F479698

General Info

Members Datasets Scaffolds Average Seq Length
763 357 1526 160

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0083434|Ga0466969_0083434_225_701
Length 158
Sequence MAKGKKRKAAPGDVATNRQASYRYNLIERFECGIELTGTEVKSLRETGAQLKDSYATIRDGEVWLIGAYIAPYAPASRENHDPERTRKLLLHRGEIERLIGRTKEKGLTLVPTRIYFSGTRSRAKVEIALASGKNLYDKRDTIRKREMARDIQRAMHE

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
170 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
202 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
203 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
204 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
207 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
337 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
346 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
347 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
350 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
351 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
352 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
353 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
354 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
357 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.13
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 10.22
Rhizosphere 81.91
Stem 0
Stem Tuber 0
Unclassified 6.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0083434 3300044656 Bacteria 1522
2 CNAas_1006854 3300000532 Bacteria 736
3 JGI24746J21847_1005799 3300001977 Bacteria 1923
4 JGI24740J21852_10002815 3300001979 Bacteria 7776
5 JGI24034J26672_10005937 3300002239 Bacteria 1758
6 JGI25406J46586_10039637 3300003203 Bacteria 1677
7 Ga0065712_10069154 3300005290 Bacteria 7874
8 Ga0065707_10084840 3300005295 Bacteria 6722
9 Ga0070658_10077786 3300005327 Bacteria 2722
10 Ga0070683_100010078 3300005329 Bacteria 8106
11 Ga0070683_100011036 3300005329 Bacteria 7787
12 Ga0070683_100012140 3300005329 Bacteria 7476
13 Ga0070683_100030156 3300005329 Bacteria 4919
14 Ga0070683_100165039 3300005329 Bacteria 2101
15 Ga0070690_100049889 3300005330 Bacteria 2669
16 Ga0070670_100001805 3300005331 Bacteria 17450
17 Ga0070677_10000304 3300005333 Bacteria 17193
18 Ga0070666_10017281 3300005335 Bacteria 4623
19 Ga0070680_100228523 3300005336 Bacteria 1571
20 Ga0070682_100000013 3300005337 Bacteria 254641
21 Ga0070682_100000045 3300005337 Bacteria 131960
22 Ga0070682_100469466 3300005337 Bacteria 968
23 Ga0068868_100000295 3300005338 Bacteria 33551
24 Ga0068868_100000932 3300005338 Bacteria 19897
25 Ga0070660_100363346 3300005339 Unclassified 1193
26 Ga0070660_101322907 3300005339 Bacteria 612
27 Ga0070689_100105307 3300005340 Bacteria 2237
28 Ga0070689_100173254 3300005340 Unclassified 1749
29 Ga0070689_100557574 3300005340 Unclassified 988
30 Ga0070689_100674281 3300005340 Unclassified 901
31 Ga0070691_10149338 3300005341 Bacteria 1197
32 Ga0070661_100000023 3300005344 Bacteria 123104
33 Ga0070661_100161889 3300005344 Bacteria 1695
34 Ga0070692_10079068 3300005345 Bacteria 1767
35 Ga0070668_100029215 3300005347 Bacteria 4186
36 Ga0070669_100618199 3300005353 Bacteria 909
37 Ga0070675_100000101 3300005354 Bacteria 50140
38 Ga0070671_100070694 3300005355 Bacteria 2912
39 Ga0070674_100000008 3300005356 Bacteria 143844
40 Ga0070674_100000420 3300005356 Bacteria 21367
41 Ga0070674_100159744 3300005356 Bacteria 1709
42 Ga0070688_100000630 3300005365 Bacteria 17586
43 Ga0070688_100009960 3300005365 Bacteria 5223
44 Ga0070659_100007823 3300005366 Bacteria 7778
45 Ga0070659_100929202 3300005366 Bacteria 761
46 Ga0070667_100000695 3300005367 Bacteria 32405
47 Ga0070667_100016006 3300005367 Bacteria 6205
48 Ga0070667_100139585 3300005367 Bacteria 2121
49 Ga0070667_100323466 3300005367 Bacteria 1392
50 Ga0070713_100000009 3300005436 Bacteria 153056
51 Ga0070713_100255245 3300005436 Bacteria 1601
52 Ga0070710_10773292 3300005437 Bacteria 684
53 Ga0070701_10686759 3300005438 Bacteria 687
54 Ga0070711_100003211 3300005439 Bacteria 9491
55 Ga0070700_100162825 3300005441 Bacteria 1537
56 Ga0070663_100008028 3300005455 Bacteria 6469
57 Ga0070678_100016400 3300005456 Bacteria 4739
58 Ga0070678_100038206 3300005456 Bacteria 3378
59 Ga0070678_100047702 3300005456 Bacteria 3080
60 Ga0070662_100000016 3300005457 Bacteria 105820
61 Ga0070662_100475057 3300005457 Bacteria 1040
62 Ga0070681_10468870 3300005458 Bacteria 1172
63 Ga0068867_100000266 3300005459 Bacteria 34381
64 Ga0070685_10000282 3300005466 Bacteria 32605
65 Ga0070685_10000320 3300005466 Bacteria 29816
66 Ga0070685_10057809 3300005466 Unclassified 2258
67 Ga0070685_10324229 3300005466 Bacteria 1045
68 Ga0070685_10467575 3300005466 Bacteria 887
69 Ga0070679_100000312 3300005530 Bacteria 41159
70 Ga0070679_100002552 3300005530 Bacteria 16514
71 Ga0070684_100030530 3300005535 Bacteria 4579
72 Ga0070684_100090451 3300005535 Bacteria 2722
73 Ga0070684_100164720 3300005535 Bacteria 2012
74 Ga0070684_100453830 3300005535 Unclassified 1185
75 Ga0068853_100003759 3300005539 Bacteria 11640
76 Ga0070672_100000091 3300005543 Bacteria 44187
77 Ga0070672_100334086 3300005543 Bacteria 1290
78 Ga0070686_100138695 3300005544 Bacteria 1690
79 Ga0070695_100170227 3300005545 Bacteria 1536
80 Ga0070693_100024199 3300005547 Bacteria 3254
81 Ga0070693_100718691 3300005547 Unclassified 733
82 Ga0070665_100000244 3300005548 Bacteria 90284
83 Ga0070665_100110821 3300005548 Bacteria 2747
84 Ga0070665_100154033 3300005548 Bacteria 2300
85 Ga0070665_101882851 3300005548 Unclassified 604
86 Ga0070664_100079495 3300005564 Bacteria 2823
87 Ga0070664_100962566 3300005564 Bacteria 802
88 Ga0068854_100000031 3300005578 Bacteria 107298
89 Ga0068854_100102023 3300005578 Bacteria 2152
90 Ga0068856_100001194 3300005614 Bacteria 27371
91 Ga0068856_100299042 3300005614 Bacteria 1627
92 Ga0068856_101389986 3300005614 Unclassified 716
93 Ga0070702_100032719 3300005615 Bacteria 2855
94 Ga0068852_100000296 3300005616 Bacteria 33429
95 Ga0068852_100109252 3300005616 Bacteria 2511
96 Ga0068864_100000045 3300005618 Bacteria 154739
97 Ga0068864_100454660 3300005618 Bacteria 1225
98 Ga0068866_10000001 3300005718 Bacteria 519680
99 Ga0068866_10000031 3300005718 Bacteria 56943
100 Ga0068866_10087780 3300005718 Bacteria 1686
101 Ga0068861_100067065 3300005719 Bacteria 2768
102 Ga0068851_10000959 3300005834 Bacteria 12486
103 Ga0068851_10042907 3300005834 Bacteria 2278
104 Ga0068863_100000021 3300005841 Bacteria 198088
105 Ga0068863_100280529 3300005841 Bacteria 1614
106 Ga0068863_101161460 3300005841 Bacteria 777
107 Ga0068858_100000267 3300005842 Bacteria 55818
108 Ga0068858_100000590 3300005842 Bacteria 37996
109 Ga0068858_100066261 3300005842 Bacteria 3343
110 Ga0068860_100004861 3300005843 Bacteria 13698
111 Ga0068860_100100343 3300005843 Bacteria 2762
112 Ga0068860_100160572 3300005843 Bacteria 2167
113 Ga0068862_100000574 3300005844 Bacteria 38284
114 Ga0081455_10087654 3300005937 Bacteria 2532
115 Ga0081455_10137725 3300005937 Bacteria 1899
116 Ga0081540_1000006 3300005983 Bacteria 208724
117 Ga0081539_10001929 3300005985 Bacteria 31957
118 Ga0075365_10007580 3300006038 Bacteria 6094
119 Ga0075365_10164770 3300006038 Unclassified 1546
