria 4970
437 Ga0495582_0022972 3300046473 Bacteria 3411
438 Ga0495582_0330861 3300046473 Bacteria 877
439 Ga0495582_0574731 3300046473 Bacteria 652
440 Ga0495605_0002800 3300046474 Bacteria 10600
441 Ga0495605_0114750 3300046474 Bacteria 1226
442 Ga0495639_0059680 3300046475 Bacteria 1746
443 Ga0495639_0380701 3300046475 Unclassified 711
444 Ga0495662_0005258 3300046476 Bacteria 6486
445 Ga0495664_0000464 3300046477 Bacteria 20002
446 Ga0495584_0019223 3300046491 Bacteria 3470
447 Ga0495584_0144383 3300046491 Bacteria 1209
448 Ga0495584_0200973 3300046491 Bacteria 1013
449 Ga0495585_0055484 3300046492 Bacteria 2189
450 Ga0495585_0131634 3300046492 Bacteria 1316
451 Ga0495594_0009610 3300046499 Bacteria 4999
452 Ga0495596_0073796 3300046500 Unclassified 1325
453 Ga0495606_0003567 3300046507 Bacteria 16407
454 Ga0495608_0000004 3300046511 Bacteria 355027
455 Ga0495610_0005010 3300046512 Bacteria 9583
456 Ga0495618_0000392 3300046514 Bacteria 31551
457 Ga0495618_0109382 3300046514 Bacteria 1770
458 Ga0495620_0084731 3300046515 Bacteria 1278
459 Ga0495628_0000006 3300046516 Bacteria 306606
460 Ga0495630_0003456 3300046517 Bacteria 10981
461 Ga0495630_0467009 3300046517 Bacteria 967
462 Ga0495631_0057609 3300046518 Bacteria 1691
463 Ga0495632_0116706 3300046519 Bacteria 1250
464 Ga0495637_0220301 3300046520 Bacteria 691
465 Ga0495644_0023479 3300046523 Bacteria 2347
466 Ga0495644_0209011 3300046523 Bacteria 753
467 Ga0495663_0138501 3300046525 Unclassified 825
468 Ga0495642_0440488 3300046528 Bacteria 575
469 Ga0495652_0005358 3300046529 Bacteria 12091
470 Ga0495665_0155331 3300046531 Bacteria 1193
471 Ga0495640_0000013 3300046533 Bacteria 172438
472 Ga0495640_0792259 3300046533 Unclassified 565
473 Ga0495587_0000004 3300046536 Bacteria 358433
474 Ga0495598_0019418 3300046537 Bacteria 1782
475 Ga0495598_0456951 3300046537 Unclassified 506
476 Ga0495609_0057540 3300046538 Bacteria 1721
477 Ga0495621_0038709 3300046539 Bacteria 1665
478 Ga0495645_0000001 3300046543 Bacteria 657910
479 Ga0495645_0864302 3300046543 Unclassified 539
480 Ga0495633_0105247 3300046558 Bacteria 1309
481 Ga0495633_0199525 3300046558 Bacteria 919
482 Ga0495667_0000084 3300046559 Bacteria 67342
483 Ga0495656_0035412 3300046615 Bacteria 2051
484 Ga0495656_0043815 3300046615 Bacteria 1881
485 Ga0495668_0094183 3300046616 Bacteria 1640
486 Ga0495668_0743960 3300046616 Bacteria 543
487 Ga0495634_0000164 3300046642 Bacteria 60673
488 Ga0495611_0034832 3300046648 Bacteria 2228
489 Ga0495635_0000003 3300046663 Bacteria 390055
490 Ga0495659_0034527 3300046664 Bacteria 1779
491 Ga0495659_0102343 3300046664 Bacteria 1111
492 Ga0495661_0264382 3300046665 Bacteria 873
493 Ga0495588_0119793 3300046674 Bacteria 1387
494 Ga0495657_0000248 3300046675 Bacteria 49080
495 Ga0495599_0000014 3300046678 Bacteria 177414
496 Ga0495623_0000006 3300046679 Bacteria 140385
497 Ga0495646_0000005 3300046680 Bacteria 266899
498 Ga0495647_0565094 3300046681 Unclassified 532
499 Ga0495658_0077900 3300046683 Bacteria 1939
500 Ga0495658_0212192 3300046683 Bacteria 1210
501 Ga0495669_0610730 3300046684 Bacteria 530
502 Ga0495624_0020517 3300046690 Bacteria 4396
503 Ga0495624_0044123 3300046690 Bacteria 2843
504 Ga0495624_0348626 3300046690 Unclassified 891
505 Ga0495670_0251206 3300046691 Bacteria 943
506 Ga0495670_0393065 3300046691 Archaea 749
507 Ga0495670_0716058 3300046691 Unclassified 546
508 Ga0495649_0102010 3300046694 Bacteria 1524
509 Ga0495649_0149849 3300046694 Bacteria 1226
510 Ga0495600_0000005 3300046809 Bacteria 171675
511 Ga0495581_0027214 3300047315 Bacteria 3316
512 Ga0495581_0092137 3300047315 Bacteria 1759
513 Ga0495604_0000002 3300047317 Bacteria 530904
514 Ga0495674_0000004 3300047319 Bacteria 531855
515 Ga0495676_0025562 3300047321 Bacteria 5096
516 Ga0495676_0123805 3300047321 Bacteria 1877
517 Ga0495676_0126839 3300047321 Bacteria 1848
518 Ga0495680_0000986 3300047322 Bacteria 31711
519 Ga0495680_0833644 3300047322 Unclassified 600
520 Ga0495683_0004622 3300047323 Bacteria 7764
521 Ga0495675_0000053 3300047444 Bacteria 78760
522 Ga0495675_0392612 3300047444 Bacteria 810
523 Ga0495677_0064530 3300047445 Bacteria 1361
524 Ga0495679_104971 3300047446 Bacteria 782
525 Ga0495684_0000004 3300047471 Bacteria 307093
526 Ga0495684_0131588 3300047471 Bacteria 1879
527 Ga0495686_0290789 3300047472 Bacteria 905
528 Ga0495593_0001912 3300047673 Bacteria 12413
529 Ga0495602_0000001 3300048088 Bacteria 510904
530 Ga0495626_0046564 3300048091 Bacteria 2020
531 Ga0496100_0002815 3300048903 Bacteria 8916
532 Ga0496100_0021590 3300048903 Bacteria 3881
533 Ga0496100_0556602 3300048903 Bacteria 888
534 Ga0496100_0882185 3300048903 Bacteria 702
535 Ga0496101_0012301 3300048904 Bacteria 5708
536 Ga0496101_0494373 3300048904 Bacteria 966
537 Ga0496102_0010366 3300048905 Bacteria 8017
538 Ga0496102_0191648 3300048905 Bacteria 1926
539 Ga0496102_0405971 3300048905 Bacteria 1280
540 Ga0496102_0897278 3300048905 Bacteria 808
541 Ga0496102_1433031 3300048905 Unclassified 610
542 Ga0496103_0004418 3300048906 Bacteria 8529
543 Ga0496103_0011877 3300048906 Bacteria 5169
544 Ga0496103_0126171 3300048906 Bacteria 1632
545 Ga0496104_0000661 3300048907 Bacteria 29545
546 Ga0496104_0000886 3300048907 Bacteria 25752
547 Ga0496104_0003228 3300048907 Bacteria 14034
548 Ga0496104_0010977 3300048907 Bacteria 8104
549 Ga0496104_0021434 3300048907 Bacteria 5932
550 Ga0496104_0225924 3300048907 Bacteria 1784
551 Ga0496104_0301467 3300048907 Bacteria 1515
552 Ga0496104_0336097 3300048907 Bacteria 1423
553 Ga0496104_0677249 3300048907 Bacteria 940
554 Ga0496105_0001513 3300048908 Bacteria 16428
555 Ga0496105_0007189 3300048908 Bacteria 8592
556 Ga0496105_0066324 3300048908 Bacteria 2979
557 Ga0496105_0117253 3300048908 Bacteria 2196
558 Ga0496105_0158605 3300048908 Bacteria 1858
559 Ga0496105_0297667 3300048908 Bacteria 1298
560 Ga0496105_0605996 3300048908 Bacteria 849
561 Ga0496106_0003463 3300048909 Bacteria 11757
562 Ga0496106_0025942 3300048909 Bacteria 4360
563 Ga0496106_0036403 3300048909 Bacteria 3682
564 Ga0496106_0077710 3300048909 Bacteria 2545
565 Ga0496106_0207104 3300048909 Bacteria 1562
566 Ga0496106_0332752 3300048909 Bacteria 1219
567 Ga0496106_0643313 3300048909 Unclassified 847
568 Ga0496106_0744486 3300048909 Bacteria 779
569 Ga0496107_0003468 3300048910 Bacteria 10535
570 Ga0496107_0049981 3300048910 Bacteria 3014
571 Ga0496107_0112065 3300048910 Bacteria 2005
572 Ga0496107_0149251 3300048910 Bacteria 1729
573 Ga0496107_0223177 3300048910 Bacteria 1402
574 Ga0496108_0001416 3300048911 Bacteria 18909
575 Ga0496108_0033849 3300048911 Bacteria 4244
576 Ga0496108_0044856 3300048911 Bacteria 3691
577 Ga0496108_0160338 3300048911 Bacteria 1943
578 Ga0496108_0238760 3300048911 Bacteria 1581
579 Ga0496108_0406983 3300048911 Bacteria 1188
580 Ga0496108_0975701 3300048911 Bacteria 725
581 Ga0496109_0003855 3300048912 Bacteria 12525
582 Ga0496109_0021144 3300048912 Bacteria 5752
583 Ga0496109_0054892 3300048912 Bacteria 3633
584 Ga0496109_0089895 3300048912 Bacteria 2840
585 Ga0496109_0196191 3300048912 Bacteria 1898
586 Ga0496109_0472279 3300048912 Bacteria 1184
587 Ga0496109_0812157 3300048912 Bacteria 873
588 Ga0496110_0000441 3300048913 Bacteria 28247
589 Ga0496110_0006376 3300048913 Bacteria 9329
590 Ga0496110_0056733 3300048913 Bacteria 3447
591 Ga0496110_0092279 3300048913 Bacteria 2709
592 Ga0496110_0092398 3300048913 Bacteria 2708
593 Ga0496110_0111049 3300048913 Bacteria 2464
594 Ga0496110_0392815 3300048913 Bacteria 1264
595 Ga0496110_0699149 3300048913 Unclassified 915
596 Ga0496110_0889436 3300048913 Bacteria 796
597 Ga0496110_1033517 3300048913 Unclassified 729
598 Ga0496110_1506172 3300048913 Bacteria 582
599 Ga0496111_0000624 3300048914 Bacteria 18747
600 Ga0496111_0000741 3300048914 Bacteria 17414
601 Ga0496111_0002966 3300048914 Bacteria 10397
602 Ga0496111_0453193 3300048914 Bacteria 946
603 Ga0496111_0469143 3300048914 Bacteria 928
604 Ga0496112_0004796 3300048915 Bacteria 11540
605 Ga0496112_0006447 3300048915 Bacteria 10303
606 Ga0496112_0015544 3300048915 Bacteria 7108
607 Ga0496112_0031599 3300048915 Bacteria 5136
