F479698
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 763 | 357 | 1526 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0083434|Ga0466969_0083434_225_701 |
| Length | 158 |
| Sequence | MAKGKKRKAAPGDVATNRQASYRYNLIERFECGIELTGTEVKSLRETGAQLKDSYATIRDGEVWLIGAYIAPYAPASRENHDPERTRKLLLHRGEIERLIGRTKEKGLTLVPTRIYFSGTRSRAKVEIALASGKNLYDKRDTIRKREMARDIQRAMHE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 184 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 207 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 293 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 294 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 295 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 296 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 350 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 351 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 353 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 354 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 357 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.13 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.8 |
| Nodule | 0 |
| Rhizoplane | 10.22 |
| Rhizosphere | 81.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466969_0083434 | 3300044656 | Bacteria | 1522 |
| 2 | CNAas_1006854 | 3300000532 | Bacteria | 736 |
| 3 | JGI24746J21847_1005799 | 3300001977 | Bacteria | 1923 |
| 4 | JGI24740J21852_10002815 | 3300001979 | Bacteria | 7776 |
| 5 | JGI24034J26672_10005937 | 3300002239 | Bacteria | 1758 |
| 6 | JGI25406J46586_10039637 | 3300003203 | Bacteria | 1677 |
| 7 | Ga0065712_10069154 | 3300005290 | Bacteria | 7874 |
| 8 | Ga0065707_10084840 | 3300005295 | Bacteria | 6722 |
| 9 | Ga0070658_10077786 | 3300005327 | Bacteria | 2722 |
| 10 | Ga0070683_100010078 | 3300005329 | Bacteria | 8106 |
| 11 | Ga0070683_100011036 | 3300005329 | Bacteria | 7787 |
| 12 | Ga0070683_100012140 | 3300005329 | Bacteria | 7476 |
| 13 | Ga0070683_100030156 | 3300005329 | Bacteria | 4919 |
| 14 | Ga0070683_100165039 | 3300005329 | Bacteria | 2101 |
| 15 | Ga0070690_100049889 | 3300005330 | Bacteria | 2669 |
| 16 | Ga0070670_100001805 | 3300005331 | Bacteria | 17450 |
| 17 | Ga0070677_10000304 | 3300005333 | Bacteria | 17193 |
| 18 | Ga0070666_10017281 | 3300005335 | Bacteria | 4623 |
| 19 | Ga0070680_100228523 | 3300005336 | Bacteria | 1571 |
| 20 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 21 | Ga0070682_100000045 | 3300005337 | Bacteria | 131960 |
| 22 | Ga0070682_100469466 | 3300005337 | Bacteria | 968 |
| 23 | Ga0068868_100000295 | 3300005338 | Bacteria | 33551 |
| 24 | Ga0068868_100000932 | 3300005338 | Bacteria | 19897 |
| 25 | Ga0070660_100363346 | 3300005339 | Unclassified | 1193 |
| 26 | Ga0070660_101322907 | 3300005339 | Bacteria | 612 |
| 27 | Ga0070689_100105307 | 3300005340 | Bacteria | 2237 |
| 28 | Ga0070689_100173254 | 3300005340 | Unclassified | 1749 |
| 29 | Ga0070689_100557574 | 3300005340 | Unclassified | 988 |
| 30 | Ga0070689_100674281 | 3300005340 | Unclassified | 901 |
| 31 | Ga0070691_10149338 | 3300005341 | Bacteria | 1197 |
| 32 | Ga0070661_100000023 | 3300005344 | Bacteria | 123104 |
| 33 | Ga0070661_100161889 | 3300005344 | Bacteria | 1695 |
| 34 | Ga0070692_10079068 | 3300005345 | Bacteria | 1767 |
| 35 | Ga0070668_100029215 | 3300005347 | Bacteria | 4186 |
| 36 | Ga0070669_100618199 | 3300005353 | Bacteria | 909 |
| 37 | Ga0070675_100000101 | 3300005354 | Bacteria | 50140 |
| 38 | Ga0070671_100070694 | 3300005355 | Bacteria | 2912 |
| 39 | Ga0070674_100000008 | 3300005356 | Bacteria | 143844 |
| 40 | Ga0070674_100000420 | 3300005356 | Bacteria | 21367 |
| 41 | Ga0070674_100159744 | 3300005356 | Bacteria | 1709 |
| 42 | Ga0070688_100000630 | 3300005365 | Bacteria | 17586 |
| 43 | Ga0070688_100009960 | 3300005365 | Bacteria | 5223 |
| 44 | Ga0070659_100007823 | 3300005366 | Bacteria | 7778 |
| 45 | Ga0070659_100929202 | 3300005366 | Bacteria | 761 |
| 46 | Ga0070667_100000695 | 3300005367 | Bacteria | 32405 |
| 47 | Ga0070667_100016006 | 3300005367 | Bacteria | 6205 |
| 48 | Ga0070667_100139585 | 3300005367 | Bacteria | 2121 |
| 49 | Ga0070667_100323466 | 3300005367 | Bacteria | 1392 |
| 50 | Ga0070713_100000009 | 3300005436 | Bacteria | 153056 |
| 51 | Ga0070713_100255245 | 3300005436 | Bacteria | 1601 |
| 52 | Ga0070710_10773292 | 3300005437 | Bacteria | 684 |
| 53 | Ga0070701_10686759 | 3300005438 | Bacteria | 687 |
| 54 | Ga0070711_100003211 | 3300005439 | Bacteria | 9491 |
| 55 | Ga0070700_100162825 | 3300005441 | Bacteria | 1537 |
| 56 | Ga0070663_100008028 | 3300005455 | Bacteria | 6469 |
| 57 | Ga0070678_100016400 | 3300005456 | Bacteria | 4739 |
| 58 | Ga0070678_100038206 | 3300005456 | Bacteria | 3378 |
| 59 | Ga0070678_100047702 | 3300005456 | Bacteria | 3080 |
| 60 | Ga0070662_100000016 | 3300005457 | Bacteria | 105820 |
| 61 | Ga0070662_100475057 | 3300005457 | Bacteria | 1040 |
| 62 | Ga0070681_10468870 | 3300005458 | Bacteria | 1172 |
| 63 | Ga0068867_100000266 | 3300005459 | Bacteria | 34381 |
| 64 | Ga0070685_10000282 | 3300005466 | Bacteria | 32605 |
| 65 | Ga0070685_10000320 | 3300005466 | Bacteria | 29816 |
| 66 | Ga0070685_10057809 | 3300005466 | Unclassified | 2258 |
| 67 | Ga0070685_10324229 | 3300005466 | Bacteria | 1045 |
| 68 | Ga0070685_10467575 | 3300005466 | Bacteria | 887 |
| 69 | Ga0070679_100000312 | 3300005530 | Bacteria | 41159 |
| 70 | Ga0070679_100002552 | 3300005530 | Bacteria | 16514 |
| 71 | Ga0070684_100030530 | 3300005535 | Bacteria | 4579 |
| 72 | Ga0070684_100090451 | 3300005535 | Bacteria | 2722 |
| 73 | Ga0070684_100164720 | 3300005535 | Bacteria | 2012 |
| 74 | Ga0070684_100453830 | 3300005535 | Unclassified | 1185 |
| 75 | Ga0068853_100003759 | 3300005539 | Bacteria | 11640 |
| 76 | Ga0070672_100000091 | 3300005543 | Bacteria | 44187 |
| 77 | Ga0070672_100334086 | 3300005543 | Bacteria | 1290 |
| 78 | Ga0070686_100138695 | 3300005544 | Bacteria | 1690 |
| 79 | Ga0070695_100170227 | 3300005545 | Bacteria | 1536 |
| 80 | Ga0070693_100024199 | 3300005547 | Bacteria | 3254 |
| 81 | Ga0070693_100718691 | 3300005547 | Unclassified | 733 |
| 82 | Ga0070665_100000244 | 3300005548 | Bacteria | 90284 |
| 83 | Ga0070665_100110821 | 3300005548 | Bacteria | 2747 |
| 84 | Ga0070665_100154033 | 3300005548 | Bacteria | 2300 |
| 85 | Ga0070665_101882851 | 3300005548 | Unclassified | 604 |
| 86 | Ga0070664_100079495 | 3300005564 | Bacteria | 2823 |
| 87 | Ga0070664_100962566 | 3300005564 | Bacteria | 802 |
| 88 | Ga0068854_100000031 | 3300005578 | Bacteria | 107298 |
| 89 | Ga0068854_100102023 | 3300005578 | Bacteria | 2152 |
| 90 | Ga0068856_100001194 | 3300005614 | Bacteria | 27371 |
| 91 | Ga0068856_100299042 | 3300005614 | Bacteria | 1627 |
| 92 | Ga0068856_101389986 | 3300005614 | Unclassified | 716 |
| 93 | Ga0070702_100032719 | 3300005615 | Bacteria | 2855 |
| 94 | Ga0068852_100000296 | 3300005616 | Bacteria | 33429 |
| 95 | Ga0068852_100109252 | 3300005616 | Bacteria | 2511 |
| 96 | Ga0068864_100000045 | 3300005618 | Bacteria | 154739 |
| 97 | Ga0068864_100454660 | 3300005618 | Bacteria | 1225 |
| 98 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 99 | Ga0068866_10000031 | 3300005718 | Bacteria | 56943 |
| 100 | Ga0068866_10087780 | 3300005718 | Bacteria | 1686 |
| 101 | Ga0068861_100067065 | 3300005719 | Bacteria | 2768 |
| 102 | Ga0068851_10000959 | 3300005834 | Bacteria | 12486 |
| 103 | Ga0068851_10042907 | 3300005834 | Bacteria | 2278 |
| 104 | Ga0068863_100000021 | 3300005841 | Bacteria | 198088 |
| 105 | Ga0068863_100280529 | 3300005841 | Bacteria | 1614 |
| 106 | Ga0068863_101161460 | 3300005841 | Bacteria | 777 |
| 107 | Ga0068858_100000267 | 3300005842 | Bacteria | 55818 |
| 108 | Ga0068858_100000590 | 3300005842 | Bacteria | 37996 |
| 109 | Ga0068858_100066261 | 3300005842 | Bacteria | 3343 |
| 110 | Ga0068860_100004861 | 3300005843 | Bacteria | 13698 |
| 111 | Ga0068860_100100343 | 3300005843 | Bacteria | 2762 |
| 112 | Ga0068860_100160572 | 3300005843 | Bacteria | 2167 |
| 113 | Ga0068862_100000574 | 3300005844 | Bacteria | 38284 |
| 114 | Ga0081455_10087654 | 3300005937 | Bacteria | 2532 |
| 115 | Ga0081455_10137725 | 3300005937 | Bacteria | 1899 |
| 116 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 117 | Ga0081539_10001929 | 3300005985 | Bacteria | 31957 |
| 118 | Ga0075365_10007580 | 3300006038 | Bacteria | 6094 |
| 119 | Ga0075365_10164770 | 3300006038 | Unclassified | 1546 |