120 Ga0075365_10175589 3300006038 Bacteria 1496
121 Ga0075365_10264805 3300006038 Bacteria 1209
122 Ga0075365_10520433 3300006038 Bacteria 841
123 Ga0075368_10210043 3300006042 Bacteria 825
124 Ga0075363_100165762 3300006048 Bacteria 1253
125 Ga0075364_10097398 3300006051 Unclassified 1957
126 Ga0075364_10179647 3300006051 Bacteria 1431
127 Ga0075364_10235430 3300006051 Bacteria 1243
128 Ga0075364_10296896 3300006051 Bacteria 1100
129 Ga0075364_10508383 3300006051 Bacteria 824
130 Ga0070715_10000001 3300006163 Bacteria 693690
131 Ga0070715_10147483 3300006163 Bacteria 1149
132 Ga0070712_100000861 3300006175 Bacteria 18065
133 Ga0075370_10296481 3300006353 Bacteria 961
134 Ga0068871_100609973 3300006358 Bacteria 993
135 Ga0075428_100108905 3300006844 Bacteria 3019
136 Ga0075430_100038515 3300006846 Bacteria 4049
137 Ga0075431_100245030 3300006847 Bacteria 1822
138 Ga0075433_10001485 3300006852 Bacteria 17324
139 Ga0075433_10634438 3300006852 Unclassified 937
140 Ga0075434_100755453 3300006871 Bacteria 989
141 Ga0075434_100765805 3300006871 Bacteria 982
142 Ga0068865_100000104 3300006881 Bacteria 43423
143 Ga0075435_100151445 3300007076 Bacteria 1950
144 Ga0099795_10176397 3300007788 Bacteria 890
145 Ga0105240_10515788 3300009093 Unclassified 1327
146 Ga0111539_10287044 3300009094 Bacteria 1915
147 Ga0111539_10683862 3300009094 Bacteria 1194
148 Ga0105245_10000016 3300009098 Bacteria 204372
149 Ga0105245_10001174 3300009098 Bacteria 23711
150 Ga0105245_10012141 3300009098 Bacteria 7491
151 Ga0105245_10022734 3300009098 Bacteria 5503
152 Ga0105245_10338491 3300009098 Bacteria 1487
153 Ga0105245_10478092 3300009098 Bacteria 1259
154 Ga0105245_12844661 3300009098 Unclassified 536
155 Ga0105247_10031141 3300009101 Bacteria 3236
156 Ga0105247_10133146 3300009101 Bacteria 1622
157 Ga0105243_10013108 3300009148 Bacteria 6265
158 Ga0105241_10046390 3300009174 Bacteria 3300
159 Ga0105242_10000194 3300009176 Bacteria 47231
160 Ga0105242_10002493 3300009176 Bacteria 14435
161 Ga0105242_10012731 3300009176 Bacteria 6479
162 Ga0105242_10026007 3300009176 Bacteria 4636
163 Ga0105242_10410785 3300009176 Bacteria 1266
164 Ga0105242_10606584 3300009176 Bacteria 1058
165 Ga0105242_12805908 3300009176 Bacteria 537
166 Ga0105248_10000118 3300009177 Bacteria 90018
167 Ga0105248_10949567 3300009177 Bacteria 971
168 Ga0105248_11707398 3300009177 Unclassified 714
169 Ga0105237_10297220 3300009545 Bacteria 1618
170 Ga0105238_10000011 3300009551 Bacteria 261080
171 Ga0105238_10696161 3300009551 Bacteria 1028
172 Ga0105249_10000068 3300009553 Bacteria 148594
173 Ga0105249_10002838 3300009553 Bacteria 14953
174 Ga0105249_10223344 3300009553 Bacteria 1854
175 Ga0105239_10533398 3300010375 Bacteria 1336
176 Ga0105246_10248540 3300011119 Bacteria 1410
177 Ga0157371_10067585 3300013102 Bacteria 2530
178 Ga0157370_10010547 3300013104 Bacteria 9730
179 Ga0157370_10016083 3300013104 Bacteria 7584
180 Ga0157370_10178725 3300013104 Bacteria 1972
181 Ga0157369_10001239 3300013105 Bacteria 31838
182 Ga0157374_10001108 3300013296 Bacteria 23187
183 Ga0157374_10684732 3300013296 Unclassified 1038
184 Ga0157374_11096164 3300013296 Bacteria 817
185 Ga0157374_11226299 3300013296 Bacteria 772
186 Ga0157378_10014344 3300013297 Bacteria 6939
187 Ga0157378_10098803 3300013297 Bacteria 2662
188 Ga0157378_10507637 3300013297 Unclassified 1205
189 Ga0163162_10557094 3300013306 Unclassified 1274
190 Ga0157372_10000409 3300013307 Bacteria 47021
191 Ga0157372_12639357 3300013307 Bacteria 576
192 Ga0157375_10000112 3300013308 Bacteria 79146
193 Ga0157375_10010730 3300013308 Bacteria 8073
194 Ga0157375_10026721 3300013308 Bacteria 5385
195 Ga0157375_11309357 3300013308 Unclassified 852
196 Ga0163163_11173504 3300014325 Unclassified 830
197 Ga0163163_11495499 3300014325 Bacteria 737
198 Ga0157380_10000815 3300014326 Bacteria 19534
199 Ga0157380_10005360 3300014326 Bacteria 8963
200 Ga0157377_10429215 3300014745 Bacteria 907
201 Ga0157379_10017130 3300014968 Bacteria 6380
202 Ga0157379_10090784 3300014968 Bacteria 2740
203 Ga0157379_10668770 3300014968 Bacteria 973
204 Ga0157379_11446140 3300014968 Bacteria 667
205 Ga0157376_10392911 3300014969 Bacteria 1339
206 Ga0157376_10557825 3300014969 Bacteria 1134
207 Ga0157376_10884652 3300014969 Bacteria 910
208 Ga0157376_11790415 3300014969 Bacteria 650
209 Ga0163161_10000032 3300017792 Bacteria 165511
210 Ga0163161_10028383 3300017792 Bacteria 3974
211 Ga0206356_10092693 3300020070 Bacteria 1668
212 Ga0213876_10006509 3300021384 Bacteria 6366
213 Ga0207656_10000116 3300025321 Bacteria 30697
214 Ga0207656_10015276 3300025321 Bacteria 2969
215 Ga0207682_10000557 3300025893 Bacteria 17207
216 Ga0207642_10000031 3300025899 Bacteria 45198
217 Ga0207642_10000034 3300025899 Bacteria 43362
218 Ga0207642_10071601 3300025899 Bacteria 1652
219 Ga0207710_10000158 3300025900 Bacteria 72527
220 Ga0207710_10068473 3300025900 Bacteria 1623
221 Ga0207710_10151792 3300025900 Unclassified 1124
222 Ga0207680_10010482 3300025903 Bacteria 4638
223 Ga0207647_10239817 3300025904 Bacteria 1041
224 Ga0207685_10001023 3300025905 Bacteria 5453
225 Ga0207705_10471049 3300025909 Bacteria 975
226 Ga0207654_10068678 3300025911 Bacteria 2097
227 Ga0207707_10316588 3300025912 Bacteria 1348
228 Ga0207693_10001956 3300025915 Bacteria 18065
229 Ga0207663_10016385 3300025916 Bacteria 4109
230 Ga0207657_10633040 3300025919 Bacteria 833
231 Ga0207649_10000063 3300025920 Bacteria 96360
232 Ga0207649_10114915 3300025920 Bacteria 1805
233 Ga0207649_10270266 3300025920 Bacteria 1232
234 Ga0207652_10000483 3300025921 Bacteria 40881
235 Ga0207652_10016512 3300025921 Bacteria 6029
236 Ga0207681_10164246 3300025923 Bacteria 1677
237 Ga0207681_10708216 3300025923 Unclassified 837
238 Ga0207694_10000004 3300025924 Bacteria 967075
239 Ga0207650_10200390 3300025925 Bacteria 1599
240 Ga0207659_10000010 3300025926 Bacteria 286639
241 Ga0207659_10567371 3300025926 Bacteria 966
242 Ga0207687_10000007 3300025927 Bacteria 604185
243 Ga0207687_10000018 3300025927 Bacteria 236159
244 Ga0207687_10000247 3300025927 Bacteria 36785
245 Ga0207687_10083702 3300025927 Bacteria 2310
246 Ga0207687_10623102 3300025927 Bacteria 911
247 Ga0207700_10000025 3300025928 Bacteria 147429
248 Ga0207644_10049758 3300025931 Bacteria 3002
249 Ga0207690_10003697 3300025932 Bacteria 9103
250 Ga0207690_10666306 3300025932 Bacteria 854
251 Ga0207706_10000068 3300025933 Bacteria 105795
252 Ga0207706_10492894 3300025933 Bacteria 1058
253 Ga0207686_10000033 3300025934 Bacteria 143602
254 Ga0207686_10001608 3300025934 Bacteria 12650
255 Ga0207686_10011451 3300025934 Bacteria 4858
256 Ga0207686_10030935 3300025934 Bacteria 3175
257 Ga0207686_10373910 3300025934 Bacteria 1079
258 Ga0207686_10580000 3300025934 Bacteria 880
259 Ga0207709_10022268 3300025935 Bacteria 3593
260 Ga0207709_10199288 3300025935 Bacteria 1428
261 Ga0207670_10104300 3300025936 Bacteria 2031
262 Ga0207670_10111508 3300025936 Bacteria 1972
263 Ga0207669_10000004 3300025937 Bacteria 196828
264 Ga0207669_10000012 3300025937 Bacteria 138242
265 Ga0207704_10000146 3300025938 Bacteria 37894
266 Ga0207704_10467684 3300025938 Unclassified 1010