608 Ga0496112_0229187 3300048915 Bacteria 1812
609 Ga0496112_0457994 3300048915 Bacteria 1213
610 Ga0496112_0702180 3300048915 Unclassified 939
611 Ga0496112_1577809 3300048915 Bacteria 570
612 Ga0496113_0002612 3300048916 Bacteria 10540
613 Ga0496113_0084834 3300048916 Bacteria 2432
614 Ga0496113_0106937 3300048916 Bacteria 2173
615 Ga0496113_0213680 3300048916 Bacteria 1536
616 Ga0496113_0299600 3300048916 Bacteria 1287
617 Ga0496113_0581115 3300048916 Bacteria 897
618 Ga0496113_1082806 3300048916 Bacteria 629
619 Ga0496114_0044845 3300048917 Bacteria 3671
620 Ga0496114_0058015 3300048917 Bacteria 3232
621 Ga0496114_0106765 3300048917 Bacteria 2396
622 Ga0496114_0195984 3300048917 Bacteria 1768
623 Ga0496115_0008940 3300048918 Bacteria 7429
624 Ga0496115_0202095 3300048918 Bacteria 1641
625 Ga0496115_0452088 3300048918 Unclassified 1037
626 Ga0496115_1138739 3300048918 Bacteria 589
627 Ga0496117_0001630 3300048920 Bacteria 31646
628 Ga0496117_0041352 3300048920 Bacteria 3378
629 Ga0496118_0000198 3300048921 Bacteria 105857
630 Ga0496118_0007169 3300048921 Bacteria 11920
631 Ga0496123_0040147 3300048926 Bacteria 3264
632 Ga0496125_0221221 3300048928 Bacteria 1220
633 Ga0501031_0068408 3300049568 Bacteria 2313
634 Ga0501031_0789523 3300049568 Bacteria 609
635 Ga0501032_0033597 3300049569 Bacteria 3513
636 Ga0501033_0008019 3300049570 Bacteria 8183
637 Ga0501034_0027191 3300049571 Bacteria 5819
638 Ga0501034_0654529 3300049571 Bacteria 952
639 Ga0501036_0013392 3300049572 Bacteria 6815
640 Ga0501036_0431761 3300049572 Bacteria 1098
641 Ga0501037_0006901 3300049573 Bacteria 8291
642 Ga0501038_0002228 3300049574 Bacteria 18040
643 Ga0501038_0354442 3300049574 Bacteria 1142
644 Ga0501038_0754527 3300049574 Bacteria 726
645 Ga0501039_0016251 3300049575 Bacteria 5700
646 Ga0501040_0265288 3300049576 Bacteria 1226
647 Ga0501041_0776963 3300049577 Unclassified 614
648 Ga0501042_0224241 3300049578 Bacteria 1356
649 Ga0501042_1058885 3300049578 Unclassified 591
650 Ga0501043_0011913 3300049579 Bacteria 6803
651 Ga0501046_0010815 3300049580 Bacteria 7823
652 Ga0501046_0512025 3300049580 Bacteria 859
653 Ga0501047_0010793 3300049581 Bacteria 8636
654 Ga0501048_0008167 3300049582 Bacteria 7916
655 Ga0501048_0221018 3300049582 Bacteria 1344
656 Ga0501067_0010362 3300049583 Bacteria 5158
657 Ga0501067_0137532 3300049583 Bacteria 1360
658 Ga0501067_0532963 3300049583 Bacteria 657
659 Ga0501068_0004223 3300049584 Bacteria 7794
660 Ga0501069_0005631 3300049585 Bacteria 6518
661 Ga0501070_0014893 3300049586 Bacteria 6540
662 Ga0501071_0013351 3300049587 Bacteria 5596
663 Ga0501071_1305115 3300049587 Bacteria 561
664 Ga0501072_0269019 3300049588 Bacteria 1356
665 Ga0501072_0640286 3300049588 Bacteria 837
666 Ga0501073_0012398 3300049589 Bacteria 6220
667 Ga0501074_0000430 3300049590 Bacteria 25105
668 Ga0501075_0144365 3300049591 Bacteria 1814
669 Ga0501075_0689381 3300049591 Bacteria 778
670 Ga0501076_0029352 3300049592 Bacteria 4277
671 Ga0501079_0010782 3300049741 Bacteria 6959
672 Ga0501079_0213358 3300049741 Bacteria 1508
673 Ga0501079_0410062 3300049741 Bacteria 1063
674 Ga0501079_0604874 3300049741 Archaea 863
675 Ga0501079_0845630 3300049741 Bacteria 721
676 Ga0501079_0988856 3300049741 Unclassified 663
677 Ga0501080_0008809 3300049742 Bacteria 9169
678 Ga0501081_0583907 3300049743 Bacteria 836
679 Ga0501081_1047239 3300049743 Bacteria 617
680 Ga0501083_0220725 3300049744 Bacteria 1235
681 Ga0501083_1129736 3300049744 Unclassified 510
682 Ga0501035_0013095 3300049822 Bacteria 7654
683 Ga0501044_0001797 3300049823 Bacteria 25029
684 Ga0501044_0017730 3300049823 Bacteria 7637
685 Ga0501045_0005187 3300049824 Bacteria 9007
686 nmdc:mga03683_170874_c1 3300050489 Bacteria 988
687 nmdc:mga03683_218808_c1 3300050489 Bacteria 878
688 nmdc:mga03683_403892_c1 3300050489 Unclassified 653
689 nmdc:mga03683_477937_c1 3300050489 Bacteria 602
690 nmdc:mga03683_70163_c1 3300050489 Bacteria 1496
691 nmdc:mga00v17_271797_c1 3300050491 Bacteria 1100
692 nmdc:mga0yw44_1131_c1 3300050492 Bacteria 10318
693 nmdc:mga0yw44_136306_c1 3300050492 Bacteria 1593
694 nmdc:mga0yw44_17009_c1 3300050492 Unclassified 3945
695 nmdc:mga0yw44_668414_c1 3300050492 Bacteria 706
696 nmdc:mga0yw44_96584_c1 3300050492 Bacteria 1876
697 nmdc:mga0k408_5297_c1 3300050493 Bacteria 6850
698 nmdc:mga06z11_166752_c1 3300050494 Unclassified 1262
699 nmdc:mga06z11_176136_c1 3300050494 Bacteria 1231
700 nmdc:mga06z11_179535_c1 3300050494 Bacteria 1220
701 nmdc:mga06z11_247249_c1 3300050494 Bacteria 1049
702 nmdc:mga06z11_73668_c1 3300050494 Bacteria 1814
703 nmdc:mga04h51_250745_c1 3300050495 Bacteria 709
704 nmdc:mga07m45_524849_c1 3300050496 Bacteria 685
705 nmdc:mga05p37_1153149_c1 3300050507 Bacteria 806
706 nmdc:mga05p37_43029_c1 3300050507 Bacteria 5553
707 nmdc:mga05p37_462958_c1 3300050507 Bacteria 1465
708 nmdc:mga05p37_4669_c1 3300050507 Bacteria 16011
709 nmdc:mga05p37_508993_c1 3300050507 Bacteria 1380
710 nmdc:mga05p37_775726_c1 3300050507 Bacteria 1053
711 nmdc:mga09592_209277_c1 3300050508 Bacteria 1689
712 nmdc:mga09592_247351_c1 3300050508 Bacteria 1545
713 nmdc:mga09592_384510_c1 3300050508 Bacteria 1213
714 nmdc:mga09592_87284_c1 3300050508 Bacteria 2663
715 nmdc:mga0qj67_137374_c1 3300050509 Bacteria 1981
716 nmdc:mga0qj67_19_c1 3300050509 Bacteria 112208
717 nmdc:mga06r32_1175528_c1 3300050510 Bacteria 714
718 nmdc:mga06r32_119432_c1 3300050510 Bacteria 2599
719 nmdc:mga06r32_207328_c1 3300050510 Bacteria 1948
720 nmdc:mga06r32_880464_c1 3300050510 Bacteria 853
721 nmdc:mga08y16_1182556_c1 3300050511 Bacteria 736
722 nmdc:mga08y16_1305796_c1 3300050511 Bacteria 692
723 nmdc:mga08y16_17233_c1 3300050511 Bacteria 7603
724 nmdc:mga08y16_600667_c1 3300050511 Bacteria 1109
725 nmdc:mga08y16_790314_c1 3300050511 Unclassified 942
726 nmdc:mga0n895_121384_c1 3300050512 Bacteria 2634
727 nmdc:mga0n895_1350920_c1 3300050512 Bacteria 682
728 nmdc:mga0rr50_1118859_c1 3300050513 Unclassified 670
729 nmdc:mga0rr50_299314_c1 3300050513 Bacteria 1345
730 nmdc:mga0rr50_347939_c1 3300050513 Bacteria 1246
731 nmdc:mga08x19_102122_c1 3300050514 Bacteria 1904
732 nmdc:mga08x19_59654_c1 3300050514 Bacteria 2470
733 nmdc:mga0a205_167259_c1 3300050515 Bacteria 2094
734 nmdc:mga0a205_535083_c1 3300050515 Bacteria 1027
735 Ga0495601_0000078 3300053077 Bacteria 51996
736 Ga0495601_0348976 3300053077 Bacteria 962
737 Ga0495601_1045832 3300053077 Unclassified 512
738 Ga0495612_0000005 3300053078 Bacteria 286943
739 Ga0495612_0408690 3300053078 Bacteria 617
740 Ga0495655_0010780 3300053083 Bacteria 1816
741 Ga0495655_0067737 3300053083 Bacteria 990
742 Ga0495595_0000065 3300053084 Bacteria 52635
743 Ga0495595_0281379 3300053084 Bacteria 835
744 Ga0495619_0000003 3300053085 Bacteria 515784
745 Ga0495619_0090141 3300053085 Bacteria 2075
746 Ga0495619_0475460 3300053085 Bacteria 860
747 Ga0495619_0574633 3300053085 Bacteria 772
748 Ga0495619_0666556 3300053085 Bacteria 709
749 Ga0500641_0230864 3300053096 Bacteria 782
750 Ga0500641_0248279 3300053096 Unclassified 747
751 Ga0500595_005091 3300053119 Bacteria 5774
752 Ga0500616_0230436 3300053153 Bacteria 802
753 Ga0501084_0016675 3300054114 Bacteria 6102
754 Ga0501084_0167468 3300054114 Bacteria 1855
755 Ga0501084_0642877 3300054114 Unclassified 896
756 Ga0501082_0018907 3300060353 Bacteria 5936
757 Ga0501082_0102022 3300060353 Bacteria 2482
758 Ga0530510_0046536 3300061734 Bacteria 3134
759 Ga0530510_0066928 3300061734 Bacteria 2606
760 Ga0530510_1247664 3300061734 Bacteria 570

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035171 Ga0373946_0564806 Ga0373946_0564806_17_400 125
2 3300046690 Ga0495624_0348626 Ga0495624_0348626_14_397 125
3 3300049578 Ga0501042_1058885 Ga0501042_1058885_18_419 131
4 3300050492 nmdc:mga0yw44_668414_c1 nmdc:mga0yw44_668414_c1_295_696 131
5 3300050510 nmdc:mga06r32_880464_c1 nmdc:mga06r32_880464_c1_435_836 131
6 3300031241 Ga0265325_10133577 Ga0265325_101335772 132
7 3300031247 Ga0265340_10065354 Ga0265340_100653542 132
8 3300009147 Ga0114129_11926580 Ga0114129_119265802 133
9 3300037068 Ga0373925_0433732 Ga0373925_0433732_239_664 133