| 120 | Ga0075365_10175589 | 3300006038 | Bacteria | 1496 |
| 121 | Ga0075365_10264805 | 3300006038 | Bacteria | 1209 |
| 122 | Ga0075365_10520433 | 3300006038 | Bacteria | 841 |
| 123 | Ga0075368_10210043 | 3300006042 | Bacteria | 825 |
| 124 | Ga0075363_100165762 | 3300006048 | Bacteria | 1253 |
| 125 | Ga0075364_10097398 | 3300006051 | Unclassified | 1957 |
| 126 | Ga0075364_10179647 | 3300006051 | Bacteria | 1431 |
| 127 | Ga0075364_10235430 | 3300006051 | Bacteria | 1243 |
| 128 | Ga0075364_10296896 | 3300006051 | Bacteria | 1100 |
| 129 | Ga0075364_10508383 | 3300006051 | Bacteria | 824 |
| 130 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 131 | Ga0070715_10147483 | 3300006163 | Bacteria | 1149 |
| 132 | Ga0070712_100000861 | 3300006175 | Bacteria | 18065 |
| 133 | Ga0075370_10296481 | 3300006353 | Bacteria | 961 |
| 134 | Ga0068871_100609973 | 3300006358 | Bacteria | 993 |
| 135 | Ga0075428_100108905 | 3300006844 | Bacteria | 3019 |
| 136 | Ga0075430_100038515 | 3300006846 | Bacteria | 4049 |
| 137 | Ga0075431_100245030 | 3300006847 | Bacteria | 1822 |
| 138 | Ga0075433_10001485 | 3300006852 | Bacteria | 17324 |
| 139 | Ga0075433_10634438 | 3300006852 | Unclassified | 937 |
| 140 | Ga0075434_100755453 | 3300006871 | Bacteria | 989 |
| 141 | Ga0075434_100765805 | 3300006871 | Bacteria | 982 |
| 142 | Ga0068865_100000104 | 3300006881 | Bacteria | 43423 |
| 143 | Ga0075435_100151445 | 3300007076 | Bacteria | 1950 |
| 144 | Ga0099795_10176397 | 3300007788 | Bacteria | 890 |
| 145 | Ga0105240_10515788 | 3300009093 | Unclassified | 1327 |
| 146 | Ga0111539_10287044 | 3300009094 | Bacteria | 1915 |
| 147 | Ga0111539_10683862 | 3300009094 | Bacteria | 1194 |
| 148 | Ga0105245_10000016 | 3300009098 | Bacteria | 204372 |
| 149 | Ga0105245_10001174 | 3300009098 | Bacteria | 23711 |
| 150 | Ga0105245_10012141 | 3300009098 | Bacteria | 7491 |
| 151 | Ga0105245_10022734 | 3300009098 | Bacteria | 5503 |
| 152 | Ga0105245_10338491 | 3300009098 | Bacteria | 1487 |
| 153 | Ga0105245_10478092 | 3300009098 | Bacteria | 1259 |
| 154 | Ga0105245_12844661 | 3300009098 | Unclassified | 536 |
| 155 | Ga0105247_10031141 | 3300009101 | Bacteria | 3236 |
| 156 | Ga0105247_10133146 | 3300009101 | Bacteria | 1622 |
| 157 | Ga0105243_10013108 | 3300009148 | Bacteria | 6265 |
| 158 | Ga0105241_10046390 | 3300009174 | Bacteria | 3300 |
| 159 | Ga0105242_10000194 | 3300009176 | Bacteria | 47231 |
| 160 | Ga0105242_10002493 | 3300009176 | Bacteria | 14435 |
| 161 | Ga0105242_10012731 | 3300009176 | Bacteria | 6479 |
| 162 | Ga0105242_10026007 | 3300009176 | Bacteria | 4636 |
| 163 | Ga0105242_10410785 | 3300009176 | Bacteria | 1266 |
| 164 | Ga0105242_10606584 | 3300009176 | Bacteria | 1058 |
| 165 | Ga0105242_12805908 | 3300009176 | Bacteria | 537 |
| 166 | Ga0105248_10000118 | 3300009177 | Bacteria | 90018 |
| 167 | Ga0105248_10949567 | 3300009177 | Bacteria | 971 |
| 168 | Ga0105248_11707398 | 3300009177 | Unclassified | 714 |
| 169 | Ga0105237_10297220 | 3300009545 | Bacteria | 1618 |
| 170 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 171 | Ga0105238_10696161 | 3300009551 | Bacteria | 1028 |
| 172 | Ga0105249_10000068 | 3300009553 | Bacteria | 148594 |
| 173 | Ga0105249_10002838 | 3300009553 | Bacteria | 14953 |
| 174 | Ga0105249_10223344 | 3300009553 | Bacteria | 1854 |
| 175 | Ga0105239_10533398 | 3300010375 | Bacteria | 1336 |
| 176 | Ga0105246_10248540 | 3300011119 | Bacteria | 1410 |
| 177 | Ga0157371_10067585 | 3300013102 | Bacteria | 2530 |
| 178 | Ga0157370_10010547 | 3300013104 | Bacteria | 9730 |
| 179 | Ga0157370_10016083 | 3300013104 | Bacteria | 7584 |
| 180 | Ga0157370_10178725 | 3300013104 | Bacteria | 1972 |
| 181 | Ga0157369_10001239 | 3300013105 | Bacteria | 31838 |
| 182 | Ga0157374_10001108 | 3300013296 | Bacteria | 23187 |
| 183 | Ga0157374_10684732 | 3300013296 | Unclassified | 1038 |
| 184 | Ga0157374_11096164 | 3300013296 | Bacteria | 817 |
| 185 | Ga0157374_11226299 | 3300013296 | Bacteria | 772 |
| 186 | Ga0157378_10014344 | 3300013297 | Bacteria | 6939 |
| 187 | Ga0157378_10098803 | 3300013297 | Bacteria | 2662 |
| 188 | Ga0157378_10507637 | 3300013297 | Unclassified | 1205 |
| 189 | Ga0163162_10557094 | 3300013306 | Unclassified | 1274 |
| 190 | Ga0157372_10000409 | 3300013307 | Bacteria | 47021 |
| 191 | Ga0157372_12639357 | 3300013307 | Bacteria | 576 |
| 192 | Ga0157375_10000112 | 3300013308 | Bacteria | 79146 |
| 193 | Ga0157375_10010730 | 3300013308 | Bacteria | 8073 |
| 194 | Ga0157375_10026721 | 3300013308 | Bacteria | 5385 |
| 195 | Ga0157375_11309357 | 3300013308 | Unclassified | 852 |
| 196 | Ga0163163_11173504 | 3300014325 | Unclassified | 830 |
| 197 | Ga0163163_11495499 | 3300014325 | Bacteria | 737 |
| 198 | Ga0157380_10000815 | 3300014326 | Bacteria | 19534 |
| 199 | Ga0157380_10005360 | 3300014326 | Bacteria | 8963 |
| 200 | Ga0157377_10429215 | 3300014745 | Bacteria | 907 |
| 201 | Ga0157379_10017130 | 3300014968 | Bacteria | 6380 |
| 202 | Ga0157379_10090784 | 3300014968 | Bacteria | 2740 |
| 203 | Ga0157379_10668770 | 3300014968 | Bacteria | 973 |
| 204 | Ga0157379_11446140 | 3300014968 | Bacteria | 667 |
| 205 | Ga0157376_10392911 | 3300014969 | Bacteria | 1339 |
| 206 | Ga0157376_10557825 | 3300014969 | Bacteria | 1134 |
| 207 | Ga0157376_10884652 | 3300014969 | Bacteria | 910 |
| 208 | Ga0157376_11790415 | 3300014969 | Bacteria | 650 |
| 209 | Ga0163161_10000032 | 3300017792 | Bacteria | 165511 |
| 210 | Ga0163161_10028383 | 3300017792 | Bacteria | 3974 |
| 211 | Ga0206356_10092693 | 3300020070 | Bacteria | 1668 |
| 212 | Ga0213876_10006509 | 3300021384 | Bacteria | 6366 |
| 213 | Ga0207656_10000116 | 3300025321 | Bacteria | 30697 |
| 214 | Ga0207656_10015276 | 3300025321 | Bacteria | 2969 |
| 215 | Ga0207682_10000557 | 3300025893 | Bacteria | 17207 |
| 216 | Ga0207642_10000031 | 3300025899 | Bacteria | 45198 |
| 217 | Ga0207642_10000034 | 3300025899 | Bacteria | 43362 |
| 218 | Ga0207642_10071601 | 3300025899 | Bacteria | 1652 |
| 219 | Ga0207710_10000158 | 3300025900 | Bacteria | 72527 |
| 220 | Ga0207710_10068473 | 3300025900 | Bacteria | 1623 |
| 221 | Ga0207710_10151792 | 3300025900 | Unclassified | 1124 |
| 222 | Ga0207680_10010482 | 3300025903 | Bacteria | 4638 |
| 223 | Ga0207647_10239817 | 3300025904 | Bacteria | 1041 |
| 224 | Ga0207685_10001023 | 3300025905 | Bacteria | 5453 |
| 225 | Ga0207705_10471049 | 3300025909 | Bacteria | 975 |
| 226 | Ga0207654_10068678 | 3300025911 | Bacteria | 2097 |
| 227 | Ga0207707_10316588 | 3300025912 | Bacteria | 1348 |
| 228 | Ga0207693_10001956 | 3300025915 | Bacteria | 18065 |
| 229 | Ga0207663_10016385 | 3300025916 | Bacteria | 4109 |
| 230 | Ga0207657_10633040 | 3300025919 | Bacteria | 833 |
| 231 | Ga0207649_10000063 | 3300025920 | Bacteria | 96360 |
| 232 | Ga0207649_10114915 | 3300025920 | Bacteria | 1805 |
| 233 | Ga0207649_10270266 | 3300025920 | Bacteria | 1232 |
| 234 | Ga0207652_10000483 | 3300025921 | Bacteria | 40881 |
| 235 | Ga0207652_10016512 | 3300025921 | Bacteria | 6029 |
| 236 | Ga0207681_10164246 | 3300025923 | Bacteria | 1677 |
| 237 | Ga0207681_10708216 | 3300025923 | Unclassified | 837 |
| 238 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 239 | Ga0207650_10200390 | 3300025925 | Bacteria | 1599 |
| 240 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 241 | Ga0207659_10567371 | 3300025926 | Bacteria | 966 |
| 242 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 243 | Ga0207687_10000018 | 3300025927 | Bacteria | 236159 |
| 244 | Ga0207687_10000247 | 3300025927 | Bacteria | 36785 |
| 245 | Ga0207687_10083702 | 3300025927 | Bacteria | 2310 |
| 246 | Ga0207687_10623102 | 3300025927 | Bacteria | 911 |
| 247 | Ga0207700_10000025 | 3300025928 | Bacteria | 147429 |
| 248 | Ga0207644_10049758 | 3300025931 | Bacteria | 3002 |
| 249 | Ga0207690_10003697 | 3300025932 | Bacteria | 9103 |
| 250 | Ga0207690_10666306 | 3300025932 | Bacteria | 854 |
| 251 | Ga0207706_10000068 | 3300025933 | Bacteria | 105795 |
| 252 | Ga0207706_10492894 | 3300025933 | Bacteria | 1058 |
| 253 | Ga0207686_10000033 | 3300025934 | Bacteria | 143602 |
| 254 | Ga0207686_10001608 | 3300025934 | Bacteria | 12650 |
| 255 | Ga0207686_10011451 | 3300025934 | Bacteria | 4858 |
| 256 | Ga0207686_10030935 | 3300025934 | Bacteria | 3175 |
| 257 | Ga0207686_10373910 | 3300025934 | Bacteria | 1079 |
| 258 | Ga0207686_10580000 | 3300025934 | Bacteria | 880 |
| 259 | Ga0207709_10022268 | 3300025935 | Bacteria | 3593 |