267 Ga0207691_10001039 3300025940 Bacteria 27535
268 Ga0207691_10419680 3300025940 Bacteria 1140
269 Ga0207711_10000020 3300025941 Bacteria 363325
270 Ga0207711_10873339 3300025941 Bacteria 837
271 Ga0207689_10226011 3300025942 Bacteria 1547
272 Ga0207661_10000095 3300025944 Bacteria 56458
273 Ga0207661_10006791 3300025944 Bacteria 8108
274 Ga0207661_10039585 3300025944 Bacteria 3701
275 Ga0207661_10194494 3300025944 Bacteria 1780
276 Ga0207661_10589589 3300025944 Bacteria 1020
277 Ga0207679_10058121 3300025945 Bacteria 2864
278 Ga0207679_10084869 3300025945 Bacteria 2431
279 Ga0207651_10009892 3300025960 Bacteria 5249
280 Ga0207651_10302916 3300025960 Bacteria 1330
281 Ga0207712_10000007 3300025961 Bacteria 539589
282 Ga0207712_10004331 3300025961 Bacteria 8966
283 Ga0207712_10405647 3300025961 Bacteria 1147
284 Ga0207640_10000015 3300025981 Bacteria 215411
285 Ga0207640_10078284 3300025981 Bacteria 2250
286 Ga0207658_10007907 3300025986 Bacteria 7243
287 Ga0207658_10019385 3300025986 Bacteria 4705
288 Ga0207658_10066688 3300025986 Bacteria 2708
289 Ga0207658_10312659 3300025986 Bacteria 1357
290 Ga0207658_10414065 3300025986 Unclassified 1187
291 Ga0207677_10000654 3300026023 Bacteria 20750
292 Ga0207703_10000020 3300026035 Bacteria 251603
293 Ga0207703_10000040 3300026035 Bacteria 168191
294 Ga0207639_10005159 3300026041 Bacteria 8807
295 Ga0207639_10703153 3300026041 Bacteria 938
296 Ga0207678_10002913 3300026067 Bacteria 15518
297 Ga0207678_10058376 3300026067 Bacteria 3320
298 Ga0207678_10654020 3300026067 Bacteria 923
299 Ga0207708_10242567 3300026075 Bacteria 1450
300 Ga0207708_10269015 3300026075 Bacteria 1378
301 Ga0207702_10000607 3300026078 Bacteria 39638
302 Ga0207702_10008495 3300026078 Bacteria 8661
303 Ga0207702_10008687 3300026078 Bacteria 8567
304 Ga0207641_10000151 3300026088 Bacteria 99225
305 Ga0207641_10098430 3300026088 Bacteria 2572
306 Ga0207641_10485255 3300026088 Bacteria 1198
307 Ga0207641_10785370 3300026088 Bacteria 941
308 Ga0207648_10000848 3300026089 Bacteria 34516
309 Ga0207676_10000016 3300026095 Bacteria 311561
310 Ga0207675_100095533 3300026118 Bacteria 2797
311 Ga0207675_100168665 3300026118 Bacteria 2091
312 Ga0207683_10025316 3300026121 Bacteria 5119
313 Ga0207683_11573880 3300026121 Bacteria 606
314 Ga0207698_10000012 3300026142 Bacteria 260061
315 Ga0207698_10064404 3300026142 Bacteria 2873
316 Ga0209179_1051211 3300027512 Bacteria 885
317 Ga0268266_10000020 3300028379 Bacteria 527065
318 Ga0268266_10000085 3300028379 Bacteria 201288
319 Ga0268266_10002765 3300028379 Bacteria 18329
320 Ga0268266_10018111 3300028379 Bacteria 6004
321 Ga0268266_10074048 3300028379 Bacteria 2957
322 Ga0268266_10274707 3300028379 Bacteria 1565
323 Ga0268266_10915252 3300028379 Bacteria 848
324 Ga0268265_10000555 3300028380 Bacteria 38092
325 Ga0268264_10001865 3300028381 Bacteria 19155
326 Ga0268264_10049545 3300028381 Bacteria 3495
327 Ga0268264_10258869 3300028381 Bacteria 1620
328 Ga0268264_10628640 3300028381 Bacteria 1061
329 Ga0265337_1000002 3300028556 Bacteria 139247
330 Ga0265326_10000007 3300028558 Bacteria 223057
331 Ga0265319_1000025 3300028563 Bacteria 142639
332 Ga0265334_10138385 3300028573 Bacteria 863
333 Ga0265322_10000001 3300028654 Bacteria 543854
334 Ga0265336_10002423 3300028666 Bacteria 7697
335 Ga0265338_10000486 3300028800 Bacteria 70900
336 Ga0265324_10001406 3300029957 Bacteria 13852
337 Ga0265332_10013614 3300031238 Bacteria 3603
338 Ga0265328_10004948 3300031239 Bacteria 5739
339 Ga0265320_10000002 3300031240 Bacteria 542875
340 Ga0265325_10011240 3300031241 Bacteria 5148
341 Ga0265331_10001248 3300031250 Bacteria 19076
342 Ga0265331_10085751 3300031250 Bacteria 1459
343 Ga0265327_10000011 3300031251 Bacteria 543807
344 Ga0265327_10284169 3300031251 Bacteria 731
345 Ga0265316_10130135 3300031344 Bacteria 1896
346 Ga0265313_10056508 3300031595 Bacteria 1856
347 Ga0265314_10000058 3300031711 Bacteria 167476
348 Ga0265342_10112891 3300031712 Bacteria 1536
349 Ga0316576_10009403 3300031727 Bacteria 6304
350 Ga0316578_10207131 3300031728 Bacteria 1180
351 Ga0307413_10045212 3300031824 Bacteria 2608
352 Ga0307406_10036814 3300031901 Bacteria 3017
353 Ga0307406_10157073 3300031901 Bacteria 1630
354 Ga0307407_10143276 3300031903 Bacteria 1544
355 Ga0307412_10581902 3300031911 Bacteria 945
356 Ga0307409_100251698 3300031995 Bacteria 1615
357 Ga0307416_100482072 3300032002 Bacteria 1300
358 Ga0307411_10095772 3300032005 Bacteria 2085
359 Ga0307415_100186306 3300032126 Bacteria 1633
360 Ga0307415_101108797 3300032126 Bacteria 741
361 Ga0316574_0014874 3300035398 Bacteria 4505
362 Ga0373937_0026804 3300036401 Bacteria 5209
363 Ga0373937_1046409 3300036401 Bacteria 765
364 Ga0316584_0000602 3300036712 Bacteria 19510
365 Ga0395900_0334952 3300037418 Bacteria 1490
366 Ga0395898_0650224 3300037466 Bacteria 997
367 Ga0395905_1399238 3300037471 Unclassified 604
368 Ga0395901_0113640 3300038443 Bacteria 2844
369 Ga0395901_0843364 3300038443 Bacteria 902
370 Ga0436365_1172353 3300039437 Bacteria 694
371 Ga0451791_0943522 3300041451 Bacteria 776
372 Ga0451798_0221974 3300041458 Bacteria 521
373 Ga0451800_0460762 3300041459 Bacteria 1178
374 Ga0451804_1141688 3300041463 Bacteria 939
375 Ga0451807_0132026 3300041486 Bacteria 590
376 Ga0451807_1153546 3300041486 Bacteria 708
377 Ga0451839_0784527 3300041496 Bacteria 1273
378 Ga0451849_0101462 3300041505 Bacteria 1053
379 Ga0451853_1663165 3300041512 Bacteria 1001
380 Ga0451853_3370634 3300041512 Bacteria 1491
381 Ga0466966_0070471 3300044684 Bacteria 2192
382 Ga0466966_0139209 3300044684 Bacteria 1484
383 Ga0466961_0030779 3300044693 Bacteria 3448
384 Ga0466963_0000282 3300044694 Bacteria 22761
385 Ga0466963_0047615 3300044694 Bacteria 2830
386 Ga0466970_0259807 3300044765 Bacteria 974
387 Ga0466957_0000505 3300044842 Bacteria 19584
388 Ga0466957_1236977 3300044842 Bacteria 541
389 Ga0466960_0086457 3300044901 Bacteria 1590
390 Ga0466959_0074369 3300045049 Bacteria 2457
391 Ga0466958_0053807 3300045836 Bacteria 2441
392 Ga0466958_0232421 3300045836 Bacteria 1177
393 Ga0466967_0000027 3300045976 Bacteria 64265
394 Ga0466967_0015351 3300045976 Bacteria 6000
395 Ga0466967_0190424 3300045976 Bacteria 1938
396 Ga0466967_2600135 3300045976 Bacteria 501
397 Ga0495592_0000036 3300046454 Bacteria 125461
398 Ga0495592_0065899 3300046454 Bacteria 2651
399 Ga0495592_0254161 3300046454 Bacteria 1160
400 Ga0495592_0302439 3300046454 Bacteria 1039
401 Ga0495603_0000030 3300046455 Bacteria 60760
402 Ga0495603_0001449 3300046455 Bacteria 13793
403 Ga0495603_0010404 3300046455 Bacteria 5634
404 Ga0495591_033913 3300046458 Bacteria 1507
405 Ga0495629_0000189 3300046459 Bacteria 55743
406 Ga0495629_0000801 3300046459 Bacteria 25450
407 Ga0495629_0009458 3300046459 Bacteria 7130
408 Ga0495629_0232952 3300046459 Bacteria 1269
409 Ga0495638_0018430 3300046460 Bacteria 4636
410 Ga0495641_0000003 3300046461 Bacteria 242879
411 Ga0495641_0020001 3300046461 Bacteria 3409
412 Ga0495641_0128647 3300046461 Bacteria 1130
413 Ga0495651_0099628 3300046462 Bacteria 2167
414 Ga0495651_0104239 3300046462 Bacteria 2106
415 Ga0495651_0137588 3300046462 Bacteria 1775