10 3300050507 nmdc:mga05p37_462958_c1 nmdc:mga05p37_462958_c1_56_466 133
11 3300050508 nmdc:mga09592_87284_c1 nmdc:mga09592_87284_c1_1758_2168 133
12 3300050509 nmdc:mga0qj67_137374_c1 nmdc:mga0qj67_137374_c1_40_450 133
13 3300050510 nmdc:mga06r32_207328_c1 nmdc:mga06r32_207328_c1_393_803 133
14 3300009094 Ga0111539_10011398 Ga0111539_1001139812 134
15 3300025928 Ga0207700_11590165 Ga0207700_115901651 134
16 3300026142 Ga0207698_11204735 Ga0207698_112047352 134
17 3300035172 Ga0373955_0553457 Ga0373955_0553457_28_456 134
18 3300047444 Ga0495675_0392612 Ga0495675_0392612_160_588 134
19 3300048903 Ga0496100_0021590 Ga0496100_0021590_466_894 134
20 3300048907 Ga0496104_0301467 Ga0496104_0301467_34_462 134
21 3300048908 Ga0496105_0158605 Ga0496105_0158605_646_1074 134
22 3300048910 Ga0496107_0049981 Ga0496107_0049981_1542_1970 134
23 3300048911 Ga0496108_0238760 Ga0496108_0238760_473_901 134
24 3300048912 Ga0496109_0089895 Ga0496109_0089895_818_1246 134
25 3300048917 Ga0496114_0058015 Ga0496114_0058015_230_658 134
26 3300049583 Ga0501067_0532963 Ga0501067_0532963_169_597 134
27 3300049588 Ga0501072_0640286 Ga0501072_0640286_255_689 134
28 3300049741 Ga0501079_0845630 Ga0501079_0845630_121_552 134
29 3300050511 nmdc:mga08y16_17233_c1 nmdc:mga08y16_17233_c1_2179_2613 134
30 3300053077 Ga0495601_0348976 Ga0495601_0348976_286_714 134
31 3300005563 Ga0068855_100211184 Ga0068855_1002111842 135
32 3300025949 Ga0207667_10544718 Ga0207667_105447182 135
33 3300026089 Ga0207648_11643681 Ga0207648_116436811 135
34 3300005347 Ga0070668_101148732 Ga0070668_1011487321 136
35 3300005364 Ga0070673_100605052 Ga0070673_1006050522 136
36 3300005434 Ga0070709_10000668 Ga0070709_100006684 136
37 3300005435 Ga0070714_100008660 Ga0070714_1000086607 136
38 3300005435 Ga0070714_100984824 Ga0070714_1009848242 136
39 3300005436 Ga0070713_100007357 Ga0070713_1000073572 136
40 3300005437 Ga0070710_10004289 Ga0070710_100042895 136
41 3300005983 Ga0081540_1045750 Ga0081540_10457502 136
42 3300006028 Ga0070717_10309058 Ga0070717_103090582 136
43 3300006028 Ga0070717_11793565 Ga0070717_117935651 136
44 3300006163 Ga0070715_10001202 Ga0070715_100012028 136
45 3300006173 Ga0070716_100038436 Ga0070716_1000384362 136
46 3300006175 Ga0070712_100008370 Ga0070712_1000083706 136
47 3300006195 Ga0075366_10586327 Ga0075366_105863272 136
48 3300009147 Ga0114129_10442771 Ga0114129_104427712 136
49 3300009176 Ga0105242_11749776 Ga0105242_117497762 136
50 3300009553 Ga0105249_10513405 Ga0105249_105134052 136
51 3300025905 Ga0207685_10023170 Ga0207685_100231702 136
52 3300025915 Ga0207693_10000564 Ga0207693_100005647 136
53 3300025916 Ga0207663_10002863 Ga0207663_100028634 136
54 3300025928 Ga0207700_10359851 Ga0207700_103598511 136
55 3300025933 Ga0207706_10670462 Ga0207706_106704622 136
56 3300025933 Ga0207706_11575269 Ga0207706_115752691 136
57 3300025939 Ga0207665_10000864 Ga0207665_1000086415 136
58 3300025961 Ga0207712_10254309 Ga0207712_102543092 136
59 3300028380 Ga0268265_11627480 Ga0268265_116274801 136
60 3300035241 Ga0373961_0144478 Ga0373961_0144478_212_637 136
61 3300039437 Ga0436365_1251157 Ga0436365_1251157_41_502 136
62 3300046473 Ga0495582_0574731 Ga0495582_0574731_112_537 136
63 3300048913 Ga0496110_1506172 Ga0496110_1506172_41_457 136
64 3300048916 Ga0496113_0213680 Ga0496113_0213680_991_1407 136
65 3300050507 nmdc:mga05p37_775726_c1 nmdc:mga05p37_775726_c1_123_548 136
66 3300050508 nmdc:mga09592_209277_c1 nmdc:mga09592_209277_c1_1028_1453 136
67 3300050510 nmdc:mga06r32_119432_c1 nmdc:mga06r32_119432_c1_2064_2489 136
68 3300002075 JGI24738J21930_10104526 JGI24738J21930_101045261 137
69 3300003911 JGI25405J52794_10067120 JGI25405J52794_100671201 137
70 3300005329 Ga0070683_100996181 Ga0070683_1009961812 137
71 3300005331 Ga0070670_100040441 Ga0070670_1000404413 137
72 3300005331 Ga0070670_100257205 Ga0070670_1002572052 137
73 3300005335 Ga0070666_10063021 Ga0070666_100630212 137
74 3300005338 Ga0068868_100032929 Ga0068868_1000329292 137
75 3300005340 Ga0070689_100051282 Ga0070689_1000512822 137
76 3300005340 Ga0070689_100658184 Ga0070689_1006581842 137
77 3300005341 Ga0070691_10032118 Ga0070691_100321182 137
78 3300005345 Ga0070692_10071972 Ga0070692_100719722 137
79 3300005354 Ga0070675_100492823 Ga0070675_1004928232 137
80 3300005355 Ga0070671_100641552 Ga0070671_1006415521 137
81 3300005364 Ga0070673_101119336 Ga0070673_1011193361 137
82 3300005365 Ga0070688_100235697 Ga0070688_1002356972 137
83 3300005366 Ga0070659_100059701 Ga0070659_1000597013 137
84 3300005366 Ga0070659_102156497 Ga0070659_1021564971 137
85 3300005434 Ga0070709_10161926 Ga0070709_101619262 137
86 3300005435 Ga0070714_100020634 Ga0070714_1000206344 137
87 3300005435 Ga0070714_100307868 Ga0070714_1003078682 137
88 3300005435 Ga0070714_101420494 Ga0070714_1014204941 137
89 3300005436 Ga0070713_100115158 Ga0070713_1001151581 137
90 3300005436 Ga0070713_100139774 Ga0070713_1001397742 137
91 3300005436 Ga0070713_100169877 Ga0070713_1001698772 137
92 3300005436 Ga0070713_100222760 Ga0070713_1002227602 137
93 3300005436 Ga0070713_100281357 Ga0070713_1002813572 137
94 3300005436 Ga0070713_100875628 Ga0070713_1008756281 137
95 3300005437 Ga0070710_10210457 Ga0070710_102104571 137
96 3300005437 Ga0070710_10332714 Ga0070710_103327142 137
97 3300005438 Ga0070701_10052649 Ga0070701_100526492 137
98 3300005439 Ga0070711_100021882 Ga0070711_1000218822 137
99 3300005439 Ga0070711_100107217 Ga0070711_1001072172 137
100 3300005439 Ga0070711_100119235 Ga0070711_1001192352 137
101 3300005439 Ga0070711_100448885 Ga0070711_1004488851 137
102 3300005439 Ga0070711_100916214 Ga0070711_1009162141 137
103 3300005440 Ga0070705_100750279 Ga0070705_1007502791 137
104 3300005444 Ga0070694_100581299 Ga0070694_1005812992 137
105 3300005455 Ga0070663_100206649 Ga0070663_1002066491 137
106 3300005456 Ga0070678_100288853 Ga0070678_1002888532 137
107 3300005457 Ga0070662_100148186 Ga0070662_1001481862 137
108 3300005458 Ga0070681_10206021 Ga0070681_102060212 137
109 3300005458 Ga0070681_11342937 Ga0070681_113429371 137
110 3300005466 Ga0070685_10341773 Ga0070685_103417731 137
111 3300005467 Ga0070706_100398338 Ga0070706_1003983382 137
112 3300005471 Ga0070698_100895348 Ga0070698_1008953481 137
113 3300005518 Ga0070699_100010309 Ga0070699_1000103094 137
114 3300005530 Ga0070679_100908494 Ga0070679_1009084941 137
115 3300005535 Ga0070684_100417909 Ga0070684_1004179092 137
116 3300005544 Ga0070686_100642483 Ga0070686_1006424831 137
117 3300005546 Ga0070696_100651791 Ga0070696_1006517911 137
118 3300005547 Ga0070693_100357243 Ga0070693_1003572431 137
119 3300005548 Ga0070665_100934873 Ga0070665_1009348731 137
120 3300005548 Ga0070665_101076589 Ga0070665_1010765892 137
121 3300005549 Ga0070704_100336792 Ga0070704_1003367922 137
122 3300005564 Ga0070664_100175665 Ga0070664_1001756652 137
123 3300005578 Ga0068854_100003131 Ga0068854_1000031317 137
124 3300005615 Ga0070702_100209792 Ga0070702_1002097922 137
125 3300005616 Ga0068852_100172578 Ga0068852_1001725782 137
126 3300005618 Ga0068864_100065337 Ga0068864_1000653373 137
127 3300005718 Ga0068866_10333251 Ga0068866_103332512 137
128 3300005719 Ga0068861_100014501 Ga0068861_1000145014 137
129 3300005834 Ga0068851_10232951 Ga0068851_102329512 137
130 3300005840 Ga0068870_10169873 Ga0068870_101698732 137
131 3300005841 Ga0068863_100037605 Ga0068863_1000376052 137
132 3300005841 Ga0068863_101192282 Ga0068863_1011922821 137
133 3300005842 Ga0068858_100981107 Ga0068858_1009811072 137
134 3300005843 Ga0068860_100058618 Ga0068860_1000586182 137
135 3300005844 Ga0068862_101003728 Ga0068862_1010037283 137
136 3300005937 Ga0081455_10001715 Ga0081455_100017157 137
137 3300005937 Ga0081455_10034176 Ga0081455_100341761 137
138 3300005937 Ga0081455_10060308 Ga0081455_100603083 137
139 3300005937 Ga0081455_10752632 Ga0081455_107526321 137
140 3300005981 Ga0081538_10008299 Ga0081538_100082995 137
141 3300005983 Ga0081540_1021808 Ga0081540_10218083 137
142 3300005983 Ga0081540_1150335 Ga0081540_11503352 137
143 3300006028 Ga0070717_10406653 Ga0070717_104066532 137
144 3300006028 Ga0070717_10543782 Ga0070717_105437822 137