| 260 | Ga0207709_10199288 | 3300025935 | Bacteria | 1428 |
| 261 | Ga0207670_10104300 | 3300025936 | Bacteria | 2031 |
| 262 | Ga0207670_10111508 | 3300025936 | Bacteria | 1972 |
| 263 | Ga0207669_10000004 | 3300025937 | Bacteria | 196828 |
| 264 | Ga0207669_10000012 | 3300025937 | Bacteria | 138242 |
| 265 | Ga0207704_10000146 | 3300025938 | Bacteria | 37894 |
| 266 | Ga0207704_10467684 | 3300025938 | Unclassified | 1010 |
| 267 | Ga0207691_10001039 | 3300025940 | Bacteria | 27535 |
| 268 | Ga0207691_10419680 | 3300025940 | Bacteria | 1140 |
| 269 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 270 | Ga0207711_10873339 | 3300025941 | Bacteria | 837 |
| 271 | Ga0207689_10226011 | 3300025942 | Bacteria | 1547 |
| 272 | Ga0207661_10000095 | 3300025944 | Bacteria | 56458 |
| 273 | Ga0207661_10006791 | 3300025944 | Bacteria | 8108 |
| 274 | Ga0207661_10039585 | 3300025944 | Bacteria | 3701 |
| 275 | Ga0207661_10194494 | 3300025944 | Bacteria | 1780 |
| 276 | Ga0207661_10589589 | 3300025944 | Bacteria | 1020 |
| 277 | Ga0207679_10058121 | 3300025945 | Bacteria | 2864 |
| 278 | Ga0207679_10084869 | 3300025945 | Bacteria | 2431 |
| 279 | Ga0207651_10009892 | 3300025960 | Bacteria | 5249 |
| 280 | Ga0207651_10302916 | 3300025960 | Bacteria | 1330 |
| 281 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 282 | Ga0207712_10004331 | 3300025961 | Bacteria | 8966 |
| 283 | Ga0207712_10405647 | 3300025961 | Bacteria | 1147 |
| 284 | Ga0207640_10000015 | 3300025981 | Bacteria | 215411 |
| 285 | Ga0207640_10078284 | 3300025981 | Bacteria | 2250 |
| 286 | Ga0207658_10007907 | 3300025986 | Bacteria | 7243 |
| 287 | Ga0207658_10019385 | 3300025986 | Bacteria | 4705 |
| 288 | Ga0207658_10066688 | 3300025986 | Bacteria | 2708 |
| 289 | Ga0207658_10312659 | 3300025986 | Bacteria | 1357 |
| 290 | Ga0207658_10414065 | 3300025986 | Unclassified | 1187 |
| 291 | Ga0207677_10000654 | 3300026023 | Bacteria | 20750 |
| 292 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 293 | Ga0207703_10000040 | 3300026035 | Bacteria | 168191 |
| 294 | Ga0207639_10005159 | 3300026041 | Bacteria | 8807 |
| 295 | Ga0207639_10703153 | 3300026041 | Bacteria | 938 |
| 296 | Ga0207678_10002913 | 3300026067 | Bacteria | 15518 |
| 297 | Ga0207678_10058376 | 3300026067 | Bacteria | 3320 |
| 298 | Ga0207678_10654020 | 3300026067 | Bacteria | 923 |
| 299 | Ga0207708_10242567 | 3300026075 | Bacteria | 1450 |
| 300 | Ga0207708_10269015 | 3300026075 | Bacteria | 1378 |
| 301 | Ga0207702_10000607 | 3300026078 | Bacteria | 39638 |
| 302 | Ga0207702_10008495 | 3300026078 | Bacteria | 8661 |
| 303 | Ga0207702_10008687 | 3300026078 | Bacteria | 8567 |
| 304 | Ga0207641_10000151 | 3300026088 | Bacteria | 99225 |
| 305 | Ga0207641_10098430 | 3300026088 | Bacteria | 2572 |
| 306 | Ga0207641_10485255 | 3300026088 | Bacteria | 1198 |
| 307 | Ga0207641_10785370 | 3300026088 | Bacteria | 941 |
| 308 | Ga0207648_10000848 | 3300026089 | Bacteria | 34516 |
| 309 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 310 | Ga0207675_100095533 | 3300026118 | Bacteria | 2797 |
| 311 | Ga0207675_100168665 | 3300026118 | Bacteria | 2091 |
| 312 | Ga0207683_10025316 | 3300026121 | Bacteria | 5119 |
| 313 | Ga0207683_11573880 | 3300026121 | Bacteria | 606 |
| 314 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 315 | Ga0207698_10064404 | 3300026142 | Bacteria | 2873 |
| 316 | Ga0209179_1051211 | 3300027512 | Bacteria | 885 |
| 317 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 318 | Ga0268266_10000085 | 3300028379 | Bacteria | 201288 |
| 319 | Ga0268266_10002765 | 3300028379 | Bacteria | 18329 |
| 320 | Ga0268266_10018111 | 3300028379 | Bacteria | 6004 |
| 321 | Ga0268266_10074048 | 3300028379 | Bacteria | 2957 |
| 322 | Ga0268266_10274707 | 3300028379 | Bacteria | 1565 |
| 323 | Ga0268266_10915252 | 3300028379 | Bacteria | 848 |
| 324 | Ga0268265_10000555 | 3300028380 | Bacteria | 38092 |
| 325 | Ga0268264_10001865 | 3300028381 | Bacteria | 19155 |
| 326 | Ga0268264_10049545 | 3300028381 | Bacteria | 3495 |
| 327 | Ga0268264_10258869 | 3300028381 | Bacteria | 1620 |
| 328 | Ga0268264_10628640 | 3300028381 | Bacteria | 1061 |
| 329 | Ga0265337_1000002 | 3300028556 | Bacteria | 139247 |
| 330 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 331 | Ga0265319_1000025 | 3300028563 | Bacteria | 142639 |
| 332 | Ga0265334_10138385 | 3300028573 | Bacteria | 863 |
| 333 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 334 | Ga0265336_10002423 | 3300028666 | Bacteria | 7697 |
| 335 | Ga0265338_10000486 | 3300028800 | Bacteria | 70900 |
| 336 | Ga0265324_10001406 | 3300029957 | Bacteria | 13852 |
| 337 | Ga0265332_10013614 | 3300031238 | Bacteria | 3603 |
| 338 | Ga0265328_10004948 | 3300031239 | Bacteria | 5739 |
| 339 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 340 | Ga0265325_10011240 | 3300031241 | Bacteria | 5148 |
| 341 | Ga0265331_10001248 | 3300031250 | Bacteria | 19076 |
| 342 | Ga0265331_10085751 | 3300031250 | Bacteria | 1459 |
| 343 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 344 | Ga0265327_10284169 | 3300031251 | Bacteria | 731 |
| 345 | Ga0265316_10130135 | 3300031344 | Bacteria | 1896 |
| 346 | Ga0265313_10056508 | 3300031595 | Bacteria | 1856 |
| 347 | Ga0265314_10000058 | 3300031711 | Bacteria | 167476 |
| 348 | Ga0265342_10112891 | 3300031712 | Bacteria | 1536 |
| 349 | Ga0316576_10009403 | 3300031727 | Bacteria | 6304 |
| 350 | Ga0316578_10207131 | 3300031728 | Bacteria | 1180 |
| 351 | Ga0307413_10045212 | 3300031824 | Bacteria | 2608 |
| 352 | Ga0307406_10036814 | 3300031901 | Bacteria | 3017 |
| 353 | Ga0307406_10157073 | 3300031901 | Bacteria | 1630 |
| 354 | Ga0307407_10143276 | 3300031903 | Bacteria | 1544 |
| 355 | Ga0307412_10581902 | 3300031911 | Bacteria | 945 |
| 356 | Ga0307409_100251698 | 3300031995 | Bacteria | 1615 |
| 357 | Ga0307416_100482072 | 3300032002 | Bacteria | 1300 |
| 358 | Ga0307411_10095772 | 3300032005 | Bacteria | 2085 |
| 359 | Ga0307415_100186306 | 3300032126 | Bacteria | 1633 |
| 360 | Ga0307415_101108797 | 3300032126 | Bacteria | 741 |
| 361 | Ga0316574_0014874 | 3300035398 | Bacteria | 4505 |
| 362 | Ga0373937_0026804 | 3300036401 | Bacteria | 5209 |
| 363 | Ga0373937_1046409 | 3300036401 | Bacteria | 765 |
| 364 | Ga0316584_0000602 | 3300036712 | Bacteria | 19510 |
| 365 | Ga0395900_0334952 | 3300037418 | Bacteria | 1490 |
| 366 | Ga0395898_0650224 | 3300037466 | Bacteria | 997 |
| 367 | Ga0395905_1399238 | 3300037471 | Unclassified | 604 |
| 368 | Ga0395901_0113640 | 3300038443 | Bacteria | 2844 |
| 369 | Ga0395901_0843364 | 3300038443 | Bacteria | 902 |
| 370 | Ga0436365_1172353 | 3300039437 | Bacteria | 694 |
| 371 | Ga0451791_0943522 | 3300041451 | Bacteria | 776 |
| 372 | Ga0451798_0221974 | 3300041458 | Bacteria | 521 |
| 373 | Ga0451800_0460762 | 3300041459 | Bacteria | 1178 |
| 374 | Ga0451804_1141688 | 3300041463 | Bacteria | 939 |
| 375 | Ga0451807_0132026 | 3300041486 | Bacteria | 590 |
| 376 | Ga0451807_1153546 | 3300041486 | Bacteria | 708 |
| 377 | Ga0451839_0784527 | 3300041496 | Bacteria | 1273 |
| 378 | Ga0451849_0101462 | 3300041505 | Bacteria | 1053 |
| 379 | Ga0451853_1663165 | 3300041512 | Bacteria | 1001 |
| 380 | Ga0451853_3370634 | 3300041512 | Bacteria | 1491 |
| 381 | Ga0466966_0070471 | 3300044684 | Bacteria | 2192 |
| 382 | Ga0466966_0139209 | 3300044684 | Bacteria | 1484 |
| 383 | Ga0466961_0030779 | 3300044693 | Bacteria | 3448 |
| 384 | Ga0466963_0000282 | 3300044694 | Bacteria | 22761 |
| 385 | Ga0466963_0047615 | 3300044694 | Bacteria | 2830 |
| 386 | Ga0466970_0259807 | 3300044765 | Bacteria | 974 |
| 387 | Ga0466957_0000505 | 3300044842 | Bacteria | 19584 |
| 388 | Ga0466957_1236977 | 3300044842 | Bacteria | 541 |
| 389 | Ga0466960_0086457 | 3300044901 | Bacteria | 1590 |
| 390 | Ga0466959_0074369 | 3300045049 | Bacteria | 2457 |
| 391 | Ga0466958_0053807 | 3300045836 | Bacteria | 2441 |
| 392 | Ga0466958_0232421 | 3300045836 | Bacteria | 1177 |
| 393 | Ga0466967_0000027 | 3300045976 | Bacteria | 64265 |
| 394 | Ga0466967_0015351 | 3300045976 | Bacteria | 6000 |
| 395 | Ga0466967_0190424 | 3300045976 | Bacteria | 1938 |
| 396 | Ga0466967_2600135 | 3300045976 | Bacteria | 501 |
| 397 | Ga0495592_0000036 | 3300046454 | Bacteria | 125461 |
| 398 | Ga0495592_0065899 | 3300046454 | Bacteria | 2651 |
| 399 | Ga0495592_0254161 | 3300046454 | Bacteria | 1160 |