416 Ga0495653_0024689 3300046463 Bacteria 4839
417 Ga0495653_0113162 3300046463 Bacteria 1947
418 Ga0495653_0161989 3300046463 Bacteria 1552
419 Ga0495653_0173474 3300046463 Bacteria 1486
420 Ga0495653_0373362 3300046463 Bacteria 912
421 Ga0495582_0000029 3300046473 Bacteria 77919
422 Ga0495639_0185199 3300046475 Unclassified 1015
423 Ga0495662_0001090 3300046476 Bacteria 13354
424 Ga0495662_0011508 3300046476 Bacteria 4323
425 Ga0495662_0312919 3300046476 Bacteria 772
426 Ga0495664_0290237 3300046477 Bacteria 988
427 Ga0495594_0000003 3300046499 Bacteria 199267
428 Ga0495594_0613284 3300046499 Unclassified 617
429 Ga0495596_0247532 3300046500 Bacteria 692
430 Ga0495606_0000221 3300046507 Bacteria 101157
431 Ga0495608_0000189 3300046511 Bacteria 43800
432 Ga0495608_0000305 3300046511 Bacteria 34510
433 Ga0495608_0005739 3300046511 Bacteria 8857
434 Ga0495608_0044964 3300046511 Bacteria 2945
435 Ga0495608_0091569 3300046511 Bacteria 1966
436 Ga0495618_0001080 3300046514 Bacteria 18551
437 Ga0495620_0000210 3300046515 Bacteria 44013
438 Ga0495620_0280640 3300046515 Bacteria 634
439 Ga0495628_0000144 3300046516 Bacteria 61254
440 Ga0495628_0002445 3300046516 Bacteria 16746
441 Ga0495628_0043803 3300046516 Bacteria 3563
442 Ga0495628_0070641 3300046516 Bacteria 2722
443 Ga0495628_0091636 3300046516 Bacteria 2352
444 Ga0495628_0118502 3300046516 Bacteria 2032
445 Ga0495628_0752376 3300046516 Bacteria 685
446 Ga0495630_0000018 3300046517 Bacteria 186064
447 Ga0495630_0013185 3300046517 Bacteria 6009
448 Ga0495630_0015188 3300046517 Bacteria 5619
449 Ga0495630_0017005 3300046517 Bacteria 5323
450 Ga0495630_0201118 3300046517 Bacteria 1520
451 Ga0495630_1038290 3300046517 Bacteria 622
452 Ga0495632_0138251 3300046519 Bacteria 1131
453 Ga0495637_0162884 3300046520 Bacteria 836
454 Ga0495644_0004801 3300046523 Bacteria 5311
455 Ga0495652_0000019 3300046529 Bacteria 190248
456 Ga0495652_0017587 3300046529 Bacteria 6378
457 Ga0495652_0168745 3300046529 Bacteria 1691
458 Ga0495652_0975175 3300046529 Unclassified 556
459 Ga0495640_0059087 3300046533 Bacteria 2613
460 Ga0495640_0084193 3300046533 Unclassified 2110
461 Ga0495640_0510064 3300046533 Bacteria 731
462 Ga0495586_0001014 3300046535 Bacteria 15853
463 Ga0495587_0003399 3300046536 Bacteria 10621
464 Ga0495587_0013375 3300046536 Bacteria 5159
465 Ga0495587_0142412 3300046536 Bacteria 1368
466 Ga0495587_0152292 3300046536 Bacteria 1318
467 Ga0495587_0205171 3300046536 Unclassified 1114
468 Ga0495598_0001175 3300046537 Bacteria 5060
469 Ga0495621_0007201 3300046539 Bacteria 3285
470 Ga0495645_0008291 3300046543 Bacteria 7252
471 Ga0495622_0000714 3300046557 Bacteria 18760
472 Ga0495667_0000032 3300046559 Bacteria 143493
473 Ga0495667_0060268 3300046559 Unclassified 2489
474 Ga0495656_0007393 3300046615 Bacteria 3880
475 Ga0495634_0000401 3300046642 Bacteria 42619
476 Ga0495634_0000801 3300046642 Bacteria 30517
477 Ga0495634_0022201 3300046642 Bacteria 4474
478 Ga0495634_0068652 3300046642 Bacteria 2341
479 Ga0495634_0207519 3300046642 Bacteria 1214
480 Ga0495625_0000766 3300046660 Bacteria 44778
481 Ga0495635_0000016 3300046663 Bacteria 214088
482 Ga0495635_0011612 3300046663 Bacteria 6174
483 Ga0495635_0159726 3300046663 Bacteria 1534
484 Ga0495635_0162253 3300046663 Unclassified 1521
485 Ga0495588_0000274 3300046674 Bacteria 39224
486 Ga0495588_0167166 3300046674 Unclassified 1163
487 Ga0495657_0000004 3300046675 Bacteria 266465
488 Ga0495657_0011664 3300046675 Bacteria 6559
489 Ga0495657_0031495 3300046675 Bacteria 3707
490 Ga0495647_0000054 3300046681 Bacteria 30734
491 Ga0495647_0001792 3300046681 Bacteria 6638
492 Ga0495647_0052774 3300046681 Bacteria 1584
493 Ga0495647_0103561 3300046681 Bacteria 1181
494 Ga0495658_0000026 3300046683 Bacteria 77681
495 Ga0495658_0014198 3300046683 Bacteria 4064
496 Ga0495658_0314478 3300046683 Bacteria 992
497 Ga0495669_0000088 3300046684 Bacteria 61314
498 Ga0495613_0000370 3300046689 Bacteria 38906
499 Ga0495613_0000577 3300046689 Bacteria 29814
500 Ga0495613_0283519 3300046689 Bacteria 1150
501 Ga0495613_0284376 3300046689 Bacteria 1148
502 Ga0495613_0325635 3300046689 Bacteria 1060
503 Ga0495613_0674461 3300046689 Bacteria 682
504 Ga0495624_0000008 3300046690 Bacteria 145035
505 Ga0495624_0001409 3300046690 Bacteria 18746
506 Ga0495624_0002494 3300046690 Bacteria 13951
507 Ga0495624_0236104 3300046690 Bacteria 1107
508 Ga0495670_0016652 3300046691 Bacteria 3615
509 Ga0495649_0003647 3300046694 Bacteria 10273
510 Ga0495600_0001624 3300046809 Bacteria 12542
511 Ga0495600_0044263 3300046809 Bacteria 2905
512 Ga0495600_0089123 3300046809 Unclassified 2012
513 Ga0495600_0217382 3300046809 Bacteria 1223
514 Ga0495600_0700942 3300046809 Bacteria 609
515 Ga0495604_0000019 3300047317 Bacteria 175064
516 Ga0495604_0003700 3300047317 Bacteria 12179
517 Ga0495604_0066021 3300047317 Unclassified 2753
518 Ga0495604_0316450 3300047317 Unclassified 1044
519 Ga0495674_0000251 3300047319 Bacteria 45351
520 Ga0495674_0566594 3300047319 Bacteria 903
521 Ga0495672_0199335 3300047320 Bacteria 1002
522 Ga0495676_0010037 3300047321 Bacteria 8600
523 Ga0495676_0038905 3300047321 Bacteria 3946
524 Ga0495676_0051454 3300047321 Bacteria 3295
525 Ga0495676_0111822 3300047321 Bacteria 2003
526 Ga0495676_0154115 3300047321 Bacteria 1632
527 Ga0495676_0491861 3300047321 Bacteria 806
528 Ga0495676_0533824 3300047321 Bacteria 768
529 Ga0495680_0000317 3300047322 Bacteria 53949
530 Ga0495680_0000647 3300047322 Bacteria 39030
531 Ga0495680_0007802 3300047322 Bacteria 9773
532 Ga0495680_0341178 3300047322 Unclassified 1045
533 Ga0495675_0001341 3300047444 Bacteria 14909
534 Ga0495675_0026270 3300047444 Bacteria 3713
535 Ga0495679_015031 3300047446 Bacteria 2844
536 Ga0495679_191165 3300047446 Bacteria 540
537 Ga0495684_0238650 3300047471 Bacteria 1327
538 Ga0495684_0282424 3300047471 Unclassified 1197
539 Ga0495686_0034881 3300047472 Bacteria 3237
540 Ga0495593_0006348 3300047673 Bacteria 6937
541 Ga0495602_0000021 3300048088 Bacteria 168585
542 Ga0495602_0015275 3300048088 Bacteria 7755
543 Ga0495602_0130660 3300048088 Bacteria 2004
544 Ga0495602_0215104 3300048088 Bacteria 1455
545 Ga0495602_0280991 3300048088 Bacteria 1226
546 Ga0495602_0587806 3300048088 Bacteria 767
547 Ga0495614_0012964 3300048089 Bacteria 3655
548 Ga0496100_0000002 3300048903 Bacteria 489057
549 Ga0496100_0000018 3300048903 Bacteria 162451
550 Ga0496100_1477223 3300048903 Bacteria 537
551 Ga0496101_0000001 3300048904 Bacteria 489057
552 Ga0496101_0000308 3300048904 Bacteria 33852
553 Ga0496102_0000039 3300048905 Bacteria 198306
554 Ga0496102_0089336 3300048905 Bacteria 2850
555 Ga0496102_0264686 3300048905 Bacteria 1621
556 Ga0496102_1083683 3300048905 Bacteria 721
557 Ga0496102_1269716 3300048905 Bacteria 656
558 Ga0496103_0000008 3300048906 Bacteria 340474
559 Ga0496103_0089068 3300048906 Bacteria 1946
560 Ga0496104_0000004 3300048907 Bacteria 641830
561 Ga0496104_0000009 3300048907 Bacteria 488055
562 Ga0496104_0000129 3300048907 Bacteria 69982
563 Ga0496104_0182436 3300048907 Bacteria 2009
564 Ga0496104_1215502 3300048907 Bacteria 657
565 Ga0496105_0000001 3300048908 Bacteria 1328178