145 3300006028 Ga0070717_11131140 Ga0070717_111311401 137
146 3300006028 Ga0070717_11565076 Ga0070717_115650762 137
147 3300006028 Ga0070717_11845860 Ga0070717_118458601 137
148 3300006038 Ga0075365_10002322 Ga0075365_100023227 137
149 3300006038 Ga0075365_10035594 Ga0075365_100355943 137
150 3300006038 Ga0075365_10040967 Ga0075365_100409673 137
151 3300006038 Ga0075365_10068968 Ga0075365_100689682 137
152 3300006038 Ga0075365_10220145 Ga0075365_102201452 137
153 3300006038 Ga0075365_10556812 Ga0075365_105568122 137
154 3300006042 Ga0075368_10263255 Ga0075368_102632551 137
155 3300006048 Ga0075363_100170429 Ga0075363_1001704292 137
156 3300006051 Ga0075364_10104200 Ga0075364_101042001 137
157 3300006051 Ga0075364_10522406 Ga0075364_105224062 137
158 3300006163 Ga0070715_10089758 Ga0070715_100897582 137
159 3300006173 Ga0070716_100042820 Ga0070716_1000428202 137
160 3300006175 Ga0070712_100003811 Ga0070712_1000038118 137
161 3300006175 Ga0070712_100382565 Ga0070712_1003825652 137
162 3300006175 Ga0070712_100670244 Ga0070712_1006702442 137
163 3300006175 Ga0070712_100911496 Ga0070712_1009114962 137
164 3300006177 Ga0075362_10058692 Ga0075362_100586922 137
165 3300006178 Ga0075367_10131122 Ga0075367_101311222 137
166 3300006178 Ga0075367_10149788 Ga0075367_101497882 137
167 3300006178 Ga0075367_10264852 Ga0075367_102648522 137
168 3300006237 Ga0097621_100047516 Ga0097621_1000475162 137
169 3300006353 Ga0075370_10575639 Ga0075370_105756391 137
170 3300006358 Ga0068871_101066770 Ga0068871_1010667701 137
171 3300006844 Ga0075428_100069715 Ga0075428_1000697153 137
172 3300006844 Ga0075428_100808228 Ga0075428_1008082282 137
173 3300006844 Ga0075428_100985093 Ga0075428_1009850932 137
174 3300006844 Ga0075428_101174079 Ga0075428_1011740792 137
175 3300006847 Ga0075431_100345803 Ga0075431_1003458032 137
176 3300006847 Ga0075431_100387458 Ga0075431_1003874582 137
177 3300006847 Ga0075431_100665300 Ga0075431_1006653002 137
178 3300006847 Ga0075431_100719990 Ga0075431_1007199901 137
179 3300006852 Ga0075433_10106011 Ga0075433_101060111 137
180 3300006871 Ga0075434_100083910 Ga0075434_1000839102 137
181 3300006871 Ga0075434_100802066 Ga0075434_1008020662 137
182 3300006881 Ga0068865_100550831 Ga0068865_1005508312 137
183 3300006914 Ga0075436_100143194 Ga0075436_1001431942 137
184 3300006914 Ga0075436_100211464 Ga0075436_1002114642 137
185 3300007076 Ga0075435_100027374 Ga0075435_1000273745 137
186 3300007265 Ga0099794_10015989 Ga0099794_100159893 137
187 3300007265 Ga0099794_10024786 Ga0099794_100247862 137
188 3300007788 Ga0099795_10075856 Ga0099795_100758562 137
189 3300007788 Ga0099795_10104572 Ga0099795_101045722 137
190 3300007788 Ga0099795_10222370 Ga0099795_102223702 137
191 3300009094 Ga0111539_10145390 Ga0111539_101453902 137
192 3300009094 Ga0111539_10443512 Ga0111539_104435122 137
193 3300009094 Ga0111539_10626941 Ga0111539_106269412 137
194 3300009094 Ga0111539_11786675 Ga0111539_117866752 137
195 3300009094 Ga0111539_12180598 Ga0111539_121805981 137
196 3300009098 Ga0105245_10478860 Ga0105245_104788602 137
197 3300009101 Ga0105247_10037846 Ga0105247_100378463 137
198 3300009101 Ga0105247_10071680 Ga0105247_100716802 137
199 3300009147 Ga0114129_10084911 Ga0114129_100849112 137
200 3300009147 Ga0114129_10311334 Ga0114129_103113342 137
201 3300009147 Ga0114129_10725485 Ga0114129_107254852 137
202 3300009147 Ga0114129_12149990 Ga0114129_121499901 137
203 3300009174 Ga0105241_10615959 Ga0105241_106159591 137
204 3300009177 Ga0105248_10496622 Ga0105248_104966222 137
205 3300009553 Ga0105249_10442613 Ga0105249_104426132 137
206 3300009553 Ga0105249_10874936 Ga0105249_108749362 137
207 3300010159 Ga0099796_10045114 Ga0099796_100451142 137
208 3300010159 Ga0099796_10055402 Ga0099796_100554022 137
209 3300010159 Ga0099796_10152577 Ga0099796_101525771 137
210 3300010375 Ga0105239_10494552 Ga0105239_104945522 137
211 3300011119 Ga0105246_10201665 Ga0105246_102016652 137
212 3300011119 Ga0105246_11279359 Ga0105246_112793591 137
213 3300012507 Ga0157342_1019718 Ga0157342_10197181 137
214 3300013306 Ga0163162_11100096 Ga0163162_111000962 137
215 3300014325 Ga0163163_10243969 Ga0163163_102439692 137
216 3300014325 Ga0163163_11053408 Ga0163163_110534081 137
217 3300014745 Ga0157377_10135919 Ga0157377_101359191 137
218 3300014745 Ga0157377_10617164 Ga0157377_106171642 137
219 3300017792 Ga0163161_10248962 Ga0163161_102489621 137
220 3300021361 Ga0213872_10043676 Ga0213872_100436762 137
221 3300021377 Ga0213874_10070323 Ga0213874_100703232 137
222 3300021384 Ga0213876_10118109 Ga0213876_101181091 137
223 3300021384 Ga0213876_10658730 Ga0213876_106587301 137
224 3300025315 Ga0207697_10059716 Ga0207697_100597162 137
225 3300025898 Ga0207692_10079882 Ga0207692_100798822 137
226 3300025898 Ga0207692_10095425 Ga0207692_100954252 137
227 3300025900 Ga0207710_10093381 Ga0207710_100933811 137
228 3300025901 Ga0207688_10028562 Ga0207688_100285623 137
229 3300025903 Ga0207680_10128683 Ga0207680_101286832 137
230 3300025904 Ga0207647_10085257 Ga0207647_100852572 137
231 3300025905 Ga0207685_10000972 Ga0207685_100009722 137
232 3300025905 Ga0207685_10410439 Ga0207685_104104391 137
233 3300025906 Ga0207699_10074924 Ga0207699_100749242 137
234 3300025907 Ga0207645_10005079 Ga0207645_100050794 137
235 3300025908 Ga0207643_10001128 Ga0207643_100011286 137
236 3300025910 Ga0207684_10217177 Ga0207684_102171772 137
237 3300025910 Ga0207684_10280034 Ga0207684_102800342 137
238 3300025912 Ga0207707_10078620 Ga0207707_100786203 137
239 3300025914 Ga0207671_10076704 Ga0207671_100767042 137
240 3300025915 Ga0207693_10001853 Ga0207693_1000185315 137
241 3300025915 Ga0207693_10011503 Ga0207693_100115032 137
242 3300025915 Ga0207693_10082723 Ga0207693_100827231 137
243 3300025915 Ga0207693_10201668 Ga0207693_102016682 137
244 3300025915 Ga0207693_10353865 Ga0207693_103538652 137
245 3300025916 Ga0207663_10042119 Ga0207663_100421193 137
246 3300025916 Ga0207663_10135075 Ga0207663_101350752 137
247 3300025916 Ga0207663_10386291 Ga0207663_103862912 137
248 3300025916 Ga0207663_10645702 Ga0207663_106457021 137
249 3300025918 Ga0207662_10089026 Ga0207662_100890262 137
250 3300025921 Ga0207652_10625871 Ga0207652_106258712 137
251 3300025923 Ga0207681_10148278 Ga0207681_101482782 137
252 3300025926 Ga0207659_10023144 Ga0207659_100231443 137
253 3300025928 Ga0207700_10001282 Ga0207700_100012822 137
254 3300025928 Ga0207700_10059362 Ga0207700_100593622 137
255 3300025928 Ga0207700_10240937 Ga0207700_102409372 137
256 3300025929 Ga0207664_10020726 Ga0207664_100207264 137
257 3300025929 Ga0207664_10865021 Ga0207664_108650211 137
258 3300025933 Ga0207706_10004504 Ga0207706_100045043 137
259 3300025935 Ga0207709_10020604 Ga0207709_100206041 137
260 3300025937 Ga0207669_10066269 Ga0207669_100662692 137
261 3300025938 Ga0207704_10039472 Ga0207704_100394722 137
262 3300025938 Ga0207704_10266338 Ga0207704_102663382 137
263 3300025939 Ga0207665_10014272 Ga0207665_100142724 137
264 3300025940 Ga0207691_10197038 Ga0207691_101970382 137
265 3300025941 Ga0207711_10172441 Ga0207711_101724412 137
266 3300025942 Ga0207689_10047702 Ga0207689_100477023 137
267 3300025942 Ga0207689_10495676 Ga0207689_104956761 137
268 3300025949 Ga0207667_12049590 Ga0207667_120495901 137
269 3300025961 Ga0207712_10280071 Ga0207712_102800712 137
270 3300025981 Ga0207640_10219980 Ga0207640_102199802 137
271 3300025986 Ga0207658_10065917 Ga0207658_100659171 137
272 3300025986 Ga0207658_10655185 Ga0207658_106551852 137
273 3300026023 Ga0207677_10230644 Ga0207677_102306442 137
274 3300026035 Ga0207703_10077185 Ga0207703_100771853 137
275 3300026041 Ga0207639_10933818 Ga0207639_109338182 137
276 3300026067 Ga0207678_10005216 Ga0207678_100052168 137
277 3300026075 Ga0207708_10001094 Ga0207708_100010946 137
278 3300026078 Ga0207702_10148930 Ga0207702_101489302 137
279 3300026088 Ga0207641_10151367 Ga0207641_101513671 137
280 3300026088 Ga0207641_10744596 Ga0207641_107445962 137
281 3300026089 Ga0207648_10009306 Ga0207648_100093064 137
282 3300026095 Ga0207676_10077488 Ga0207676_100774882 137
283 3300026116 Ga0207674_10023673 Ga0207674_100236734 137