| 400 | Ga0495592_0302439 | 3300046454 | Bacteria | 1039 |
| 401 | Ga0495603_0000030 | 3300046455 | Bacteria | 60760 |
| 402 | Ga0495603_0001449 | 3300046455 | Bacteria | 13793 |
| 403 | Ga0495603_0010404 | 3300046455 | Bacteria | 5634 |
| 404 | Ga0495591_033913 | 3300046458 | Bacteria | 1507 |
| 405 | Ga0495629_0000189 | 3300046459 | Bacteria | 55743 |
| 406 | Ga0495629_0000801 | 3300046459 | Bacteria | 25450 |
| 407 | Ga0495629_0009458 | 3300046459 | Bacteria | 7130 |
| 408 | Ga0495629_0232952 | 3300046459 | Bacteria | 1269 |
| 409 | Ga0495638_0018430 | 3300046460 | Bacteria | 4636 |
| 410 | Ga0495641_0000003 | 3300046461 | Bacteria | 242879 |
| 411 | Ga0495641_0020001 | 3300046461 | Bacteria | 3409 |
| 412 | Ga0495641_0128647 | 3300046461 | Bacteria | 1130 |
| 413 | Ga0495651_0099628 | 3300046462 | Bacteria | 2167 |
| 414 | Ga0495651_0104239 | 3300046462 | Bacteria | 2106 |
| 415 | Ga0495651_0137588 | 3300046462 | Bacteria | 1775 |
| 416 | Ga0495653_0024689 | 3300046463 | Bacteria | 4839 |
| 417 | Ga0495653_0113162 | 3300046463 | Bacteria | 1947 |
| 418 | Ga0495653_0161989 | 3300046463 | Bacteria | 1552 |
| 419 | Ga0495653_0173474 | 3300046463 | Bacteria | 1486 |
| 420 | Ga0495653_0373362 | 3300046463 | Bacteria | 912 |
| 421 | Ga0495582_0000029 | 3300046473 | Bacteria | 77919 |
| 422 | Ga0495639_0185199 | 3300046475 | Unclassified | 1015 |
| 423 | Ga0495662_0001090 | 3300046476 | Bacteria | 13354 |
| 424 | Ga0495662_0011508 | 3300046476 | Bacteria | 4323 |
| 425 | Ga0495662_0312919 | 3300046476 | Bacteria | 772 |
| 426 | Ga0495664_0290237 | 3300046477 | Bacteria | 988 |
| 427 | Ga0495594_0000003 | 3300046499 | Bacteria | 199267 |
| 428 | Ga0495594_0613284 | 3300046499 | Unclassified | 617 |
| 429 | Ga0495596_0247532 | 3300046500 | Bacteria | 692 |
| 430 | Ga0495606_0000221 | 3300046507 | Bacteria | 101157 |
| 431 | Ga0495608_0000189 | 3300046511 | Bacteria | 43800 |
| 432 | Ga0495608_0000305 | 3300046511 | Bacteria | 34510 |
| 433 | Ga0495608_0005739 | 3300046511 | Bacteria | 8857 |
| 434 | Ga0495608_0044964 | 3300046511 | Bacteria | 2945 |
| 435 | Ga0495608_0091569 | 3300046511 | Bacteria | 1966 |
| 436 | Ga0495618_0001080 | 3300046514 | Bacteria | 18551 |
| 437 | Ga0495620_0000210 | 3300046515 | Bacteria | 44013 |
| 438 | Ga0495620_0280640 | 3300046515 | Bacteria | 634 |
| 439 | Ga0495628_0000144 | 3300046516 | Bacteria | 61254 |
| 440 | Ga0495628_0002445 | 3300046516 | Bacteria | 16746 |
| 441 | Ga0495628_0043803 | 3300046516 | Bacteria | 3563 |
| 442 | Ga0495628_0070641 | 3300046516 | Bacteria | 2722 |
| 443 | Ga0495628_0091636 | 3300046516 | Bacteria | 2352 |
| 444 | Ga0495628_0118502 | 3300046516 | Bacteria | 2032 |
| 445 | Ga0495628_0752376 | 3300046516 | Bacteria | 685 |
| 446 | Ga0495630_0000018 | 3300046517 | Bacteria | 186064 |
| 447 | Ga0495630_0013185 | 3300046517 | Bacteria | 6009 |
| 448 | Ga0495630_0015188 | 3300046517 | Bacteria | 5619 |
| 449 | Ga0495630_0017005 | 3300046517 | Bacteria | 5323 |
| 450 | Ga0495630_0201118 | 3300046517 | Bacteria | 1520 |
| 451 | Ga0495630_1038290 | 3300046517 | Bacteria | 622 |
| 452 | Ga0495632_0138251 | 3300046519 | Bacteria | 1131 |
| 453 | Ga0495637_0162884 | 3300046520 | Bacteria | 836 |
| 454 | Ga0495644_0004801 | 3300046523 | Bacteria | 5311 |
| 455 | Ga0495652_0000019 | 3300046529 | Bacteria | 190248 |
| 456 | Ga0495652_0017587 | 3300046529 | Bacteria | 6378 |
| 457 | Ga0495652_0168745 | 3300046529 | Bacteria | 1691 |
| 458 | Ga0495652_0975175 | 3300046529 | Unclassified | 556 |
| 459 | Ga0495640_0059087 | 3300046533 | Bacteria | 2613 |
| 460 | Ga0495640_0084193 | 3300046533 | Unclassified | 2110 |
| 461 | Ga0495640_0510064 | 3300046533 | Bacteria | 731 |
| 462 | Ga0495586_0001014 | 3300046535 | Bacteria | 15853 |
| 463 | Ga0495587_0003399 | 3300046536 | Bacteria | 10621 |
| 464 | Ga0495587_0013375 | 3300046536 | Bacteria | 5159 |
| 465 | Ga0495587_0142412 | 3300046536 | Bacteria | 1368 |
| 466 | Ga0495587_0152292 | 3300046536 | Bacteria | 1318 |
| 467 | Ga0495587_0205171 | 3300046536 | Unclassified | 1114 |
| 468 | Ga0495598_0001175 | 3300046537 | Bacteria | 5060 |
| 469 | Ga0495621_0007201 | 3300046539 | Bacteria | 3285 |
| 470 | Ga0495645_0008291 | 3300046543 | Bacteria | 7252 |
| 471 | Ga0495622_0000714 | 3300046557 | Bacteria | 18760 |
| 472 | Ga0495667_0000032 | 3300046559 | Bacteria | 143493 |
| 473 | Ga0495667_0060268 | 3300046559 | Unclassified | 2489 |
| 474 | Ga0495656_0007393 | 3300046615 | Bacteria | 3880 |
| 475 | Ga0495634_0000401 | 3300046642 | Bacteria | 42619 |
| 476 | Ga0495634_0000801 | 3300046642 | Bacteria | 30517 |
| 477 | Ga0495634_0022201 | 3300046642 | Bacteria | 4474 |
| 478 | Ga0495634_0068652 | 3300046642 | Bacteria | 2341 |
| 479 | Ga0495634_0207519 | 3300046642 | Bacteria | 1214 |
| 480 | Ga0495625_0000766 | 3300046660 | Bacteria | 44778 |
| 481 | Ga0495635_0000016 | 3300046663 | Bacteria | 214088 |
| 482 | Ga0495635_0011612 | 3300046663 | Bacteria | 6174 |
| 483 | Ga0495635_0159726 | 3300046663 | Bacteria | 1534 |
| 484 | Ga0495635_0162253 | 3300046663 | Unclassified | 1521 |
| 485 | Ga0495588_0000274 | 3300046674 | Bacteria | 39224 |
| 486 | Ga0495588_0167166 | 3300046674 | Unclassified | 1163 |
| 487 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 488 | Ga0495657_0011664 | 3300046675 | Bacteria | 6559 |
| 489 | Ga0495657_0031495 | 3300046675 | Bacteria | 3707 |
| 490 | Ga0495647_0000054 | 3300046681 | Bacteria | 30734 |
| 491 | Ga0495647_0001792 | 3300046681 | Bacteria | 6638 |
| 492 | Ga0495647_0052774 | 3300046681 | Bacteria | 1584 |
| 493 | Ga0495647_0103561 | 3300046681 | Bacteria | 1181 |
| 494 | Ga0495658_0000026 | 3300046683 | Bacteria | 77681 |
| 495 | Ga0495658_0014198 | 3300046683 | Bacteria | 4064 |
| 496 | Ga0495658_0314478 | 3300046683 | Bacteria | 992 |
| 497 | Ga0495669_0000088 | 3300046684 | Bacteria | 61314 |
| 498 | Ga0495613_0000370 | 3300046689 | Bacteria | 38906 |
| 499 | Ga0495613_0000577 | 3300046689 | Bacteria | 29814 |
| 500 | Ga0495613_0283519 | 3300046689 | Bacteria | 1150 |
| 501 | Ga0495613_0284376 | 3300046689 | Bacteria | 1148 |
| 502 | Ga0495613_0325635 | 3300046689 | Bacteria | 1060 |
| 503 | Ga0495613_0674461 | 3300046689 | Bacteria | 682 |
| 504 | Ga0495624_0000008 | 3300046690 | Bacteria | 145035 |
| 505 | Ga0495624_0001409 | 3300046690 | Bacteria | 18746 |
| 506 | Ga0495624_0002494 | 3300046690 | Bacteria | 13951 |
| 507 | Ga0495624_0236104 | 3300046690 | Bacteria | 1107 |
| 508 | Ga0495670_0016652 | 3300046691 | Bacteria | 3615 |
| 509 | Ga0495649_0003647 | 3300046694 | Bacteria | 10273 |
| 510 | Ga0495600_0001624 | 3300046809 | Bacteria | 12542 |
| 511 | Ga0495600_0044263 | 3300046809 | Bacteria | 2905 |
| 512 | Ga0495600_0089123 | 3300046809 | Unclassified | 2012 |
| 513 | Ga0495600_0217382 | 3300046809 | Bacteria | 1223 |
| 514 | Ga0495600_0700942 | 3300046809 | Bacteria | 609 |
| 515 | Ga0495604_0000019 | 3300047317 | Bacteria | 175064 |
| 516 | Ga0495604_0003700 | 3300047317 | Bacteria | 12179 |
| 517 | Ga0495604_0066021 | 3300047317 | Unclassified | 2753 |
| 518 | Ga0495604_0316450 | 3300047317 | Unclassified | 1044 |
| 519 | Ga0495674_0000251 | 3300047319 | Bacteria | 45351 |
| 520 | Ga0495674_0566594 | 3300047319 | Bacteria | 903 |
| 521 | Ga0495672_0199335 | 3300047320 | Bacteria | 1002 |
| 522 | Ga0495676_0010037 | 3300047321 | Bacteria | 8600 |
| 523 | Ga0495676_0038905 | 3300047321 | Bacteria | 3946 |
| 524 | Ga0495676_0051454 | 3300047321 | Bacteria | 3295 |
| 525 | Ga0495676_0111822 | 3300047321 | Bacteria | 2003 |
| 526 | Ga0495676_0154115 | 3300047321 | Bacteria | 1632 |
| 527 | Ga0495676_0491861 | 3300047321 | Bacteria | 806 |
| 528 | Ga0495676_0533824 | 3300047321 | Bacteria | 768 |
| 529 | Ga0495680_0000317 | 3300047322 | Bacteria | 53949 |
| 530 | Ga0495680_0000647 | 3300047322 | Bacteria | 39030 |
| 531 | Ga0495680_0007802 | 3300047322 | Bacteria | 9773 |
| 532 | Ga0495680_0341178 | 3300047322 | Unclassified | 1045 |
| 533 | Ga0495675_0001341 | 3300047444 | Bacteria | 14909 |
| 534 | Ga0495675_0026270 | 3300047444 | Bacteria | 3713 |
| 535 | Ga0495679_015031 | 3300047446 | Bacteria | 2844 |
| 536 | Ga0495679_191165 | 3300047446 | Bacteria | 540 |
| 537 | Ga0495684_0238650 | 3300047471 | Bacteria | 1327 |
| 538 | Ga0495684_0282424 | 3300047471 | Unclassified | 1197 |
| 539 | Ga0495686_0034881 | 3300047472 | Bacteria | 3237 |
| 540 | Ga0495593_0006348 | 3300047673 | Bacteria | 6937 |
| 541 | Ga0495602_0000021 | 3300048088 | Bacteria | 168585 |