566 Ga0496105_0000027 3300048908 Bacteria 148197
567 Ga0496105_0000511 3300048908 Bacteria 25595
568 Ga0496105_0008230 3300048908 Bacteria 8106
569 Ga0496105_0014230 3300048908 Bacteria 6332
570 Ga0496105_0422647 3300048908 Bacteria 1055
571 Ga0496106_0000081 3300048909 Bacteria 76468
572 Ga0496106_0000098 3300048909 Bacteria 66098
573 Ga0496106_0000229 3300048909 Bacteria 39124
574 Ga0496106_0078856 3300048909 Bacteria 2528
575 Ga0496106_0210406 3300048909 Bacteria 1549
576 Ga0496107_0000006 3300048910 Bacteria 258746
577 Ga0496107_0000013 3300048910 Bacteria 178284
578 Ga0496107_0709230 3300048910 Bacteria 740
579 Ga0496108_0000001 3300048911 Bacteria 919044
580 Ga0496108_0000132 3300048911 Bacteria 73888
581 Ga0496108_0000630 3300048911 Bacteria 27529
582 Ga0496108_0042653 3300048911 Bacteria 3787
583 Ga0496108_0114695 3300048911 Bacteria 2307
584 Ga0496108_0165736 3300048911 Bacteria 1910
585 Ga0496108_0839882 3300048911 Bacteria 791
586 Ga0496109_0000003 3300048912 Bacteria 420862
587 Ga0496109_0000007 3300048912 Bacteria 247554
588 Ga0496109_0000028 3300048912 Bacteria 168138
589 Ga0496109_0000168 3300048912 Bacteria 64462
590 Ga0496109_0094874 3300048912 Bacteria 2762
591 Ga0496109_0596439 3300048912 Bacteria 1041
592 Ga0496109_0738918 3300048912 Bacteria 922
593 Ga0496110_0000492 3300048913 Bacteria 26887
594 Ga0496110_0018459 3300048913 Bacteria 5850
595 Ga0496110_0056188 3300048913 Bacteria 3464
596 Ga0496110_0363992 3300048913 Bacteria 1318
597 Ga0496111_0003195 3300048914 Bacteria 10108
598 Ga0496111_0031556 3300048914 Bacteria 3775
599 Ga0496111_0136876 3300048914 Bacteria 1814
600 Ga0496111_0196551 3300048914 Bacteria 1499
601 Ga0496111_0205415 3300048914 Bacteria 1464
602 Ga0496112_0000003 3300048915 Bacteria 660147
603 Ga0496112_0011739 3300048915 Bacteria 8020
604 Ga0496112_0163523 3300048915 Bacteria 2192
605 Ga0496112_0271352 3300048915 Bacteria 1645
606 Ga0496112_1410400 3300048915 Bacteria 611
607 Ga0496113_0000029 3300048916 Bacteria 61873
608 Ga0496113_0011781 3300048916 Bacteria 5856
609 Ga0496113_0021073 3300048916 Bacteria 4594
610 Ga0496113_0047500 3300048916 Bacteria 3190
611 Ga0496113_0071145 3300048916 Bacteria 2646
612 Ga0496113_0880026 3300048916 Unclassified 709
613 Ga0496113_1075718 3300048916 Bacteria 631
614 Ga0496114_0000014 3300048917 Bacteria 297902
615 Ga0496114_0113621 3300048917 Bacteria 2322
616 Ga0496114_0556382 3300048917 Bacteria 1013
617 Ga0496115_0000003 3300048918 Bacteria 354994
618 Ga0496115_0000828 3300048918 Bacteria 22654
619 Ga0496115_0023412 3300048918 Bacteria 4793
620 Ga0496116_0003216 3300048919 Bacteria 16307
621 Ga0496117_0007379 3300048920 Bacteria 10762
622 Ga0496117_0156799 3300048920 Bacteria 1339
623 Ga0496118_0009262 3300048921 Bacteria 9989
624 Ga0496118_0058765 3300048921 Bacteria 2870
625 Ga0496119_0004563 3300048922 Bacteria 13703
626 Ga0496119_0009421 3300048922 Bacteria 8385
627 Ga0496119_0022258 3300048922 Bacteria 4546
628 Ga0496119_0186383 3300048922 Bacteria 1084
629 Ga0496119_0311796 3300048922 Bacteria 772
630 Ga0496120_0038980 3300048923 Bacteria 2808
631 Ga0496120_0042949 3300048923 Bacteria 2637
632 Ga0496120_0335365 3300048923 Bacteria 683
633 Ga0496121_0018218 3300048924 Bacteria 7098
634 Ga0496121_0031743 3300048924 Bacteria 4818
635 Ga0496121_0108177 3300048924 Bacteria 2127
636 Ga0496121_0186024 3300048924 Bacteria 1494
637 Ga0496121_0313075 3300048924 Bacteria 1060
638 Ga0496124_0184910 3300048927 Bacteria 1600
639 Ga0496124_0187766 3300048927 Bacteria 1585
640 Ga0496124_0507460 3300048927 Unclassified 807
641 Ga0496125_0068748 3300048928 Bacteria 2784
642 Ga0496126_0024325 3300048929 Bacteria 5849
643 Ga0496126_0287100 3300048929 Bacteria 1361
644 Ga0501031_0003232 3300049568 Bacteria 10470
645 Ga0501032_0006009 3300049569 Bacteria 8953
646 Ga0501033_0001866 3300049570 Bacteria 18321
647 Ga0501034_0002092 3300049571 Bacteria 24942
648 Ga0501034_0005614 3300049571 Bacteria 13663
649 Ga0501034_0063638 3300049571 Bacteria 3702
650 Ga0501034_0321996 3300049571 Bacteria 1479
651 Ga0501034_0725009 3300049571 Unclassified 891
652 Ga0501034_1008738 3300049571 Bacteria 716
653 Ga0501036_0001911 3300049572 Bacteria 16200
654 Ga0501037_0001803 3300049573 Bacteria 15558
655 Ga0501038_0007182 3300049574 Bacteria 10296
656 Ga0501039_0129511 3300049575 Bacteria 1980
657 Ga0501039_0587375 3300049575 Bacteria 873
658 Ga0501040_0038891 3300049576 Bacteria 3235
659 Ga0501040_0172185 3300049576 Bacteria 1533
660 Ga0501040_0239664 3300049576 Bacteria 1293
661 Ga0501040_0499288 3300049576 Bacteria 877
662 Ga0501040_0539796 3300049576 Bacteria 841
663 Ga0501041_0234840 3300049577 Bacteria 1152
664 Ga0501042_0140822 3300049578 Bacteria 1739
665 Ga0501042_0235172 3300049578 Bacteria 1322
666 Ga0501042_0248255 3300049578 Bacteria 1284
667 Ga0501042_0272846 3300049578 Bacteria 1221
668 Ga0501043_0001784 3300049579 Bacteria 18501
669 Ga0501046_0000447 3300049580 Bacteria 41432
670 Ga0501047_0001305 3300049581 Bacteria 24582
671 Ga0501047_0011129 3300049581 Bacteria 8514
672 Ga0501047_0233390 3300049581 Bacteria 1692
673 Ga0501048_0004752 3300049582 Bacteria 10347
674 Ga0501048_0856107 3300049582 Unclassified 653
675 Ga0501067_0076446 3300049583 Bacteria 1855
676 Ga0501068_0033463 3300049584 Bacteria 3061
677 Ga0501068_0308531 3300049584 Unclassified 1013
678 Ga0501068_0870377 3300049584 Bacteria 592
679 Ga0501069_0004400 3300049585 Bacteria 7276
680 Ga0501069_0034969 3300049585 Bacteria 2766
681 Ga0501070_0010491 3300049586 Bacteria 7834
682 Ga0501070_0108970 3300049586 Bacteria 2288
683 Ga0501070_0275899 3300049586 Bacteria 1372
684 Ga0501071_0015488 3300049587 Bacteria 5236
685 Ga0501072_0055136 3300049588 Bacteria 3133
686 Ga0501072_0405066 3300049588 Bacteria 1082
687 Ga0501073_0004789 3300049589 Bacteria 10153
688 Ga0501074_0015719 3300049590 Bacteria 5503
689 Ga0501074_0024609 3300049590 Bacteria 4375
690 Ga0501074_0199429 3300049590 Bacteria 1426
691 Ga0501075_0000392 3300049591 Bacteria 25374
692 Ga0501075_0249342 3300049591 Bacteria 1353
693 Ga0501076_0099879 3300049592 Bacteria 2338
694 Ga0501077_0478258 3300049593 Bacteria 798
695 Ga0501079_0008691 3300049741 Bacteria 7703
696 Ga0501079_0353469 3300049741 Bacteria 1151
697 Ga0501079_0354803 3300049741 Bacteria 1149
698 Ga0501079_0476060 3300049741 Bacteria 981
699 Ga0501080_0006172 3300049742 Bacteria 10755
700 Ga0501080_0180265 3300049742 Bacteria 1944
701 Ga0501080_0928975 3300049742 Bacteria 757
702 Ga0501083_0013666 3300049744 Bacteria 5677
703 Ga0501035_0001414 3300049822 Bacteria 24605
704 Ga0501044_0004159 3300049823 Bacteria 16260
705 Ga0501044_0057870 3300049823 Bacteria 3977
706 Ga0501044_0071899 3300049823 Bacteria 3517
707 Ga0501044_0281433 3300049823 Bacteria 1597
708 Ga0501044_0569520 3300049823 Bacteria 1028
709 Ga0501045_0013976 3300049824 Bacteria 5682
710 nmdc:mga03n38_31261_c1 3300050490 Bacteria 2245
711 nmdc:mga00v17_138241_c1 3300050491 Bacteria 1561
712 nmdc:mga00v17_335550_c1 3300050491 Bacteria 983
713 nmdc:mga0yw44_333751_c1 3300050492 Unclassified 1019
714 nmdc:mga0yw44_345090_c1 3300050492 Unclassified 1002
715 nmdc:mga0yw44_399180_c1 3300050492 Bacteria 929