284 3300026118 Ga0207675_100011964 Ga0207675_1000119645 137
285 3300026121 Ga0207683_10136908 Ga0207683_101369082 137
286 3300026121 Ga0207683_10305700 Ga0207683_103057002 137
287 3300026142 Ga0207698_10077364 Ga0207698_100773642 137
288 3300027512 Ga0209179_1018933 Ga0209179_10189332 137
289 3300027512 Ga0209179_1046447 Ga0209179_10464472 137
290 3300027671 Ga0209588_1007975 Ga0209588_10079752 137
291 3300027671 Ga0209588_1068485 Ga0209588_10684852 137
292 3300028379 Ga0268266_11680103 Ga0268266_116801032 137
293 3300028380 Ga0268265_10033639 Ga0268265_100336391 137
294 3300028380 Ga0268265_11111993 Ga0268265_111119932 137
295 3300028381 Ga0268264_10021384 Ga0268264_100213843 137
296 3300028381 Ga0268264_11584430 Ga0268264_115844302 137
297 3300031235 Ga0265330_10044668 Ga0265330_100446682 137
298 3300031241 Ga0265325_10130833 Ga0265325_101308332 137
299 3300031249 Ga0265339_10016985 Ga0265339_100169852 137
300 3300031250 Ga0265331_10259371 Ga0265331_102593712 137
301 3300035083 Ga0373926_0010917 Ga0373926_0010917_753_1172 137
302 3300035086 Ga0373934_0079136 Ga0373934_0079136_154_573 137
303 3300035089 Ga0373944_0009890 Ga0373944_0009890_116_535 137
304 3300035111 Ga0373923_0001024 Ga0373923_0001024_1338_1757 137
305 3300035113 Ga0373936_0004647 Ga0373936_0004647_1827_2246 137
306 3300035113 Ga0373936_0106151 Ga0373936_0106151_20_439 137
307 3300035113 Ga0373936_0340122 Ga0373936_0340122_247_666 137
308 3300035115 Ga0373941_0348862 Ga0373941_0348862_119_550 137
309 3300035115 Ga0373941_0454243 Ga0373941_0454243_64_483 137
310 3300035116 Ga0373945_0091474 Ga0373945_0091474_693_1112 137
311 3300035116 Ga0373945_0175937 Ga0373945_0175937_334_753 137
312 3300035116 Ga0373945_0190161 Ga0373945_0190161_135_554 137
313 3300035117 Ga0373953_0013416 Ga0373953_0013416_1879_2298 137
314 3300035117 Ga0373953_0090213 Ga0373953_0090213_185_604 137
315 3300035118 Ga0373954_0000987 Ga0373954_0000987_6955_7374 137
316 3300035118 Ga0373954_0156234 Ga0373954_0156234_628_1047 137
317 3300035120 Ga0373957_0041360 Ga0373957_0041360_608_1027 137
318 3300035170 Ga0373943_0061659 Ga0373943_0061659_1018_1437 137
319 3300035170 Ga0373943_0213064 Ga0373943_0213064_16_435 137
320 3300035171 Ga0373946_0035882 Ga0373946_0035882_840_1259 137
321 3300035172 Ga0373955_0002808 Ga0373955_0002808_4644_5063 137
322 3300035410 Ga0373924_0002822 Ga0373924_0002822_4697_5116 137
323 3300035692 Ga0373935_0000123 Ga0373935_0000123_7269_7688 137
324 3300035692 Ga0373935_0067566 Ga0373935_0067566_1104_1523 137
325 3300035695 Ga0373927_0032738 Ga0373927_0032738_1840_2259 137
326 3300035695 Ga0373927_0032887 Ga0373927_0032887_957_1376 137
327 3300035695 Ga0373927_0037224 Ga0373927_0037224_1984_2403 137
328 3300035695 Ga0373927_0306971 Ga0373927_0306971_208_627 137
329 3300035725 Ga0373947_0002728 Ga0373947_0002728_3034_3453 137
330 3300035725 Ga0373947_0033365 Ga0373947_0033365_1639_2058 137
331 3300035725 Ga0373947_0203653 Ga0373947_0203653_612_1031 137
332 3300036401 Ga0373937_0000007 Ga0373937_0000007_50712_51131 137
333 3300036401 Ga0373937_0021571 Ga0373937_0021571_5200_5619 137
334 3300037068 Ga0373925_0000011 Ga0373925_0000011_41963_42382 137
335 3300037068 Ga0373925_0047614 Ga0373925_0047614_1070_1489 137
336 3300037068 Ga0373925_0248980 Ga0373925_0248980_24_443 137
337 3300037068 Ga0373925_0367137 Ga0373925_0367137_559_978 137
338 3300037312 Ga0395899_0179704 Ga0395899_0179704_165_584 137
339 3300037418 Ga0395900_0384323 Ga0395900_0384323_746_1165 137
340 3300037466 Ga0395898_0125844 Ga0395898_0125844_1904_2323 137
341 3300037471 Ga0395905_0705508 Ga0395905_0705508_35_454 137
342 3300037853 Ga0436364_0527040 Ga0436364_0527040_386_808 137
343 3300037853 Ga0436364_1527085 Ga0436364_1527085_445_864 137
344 3300038443 Ga0395901_0939134 Ga0395901_0939134_94_513 137
345 3300039437 Ga0436365_0698136 Ga0436365_0698136_1537_1956 137
346 3300039437 Ga0436365_1251542 Ga0436365_1251542_353_775 137
347 3300039437 Ga0436365_1914251 Ga0436365_1914251_895_1317 137
348 3300039438 Ga0436360_0276015 Ga0436360_0276015_461_880 137
349 3300039447 Ga0436361_0022907 Ga0436361_0022907_402_821 137
350 3300039447 Ga0436361_0317799 Ga0436361_0317799_5580_5999 137
351 3300039450 Ga0436363_0092101 Ga0436363_0092101_649_1068 137
352 3300039450 Ga0436363_0525082 Ga0436363_0525082_125_547 137
353 3300039450 Ga0436363_1375367 Ga0436363_1375367_509_928 137
354 3300039453 Ga0436362_0144763 Ga0436362_0144763_162_584 137
355 3300041512 Ga0451853_3761155 Ga0451853_3761155_958_1377 137
356 3300045976 Ga0466967_1278730 Ga0466967_1278730_196_627 137
357 3300046454 Ga0495592_0000511 Ga0495592_0000511_7193_7612 137
358 3300046455 Ga0495603_0098394 Ga0495603_0098394_58_477 137
359 3300046457 Ga0495590_0037400 Ga0495590_0037400_231_650 137
360 3300046459 Ga0495629_0019790 Ga0495629_0019790_196_615 137
361 3300046459 Ga0495629_0286130 Ga0495629_0286130_605_1024 137
362 3300046460 Ga0495638_0444727 Ga0495638_0444727_38_457 137
363 3300046460 Ga0495638_0656792 Ga0495638_0656792_13_432 137
364 3300046462 Ga0495651_0002325 Ga0495651_0002325_13020_13439 137
365 3300046463 Ga0495653_0000190 Ga0495653_0000190_43885_44304 137
366 3300046472 Ga0495580_0019951 Ga0495580_0019951_3119_3538 137
367 3300046473 Ga0495582_0022972 Ga0495582_0022972_1902_2321 137
368 3300046473 Ga0495582_0330861 Ga0495582_0330861_31_450 137
369 3300046474 Ga0495605_0114750 Ga0495605_0114750_526_945 137
370 3300046475 Ga0495639_0059680 Ga0495639_0059680_530_949 137
371 3300046475 Ga0495639_0380701 Ga0495639_0380701_72_491 137
372 3300046476 Ga0495662_0005258 Ga0495662_0005258_5836_6255 137
373 3300046477 Ga0495664_0000464 Ga0495664_0000464_15067_15486 137
374 3300046491 Ga0495584_0019223 Ga0495584_0019223_2755_3174 137
375 3300046491 Ga0495584_0144383 Ga0495584_0144383_249_677 137
376 3300046491 Ga0495584_0200973 Ga0495584_0200973_579_1001 137
377 3300046492 Ga0495585_0055484 Ga0495585_0055484_1225_1647 137
378 3300046492 Ga0495585_0131634 Ga0495585_0131634_19_438 137
379 3300046499 Ga0495594_0009610 Ga0495594_0009610_2667_3086 137
380 3300046500 Ga0495596_0073796 Ga0495596_0073796_360_779 137
381 3300046511 Ga0495608_0000004 Ga0495608_0000004_11624_12043 137
382 3300046514 Ga0495618_0000392 Ga0495618_0000392_15079_15498 137
383 3300046514 Ga0495618_0109382 Ga0495618_0109382_230_649 137
384 3300046515 Ga0495620_0084731 Ga0495620_0084731_685_1104 137
385 3300046516 Ga0495628_0000006 Ga0495628_0000006_138690_139109 137
386 3300046517 Ga0495630_0003456 Ga0495630_0003456_4692_5111 137
387 3300046517 Ga0495630_0467009 Ga0495630_0467009_15_434 137
388 3300046518 Ga0495631_0057609 Ga0495631_0057609_497_916 137
389 3300046519 Ga0495632_0116706 Ga0495632_0116706_761_1180 137
390 3300046520 Ga0495637_0220301 Ga0495637_0220301_242_661 137
391 3300046523 Ga0495644_0023479 Ga0495644_0023479_1374_1793 137
392 3300046523 Ga0495644_0209011 Ga0495644_0209011_47_466 137
393 3300046525 Ga0495663_0138501 Ga0495663_0138501_286_705 137
394 3300046529 Ga0495652_0005358 Ga0495652_0005358_7156_7575 137
395 3300046531 Ga0495665_0155331 Ga0495665_0155331_285_704 137
396 3300046533 Ga0495640_0000013 Ga0495640_0000013_39537_39956 137
397 3300046533 Ga0495640_0792259 Ga0495640_0792259_47_478 137
398 3300046536 Ga0495587_0000004 Ga0495587_0000004_15089_15508 137
399 3300046537 Ga0495598_0019418 Ga0495598_0019418_1130_1549 137
400 3300046537 Ga0495598_0456951 Ga0495598_0456951_77_496 137
401 3300046538 Ga0495609_0057540 Ga0495609_0057540_810_1229 137
402 3300046539 Ga0495621_0038709 Ga0495621_0038709_698_1117 137
403 3300046543 Ga0495645_0000001 Ga0495645_0000001_343073_343492 137
404 3300046543 Ga0495645_0864302 Ga0495645_0864302_53_472 137
405 3300046558 Ga0495633_0105247 Ga0495633_0105247_458_880 137
406 3300046558 Ga0495633_0199525 Ga0495633_0199525_419_838 137
407 3300046559 Ga0495667_0000084 Ga0495667_0000084_59735_60154 137
408 3300046615 Ga0495656_0035412 Ga0495656_0035412_1338_1757 137
409 3300046615 Ga0495656_0043815 Ga0495656_0043815_387_806 137
410 3300046616 Ga0495668_0094183 Ga0495668_0094183_671_1090 137
411 3300046616 Ga0495668_0743960 Ga0495668_0743960_59_487 137
412 3300046642 Ga0495634_0000164 Ga0495634_0000164_37177_37596 137