| 542 | Ga0495602_0015275 | 3300048088 | Bacteria | 7755 |
| 543 | Ga0495602_0130660 | 3300048088 | Bacteria | 2004 |
| 544 | Ga0495602_0215104 | 3300048088 | Bacteria | 1455 |
| 545 | Ga0495602_0280991 | 3300048088 | Bacteria | 1226 |
| 546 | Ga0495602_0587806 | 3300048088 | Bacteria | 767 |
| 547 | Ga0495614_0012964 | 3300048089 | Bacteria | 3655 |
| 548 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 549 | Ga0496100_0000018 | 3300048903 | Bacteria | 162451 |
| 550 | Ga0496100_1477223 | 3300048903 | Bacteria | 537 |
| 551 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 552 | Ga0496101_0000308 | 3300048904 | Bacteria | 33852 |
| 553 | Ga0496102_0000039 | 3300048905 | Bacteria | 198306 |
| 554 | Ga0496102_0089336 | 3300048905 | Bacteria | 2850 |
| 555 | Ga0496102_0264686 | 3300048905 | Bacteria | 1621 |
| 556 | Ga0496102_1083683 | 3300048905 | Bacteria | 721 |
| 557 | Ga0496102_1269716 | 3300048905 | Bacteria | 656 |
| 558 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 559 | Ga0496103_0089068 | 3300048906 | Bacteria | 1946 |
| 560 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 561 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 562 | Ga0496104_0000129 | 3300048907 | Bacteria | 69982 |
| 563 | Ga0496104_0182436 | 3300048907 | Bacteria | 2009 |
| 564 | Ga0496104_1215502 | 3300048907 | Bacteria | 657 |
| 565 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 566 | Ga0496105_0000027 | 3300048908 | Bacteria | 148197 |
| 567 | Ga0496105_0000511 | 3300048908 | Bacteria | 25595 |
| 568 | Ga0496105_0008230 | 3300048908 | Bacteria | 8106 |
| 569 | Ga0496105_0014230 | 3300048908 | Bacteria | 6332 |
| 570 | Ga0496105_0422647 | 3300048908 | Bacteria | 1055 |
| 571 | Ga0496106_0000081 | 3300048909 | Bacteria | 76468 |
| 572 | Ga0496106_0000098 | 3300048909 | Bacteria | 66098 |
| 573 | Ga0496106_0000229 | 3300048909 | Bacteria | 39124 |
| 574 | Ga0496106_0078856 | 3300048909 | Bacteria | 2528 |
| 575 | Ga0496106_0210406 | 3300048909 | Bacteria | 1549 |
| 576 | Ga0496107_0000006 | 3300048910 | Bacteria | 258746 |
| 577 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 578 | Ga0496107_0709230 | 3300048910 | Bacteria | 740 |
| 579 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 580 | Ga0496108_0000132 | 3300048911 | Bacteria | 73888 |
| 581 | Ga0496108_0000630 | 3300048911 | Bacteria | 27529 |
| 582 | Ga0496108_0042653 | 3300048911 | Bacteria | 3787 |
| 583 | Ga0496108_0114695 | 3300048911 | Bacteria | 2307 |
| 584 | Ga0496108_0165736 | 3300048911 | Bacteria | 1910 |
| 585 | Ga0496108_0839882 | 3300048911 | Bacteria | 791 |
| 586 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 587 | Ga0496109_0000007 | 3300048912 | Bacteria | 247554 |
| 588 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 589 | Ga0496109_0000168 | 3300048912 | Bacteria | 64462 |
| 590 | Ga0496109_0094874 | 3300048912 | Bacteria | 2762 |
| 591 | Ga0496109_0596439 | 3300048912 | Bacteria | 1041 |
| 592 | Ga0496109_0738918 | 3300048912 | Bacteria | 922 |
| 593 | Ga0496110_0000492 | 3300048913 | Bacteria | 26887 |
| 594 | Ga0496110_0018459 | 3300048913 | Bacteria | 5850 |
| 595 | Ga0496110_0056188 | 3300048913 | Bacteria | 3464 |
| 596 | Ga0496110_0363992 | 3300048913 | Bacteria | 1318 |
| 597 | Ga0496111_0003195 | 3300048914 | Bacteria | 10108 |
| 598 | Ga0496111_0031556 | 3300048914 | Bacteria | 3775 |
| 599 | Ga0496111_0136876 | 3300048914 | Bacteria | 1814 |
| 600 | Ga0496111_0196551 | 3300048914 | Bacteria | 1499 |
| 601 | Ga0496111_0205415 | 3300048914 | Bacteria | 1464 |
| 602 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 603 | Ga0496112_0011739 | 3300048915 | Bacteria | 8020 |
| 604 | Ga0496112_0163523 | 3300048915 | Bacteria | 2192 |
| 605 | Ga0496112_0271352 | 3300048915 | Bacteria | 1645 |
| 606 | Ga0496112_1410400 | 3300048915 | Bacteria | 611 |
| 607 | Ga0496113_0000029 | 3300048916 | Bacteria | 61873 |
| 608 | Ga0496113_0011781 | 3300048916 | Bacteria | 5856 |
| 609 | Ga0496113_0021073 | 3300048916 | Bacteria | 4594 |
| 610 | Ga0496113_0047500 | 3300048916 | Bacteria | 3190 |
| 611 | Ga0496113_0071145 | 3300048916 | Bacteria | 2646 |
| 612 | Ga0496113_0880026 | 3300048916 | Unclassified | 709 |
| 613 | Ga0496113_1075718 | 3300048916 | Bacteria | 631 |
| 614 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 615 | Ga0496114_0113621 | 3300048917 | Bacteria | 2322 |
| 616 | Ga0496114_0556382 | 3300048917 | Bacteria | 1013 |
| 617 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 618 | Ga0496115_0000828 | 3300048918 | Bacteria | 22654 |
| 619 | Ga0496115_0023412 | 3300048918 | Bacteria | 4793 |
| 620 | Ga0496116_0003216 | 3300048919 | Bacteria | 16307 |
| 621 | Ga0496117_0007379 | 3300048920 | Bacteria | 10762 |
| 622 | Ga0496117_0156799 | 3300048920 | Bacteria | 1339 |
| 623 | Ga0496118_0009262 | 3300048921 | Bacteria | 9989 |
| 624 | Ga0496118_0058765 | 3300048921 | Bacteria | 2870 |
| 625 | Ga0496119_0004563 | 3300048922 | Bacteria | 13703 |
| 626 | Ga0496119_0009421 | 3300048922 | Bacteria | 8385 |
| 627 | Ga0496119_0022258 | 3300048922 | Bacteria | 4546 |
| 628 | Ga0496119_0186383 | 3300048922 | Bacteria | 1084 |
| 629 | Ga0496119_0311796 | 3300048922 | Bacteria | 772 |
| 630 | Ga0496120_0038980 | 3300048923 | Bacteria | 2808 |
| 631 | Ga0496120_0042949 | 3300048923 | Bacteria | 2637 |
| 632 | Ga0496120_0335365 | 3300048923 | Bacteria | 683 |
| 633 | Ga0496121_0018218 | 3300048924 | Bacteria | 7098 |
| 634 | Ga0496121_0031743 | 3300048924 | Bacteria | 4818 |
| 635 | Ga0496121_0108177 | 3300048924 | Bacteria | 2127 |
| 636 | Ga0496121_0186024 | 3300048924 | Bacteria | 1494 |
| 637 | Ga0496121_0313075 | 3300048924 | Bacteria | 1060 |
| 638 | Ga0496124_0184910 | 3300048927 | Bacteria | 1600 |
| 639 | Ga0496124_0187766 | 3300048927 | Bacteria | 1585 |
| 640 | Ga0496124_0507460 | 3300048927 | Unclassified | 807 |
| 641 | Ga0496125_0068748 | 3300048928 | Bacteria | 2784 |
| 642 | Ga0496126_0024325 | 3300048929 | Bacteria | 5849 |
| 643 | Ga0496126_0287100 | 3300048929 | Bacteria | 1361 |
| 644 | Ga0501031_0003232 | 3300049568 | Bacteria | 10470 |
| 645 | Ga0501032_0006009 | 3300049569 | Bacteria | 8953 |
| 646 | Ga0501033_0001866 | 3300049570 | Bacteria | 18321 |
| 647 | Ga0501034_0002092 | 3300049571 | Bacteria | 24942 |
| 648 | Ga0501034_0005614 | 3300049571 | Bacteria | 13663 |
| 649 | Ga0501034_0063638 | 3300049571 | Bacteria | 3702 |
| 650 | Ga0501034_0321996 | 3300049571 | Bacteria | 1479 |
| 651 | Ga0501034_0725009 | 3300049571 | Unclassified | 891 |
| 652 | Ga0501034_1008738 | 3300049571 | Bacteria | 716 |
| 653 | Ga0501036_0001911 | 3300049572 | Bacteria | 16200 |
| 654 | Ga0501037_0001803 | 3300049573 | Bacteria | 15558 |
| 655 | Ga0501038_0007182 | 3300049574 | Bacteria | 10296 |
| 656 | Ga0501039_0129511 | 3300049575 | Bacteria | 1980 |
| 657 | Ga0501039_0587375 | 3300049575 | Bacteria | 873 |
| 658 | Ga0501040_0038891 | 3300049576 | Bacteria | 3235 |
| 659 | Ga0501040_0172185 | 3300049576 | Bacteria | 1533 |
| 660 | Ga0501040_0239664 | 3300049576 | Bacteria | 1293 |
| 661 | Ga0501040_0499288 | 3300049576 | Bacteria | 877 |
| 662 | Ga0501040_0539796 | 3300049576 | Bacteria | 841 |
| 663 | Ga0501041_0234840 | 3300049577 | Bacteria | 1152 |
| 664 | Ga0501042_0140822 | 3300049578 | Bacteria | 1739 |
| 665 | Ga0501042_0235172 | 3300049578 | Bacteria | 1322 |
| 666 | Ga0501042_0248255 | 3300049578 | Bacteria | 1284 |
| 667 | Ga0501042_0272846 | 3300049578 | Bacteria | 1221 |
| 668 | Ga0501043_0001784 | 3300049579 | Bacteria | 18501 |
| 669 | Ga0501046_0000447 | 3300049580 | Bacteria | 41432 |
| 670 | Ga0501047_0001305 | 3300049581 | Bacteria | 24582 |
| 671 | Ga0501047_0011129 | 3300049581 | Bacteria | 8514 |
| 672 | Ga0501047_0233390 | 3300049581 | Bacteria | 1692 |
| 673 | Ga0501048_0004752 | 3300049582 | Bacteria | 10347 |
| 674 | Ga0501048_0856107 | 3300049582 | Unclassified | 653 |
| 675 | Ga0501067_0076446 | 3300049583 | Bacteria | 1855 |
| 676 | Ga0501068_0033463 | 3300049584 | Bacteria | 3061 |
| 677 | Ga0501068_0308531 | 3300049584 | Unclassified | 1013 |
| 678 | Ga0501068_0870377 | 3300049584 | Bacteria | 592 |
| 679 | Ga0501069_0004400 | 3300049585 | Bacteria | 7276 |
| 680 | Ga0501069_0034969 | 3300049585 | Bacteria | 2766 |
| 681 | Ga0501070_0010491 | 3300049586 | Bacteria | 7834 |
| 682 | Ga0501070_0108970 | 3300049586 | Bacteria | 2288 |
| 683 | Ga0501070_0275899 | 3300049586 | Bacteria | 1372 |