716 nmdc:mga0yw44_621268_c1 3300050492 Bacteria 734
717 nmdc:mga06z11_160116_c1 3300050494 Bacteria 1286
718 nmdc:mga06z11_238976_c1 3300050494 Bacteria 1066
719 nmdc:mga07m45_397734_c1 3300050496 Bacteria 800
720 nmdc:mga0qj67_18507_c1 3300050509 Bacteria 2502
721 nmdc:mga06r32_139202_c1 3300050510 Bacteria 2403
722 nmdc:mga06r32_452124_c1 3300050510 Bacteria 1264
723 nmdc:mga08y16_859110_c1 3300050511 Bacteria 896
724 nmdc:mga0n895_689813_c1 3300050512 Bacteria 1018
725 nmdc:mga0rr50_121797_c1 3300050513 Bacteria 2077
726 nmdc:mga0a205_11_c1 3300050515 Bacteria 121735
727 nmdc:mga0a205_1916_c1 3300050515 Bacteria 18075
728 Ga0495601_0000013 3300053077 Bacteria 226476
729 Ga0495601_0000375 3300053077 Bacteria 23634
730 Ga0495601_0005084 3300053077 Bacteria 7637
731 Ga0495601_0031282 3300053077 Bacteria 3307
732 Ga0495601_0045893 3300053077 Bacteria 2749
733 Ga0495601_0300703 3300053077 Unclassified 1045
734 Ga0495612_0000068 3300053078 Bacteria 47169
735 Ga0495612_0004329 3300053078 Bacteria 5886
736 Ga0495612_0014080 3300053078 Bacteria 3220
737 Ga0495612_0181178 3300053078 Bacteria 925
738 Ga0495655_0000001 3300053083 Bacteria 419518
739 Ga0495655_0000490 3300053083 Bacteria 6611
740 Ga0495595_0000003 3300053084 Bacteria 266465
741 Ga0495595_0000087 3300053084 Bacteria 43931
742 Ga0495595_0298648 3300053084 Unclassified 810
743 Ga0495595_0312641 3300053084 Unclassified 791
744 Ga0495595_0543539 3300053084 Bacteria 593
745 Ga0495619_0000021 3300053085 Bacteria 187095
746 Ga0495619_0000055 3300053085 Bacteria 95570
747 Ga0495619_0000686 3300053085 Bacteria 22138
748 Ga0495619_0000693 3300053085 Bacteria 22004
749 Ga0495619_0001229 3300053085 Bacteria 16759
750 Ga0495619_0001468 3300053085 Bacteria 15538
751 Ga0495619_0004285 3300053085 Bacteria 9094
752 Ga0495619_0006064 3300053085 Bacteria 7655
753 Ga0495619_0075869 3300053085 Bacteria 2256
754 Ga0495619_0501248 3300053085 Unclassified 835
755 Ga0500566_0065994 3300053094 Bacteria 2040
756 Ga0500641_0033819 3300053096 Bacteria 2032
757 Ga0500595_030412 3300053119 Bacteria 1819
758 Ga0500614_002777 3300053123 Bacteria 3860
759 Ga0500628_000065 3300053129 Bacteria 28526
760 Ga0500658_0280389 3300053134 Bacteria 766
761 Ga0501082_0006423 3300060353 Bacteria 10199
762 Ga0530510_0184486 3300061734 Unclassified 1548
763 2688392987 2687453341 Bacteria 6534136
764 Ga0466969_0083434
765 CNAas_1006854
766 JGI24746J21847_1005799
767 JGI24740J21852_10002815
768 JGI24034J26672_10005937
769 JGI25406J46586_10039637
770 Ga0065712_10069154
771 Ga0065707_10084840
772 Ga0070658_10077786
773 Ga0070683_100010078
774 Ga0070683_100011036
775 Ga0070683_100012140
776 Ga0070683_100030156
777 Ga0070683_100165039
778 Ga0070690_100049889
779 Ga0070670_100001805
780 Ga0070677_10000304
781 Ga0070666_10017281
782 Ga0070680_100228523
783 Ga0070682_100000013
784 Ga0070682_100000045
785 Ga0070682_100469466
786 Ga0068868_100000295
787 Ga0068868_100000932
788 Ga0070660_100363346
789 Ga0070660_101322907
790 Ga0070689_100105307
791 Ga0070689_100173254
792 Ga0070689_100557574
793 Ga0070689_100674281
794 Ga0070691_10149338
795 Ga0070661_100000023
796 Ga0070661_100161889
797 Ga0070692_10079068
798 Ga0070668_100029215
799 Ga0070669_100618199
800 Ga0070675_100000101
801 Ga0070671_100070694
802 Ga0070674_100000008
803 Ga0070674_100000420
804 Ga0070674_100159744
805 Ga0070688_100000630
806 Ga0070688_100009960
807 Ga0070659_100007823
808 Ga0070659_100929202
809 Ga0070667_100000695
810 Ga0070667_100016006
811 Ga0070667_100139585
812 Ga0070667_100323466
813 Ga0070713_100000009
814 Ga0070713_100255245
815 Ga0070710_10773292
816 Ga0070701_10686759
817 Ga0070711_100003211
818 Ga0070700_100162825
819 Ga0070663_100008028
820 Ga0070678_100016400
821 Ga0070678_100038206
822 Ga0070678_100047702
823 Ga0070662_100000016
824 Ga0070662_100475057
825 Ga0070681_10468870
826 Ga0068867_100000266
827 Ga0070685_10000282
828 Ga0070685_10000320
829 Ga0070685_10057809
830 Ga0070685_10324229
831 Ga0070685_10467575
832 Ga0070679_100000312
833 Ga0070679_100002552
834 Ga0070684_100030530
835 Ga0070684_100090451
836 Ga0070684_100164720
837 Ga0070684_100453830
838 Ga0068853_100003759
839 Ga0070672_100000091
840 Ga0070672_100334086
841 Ga0070686_100138695
842 Ga0070695_100170227
843 Ga0070693_100024199
844 Ga0070693_100718691
845 Ga0070665_100000244
846 Ga0070665_100110821
847 Ga0070665_100154033
848 Ga0070665_101882851
849 Ga0070664_100079495
850 Ga0070664_100962566
851 Ga0068854_100000031
852 Ga0068854_100102023
853 Ga0068856_100001194
854 Ga0068856_100299042
855 Ga0068856_101389986
856 Ga0070702_100032719
857 Ga0068852_100000296
858 Ga0068852_100109252
859 Ga0068864_100000045
860 Ga0068864_100454660
861 Ga0068866_10000001
862 Ga0068866_10000031
863 Ga0068866_10087780
864 Ga0068861_100067065
865 Ga0068851_10000959
866 Ga0068851_10042907
867 Ga0068863_100000021
868 Ga0068863_100280529
869 Ga0068863_101161460
870 Ga0068858_100000267
871 Ga0068858_100000590
872 Ga0068858_100066261
873 Ga0068860_100004861
874 Ga0068860_100100343
875 Ga0068860_100160572
876 Ga0068862_100000574
877 Ga0081455_10087654
878 Ga0081455_10137725
879 Ga0081540_1000006
880 Ga0081539_10001929
881 Ga0075365_10007580
882 Ga0075365_10164770
883 Ga0075365_10175589
884 Ga0075365_10264805
885 Ga0075365_10520433
886 Ga0075368_10210043
887 Ga0075363_100165762
888 Ga0075364_10097398
889 Ga0075364_10179647
890 Ga0075364_10235430
891 Ga0075364_10296896
892 Ga0075364_10508383
893 Ga0070715_10000001
894 Ga0070715_10147483
895 Ga0070712_100000861
896 Ga0075370_10296481
897 Ga0068871_100609973
898 Ga0075428_100108905
899 Ga0075430_100038515
900 Ga0075431_100245030
901 Ga0075433_10001485
902 Ga0075433_10634438
903 Ga0075434_100755453
904 Ga0075434_100765805
905 Ga0068865_100000104
906 Ga0075435_100151445
907 Ga0099795_10176397
908 Ga0105240_10515788
909 Ga0111539_10287044
910 Ga0111539_10683862
911 Ga0105245_10000016
912 Ga0105245_10001174
913 Ga0105245_10012141
914 Ga0105245_10022734
915 Ga0105245_10338491
916 Ga0105245_10478092
917 Ga0105245_12844661
918 Ga0105247_10031141
919 Ga0105247_10133146
920 Ga0105243_10013108
921 Ga0105241_10046390
922 Ga0105242_10000194
923 Ga0105242_10002493
924 Ga0105242_10012731
925 Ga0105242_10026007
926 Ga0105242_10410785
927 Ga0105242_10606584
928 Ga0105242_12805908
929 Ga0105248_10000118
930 Ga0105248_10949567
931 Ga0105248_11707398
932 Ga0105237_10297220
933 Ga0105238_10000011
934 Ga0105238_10696161
935 Ga0105249_10000068
936 Ga0105249_10002838
937 Ga0105249_10223344
938 Ga0105239_10533398
939 Ga0105246_10248540
940 Ga0157371_10067585
941 Ga0157370_10010547
942 Ga0157370_10016083
943 Ga0157370_10178725
944 Ga0157369_10001239
945 Ga0157374_10001108
946 Ga0157374_10684732
947 Ga0157374_11096164
948 Ga0157374_11226299
949 Ga0157378_10014344
950 Ga0157378_10098803
951 Ga0157378_10507637
952 Ga0163162_10557094
953 Ga0157372_10000409
954 Ga0157372_12639357
955 Ga0157375_10000112
956 Ga0157375_10010730
957 Ga0157375_10026721
958 Ga0157375_11309357
959 Ga0163163_11173504
960 Ga0163163_11495499
961 Ga0157380_10000815
962 Ga0157380_10005360
963 Ga0157377_10429215
964 Ga0157379_10017130
965 Ga0157379_10090784
966 Ga0157379_10668770
967 Ga0157379_11446140