413 3300046648 Ga0495611_0034832 Ga0495611_0034832_439_858 137
414 3300046663 Ga0495635_0000003 Ga0495635_0000003_342704_343123 137
415 3300046664 Ga0495659_0034527 Ga0495659_0034527_891_1313 137
416 3300046664 Ga0495659_0102343 Ga0495659_0102343_576_995 137
417 3300046665 Ga0495661_0264382 Ga0495661_0264382_225_647 137
418 3300046674 Ga0495588_0119793 Ga0495588_0119793_667_1086 137
419 3300046675 Ga0495657_0000248 Ga0495657_0000248_7113_7532 137
420 3300046678 Ga0495599_0000014 Ga0495599_0000014_132526_132945 137
421 3300046679 Ga0495623_0000006 Ga0495623_0000006_7367_7786 137
422 3300046680 Ga0495646_0000005 Ga0495646_0000005_255244_255663 137
423 3300046681 Ga0495647_0565094 Ga0495647_0565094_34_453 137
424 3300046683 Ga0495658_0077900 Ga0495658_0077900_145_564 137
425 3300046683 Ga0495658_0212192 Ga0495658_0212192_271_690 137
426 3300046690 Ga0495624_0020517 Ga0495624_0020517_3866_4285 137
427 3300046690 Ga0495624_0044123 Ga0495624_0044123_392_811 137
428 3300046691 Ga0495670_0251206 Ga0495670_0251206_258_680 137
429 3300046691 Ga0495670_0393065 Ga0495670_0393065_128_547 137
430 3300046694 Ga0495649_0149849 Ga0495649_0149849_672_1091 137
431 3300046809 Ga0495600_0000005 Ga0495600_0000005_38702_39121 137
432 3300047315 Ga0495581_0027214 Ga0495581_0027214_1038_1457 137
433 3300047315 Ga0495581_0092137 Ga0495581_0092137_354_773 137
434 3300047317 Ga0495604_0000002 Ga0495604_0000002_187527_187946 137
435 3300047319 Ga0495674_0000004 Ga0495674_0000004_187075_187494 137
436 3300047321 Ga0495676_0025562 Ga0495676_0025562_3893_4312 137
437 3300047321 Ga0495676_0123805 Ga0495676_0123805_812_1231 137
438 3300047321 Ga0495676_0126839 Ga0495676_0126839_846_1265 137
439 3300047322 Ga0495680_0000986 Ga0495680_0000986_24165_24584 137
440 3300047322 Ga0495680_0833644 Ga0495680_0833644_150_581 137
441 3300047444 Ga0495675_0000053 Ga0495675_0000053_71136_71555 137
442 3300047445 Ga0495677_0064530 Ga0495677_0064530_862_1281 137
443 3300047446 Ga0495679_104971 Ga0495679_104971_274_693 137
444 3300047471 Ga0495684_0000004 Ga0495684_0000004_167951_168370 137
445 3300047471 Ga0495684_0131588 Ga0495684_0131588_1167_1586 137
446 3300047673 Ga0495593_0001912 Ga0495593_0001912_4971_5390 137
447 3300048088 Ga0495602_0000001 Ga0495602_0000001_342746_343165 137
448 3300048904 Ga0496101_0494373 Ga0496101_0494373_83_502 137
449 3300048905 Ga0496102_0405971 Ga0496102_0405971_145_564 137
450 3300048905 Ga0496102_0897278 Ga0496102_0897278_126_545 137
451 3300048906 Ga0496103_0011877 Ga0496103_0011877_205_624 137
452 3300048906 Ga0496103_0126171 Ga0496103_0126171_1016_1435 137
453 3300048907 Ga0496104_0000661 Ga0496104_0000661_16782_17201 137
454 3300048907 Ga0496104_0000886 Ga0496104_0000886_3615_4034 137
455 3300048907 Ga0496104_0021434 Ga0496104_0021434_5115_5534 137
456 3300048907 Ga0496104_0677249 Ga0496104_0677249_491_910 137
457 3300048908 Ga0496105_0001513 Ga0496105_0001513_10414_10833 137
458 3300048908 Ga0496105_0007189 Ga0496105_0007189_3526_3945 137
459 3300048909 Ga0496106_0025942 Ga0496106_0025942_3838_4257 137
460 3300048909 Ga0496106_0036403 Ga0496106_0036403_1453_1872 137
461 3300048909 Ga0496106_0077710 Ga0496106_0077710_591_1010 137
462 3300048909 Ga0496106_0744486 Ga0496106_0744486_104_523 137
463 3300048910 Ga0496107_0149251 Ga0496107_0149251_359_778 137
464 3300048911 Ga0496108_0033849 Ga0496108_0033849_3642_4061 137
465 3300048911 Ga0496108_0975701 Ga0496108_0975701_68_499 137
466 3300048912 Ga0496109_0021144 Ga0496109_0021144_1168_1587 137
467 3300048912 Ga0496109_0472279 Ga0496109_0472279_365_784 137
468 3300048912 Ga0496109_0812157 Ga0496109_0812157_244_663 137
469 3300048913 Ga0496110_0056733 Ga0496110_0056733_800_1219 137
470 3300048913 Ga0496110_0092279 Ga0496110_0092279_1030_1449 137
471 3300048913 Ga0496110_0092398 Ga0496110_0092398_1413_1832 137
472 3300048913 Ga0496110_0392815 Ga0496110_0392815_445_864 137
473 3300048913 Ga0496110_0699149 Ga0496110_0699149_179_598 137
474 3300048913 Ga0496110_0889436 Ga0496110_0889436_109_528 137
475 3300048913 Ga0496110_1033517 Ga0496110_1033517_179_607 137
476 3300048914 Ga0496111_0000624 Ga0496111_0000624_17846_18265 137
477 3300048914 Ga0496111_0453193 Ga0496111_0453193_40_459 137
478 3300048914 Ga0496111_0469143 Ga0496111_0469143_82_501 137
479 3300048915 Ga0496112_0004796 Ga0496112_0004796_4166_4585 137
480 3300048915 Ga0496112_0702180 Ga0496112_0702180_379_798 137
481 3300048915 Ga0496112_1577809 Ga0496112_1577809_44_475 137
482 3300048916 Ga0496113_0002612 Ga0496113_0002612_7622_8041 137
483 3300048916 Ga0496113_0299600 Ga0496113_0299600_759_1178 137
484 3300048916 Ga0496113_1082806 Ga0496113_1082806_147_578 137
485 3300048917 Ga0496114_0195984 Ga0496114_0195984_625_1044 137
486 3300048918 Ga0496115_0008940 Ga0496115_0008940_4271_4690 137
487 3300048918 Ga0496115_0452088 Ga0496115_0452088_175_594 137
488 3300048918 Ga0496115_1138739 Ga0496115_1138739_109_528 137
489 3300049568 Ga0501031_0789523 Ga0501031_0789523_113_532 137
490 3300049572 Ga0501036_0431761 Ga0501036_0431761_215_634 137
491 3300049574 Ga0501038_0754527 Ga0501038_0754527_79_498 137
492 3300049576 Ga0501040_0265288 Ga0501040_0265288_690_1109 137
493 3300049577 Ga0501041_0776963 Ga0501041_0776963_85_504 137
494 3300049578 Ga0501042_0224241 Ga0501042_0224241_250_669 137
495 3300049582 Ga0501048_0221018 Ga0501048_0221018_849_1268 137
496 3300049587 Ga0501071_1305115 Ga0501071_1305115_122_541 137
497 3300049588 Ga0501072_0269019 Ga0501072_0269019_651_1070 137
498 3300049591 Ga0501075_0144365 Ga0501075_0144365_1069_1488 137
499 3300049591 Ga0501075_0689381 Ga0501075_0689381_294_713 137
500 3300049741 Ga0501079_0213358 Ga0501079_0213358_550_969 137
501 3300049741 Ga0501079_0410062 Ga0501079_0410062_298_726 137
502 3300049741 Ga0501079_0604874 Ga0501079_0604874_77_496 137
503 3300049743 Ga0501081_1047239 Ga0501081_1047239_53_481 137
504 3300049744 Ga0501083_0220725 Ga0501083_0220725_96_515 137
505 3300049744 Ga0501083_1129736 Ga0501083_1129736_27_446 137
506 3300050489 nmdc:mga03683_403892_c1 nmdc:mga03683_403892_c1_179_598 137
507 3300050489 nmdc:mga03683_70163_c1 nmdc:mga03683_70163_c1_83_502 137
508 3300050492 nmdc:mga0yw44_1131_c1 nmdc:mga0yw44_1131_c1_8566_8985 137
509 3300050492 nmdc:mga0yw44_136306_c1 nmdc:mga0yw44_136306_c1_939_1358 137
510 3300050492 nmdc:mga0yw44_17009_c1 nmdc:mga0yw44_17009_c1_3281_3700 137
511 3300050492 nmdc:mga0yw44_96584_c1 nmdc:mga0yw44_96584_c1_1109_1528 137
512 3300050494 nmdc:mga06z11_166752_c1 nmdc:mga06z11_166752_c1_355_774 137
513 3300050494 nmdc:mga06z11_176136_c1 nmdc:mga06z11_176136_c1_92_511 137
514 3300050494 nmdc:mga06z11_247249_c1 nmdc:mga06z11_247249_c1_234_653 137
515 3300050494 nmdc:mga06z11_73668_c1 nmdc:mga06z11_73668_c1_1081_1500 137
516 3300050496 nmdc:mga07m45_524849_c1 nmdc:mga07m45_524849_c1_191_610 137
517 3300050507 nmdc:mga05p37_1153149_c1 nmdc:mga05p37_1153149_c1_88_507 137
518 3300050507 nmdc:mga05p37_43029_c1 nmdc:mga05p37_43029_c1_1572_1991 137
519 3300050507 nmdc:mga05p37_4669_c1 nmdc:mga05p37_4669_c1_14921_15340 137
520 3300050507 nmdc:mga05p37_508993_c1 nmdc:mga05p37_508993_c1_786_1205 137
521 3300050508 nmdc:mga09592_247351_c1 nmdc:mga09592_247351_c1_70_489 137
522 3300050508 nmdc:mga09592_384510_c1 nmdc:mga09592_384510_c1_462_881 137
523 3300050510 nmdc:mga06r32_1175528_c1 nmdc:mga06r32_1175528_c1_237_665 137
524 3300050511 nmdc:mga08y16_1182556_c1 nmdc:mga08y16_1182556_c1_106_525 137
525 3300050511 nmdc:mga08y16_1305796_c1 nmdc:mga08y16_1305796_c1_108_527 137
526 3300050511 nmdc:mga08y16_600667_c1 nmdc:mga08y16_600667_c1_517_936 137
527 3300050511 nmdc:mga08y16_790314_c1 nmdc:mga08y16_790314_c1_243_665 137
528 3300050512 nmdc:mga0n895_121384_c1 nmdc:mga0n895_121384_c1_1658_2077 137
529 3300050512 nmdc:mga0n895_1350920_c1 nmdc:mga0n895_1350920_c1_53_472 137
530 3300050513 nmdc:mga0rr50_1118859_c1 nmdc:mga0rr50_1118859_c1_174_593 137
531 3300050513 nmdc:mga0rr50_299314_c1 nmdc:mga0rr50_299314_c1_758_1177 137
532 3300050514 nmdc:mga08x19_102122_c1 nmdc:mga08x19_102122_c1_709_1128 137
533 3300050515 nmdc:mga0a205_167259_c1 nmdc:mga0a205_167259_c1_290_709 137