| 684 | Ga0501071_0015488 | 3300049587 | Bacteria | 5236 |
| 685 | Ga0501072_0055136 | 3300049588 | Bacteria | 3133 |
| 686 | Ga0501072_0405066 | 3300049588 | Bacteria | 1082 |
| 687 | Ga0501073_0004789 | 3300049589 | Bacteria | 10153 |
| 688 | Ga0501074_0015719 | 3300049590 | Bacteria | 5503 |
| 689 | Ga0501074_0024609 | 3300049590 | Bacteria | 4375 |
| 690 | Ga0501074_0199429 | 3300049590 | Bacteria | 1426 |
| 691 | Ga0501075_0000392 | 3300049591 | Bacteria | 25374 |
| 692 | Ga0501075_0249342 | 3300049591 | Bacteria | 1353 |
| 693 | Ga0501076_0099879 | 3300049592 | Bacteria | 2338 |
| 694 | Ga0501077_0478258 | 3300049593 | Bacteria | 798 |
| 695 | Ga0501079_0008691 | 3300049741 | Bacteria | 7703 |
| 696 | Ga0501079_0353469 | 3300049741 | Bacteria | 1151 |
| 697 | Ga0501079_0354803 | 3300049741 | Bacteria | 1149 |
| 698 | Ga0501079_0476060 | 3300049741 | Bacteria | 981 |
| 699 | Ga0501080_0006172 | 3300049742 | Bacteria | 10755 |
| 700 | Ga0501080_0180265 | 3300049742 | Bacteria | 1944 |
| 701 | Ga0501080_0928975 | 3300049742 | Bacteria | 757 |
| 702 | Ga0501083_0013666 | 3300049744 | Bacteria | 5677 |
| 703 | Ga0501035_0001414 | 3300049822 | Bacteria | 24605 |
| 704 | Ga0501044_0004159 | 3300049823 | Bacteria | 16260 |
| 705 | Ga0501044_0057870 | 3300049823 | Bacteria | 3977 |
| 706 | Ga0501044_0071899 | 3300049823 | Bacteria | 3517 |
| 707 | Ga0501044_0281433 | 3300049823 | Bacteria | 1597 |
| 708 | Ga0501044_0569520 | 3300049823 | Bacteria | 1028 |
| 709 | Ga0501045_0013976 | 3300049824 | Bacteria | 5682 |
| 710 | nmdc:mga03n38_31261_c1 | 3300050490 | Bacteria | 2245 |
| 711 | nmdc:mga00v17_138241_c1 | 3300050491 | Bacteria | 1561 |
| 712 | nmdc:mga00v17_335550_c1 | 3300050491 | Bacteria | 983 |
| 713 | nmdc:mga0yw44_333751_c1 | 3300050492 | Unclassified | 1019 |
| 714 | nmdc:mga0yw44_345090_c1 | 3300050492 | Unclassified | 1002 |
| 715 | nmdc:mga0yw44_399180_c1 | 3300050492 | Bacteria | 929 |
| 716 | nmdc:mga0yw44_621268_c1 | 3300050492 | Bacteria | 734 |
| 717 | nmdc:mga06z11_160116_c1 | 3300050494 | Bacteria | 1286 |
| 718 | nmdc:mga06z11_238976_c1 | 3300050494 | Bacteria | 1066 |
| 719 | nmdc:mga07m45_397734_c1 | 3300050496 | Bacteria | 800 |
| 720 | nmdc:mga0qj67_18507_c1 | 3300050509 | Bacteria | 2502 |
| 721 | nmdc:mga06r32_139202_c1 | 3300050510 | Bacteria | 2403 |
| 722 | nmdc:mga06r32_452124_c1 | 3300050510 | Bacteria | 1264 |
| 723 | nmdc:mga08y16_859110_c1 | 3300050511 | Bacteria | 896 |
| 724 | nmdc:mga0n895_689813_c1 | 3300050512 | Bacteria | 1018 |
| 725 | nmdc:mga0rr50_121797_c1 | 3300050513 | Bacteria | 2077 |
| 726 | nmdc:mga0a205_11_c1 | 3300050515 | Bacteria | 121735 |
| 727 | nmdc:mga0a205_1916_c1 | 3300050515 | Bacteria | 18075 |
| 728 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 729 | Ga0495601_0000375 | 3300053077 | Bacteria | 23634 |
| 730 | Ga0495601_0005084 | 3300053077 | Bacteria | 7637 |
| 731 | Ga0495601_0031282 | 3300053077 | Bacteria | 3307 |
| 732 | Ga0495601_0045893 | 3300053077 | Bacteria | 2749 |
| 733 | Ga0495601_0300703 | 3300053077 | Unclassified | 1045 |
| 734 | Ga0495612_0000068 | 3300053078 | Bacteria | 47169 |
| 735 | Ga0495612_0004329 | 3300053078 | Bacteria | 5886 |
| 736 | Ga0495612_0014080 | 3300053078 | Bacteria | 3220 |
| 737 | Ga0495612_0181178 | 3300053078 | Bacteria | 925 |
| 738 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 739 | Ga0495655_0000490 | 3300053083 | Bacteria | 6611 |
| 740 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 741 | Ga0495595_0000087 | 3300053084 | Bacteria | 43931 |
| 742 | Ga0495595_0298648 | 3300053084 | Unclassified | 810 |
| 743 | Ga0495595_0312641 | 3300053084 | Unclassified | 791 |
| 744 | Ga0495595_0543539 | 3300053084 | Bacteria | 593 |
| 745 | Ga0495619_0000021 | 3300053085 | Bacteria | 187095 |
| 746 | Ga0495619_0000055 | 3300053085 | Bacteria | 95570 |
| 747 | Ga0495619_0000686 | 3300053085 | Bacteria | 22138 |
| 748 | Ga0495619_0000693 | 3300053085 | Bacteria | 22004 |
| 749 | Ga0495619_0001229 | 3300053085 | Bacteria | 16759 |
| 750 | Ga0495619_0001468 | 3300053085 | Bacteria | 15538 |
| 751 | Ga0495619_0004285 | 3300053085 | Bacteria | 9094 |
| 752 | Ga0495619_0006064 | 3300053085 | Bacteria | 7655 |
| 753 | Ga0495619_0075869 | 3300053085 | Bacteria | 2256 |
| 754 | Ga0495619_0501248 | 3300053085 | Unclassified | 835 |
| 755 | Ga0500566_0065994 | 3300053094 | Bacteria | 2040 |
| 756 | Ga0500641_0033819 | 3300053096 | Bacteria | 2032 |
| 757 | Ga0500595_030412 | 3300053119 | Bacteria | 1819 |
| 758 | Ga0500614_002777 | 3300053123 | Bacteria | 3860 |
| 759 | Ga0500628_000065 | 3300053129 | Bacteria | 28526 |
| 760 | Ga0500658_0280389 | 3300053134 | Bacteria | 766 |
| 761 | Ga0501082_0006423 | 3300060353 | Bacteria | 10199 |
| 762 | Ga0530510_0184486 | 3300061734 | Unclassified | 1548 |
| 763 | 2688392987 | 2687453341 | Bacteria | 6534136 |
| 764 | Ga0466969_0083434 | |||
| 765 | CNAas_1006854 | |||
| 766 | JGI24746J21847_1005799 | |||
| 767 | JGI24740J21852_10002815 | |||
| 768 | JGI24034J26672_10005937 | |||
| 769 | JGI25406J46586_10039637 | |||
| 770 | Ga0065712_10069154 | |||
| 771 | Ga0065707_10084840 | |||
| 772 | Ga0070658_10077786 | |||
| 773 | Ga0070683_100010078 | |||
| 774 | Ga0070683_100011036 | |||
| 775 | Ga0070683_100012140 | |||
| 776 | Ga0070683_100030156 | |||
| 777 | Ga0070683_100165039 | |||
| 778 | Ga0070690_100049889 | |||
| 779 | Ga0070670_100001805 | |||
| 780 | Ga0070677_10000304 | |||
| 781 | Ga0070666_10017281 | |||
| 782 | Ga0070680_100228523 | |||
| 783 | Ga0070682_100000013 | |||
| 784 | Ga0070682_100000045 | |||
| 785 | Ga0070682_100469466 | |||
| 786 | Ga0068868_100000295 | |||
| 787 | Ga0068868_100000932 | |||
| 788 | Ga0070660_100363346 | |||
| 789 | Ga0070660_101322907 | |||
| 790 | Ga0070689_100105307 | |||
| 791 | Ga0070689_100173254 | |||
| 792 | Ga0070689_100557574 | |||
| 793 | Ga0070689_100674281 | |||
| 794 | Ga0070691_10149338 | |||
| 795 | Ga0070661_100000023 | |||
| 796 | Ga0070661_100161889 | |||
| 797 | Ga0070692_10079068 | |||
| 798 | Ga0070668_100029215 | |||
| 799 | Ga0070669_100618199 | |||
| 800 | Ga0070675_100000101 | |||
| 801 | Ga0070671_100070694 | |||
| 802 | Ga0070674_100000008 | |||
| 803 | Ga0070674_100000420 | |||
| 804 | Ga0070674_100159744 | |||
| 805 | Ga0070688_100000630 | |||
| 806 | Ga0070688_100009960 | |||
| 807 | Ga0070659_100007823 | |||
| 808 | Ga0070659_100929202 | |||
| 809 | Ga0070667_100000695 | |||
| 810 | Ga0070667_100016006 | |||
| 811 | Ga0070667_100139585 | |||
| 812 | Ga0070667_100323466 | |||
| 813 | Ga0070713_100000009 | |||
| 814 | Ga0070713_100255245 | |||
| 815 | Ga0070710_10773292 | |||
| 816 | Ga0070701_10686759 | |||
| 817 | Ga0070711_100003211 | |||
| 818 | Ga0070700_100162825 | |||
| 819 | Ga0070663_100008028 | |||
| 820 | Ga0070678_100016400 | |||
| 821 | Ga0070678_100038206 | |||
| 822 | Ga0070678_100047702 | |||
| 823 | Ga0070662_100000016 | |||
| 824 | Ga0070662_100475057 | |||
| 825 | Ga0070681_10468870 | |||
| 826 | Ga0068867_100000266 | |||
| 827 | Ga0070685_10000282 | |||
| 828 | Ga0070685_10000320 | |||
| 829 | Ga0070685_10057809 | |||
| 830 | Ga0070685_10324229 | |||
| 831 | Ga0070685_10467575 | |||
| 832 | Ga0070679_100000312 | |||
| 833 | Ga0070679_100002552 | |||
| 834 | Ga0070684_100030530 | |||
| 835 | Ga0070684_100090451 | |||
| 836 | Ga0070684_100164720 | |||
| 837 | Ga0070684_100453830 | |||
| 838 | Ga0068853_100003759 | |||
| 839 | Ga0070672_100000091 | |||
| 840 | Ga0070672_100334086 | |||
| 841 | Ga0070686_100138695 | |||
| 842 | Ga0070695_100170227 | |||
| 843 | Ga0070693_100024199 | |||
| 844 | Ga0070693_100718691 | |||
| 845 | Ga0070665_100000244 | |||
| 846 | Ga0070665_100110821 | |||
| 847 | Ga0070665_100154033 | |||
| 848 | Ga0070665_101882851 | |||
| 849 | Ga0070664_100079495 | |||
| 850 | Ga0070664_100962566 | |||
| 851 | Ga0068854_100000031 | |||
| 852 | Ga0068854_100102023 | |||
| 853 | Ga0068856_100001194 | |||
| 854 | Ga0068856_100299042 | |||
| 855 | Ga0068856_101389986 | |||
| 856 | Ga0070702_100032719 | |||
| 857 | Ga0068852_100000296 | |||
| 858 | Ga0068852_100109252 | |||
| 859 | Ga0068864_100000045 | |||
| 860 | Ga0068864_100454660 | |||
| 861 | Ga0068866_10000001 | |||
| 862 | Ga0068866_10000031 | |||
| 863 | Ga0068866_10087780 | |||
| 864 | Ga0068861_100067065 | |||
| 865 | Ga0068851_10000959 | |||
| 866 | Ga0068851_10042907 | |||
| 867 | Ga0068863_100000021 | |||
| 868 | Ga0068863_100280529 | |||