968 Ga0157376_10392911
969 Ga0157376_10557825
970 Ga0157376_10884652
971 Ga0157376_11790415
972 Ga0163161_10000032
973 Ga0163161_10028383
974 Ga0206356_10092693
975 Ga0213876_10006509
976 Ga0207656_10000116
977 Ga0207656_10015276
978 Ga0207682_10000557
979 Ga0207642_10000031
980 Ga0207642_10000034
981 Ga0207642_10071601
982 Ga0207710_10000158
983 Ga0207710_10068473
984 Ga0207710_10151792
985 Ga0207680_10010482
986 Ga0207647_10239817
987 Ga0207685_10001023
988 Ga0207705_10471049
989 Ga0207654_10068678
990 Ga0207707_10316588
991 Ga0207693_10001956
992 Ga0207663_10016385
993 Ga0207657_10633040
994 Ga0207649_10000063
995 Ga0207649_10114915
996 Ga0207649_10270266
997 Ga0207652_10000483
998 Ga0207652_10016512
999 Ga0207681_10164246
1000 Ga0207681_10708216
1001 Ga0207694_10000004
1002 Ga0207650_10200390
1003 Ga0207659_10000010
1004 Ga0207659_10567371
1005 Ga0207687_10000007
1006 Ga0207687_10000018
1007 Ga0207687_10000247
1008 Ga0207687_10083702
1009 Ga0207687_10623102
1010 Ga0207700_10000025
1011 Ga0207644_10049758
1012 Ga0207690_10003697
1013 Ga0207690_10666306
1014 Ga0207706_10000068
1015 Ga0207706_10492894
1016 Ga0207686_10000033
1017 Ga0207686_10001608
1018 Ga0207686_10011451
1019 Ga0207686_10030935
1020 Ga0207686_10373910
1021 Ga0207686_10580000
1022 Ga0207709_10022268
1023 Ga0207709_10199288
1024 Ga0207670_10104300
1025 Ga0207670_10111508
1026 Ga0207669_10000004
1027 Ga0207669_10000012
1028 Ga0207704_10000146
1029 Ga0207704_10467684
1030 Ga0207691_10001039
1031 Ga0207691_10419680
1032 Ga0207711_10000020
1033 Ga0207711_10873339
1034 Ga0207689_10226011
1035 Ga0207661_10000095
1036 Ga0207661_10006791
1037 Ga0207661_10039585
1038 Ga0207661_10194494
1039 Ga0207661_10589589
1040 Ga0207679_10058121
1041 Ga0207679_10084869
1042 Ga0207651_10009892
1043 Ga0207651_10302916
1044 Ga0207712_10000007
1045 Ga0207712_10004331
1046 Ga0207712_10405647
1047 Ga0207640_10000015
1048 Ga0207640_10078284
1049 Ga0207658_10007907
1050 Ga0207658_10019385
1051 Ga0207658_10066688
1052 Ga0207658_10312659
1053 Ga0207658_10414065
1054 Ga0207677_10000654
1055 Ga0207703_10000020
1056 Ga0207703_10000040
1057 Ga0207639_10005159
1058 Ga0207639_10703153
1059 Ga0207678_10002913
1060 Ga0207678_10058376
1061 Ga0207678_10654020
1062 Ga0207708_10242567
1063 Ga0207708_10269015
1064 Ga0207702_10000607
1065 Ga0207702_10008495
1066 Ga0207702_10008687
1067 Ga0207641_10000151
1068 Ga0207641_10098430
1069 Ga0207641_10485255
1070 Ga0207641_10785370
1071 Ga0207648_10000848
1072 Ga0207676_10000016
1073 Ga0207675_100095533
1074 Ga0207675_100168665
1075 Ga0207683_10025316
1076 Ga0207683_11573880
1077 Ga0207698_10000012
1078 Ga0207698_10064404
1079 Ga0209179_1051211
1080 Ga0268266_10000020
1081 Ga0268266_10000085
1082 Ga0268266_10002765
1083 Ga0268266_10018111
1084 Ga0268266_10074048
1085 Ga0268266_10274707
1086 Ga0268266_10915252
1087 Ga0268265_10000555
1088 Ga0268264_10001865
1089 Ga0268264_10049545
1090 Ga0268264_10258869
1091 Ga0268264_10628640
1092 Ga0265337_1000002
1093 Ga0265326_10000007
1094 Ga0265319_1000025
1095 Ga0265334_10138385
1096 Ga0265322_10000001
1097 Ga0265336_10002423
1098 Ga0265338_10000486
1099 Ga0265324_10001406
1100 Ga0265332_10013614
1101 Ga0265328_10004948
1102 Ga0265320_10000002
1103 Ga0265325_10011240
1104 Ga0265331_10001248
1105 Ga0265331_10085751
1106 Ga0265327_10000011
1107 Ga0265327_10284169
1108 Ga0265316_10130135
1109 Ga0265313_10056508
1110 Ga0265314_10000058
1111 Ga0265342_10112891
1112 Ga0316576_10009403
1113 Ga0316578_10207131
1114 Ga0307413_10045212
1115 Ga0307406_10036814
1116 Ga0307406_10157073
1117 Ga0307407_10143276
1118 Ga0307412_10581902
1119 Ga0307409_100251698
1120 Ga0307416_100482072
1121 Ga0307411_10095772
1122 Ga0307415_100186306
1123 Ga0307415_101108797
1124 Ga0316574_0014874
1125 Ga0373937_0026804
1126 Ga0373937_1046409
1127 Ga0316584_0000602
1128 Ga0395900_0334952
1129 Ga0395898_0650224
1130 Ga0395905_1399238
1131 Ga0395901_0113640
1132 Ga0395901_0843364
1133 Ga0436365_1172353
1134 Ga0451791_0943522
1135 Ga0451798_0221974
1136 Ga0451800_0460762
1137 Ga0451804_1141688
1138 Ga0451807_0132026
1139 Ga0451807_1153546
1140 Ga0451839_0784527
1141 Ga0451849_0101462
1142 Ga0451853_1663165
1143 Ga0451853_3370634
1144 Ga0466966_0070471
1145 Ga0466966_0139209
1146 Ga0466961_0030779
1147 Ga0466963_0000282
1148 Ga0466963_0047615
1149 Ga0466970_0259807
1150 Ga0466957_0000505
1151 Ga0466957_1236977
1152 Ga0466960_0086457
1153 Ga0466959_0074369
1154 Ga0466958_0053807
1155 Ga0466958_0232421
1156 Ga0466967_0000027
1157 Ga0466967_0015351
1158 Ga0466967_0190424
1159 Ga0466967_2600135
1160 Ga0495592_0000036
1161 Ga0495592_0065899
1162 Ga0495592_0254161
1163 Ga0495592_0302439
1164 Ga0495603_0000030
1165 Ga0495603_0001449
1166 Ga0495603_0010404
1167 Ga0495591_033913
1168 Ga0495629_0000189
1169 Ga0495629_0000801
1170 Ga0495629_0009458
1171 Ga0495629_0232952
1172 Ga0495638_0018430
1173 Ga0495641_0000003
1174 Ga0495641_0020001
1175 Ga0495641_0128647
1176 Ga0495651_0099628
1177 Ga0495651_0104239
1178 Ga0495651_0137588
1179 Ga0495653_0024689
1180 Ga0495653_0113162
1181 Ga0495653_0161989
1182 Ga0495653_0173474
1183 Ga0495653_0373362
1184 Ga0495582_0000029
1185 Ga0495639_0185199
1186 Ga0495662_0001090
1187 Ga0495662_0011508
1188 Ga0495662_0312919
1189 Ga0495664_0290237
1190 Ga0495594_0000003
1191 Ga0495594_0613284
1192 Ga0495596_0247532
1193 Ga0495606_0000221
1194 Ga0495608_0000189
1195 Ga0495608_0000305
1196 Ga0495608_0005739
1197 Ga0495608_0044964
1198 Ga0495608_0091569
1199 Ga0495618_0001080
1200 Ga0495620_0000210
1201 Ga0495620_0280640
1202 Ga0495628_0000144
1203 Ga0495628_0002445
1204 Ga0495628_0043803
1205 Ga0495628_0070641
1206 Ga0495628_0091636
1207 Ga0495628_0118502
1208 Ga0495628_0752376
1209 Ga0495630_0000018
1210 Ga0495630_0013185
1211 Ga0495630_0015188
1212 Ga0495630_0017005
1213 Ga0495630_0201118
1214 Ga0495630_1038290
1215 Ga0495632_0138251
1216 Ga0495637_0162884
1217 Ga0495644_0004801
1218 Ga0495652_0000019
1219 Ga0495652_0017587
1220 Ga0495652_0168745
1221 Ga0495652_0975175
1222 Ga0495640_0059087
1223 Ga0495640_0084193
1224 Ga0495640_0510064
1225 Ga0495586_0001014
1226 Ga0495587_0003399
1227 Ga0495587_0013375
1228 Ga0495587_0142412
1229 Ga0495587_0152292
1230 Ga0495587_0205171
1231 Ga0495598_0001175
1232 Ga0495621_0007201
1233 Ga0495645_0008291
1234 Ga0495622_0000714
1235 Ga0495667_0000032
1236 Ga0495667_0060268
1237 Ga0495656_0007393
1238 Ga0495634_0000401
1239 Ga0495634_0000801
1240 Ga0495634_0022201
1241 Ga0495634_0068652
1242 Ga0495634_0207519
1243 Ga0495625_0000766
1244 Ga0495635_0000016
1245 Ga0495635_0011612
1246 Ga0495635_0159726
1247 Ga0495635_0162253
1248 Ga0495588_0000274
1249 Ga0495588_0167166
1250 Ga0495657_0000004
1251 Ga0495657_0011664
1252 Ga0495657_0031495
1253 Ga0495647_0000054
1254 Ga0495647_0001792
1255 Ga0495647_0052774
1256 Ga0495647_0103561
1257 Ga0495658_0000026
1258 Ga0495658_0014198
1259 Ga0495658_0314478
1260 Ga0495669_0000088
1261 Ga0495613_0000370
1262 Ga0495613_0000577
1263 Ga0495613_0283519
1264 Ga0495613_0284376
1265 Ga0495613_0325635
1266 Ga0495613_0674461
1267 Ga0495624_0000008
1268 Ga0495624_0001409
1269 Ga0495624_0002494
1270 Ga0495624_0236104
1271 Ga0495670_0016652
1272 Ga0495649_0003647