534 3300053077 Ga0495601_0000078 Ga0495601_0000078_4645_5064 137
535 3300053077 Ga0495601_1045832 Ga0495601_1045832_71_502 137
536 3300053078 Ga0495612_0000005 Ga0495612_0000005_119027_119446 137
537 3300053078 Ga0495612_0408690 Ga0495612_0408690_119_538 137
538 3300053084 Ga0495595_0000065 Ga0495595_0000065_7198_7617 137
539 3300053084 Ga0495595_0281379 Ga0495595_0281379_336_755 137
540 3300053085 Ga0495619_0000003 Ga0495619_0000003_347868_348287 137
541 3300053085 Ga0495619_0090141 Ga0495619_0090141_468_887 137
542 3300053085 Ga0495619_0475460 Ga0495619_0475460_332_751 137
543 3300053085 Ga0495619_0574633 Ga0495619_0574633_161_580 137
544 3300053096 Ga0500641_0230864 Ga0500641_0230864_27_461 137
545 3300053096 Ga0500641_0248279 Ga0500641_0248279_295_714 137
546 3300053119 Ga0500595_005091 Ga0500595_005091_3412_3846 137
547 3300053153 Ga0500616_0230436 Ga0500616_0230436_91_525 137
548 3300054114 Ga0501084_0167468 Ga0501084_0167468_1335_1754 137
549 3300054114 Ga0501084_0642877 Ga0501084_0642877_272_691 137
550 3300060353 Ga0501082_0102022 Ga0501082_0102022_1650_2069 137
551 3300061734 Ga0530510_0046536 Ga0530510_0046536_296_715 137
552 3300061734 Ga0530510_1247664 Ga0530510_1247664_125_544 137
553 iso_pu_bacteria 2738541298 2738831271 137
554 iso_pu_bacteria 2738541306 2738872799 137
555 iso_pu_bacteria 2738543002 2739184429 137
556 iso_pu_bacteria 2738543008 2739219398 137
557 3300006173 Ga0070716_100813815 Ga0070716_1008138152 138
558 3300006175 Ga0070712_101653630 Ga0070712_1016536302 138
559 3300013296 Ga0157374_11534609 Ga0157374_115346092 138
560 3300025915 Ga0207693_10404720 Ga0207693_104047202 138
561 3300026075 Ga0207708_10627320 Ga0207708_106273202 138
562 3300041408 Ga0439453_0052982 Ga0439453_0052982_39_464 138
563 3300048903 Ga0496100_0002815 Ga0496100_0002815_7690_8112 138
564 3300048903 Ga0496100_0882185 Ga0496100_0882185_43_465 138
565 3300048904 Ga0496101_0012301 Ga0496101_0012301_3462_3884 138
566 3300048905 Ga0496102_0010366 Ga0496102_0010366_2721_3143 138
567 3300048907 Ga0496104_0003228 Ga0496104_0003228_12764_13186 138
568 3300048907 Ga0496104_0225924 Ga0496104_0225924_1226_1648 138
569 3300048908 Ga0496105_0117253 Ga0496105_0117253_1731_2153 138
570 3300048908 Ga0496105_0297667 Ga0496105_0297667_81_503 138
571 3300048909 Ga0496106_0003463 Ga0496106_0003463_1010_1432 138
572 3300048909 Ga0496106_0332752 Ga0496106_0332752_454_876 138
573 3300048910 Ga0496107_0003468 Ga0496107_0003468_6774_7196 138
574 3300048911 Ga0496108_0001416 Ga0496108_0001416_6535_6957 138
575 3300048911 Ga0496108_0044856 Ga0496108_0044856_791_1213 138
576 3300048911 Ga0496108_0406983 Ga0496108_0406983_431_853 138
577 3300048912 Ga0496109_0003855 Ga0496109_0003855_5586_6008 138
578 3300048912 Ga0496109_0196191 Ga0496109_0196191_1359_1781 138
579 3300048913 Ga0496110_0000441 Ga0496110_0000441_18626_19048 138
580 3300048913 Ga0496110_0006376 Ga0496110_0006376_3932_4354 138
581 3300048914 Ga0496111_0000741 Ga0496111_0000741_11402_11824 138
582 3300048914 Ga0496111_0002966 Ga0496111_0002966_6600_7022 138
583 3300048915 Ga0496112_0006447 Ga0496112_0006447_8435_8857 138
584 3300048915 Ga0496112_0015544 Ga0496112_0015544_5601_6023 138
585 3300048915 Ga0496112_0457994 Ga0496112_0457994_171_593 138
586 3300048916 Ga0496113_0084834 Ga0496113_0084834_1731_2153 138
587 3300048916 Ga0496113_0106937 Ga0496113_0106937_1400_1822 138
588 3300048917 Ga0496114_0044845 Ga0496114_0044845_475_897 138
589 3300049583 Ga0501067_0137532 Ga0501067_0137532_759_1181 138
590 3300003215 JGI25153J46596_10003207 JGI25153J46596_100032078 139
591 3300005356 Ga0070674_100040160 Ga0070674_1000401602 139
592 3300005365 Ga0070688_100204429 Ga0070688_1002044292 139
593 3300005439 Ga0070711_101234659 Ga0070711_1012346591 139
594 3300005441 Ga0070700_100239820 Ga0070700_1002398202 139
595 3300005456 Ga0070678_100046173 Ga0070678_1000461731 139
596 3300005457 Ga0070662_100670489 Ga0070662_1006704892 139
597 3300005543 Ga0070672_100880305 Ga0070672_1008803052 139
598 3300005544 Ga0070686_100058004 Ga0070686_1000580042 139
599 3300005564 Ga0070664_100546466 Ga0070664_1005464662 139
600 3300005615 Ga0070702_100122525 Ga0070702_1001225253 139
601 3300006038 Ga0075365_10582484 Ga0075365_105824842 139
602 3300006042 Ga0075368_10073422 Ga0075368_100734222 139
603 3300006042 Ga0075368_10192761 Ga0075368_101927612 139
604 3300006177 Ga0075362_10232933 Ga0075362_102329332 139
605 3300006178 Ga0075367_10180694 Ga0075367_101806942 139
606 3300006178 Ga0075367_10456982 Ga0075367_104569821 139
607 3300006186 Ga0075369_10132171 Ga0075369_101321712 139
608 3300006195 Ga0075366_10470019 Ga0075366_104700192 139
609 3300006846 Ga0075430_100000415 Ga0075430_10000041521 139
610 3300006846 Ga0075430_100130284 Ga0075430_1001302843 139
611 3300006847 Ga0075431_100185293 Ga0075431_1001852932 139
612 3300006880 Ga0075429_100057131 Ga0075429_1000571313 139
613 3300006881 Ga0068865_100366218 Ga0068865_1003662182 139
614 3300006881 Ga0068865_100986063 Ga0068865_1009860632 139
615 3300009011 Ga0105251_10188292 Ga0105251_101882922 139
616 3300009094 Ga0111539_10682029 Ga0111539_106820292 139
617 3300009098 Ga0105245_11574132 Ga0105245_115741321 139
618 3300009147 Ga0114129_10184782 Ga0114129_101847822 139
619 3300009148 Ga0105243_10478429 Ga0105243_104784292 139
620 3300009148 Ga0105243_11323375 Ga0105243_113233751 139
621 3300009176 Ga0105242_10127614 Ga0105242_101276142 139
622 3300009545 Ga0105237_10229317 Ga0105237_102293172 139
623 3300010375 Ga0105239_10350481 Ga0105239_103504812 139
624 3300011119 Ga0105246_10057227 Ga0105246_100572272 139
625 3300011119 Ga0105246_10749043 Ga0105246_107490432 139
626 3300013296 Ga0157374_10333944 Ga0157374_103339442 139
627 3300013297 Ga0157378_10418221 Ga0157378_104182212 139
628 3300013306 Ga0163162_10427475 Ga0163162_104274752 139
629 3300013308 Ga0157375_10613567 Ga0157375_106135672 139
630 3300013308 Ga0157375_10898303 Ga0157375_108983032 139
631 3300014325 Ga0163163_10293202 Ga0163163_102932022 139
632 3300014325 Ga0163163_10333760 Ga0163163_103337604 139
633 3300014326 Ga0157380_10054439 Ga0157380_100544394 139
634 3300014326 Ga0157380_10785917 Ga0157380_107859172 139
635 3300014497 Ga0182008_10048561 Ga0182008_100485612 139
636 3300014968 Ga0157379_10268918 Ga0157379_102689182 139
637 3300014969 Ga0157376_10040586 Ga0157376_100405862 139
638 3300025297 Ga0209758_1002876 Ga0209758_100287613 139
639 3300025901 Ga0207688_10252293 Ga0207688_102522932 139
640 3300025937 Ga0207669_10291756 Ga0207669_102917562 139
641 3300025938 Ga0207704_10639504 Ga0207704_106395042 139
642 3300025939 Ga0207665_10273603 Ga0207665_102736031 139
643 3300025940 Ga0207691_10114700 Ga0207691_101147003 139
644 3300025944 Ga0207661_11167429 Ga0207661_111674291 139
645 3300026075 Ga0207708_10250468 Ga0207708_102504682 139
646 3300026118 Ga0207675_100638858 Ga0207675_1006388582 139
647 3300026121 Ga0207683_10041081 Ga0207683_100410814 139
648 3300027866 Ga0209813_10220764 Ga0209813_102207642 139
649 3300027866 Ga0209813_10360442 Ga0209813_103604421 139
650 3300031548 Ga0307408_100543838 Ga0307408_1005438382 139
651 3300031901 Ga0307406_10854759 Ga0307406_108547592 139
652 3300032002 Ga0307416_103154128 Ga0307416_1031541281 139
653 3300032005 Ga0307411_12224723 Ga0307411_122247231 139
654 3300035691 Ga0373931_0445902 Ga0373931_0445902_340_813 139
655 3300037068 Ga0373925_0875446 Ga0373925_0875446_72_545 139
656 3300039437 Ga0436365_1653913 Ga0436365_1653913_49_498 139
657 3300039447 Ga0436361_0028523 Ga0436361_0028523_995_1435 139
658 3300041443 Ga0451789_1368216 Ga0451789_1368216_98_559 139
659 3300041501 Ga0451845_0687621 Ga0451845_0687621_22_471 139
660 3300042001 Ga0439441_015847 Ga0439441_015847_365_799 139
661 3300042436 Ga0439435_0064608 Ga0439435_0064608_27_461 139
662 3300046684 Ga0495669_0610730 Ga0495669_0610730_15_488 139
663 3300046691 Ga0495670_0716058 Ga0495670_0716058_24_482 139
664 3300048903 Ga0496100_0556602 Ga0496100_0556602_92_523 139
665 3300048905 Ga0496102_0191648 Ga0496102_0191648_346_819 139
666 3300048905 Ga0496102_1433031 Ga0496102_1433031_11_442 139
667 3300048907 Ga0496104_0010977 Ga0496104_0010977_4655_5128 139