| 869 | Ga0068863_101161460 | |||
| 870 | Ga0068858_100000267 | |||
| 871 | Ga0068858_100000590 | |||
| 872 | Ga0068858_100066261 | |||
| 873 | Ga0068860_100004861 | |||
| 874 | Ga0068860_100100343 | |||
| 875 | Ga0068860_100160572 | |||
| 876 | Ga0068862_100000574 | |||
| 877 | Ga0081455_10087654 | |||
| 878 | Ga0081455_10137725 | |||
| 879 | Ga0081540_1000006 | |||
| 880 | Ga0081539_10001929 | |||
| 881 | Ga0075365_10007580 | |||
| 882 | Ga0075365_10164770 | |||
| 883 | Ga0075365_10175589 | |||
| 884 | Ga0075365_10264805 | |||
| 885 | Ga0075365_10520433 | |||
| 886 | Ga0075368_10210043 | |||
| 887 | Ga0075363_100165762 | |||
| 888 | Ga0075364_10097398 | |||
| 889 | Ga0075364_10179647 | |||
| 890 | Ga0075364_10235430 | |||
| 891 | Ga0075364_10296896 | |||
| 892 | Ga0075364_10508383 | |||
| 893 | Ga0070715_10000001 | |||
| 894 | Ga0070715_10147483 | |||
| 895 | Ga0070712_100000861 | |||
| 896 | Ga0075370_10296481 | |||
| 897 | Ga0068871_100609973 | |||
| 898 | Ga0075428_100108905 | |||
| 899 | Ga0075430_100038515 | |||
| 900 | Ga0075431_100245030 | |||
| 901 | Ga0075433_10001485 | |||
| 902 | Ga0075433_10634438 | |||
| 903 | Ga0075434_100755453 | |||
| 904 | Ga0075434_100765805 | |||
| 905 | Ga0068865_100000104 | |||
| 906 | Ga0075435_100151445 | |||
| 907 | Ga0099795_10176397 | |||
| 908 | Ga0105240_10515788 | |||
| 909 | Ga0111539_10287044 | |||
| 910 | Ga0111539_10683862 | |||
| 911 | Ga0105245_10000016 | |||
| 912 | Ga0105245_10001174 | |||
| 913 | Ga0105245_10012141 | |||
| 914 | Ga0105245_10022734 | |||
| 915 | Ga0105245_10338491 | |||
| 916 | Ga0105245_10478092 | |||
| 917 | Ga0105245_12844661 | |||
| 918 | Ga0105247_10031141 | |||
| 919 | Ga0105247_10133146 | |||
| 920 | Ga0105243_10013108 | |||
| 921 | Ga0105241_10046390 | |||
| 922 | Ga0105242_10000194 | |||
| 923 | Ga0105242_10002493 | |||
| 924 | Ga0105242_10012731 | |||
| 925 | Ga0105242_10026007 | |||
| 926 | Ga0105242_10410785 | |||
| 927 | Ga0105242_10606584 | |||
| 928 | Ga0105242_12805908 | |||
| 929 | Ga0105248_10000118 | |||
| 930 | Ga0105248_10949567 | |||
| 931 | Ga0105248_11707398 | |||
| 932 | Ga0105237_10297220 | |||
| 933 | Ga0105238_10000011 | |||
| 934 | Ga0105238_10696161 | |||
| 935 | Ga0105249_10000068 | |||
| 936 | Ga0105249_10002838 | |||
| 937 | Ga0105249_10223344 | |||
| 938 | Ga0105239_10533398 | |||
| 939 | Ga0105246_10248540 | |||
| 940 | Ga0157371_10067585 | |||
| 941 | Ga0157370_10010547 | |||
| 942 | Ga0157370_10016083 | |||
| 943 | Ga0157370_10178725 | |||
| 944 | Ga0157369_10001239 | |||
| 945 | Ga0157374_10001108 | |||
| 946 | Ga0157374_10684732 | |||
| 947 | Ga0157374_11096164 | |||
| 948 | Ga0157374_11226299 | |||
| 949 | Ga0157378_10014344 | |||
| 950 | Ga0157378_10098803 | |||
| 951 | Ga0157378_10507637 | |||
| 952 | Ga0163162_10557094 | |||
| 953 | Ga0157372_10000409 | |||
| 954 | Ga0157372_12639357 | |||
| 955 | Ga0157375_10000112 | |||
| 956 | Ga0157375_10010730 | |||
| 957 | Ga0157375_10026721 | |||
| 958 | Ga0157375_11309357 | |||
| 959 | Ga0163163_11173504 | |||
| 960 | Ga0163163_11495499 | |||
| 961 | Ga0157380_10000815 | |||
| 962 | Ga0157380_10005360 | |||
| 963 | Ga0157377_10429215 | |||
| 964 | Ga0157379_10017130 | |||
| 965 | Ga0157379_10090784 | |||
| 966 | Ga0157379_10668770 | |||
| 967 | Ga0157379_11446140 | |||
| 968 | Ga0157376_10392911 | |||
| 969 | Ga0157376_10557825 | |||
| 970 | Ga0157376_10884652 | |||
| 971 | Ga0157376_11790415 | |||
| 972 | Ga0163161_10000032 | |||
| 973 | Ga0163161_10028383 | |||
| 974 | Ga0206356_10092693 | |||
| 975 | Ga0213876_10006509 | |||
| 976 | Ga0207656_10000116 | |||
| 977 | Ga0207656_10015276 | |||
| 978 | Ga0207682_10000557 | |||
| 979 | Ga0207642_10000031 | |||
| 980 | Ga0207642_10000034 | |||
| 981 | Ga0207642_10071601 | |||
| 982 | Ga0207710_10000158 | |||
| 983 | Ga0207710_10068473 | |||
| 984 | Ga0207710_10151792 | |||
| 985 | Ga0207680_10010482 | |||
| 986 | Ga0207647_10239817 | |||
| 987 | Ga0207685_10001023 | |||
| 988 | Ga0207705_10471049 | |||
| 989 | Ga0207654_10068678 | |||
| 990 | Ga0207707_10316588 | |||
| 991 | Ga0207693_10001956 | |||
| 992 | Ga0207663_10016385 | |||
| 993 | Ga0207657_10633040 | |||
| 994 | Ga0207649_10000063 | |||
| 995 | Ga0207649_10114915 | |||
| 996 | Ga0207649_10270266 | |||
| 997 | Ga0207652_10000483 | |||
| 998 | Ga0207652_10016512 | |||
| 999 | Ga0207681_10164246 | |||
| 1000 | Ga0207681_10708216 | |||
| 1001 | Ga0207694_10000004 | |||
| 1002 | Ga0207650_10200390 | |||
| 1003 | Ga0207659_10000010 | |||
| 1004 | Ga0207659_10567371 | |||
| 1005 | Ga0207687_10000007 | |||
| 1006 | Ga0207687_10000018 | |||
| 1007 | Ga0207687_10000247 | |||
| 1008 | Ga0207687_10083702 | |||
| 1009 | Ga0207687_10623102 | |||
| 1010 | Ga0207700_10000025 | |||
| 1011 | Ga0207644_10049758 | |||
| 1012 | Ga0207690_10003697 | |||
| 1013 | Ga0207690_10666306 | |||
| 1014 | Ga0207706_10000068 | |||
| 1015 | Ga0207706_10492894 | |||
| 1016 | Ga0207686_10000033 | |||
| 1017 | Ga0207686_10001608 | |||
| 1018 | Ga0207686_10011451 | |||
| 1019 | Ga0207686_10030935 | |||
| 1020 | Ga0207686_10373910 | |||
| 1021 | Ga0207686_10580000 | |||
| 1022 | Ga0207709_10022268 | |||
| 1023 | Ga0207709_10199288 | |||
| 1024 | Ga0207670_10104300 | |||
| 1025 | Ga0207670_10111508 | |||
| 1026 | Ga0207669_10000004 | |||
| 1027 | Ga0207669_10000012 | |||
| 1028 | Ga0207704_10000146 | |||
| 1029 | Ga0207704_10467684 | |||
| 1030 | Ga0207691_10001039 | |||
| 1031 | Ga0207691_10419680 | |||
| 1032 | Ga0207711_10000020 | |||
| 1033 | Ga0207711_10873339 | |||
| 1034 | Ga0207689_10226011 | |||
| 1035 | Ga0207661_10000095 | |||
| 1036 | Ga0207661_10006791 | |||
| 1037 | Ga0207661_10039585 | |||
| 1038 | Ga0207661_10194494 | |||
| 1039 | Ga0207661_10589589 | |||
| 1040 | Ga0207679_10058121 | |||
| 1041 | Ga0207679_10084869 | |||
| 1042 | Ga0207651_10009892 | |||
| 1043 | Ga0207651_10302916 | |||
| 1044 | Ga0207712_10000007 | |||
| 1045 | Ga0207712_10004331 | |||
| 1046 | Ga0207712_10405647 | |||
| 1047 | Ga0207640_10000015 | |||
| 1048 | Ga0207640_10078284 | |||
| 1049 | Ga0207658_10007907 | |||
| 1050 | Ga0207658_10019385 | |||
| 1051 | Ga0207658_10066688 | |||
| 1052 | Ga0207658_10312659 | |||
| 1053 | Ga0207658_10414065 | |||
| 1054 | Ga0207677_10000654 | |||
| 1055 | Ga0207703_10000020 | |||
| 1056 | Ga0207703_10000040 | |||
| 1057 | Ga0207639_10005159 | |||
| 1058 | Ga0207639_10703153 | |||
| 1059 | Ga0207678_10002913 | |||
| 1060 | Ga0207678_10058376 | |||
| 1061 | Ga0207678_10654020 | |||
| 1062 | Ga0207708_10242567 | |||
| 1063 | Ga0207708_10269015 | |||
| 1064 | Ga0207702_10000607 | |||
| 1065 | Ga0207702_10008495 | |||
| 1066 | Ga0207702_10008687 | |||
| 1067 | Ga0207641_10000151 | |||
| 1068 | Ga0207641_10098430 | |||
| 1069 | Ga0207641_10485255 | |||
| 1070 | Ga0207641_10785370 | |||
| 1071 | Ga0207648_10000848 | |||
| 1072 | Ga0207676_10000016 | |||
| 1073 | Ga0207675_100095533 | |||
| 1074 | Ga0207675_100168665 | |||
| 1075 | Ga0207683_10025316 | |||
| 1076 | Ga0207683_11573880 | |||
| 1077 | Ga0207698_10000012 | |||
| 1078 | Ga0207698_10064404 | |||
| 1079 | Ga0209179_1051211 | |||
| 1080 | Ga0268266_10000020 | |||
| 1081 | Ga0268266_10000085 | |||
| 1082 | Ga0268266_10002765 | |||
| 1083 | Ga0268266_10018111 | |||
| 1084 | Ga0268266_10074048 | |||
| 1085 | Ga0268266_10274707 | |||
| 1086 | Ga0268266_10915252 | |||
| 1087 | Ga0268265_10000555 | |||
| 1088 | Ga0268264_10001865 | |||
| 1089 | Ga0268264_10049545 | |||
| 1090 | Ga0268264_10258869 | |||
| 1091 | Ga0268264_10628640 | |||
| 1092 | Ga0265337_1000002 | |||
| 1093 | Ga0265326_10000007 | |||
| 1094 | Ga0265319_1000025 | |||
| 1095 | Ga0265334_10138385 | |||
| 1096 | Ga0265322_10000001 | |||
| 1097 | Ga0265336_10002423 | |||
| 1098 | Ga0265338_10000486 | |||
| 1099 | Ga0265324_10001406 | |||
| 1100 | Ga0265332_10013614 | |||
| 1101 | Ga0265328_10004948 | |||
| 1102 | Ga0265320_10000002 | |||
| 1103 | Ga0265325_10011240 | |||
| 1104 | Ga0265331_10001248 | |||
| 1105 | Ga0265331_10085751 | |||
| 1106 | Ga0265327_10000011 | |||
| 1107 | Ga0265327_10284169 | |||
| 1108 | Ga0265316_10130135 | |||
| 1109 | Ga0265313_10056508 | |||
| 1110 | Ga0265314_10000058 | |||
| 1111 | Ga0265342_10112891 | |||
| 1112 | Ga0316576_10009403 | |||
| 1113 | Ga0316578_10207131 | |||
| 1114 | Ga0307413_10045212 | |||
| 1115 | Ga0307406_10036814 | |||
| 1116 | Ga0307406_10157073 | |||
| 1117 | Ga0307407_10143276 | |||
| 1118 | Ga0307412_10581902 | |||
| 1119 | Ga0307409_100251698 | |||