1273 Ga0495600_0001624
1274 Ga0495600_0044263
1275 Ga0495600_0089123
1276 Ga0495600_0217382
1277 Ga0495600_0700942
1278 Ga0495604_0000019
1279 Ga0495604_0003700
1280 Ga0495604_0066021
1281 Ga0495604_0316450
1282 Ga0495674_0000251
1283 Ga0495674_0566594
1284 Ga0495672_0199335
1285 Ga0495676_0010037
1286 Ga0495676_0038905
1287 Ga0495676_0051454
1288 Ga0495676_0111822
1289 Ga0495676_0154115
1290 Ga0495676_0491861
1291 Ga0495676_0533824
1292 Ga0495680_0000317
1293 Ga0495680_0000647
1294 Ga0495680_0007802
1295 Ga0495680_0341178
1296 Ga0495675_0001341
1297 Ga0495675_0026270
1298 Ga0495679_015031
1299 Ga0495679_191165
1300 Ga0495684_0238650
1301 Ga0495684_0282424
1302 Ga0495686_0034881
1303 Ga0495593_0006348
1304 Ga0495602_0000021
1305 Ga0495602_0015275
1306 Ga0495602_0130660
1307 Ga0495602_0215104
1308 Ga0495602_0280991
1309 Ga0495602_0587806
1310 Ga0495614_0012964
1311 Ga0496100_0000002
1312 Ga0496100_0000018
1313 Ga0496100_1477223
1314 Ga0496101_0000001
1315 Ga0496101_0000308
1316 Ga0496102_0000039
1317 Ga0496102_0089336
1318 Ga0496102_0264686
1319 Ga0496102_1083683
1320 Ga0496102_1269716
1321 Ga0496103_0000008
1322 Ga0496103_0089068
1323 Ga0496104_0000004
1324 Ga0496104_0000009
1325 Ga0496104_0000129
1326 Ga0496104_0182436
1327 Ga0496104_1215502
1328 Ga0496105_0000001
1329 Ga0496105_0000027
1330 Ga0496105_0000511
1331 Ga0496105_0008230
1332 Ga0496105_0014230
1333 Ga0496105_0422647
1334 Ga0496106_0000081
1335 Ga0496106_0000098
1336 Ga0496106_0000229
1337 Ga0496106_0078856
1338 Ga0496106_0210406
1339 Ga0496107_0000006
1340 Ga0496107_0000013
1341 Ga0496107_0709230
1342 Ga0496108_0000001
1343 Ga0496108_0000132
1344 Ga0496108_0000630
1345 Ga0496108_0042653
1346 Ga0496108_0114695
1347 Ga0496108_0165736
1348 Ga0496108_0839882
1349 Ga0496109_0000003
1350 Ga0496109_0000007
1351 Ga0496109_0000028
1352 Ga0496109_0000168
1353 Ga0496109_0094874
1354 Ga0496109_0596439
1355 Ga0496109_0738918
1356 Ga0496110_0000492
1357 Ga0496110_0018459
1358 Ga0496110_0056188
1359 Ga0496110_0363992
1360 Ga0496111_0003195
1361 Ga0496111_0031556
1362 Ga0496111_0136876
1363 Ga0496111_0196551
1364 Ga0496111_0205415
1365 Ga0496112_0000003
1366 Ga0496112_0011739
1367 Ga0496112_0163523
1368 Ga0496112_0271352
1369 Ga0496112_1410400
1370 Ga0496113_0000029
1371 Ga0496113_0011781
1372 Ga0496113_0021073
1373 Ga0496113_0047500
1374 Ga0496113_0071145
1375 Ga0496113_0880026
1376 Ga0496113_1075718
1377 Ga0496114_0000014
1378 Ga0496114_0113621
1379 Ga0496114_0556382
1380 Ga0496115_0000003
1381 Ga0496115_0000828
1382 Ga0496115_0023412
1383 Ga0496116_0003216
1384 Ga0496117_0007379
1385 Ga0496117_0156799
1386 Ga0496118_0009262
1387 Ga0496118_0058765
1388 Ga0496119_0004563
1389 Ga0496119_0009421
1390 Ga0496119_0022258
1391 Ga0496119_0186383
1392 Ga0496119_0311796
1393 Ga0496120_0038980
1394 Ga0496120_0042949
1395 Ga0496120_0335365
1396 Ga0496121_0018218
1397 Ga0496121_0031743
1398 Ga0496121_0108177
1399 Ga0496121_0186024
1400 Ga0496121_0313075
1401 Ga0496124_0184910
1402 Ga0496124_0187766
1403 Ga0496124_0507460
1404 Ga0496125_0068748
1405 Ga0496126_0024325
1406 Ga0496126_0287100
1407 Ga0501031_0003232
1408 Ga0501032_0006009
1409 Ga0501033_0001866
1410 Ga0501034_0002092
1411 Ga0501034_0005614
1412 Ga0501034_0063638
1413 Ga0501034_0321996
1414 Ga0501034_0725009
1415 Ga0501034_1008738
1416 Ga0501036_0001911
1417 Ga0501037_0001803
1418 Ga0501038_0007182
1419 Ga0501039_0129511
1420 Ga0501039_0587375
1421 Ga0501040_0038891
1422 Ga0501040_0172185
1423 Ga0501040_0239664
1424 Ga0501040_0499288
1425 Ga0501040_0539796
1426 Ga0501041_0234840
1427 Ga0501042_0140822
1428 Ga0501042_0235172
1429 Ga0501042_0248255
1430 Ga0501042_0272846
1431 Ga0501043_0001784
1432 Ga0501046_0000447
1433 Ga0501047_0001305
1434 Ga0501047_0011129
1435 Ga0501047_0233390
1436 Ga0501048_0004752
1437 Ga0501048_0856107
1438 Ga0501067_0076446
1439 Ga0501068_0033463
1440 Ga0501068_0308531
1441 Ga0501068_0870377
1442 Ga0501069_0004400
1443 Ga0501069_0034969
1444 Ga0501070_0010491
1445 Ga0501070_0108970
1446 Ga0501070_0275899
1447 Ga0501071_0015488
1448 Ga0501072_0055136
1449 Ga0501072_0405066
1450 Ga0501073_0004789
1451 Ga0501074_0015719
1452 Ga0501074_0024609
1453 Ga0501074_0199429
1454 Ga0501075_0000392
1455 Ga0501075_0249342
1456 Ga0501076_0099879
1457 Ga0501077_0478258
1458 Ga0501079_0008691
1459 Ga0501079_0353469
1460 Ga0501079_0354803
1461 Ga0501079_0476060
1462 Ga0501080_0006172
1463 Ga0501080_0180265
1464 Ga0501080_0928975
1465 Ga0501083_0013666
1466 Ga0501035_0001414
1467 Ga0501044_0004159
1468 Ga0501044_0057870
1469 Ga0501044_0071899
1470 Ga0501044_0281433
1471 Ga0501044_0569520
1472 Ga0501045_0013976
1473 nmdc:mga03n38_31261_c1
1474 nmdc:mga00v17_138241_c1
1475 nmdc:mga00v17_335550_c1
1476 nmdc:mga0yw44_333751_c1
1477 nmdc:mga0yw44_345090_c1
1478 nmdc:mga0yw44_399180_c1
1479 nmdc:mga0yw44_621268_c1
1480 nmdc:mga06z11_160116_c1
1481 nmdc:mga06z11_238976_c1
1482 nmdc:mga07m45_397734_c1
1483 nmdc:mga0qj67_18507_c1
1484 nmdc:mga06r32_139202_c1
1485 nmdc:mga06r32_452124_c1
1486 nmdc:mga08y16_859110_c1
1487 nmdc:mga0n895_689813_c1
1488 nmdc:mga0rr50_121797_c1
1489 nmdc:mga0a205_11_c1
1490 nmdc:mga0a205_1916_c1
1491 Ga0495601_0000013
1492 Ga0495601_0000375
1493 Ga0495601_0005084
1494 Ga0495601_0031282
1495 Ga0495601_0045893
1496 Ga0495601_0300703
1497 Ga0495612_0000068
1498 Ga0495612_0004329
1499 Ga0495612_0014080
1500 Ga0495612_0181178
1501 Ga0495655_0000001
1502 Ga0495655_0000490
1503 Ga0495595_0000003
1504 Ga0495595_0000087
1505 Ga0495595_0298648
1506 Ga0495595_0312641
1507 Ga0495595_0543539
1508 Ga0495619_0000021
1509 Ga0495619_0000055
1510 Ga0495619_0000686
1511 Ga0495619_0000693
1512 Ga0495619_0001229
1513 Ga0495619_0001468
1514 Ga0495619_0004285
1515 Ga0495619_0006064
1516 Ga0495619_0075869
1517 Ga0495619_0501248
1518 Ga0500566_0065994
1519 Ga0500641_0033819
1520 Ga0500595_030412
1521 Ga0500614_002777
1522 Ga0500628_000065
1523 Ga0500658_0280389
1524 Ga0501082_0006423
1525 Ga0530510_0184486
1526 2688392987

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

14

158

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.9724 15 134
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9327 14 130
1wjx-assembly1.cif.gz_A crystal sturucture of tt0801 from thermus thermophilus 0.9124 17 134
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9092 14 136
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.902 15 136
ID Description Score Start End Superfamily
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9247 11 136 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9204 18 134 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8971 11 136 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8831 18 134 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.7497 14 134 2.40.280.10
ID Description Score Start End GO Terms
AF-A0A7C2HUU9-F1-model_v4 SsrA-binding protein SmpB 0.9905 14 121 GO:0003723
GO:0005829
AF-A0A3D4QUW8-F1-model_v4 SsrA-binding protein 0.9892 14 120 GO:0003723
GO:0005829
AF-A7L9H9-F1-model_v4 SmpB 0.9815 29 130 GO:0003723
GO:0005829
AF-B6V881-F1-model_v4 SmpB 0.9799 23 126 GO:0003723
GO:0005829
AF-D3AUN1-F1-model_v4 SsrA-binding protein 0.9785 15 132 GO:0003723
GO:0005829

Map