668 3300048907 Ga0496104_0336097 Ga0496104_0336097_414_845 139
669 3300048908 Ga0496105_0066324 Ga0496105_0066324_1322_1795 139
670 3300048908 Ga0496105_0605996 Ga0496105_0605996_57_488 139
671 3300048909 Ga0496106_0207104 Ga0496106_0207104_478_909 139
672 3300048909 Ga0496106_0643313 Ga0496106_0643313_92_565 139
673 3300048910 Ga0496107_0112065 Ga0496107_0112065_545_1018 139
674 3300048910 Ga0496107_0223177 Ga0496107_0223177_196_627 139
675 3300048911 Ga0496108_0160338 Ga0496108_0160338_1320_1793 139
676 3300048912 Ga0496109_0054892 Ga0496109_0054892_1966_2439 139
677 3300048913 Ga0496110_0111049 Ga0496110_0111049_1939_2370 139
678 3300048915 Ga0496112_0031599 Ga0496112_0031599_3454_3927 139
679 3300048915 Ga0496112_0229187 Ga0496112_0229187_547_978 139
680 3300048916 Ga0496113_0581115 Ga0496113_0581115_47_520 139
681 3300048917 Ga0496114_0106765 Ga0496114_0106765_1720_2151 139
682 3300048918 Ga0496115_0202095 Ga0496115_0202095_295_726 139
683 3300049571 Ga0501034_0654529 Ga0501034_0654529_295_756 139
684 3300050489 nmdc:mga03683_170874_c1 nmdc:mga03683_170874_c1_419_853 139
685 3300050489 nmdc:mga03683_218808_c1 nmdc:mga03683_218808_c1_394_828 139
686 3300050489 nmdc:mga03683_477937_c1 nmdc:mga03683_477937_c1_85_519 139
687 3300050491 nmdc:mga00v17_271797_c1 nmdc:mga00v17_271797_c1_531_965 139
688 3300050493 nmdc:mga0k408_5297_c1 nmdc:mga0k408_5297_c1_6161_6610 139
689 3300050494 nmdc:mga06z11_179535_c1 nmdc:mga06z11_179535_c1_93_527 139
690 3300050495 nmdc:mga04h51_250745_c1 nmdc:mga04h51_250745_c1_202_651 139
691 3300050509 nmdc:mga0qj67_19_c1 nmdc:mga0qj67_19_c1_72341_72769 139
692 3300050513 nmdc:mga0rr50_347939_c1 nmdc:mga0rr50_347939_c1_439_912 139
693 3300050514 nmdc:mga08x19_59654_c1 nmdc:mga08x19_59654_c1_1121_1594 139
694 3300050515 nmdc:mga0a205_535083_c1 nmdc:mga0a205_535083_c1_327_800 139
695 3300053083 Ga0495655_0010780 Ga0495655_0010780_31_480 139
696 3300053083 Ga0495655_0067737 Ga0495655_0067737_395_868 139
697 3300053085 Ga0495619_0666556 Ga0495619_0666556_186_614 139
698 3300061734 Ga0530510_0066928 Ga0530510_0066928_1059_1499 139
699 3300005339 Ga0070660_100135219 Ga0070660_1001352191 140
700 3300005458 Ga0070681_10047951 Ga0070681_100479513 140
701 3300005530 Ga0070679_100007416 Ga0070679_1000074164 140
702 3300025909 Ga0207705_10828753 Ga0207705_108287531 140
703 3300025912 Ga0207707_10083019 Ga0207707_100830193 140
704 3300025917 Ga0207660_10145978 Ga0207660_101459782 140
705 3300025919 Ga0207657_10129109 Ga0207657_101291092 140
706 3300025921 Ga0207652_10049692 Ga0207652_100496923 140
707 3300049568 Ga0501031_0068408 Ga0501031_0068408_170_622 140
708 3300049569 Ga0501032_0033597 Ga0501032_0033597_1887_2339 140
709 3300049570 Ga0501033_0008019 Ga0501033_0008019_4061_4513 140
710 3300049571 Ga0501034_0027191 Ga0501034_0027191_4007_4459 140
711 3300049572 Ga0501036_0013392 Ga0501036_0013392_1896_2348 140
712 3300049573 Ga0501037_0006901 Ga0501037_0006901_4529_4981 140
713 3300049574 Ga0501038_0002228 Ga0501038_0002228_4148_4600 140
714 3300049574 Ga0501038_0354442 Ga0501038_0354442_461_913 140
715 3300049575 Ga0501039_0016251 Ga0501039_0016251_5039_5491 140
716 3300049579 Ga0501043_0011913 Ga0501043_0011913_5177_5629 140
717 3300049580 Ga0501046_0010815 Ga0501046_0010815_5538_5990 140
718 3300049580 Ga0501046_0512025 Ga0501046_0512025_224_679 140
719 3300049581 Ga0501047_0010793 Ga0501047_0010793_4700_5152 140
720 3300049582 Ga0501048_0008167 Ga0501048_0008167_5767_6219 140
721 3300049583 Ga0501067_0010362 Ga0501067_0010362_1766_2218 140
722 3300049584 Ga0501068_0004223 Ga0501068_0004223_5419_5871 140
723 3300049585 Ga0501069_0005631 Ga0501069_0005631_2011_2463 140
724 3300049586 Ga0501070_0014893 Ga0501070_0014893_4468_4920 140
725 3300049587 Ga0501071_0013351 Ga0501071_0013351_181_633 140
726 3300049589 Ga0501073_0012398 Ga0501073_0012398_4148_4600 140
727 3300049590 Ga0501074_0000430 Ga0501074_0000430_7136_7588 140
728 3300049592 Ga0501076_0029352 Ga0501076_0029352_2172_2624 140
729 3300049741 Ga0501079_0010782 Ga0501079_0010782_4024_4476 140
730 3300049741 Ga0501079_0988856 Ga0501079_0988856_10_450 140
731 3300049742 Ga0501080_0008809 Ga0501080_0008809_3179_3631 140
732 3300049743 Ga0501081_0583907 Ga0501081_0583907_72_524 140
733 3300049822 Ga0501035_0013095 Ga0501035_0013095_3343_3795 140
734 3300049823 Ga0501044_0001797 Ga0501044_0001797_23649_24101 140
735 3300049823 Ga0501044_0017730 Ga0501044_0017730_3179_3631 140
736 3300049824 Ga0501045_0005187 Ga0501045_0005187_4061_4513 140
737 3300054114 Ga0501084_0016675 Ga0501084_0016675_565_1017 140
738 3300060353 Ga0501082_0018907 Ga0501082_0018907_539_991 140
739 3300001979 JGI24740J21852_10026211 JGI24740J21852_100262112 141
740 3300001990 JGI24737J22298_10009842 JGI24737J22298_100098422 141
741 3300002067 JGI24735J21928_10000063 JGI24735J21928_1000006328 141
742 3300005535 Ga0070684_101168564 Ga0070684_1011685641 141
743 3300013105 Ga0157369_10004170 Ga0157369_1000417016 141
744 3300017792 Ga0163161_10595774 Ga0163161_105957741 141
745 3300025904 Ga0207647_10007491 Ga0207647_100074915 141
746 3300025919 Ga0207657_10189770 Ga0207657_101897702 141
747 3300031241 Ga0265325_10000938 Ga0265325_100009384 141
748 3300031250 Ga0265331_10099316 Ga0265331_100993162 141
749 3300035725 Ga0373947_0233033 Ga0373947_0233033_701_1162 141
750 3300046474 Ga0495605_0002800 Ga0495605_0002800_2604_3074 141
751 3300046507 Ga0495606_0003567 Ga0495606_0003567_7281_7751 141
752 3300046512 Ga0495610_0005010 Ga0495610_0005010_5191_5661 141
753 3300046528 Ga0495642_0440488 Ga0495642_0440488_54_524 141
754 3300046694 Ga0495649_0102010 Ga0495649_0102010_546_1016 141
755 3300047323 Ga0495683_0004622 Ga0495683_0004622_3137_3607 141
756 3300047472 Ga0495686_0290789 Ga0495686_0290789_218_688 141
757 3300048091 Ga0495626_0046564 Ga0495626_0046564_554_1024 141
758 3300048906 Ga0496103_0004418 Ga0496103_0004418_7004_7459 141
759 3300048920 Ga0496117_0001630 Ga0496117_0001630_23005_23460 141
760 3300048920 Ga0496117_0041352 Ga0496117_0041352_1762_2232 141
761 3300048921 Ga0496118_0000198 Ga0496118_0000198_29616_30071 141
762 3300048921 Ga0496118_0007169 Ga0496118_0007169_4325_4795 141
763 3300048926 Ga0496123_0040147 Ga0496123_0040147_1891_2361 141
764 3300048928 Ga0496125_0221221 Ga0496125_0221221_225_695 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

70

144

0.89

PF20789

4HBT_3C

Acyl-CoA thioesterase C-terminal domain

54

151

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e29-assembly1.cif.gz_D x-ray structure of the protein q7we92_borbr from thioesterase superfamily. northeast structural genomics consortium target bor214a. 0.9293 9 135
3e29-assembly1.cif.gz_D x-ray structure of the protein q7we92_borbr from thioesterase superfamily. northeast structural genomics consortium target bor214a. 0.8896 9 135
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.8814 19 135
4qda-assembly4.cif.gz_E crystal structure of mutant thioesterase pa1618 (e64a) from pseudomonas aeruginosa 0.8693 7 135
4k4c-assembly1.cif.gz_D x-ray crystal structure of e. coli ybdb complexed with phenacyl-coa 0.8667 7 135
ID Description Score Start End Superfamily
3e29D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9229 11 135 3.10.129.10
af_P0ADP2_3_154_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.884 13 135 3.10.129.10
3e29D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8754 11 135 3.10.129.10
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8664 19 135 3.10.129.10
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8611 9 135 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1G9LQ64-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9594 5 136 GO:0016790
AF-A0A0P7YBV9-F1-model_v4 Thioesterase domain-containing protein 0.9444 7 139 GO:0047617
AF-A0A3S8ZAL1-F1-model_v4 PaaI family thioesterase 0.9431 7 136 GO:0016790
AF-A0A2N3Y3H6-F1-model_v4 Uncharacterized protein (TIGR00369 family) 0.9393 5 140 GO:0047617
AF-A0A2E7RE06-F1-model_v4 Phenylacetic acid degradation protein 0.9382 7 136 GO:0047617

Feature Viewer

pLDDT pTM Quality
91.72 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map