| 1120 | Ga0307416_100482072 | |||
| 1121 | Ga0307411_10095772 | |||
| 1122 | Ga0307415_100186306 | |||
| 1123 | Ga0307415_101108797 | |||
| 1124 | Ga0316574_0014874 | |||
| 1125 | Ga0373937_0026804 | |||
| 1126 | Ga0373937_1046409 | |||
| 1127 | Ga0316584_0000602 | |||
| 1128 | Ga0395900_0334952 | |||
| 1129 | Ga0395898_0650224 | |||
| 1130 | Ga0395905_1399238 | |||
| 1131 | Ga0395901_0113640 | |||
| 1132 | Ga0395901_0843364 | |||
| 1133 | Ga0436365_1172353 | |||
| 1134 | Ga0451791_0943522 | |||
| 1135 | Ga0451798_0221974 | |||
| 1136 | Ga0451800_0460762 | |||
| 1137 | Ga0451804_1141688 | |||
| 1138 | Ga0451807_0132026 | |||
| 1139 | Ga0451807_1153546 | |||
| 1140 | Ga0451839_0784527 | |||
| 1141 | Ga0451849_0101462 | |||
| 1142 | Ga0451853_1663165 | |||
| 1143 | Ga0451853_3370634 | |||
| 1144 | Ga0466966_0070471 | |||
| 1145 | Ga0466966_0139209 | |||
| 1146 | Ga0466961_0030779 | |||
| 1147 | Ga0466963_0000282 | |||
| 1148 | Ga0466963_0047615 | |||
| 1149 | Ga0466970_0259807 | |||
| 1150 | Ga0466957_0000505 | |||
| 1151 | Ga0466957_1236977 | |||
| 1152 | Ga0466960_0086457 | |||
| 1153 | Ga0466959_0074369 | |||
| 1154 | Ga0466958_0053807 | |||
| 1155 | Ga0466958_0232421 | |||
| 1156 | Ga0466967_0000027 | |||
| 1157 | Ga0466967_0015351 | |||
| 1158 | Ga0466967_0190424 | |||
| 1159 | Ga0466967_2600135 | |||
| 1160 | Ga0495592_0000036 | |||
| 1161 | Ga0495592_0065899 | |||
| 1162 | Ga0495592_0254161 | |||
| 1163 | Ga0495592_0302439 | |||
| 1164 | Ga0495603_0000030 | |||
| 1165 | Ga0495603_0001449 | |||
| 1166 | Ga0495603_0010404 | |||
| 1167 | Ga0495591_033913 | |||
| 1168 | Ga0495629_0000189 | |||
| 1169 | Ga0495629_0000801 | |||
| 1170 | Ga0495629_0009458 | |||
| 1171 | Ga0495629_0232952 | |||
| 1172 | Ga0495638_0018430 | |||
| 1173 | Ga0495641_0000003 | |||
| 1174 | Ga0495641_0020001 | |||
| 1175 | Ga0495641_0128647 | |||
| 1176 | Ga0495651_0099628 | |||
| 1177 | Ga0495651_0104239 | |||
| 1178 | Ga0495651_0137588 | |||
| 1179 | Ga0495653_0024689 | |||
| 1180 | Ga0495653_0113162 | |||
| 1181 | Ga0495653_0161989 | |||
| 1182 | Ga0495653_0173474 | |||
| 1183 | Ga0495653_0373362 | |||
| 1184 | Ga0495582_0000029 | |||
| 1185 | Ga0495639_0185199 | |||
| 1186 | Ga0495662_0001090 | |||
| 1187 | Ga0495662_0011508 | |||
| 1188 | Ga0495662_0312919 | |||
| 1189 | Ga0495664_0290237 | |||
| 1190 | Ga0495594_0000003 | |||
| 1191 | Ga0495594_0613284 | |||
| 1192 | Ga0495596_0247532 | |||
| 1193 | Ga0495606_0000221 | |||
| 1194 | Ga0495608_0000189 | |||
| 1195 | Ga0495608_0000305 | |||
| 1196 | Ga0495608_0005739 | |||
| 1197 | Ga0495608_0044964 | |||
| 1198 | Ga0495608_0091569 | |||
| 1199 | Ga0495618_0001080 | |||
| 1200 | Ga0495620_0000210 | |||
| 1201 | Ga0495620_0280640 | |||
| 1202 | Ga0495628_0000144 | |||
| 1203 | Ga0495628_0002445 | |||
| 1204 | Ga0495628_0043803 | |||
| 1205 | Ga0495628_0070641 | |||
| 1206 | Ga0495628_0091636 | |||
| 1207 | Ga0495628_0118502 | |||
| 1208 | Ga0495628_0752376 | |||
| 1209 | Ga0495630_0000018 | |||
| 1210 | Ga0495630_0013185 | |||
| 1211 | Ga0495630_0015188 | |||
| 1212 | Ga0495630_0017005 | |||
| 1213 | Ga0495630_0201118 | |||
| 1214 | Ga0495630_1038290 | |||
| 1215 | Ga0495632_0138251 | |||
| 1216 | Ga0495637_0162884 | |||
| 1217 | Ga0495644_0004801 | |||
| 1218 | Ga0495652_0000019 | |||
| 1219 | Ga0495652_0017587 | |||
| 1220 | Ga0495652_0168745 | |||
| 1221 | Ga0495652_0975175 | |||
| 1222 | Ga0495640_0059087 | |||
| 1223 | Ga0495640_0084193 | |||
| 1224 | Ga0495640_0510064 | |||
| 1225 | Ga0495586_0001014 | |||
| 1226 | Ga0495587_0003399 | |||
| 1227 | Ga0495587_0013375 | |||
| 1228 | Ga0495587_0142412 | |||
| 1229 | Ga0495587_0152292 | |||
| 1230 | Ga0495587_0205171 | |||
| 1231 | Ga0495598_0001175 | |||
| 1232 | Ga0495621_0007201 | |||
| 1233 | Ga0495645_0008291 | |||
| 1234 | Ga0495622_0000714 | |||
| 1235 | Ga0495667_0000032 | |||
| 1236 | Ga0495667_0060268 | |||
| 1237 | Ga0495656_0007393 | |||
| 1238 | Ga0495634_0000401 | |||
| 1239 | Ga0495634_0000801 | |||
| 1240 | Ga0495634_0022201 | |||
| 1241 | Ga0495634_0068652 | |||
| 1242 | Ga0495634_0207519 | |||
| 1243 | Ga0495625_0000766 | |||
| 1244 | Ga0495635_0000016 | |||
| 1245 | Ga0495635_0011612 | |||
| 1246 | Ga0495635_0159726 | |||
| 1247 | Ga0495635_0162253 | |||
| 1248 | Ga0495588_0000274 | |||
| 1249 | Ga0495588_0167166 | |||
| 1250 | Ga0495657_0000004 | |||
| 1251 | Ga0495657_0011664 | |||
| 1252 | Ga0495657_0031495 | |||
| 1253 | Ga0495647_0000054 | |||
| 1254 | Ga0495647_0001792 | |||
| 1255 | Ga0495647_0052774 | |||
| 1256 | Ga0495647_0103561 | |||
| 1257 | Ga0495658_0000026 | |||
| 1258 | Ga0495658_0014198 | |||
| 1259 | Ga0495658_0314478 | |||
| 1260 | Ga0495669_0000088 | |||
| 1261 | Ga0495613_0000370 | |||
| 1262 | Ga0495613_0000577 | |||
| 1263 | Ga0495613_0283519 | |||
| 1264 | Ga0495613_0284376 | |||
| 1265 | Ga0495613_0325635 | |||
| 1266 | Ga0495613_0674461 | |||
| 1267 | Ga0495624_0000008 | |||
| 1268 | Ga0495624_0001409 | |||
| 1269 | Ga0495624_0002494 | |||
| 1270 | Ga0495624_0236104 | |||
| 1271 | Ga0495670_0016652 | |||
| 1272 | Ga0495649_0003647 | |||
| 1273 | Ga0495600_0001624 | |||
| 1274 | Ga0495600_0044263 | |||
| 1275 | Ga0495600_0089123 | |||
| 1276 | Ga0495600_0217382 | |||
| 1277 | Ga0495600_0700942 | |||
| 1278 | Ga0495604_0000019 | |||
| 1279 | Ga0495604_0003700 | |||
| 1280 | Ga0495604_0066021 | |||
| 1281 | Ga0495604_0316450 | |||
| 1282 | Ga0495674_0000251 | |||
| 1283 | Ga0495674_0566594 | |||
| 1284 | Ga0495672_0199335 | |||
| 1285 | Ga0495676_0010037 | |||
| 1286 | Ga0495676_0038905 | |||
| 1287 | Ga0495676_0051454 | |||
| 1288 | Ga0495676_0111822 | |||
| 1289 | Ga0495676_0154115 | |||
| 1290 | Ga0495676_0491861 | |||
| 1291 | Ga0495676_0533824 | |||
| 1292 | Ga0495680_0000317 | |||
| 1293 | Ga0495680_0000647 | |||
| 1294 | Ga0495680_0007802 | |||
| 1295 | Ga0495680_0341178 | |||
| 1296 | Ga0495675_0001341 | |||
| 1297 | Ga0495675_0026270 | |||
| 1298 | Ga0495679_015031 | |||
| 1299 | Ga0495679_191165 | |||
| 1300 | Ga0495684_0238650 | |||
| 1301 | Ga0495684_0282424 | |||
| 1302 | Ga0495686_0034881 | |||
| 1303 | Ga0495593_0006348 | |||
| 1304 | Ga0495602_0000021 | |||
| 1305 | Ga0495602_0015275 | |||
| 1306 | Ga0495602_0130660 | |||
| 1307 | Ga0495602_0215104 | |||
| 1308 | Ga0495602_0280991 | |||
| 1309 | Ga0495602_0587806 | |||
| 1310 | Ga0495614_0012964 | |||
| 1311 | Ga0496100_0000002 | |||
| 1312 | Ga0496100_0000018 | |||
| 1313 | Ga0496100_1477223 | |||
| 1314 | Ga0496101_0000001 | |||
| 1315 | Ga0496101_0000308 | |||
| 1316 | Ga0496102_0000039 | |||
| 1317 | Ga0496102_0089336 | |||
| 1318 | Ga0496102_0264686 | |||
| 1319 | Ga0496102_1083683 | |||
| 1320 | Ga0496102_1269716 | |||
| 1321 | Ga0496103_0000008 | |||
| 1322 | Ga0496103_0089068 | |||
| 1323 | Ga0496104_0000004 | |||
| 1324 | Ga0496104_0000009 | |||
| 1325 | Ga0496104_0000129 | |||
| 1326 | Ga0496104_0182436 | |||
| 1327 | Ga0496104_1215502 | |||
| 1328 | Ga0496105_0000001 | |||
| 1329 | Ga0496105_0000027 | |||
| 1330 | Ga0496105_0000511 | |||
| 1331 | Ga0496105_0008230 | |||
| 1332 | Ga0496105_0014230 | |||
| 1333 | Ga0496105_0422647 | |||
| 1334 | Ga0496106_0000081 | |||
| 1335 | Ga0496106_0000098 | |||
| 1336 | Ga0496106_0000229 | |||
| 1337 | Ga0496106_0078856 | |||
| 1338 | Ga0496106_0210406 | |||
| 1339 | Ga0496107_0000006 | |||
| 1340 | Ga0496107_0000013 | |||
| 1341 | Ga0496107_0709230 | |||
| 1342 | Ga0496108_0000001 | |||
| 1343 | Ga0496108_0000132 | |||
| 1344 | Ga0496108_0000630 | |||
| 1345 | Ga0496108_0042653 | |||
| 1346 | Ga0496108_0114695 | |||
| 1347 | Ga0496108_0165736 | |||
| 1348 | Ga0496108_0839882 | |||
| 1349 | Ga0496109_0000003 | |||
| 1350 | Ga0496109_0000007 | |||
| 1351 | Ga0496109_0000028 | |||
| 1352 | Ga0496109_0000168 | |||
| 1353 | Ga0496109_0094874 | |||
| 1354 | Ga0496109_0596439 | |||
| 1355 | Ga0496109_0738918 | |||
| 1356 | Ga0496110_0000492 | |||
| 1357 | Ga0496110_0018459 | |||
| 1358 | Ga0496110_0056188 | |||
| 1359 | Ga0496110_0363992 | |||
| 1360 | Ga0496111_0003195 | |||
| 1361 | Ga0496111_0031556 | |||
| 1362 | Ga0496111_0136876 | |||
| 1363 | Ga0496111_0196551 | |||
| 1364 | Ga0496111_0205415 | |||
| 1365 | Ga0496112_0000003 | |||
| 1366 | Ga0496112_0011739 | |||
| 1367 | Ga0496112_0163523 | |||
| 1368 | Ga0496112_0271352 | |||
| 1369 | Ga0496112_1410400 | |||
| 1370 | Ga0496113_0000029 | |||
| 1371 | Ga0496113_0011781 | |||
| 1372 | Ga0496113_0021073 | |||
| 1373 | Ga0496113_0047500 | |||
| 1374 | Ga0496113_0071145 | |||
| 1375 | Ga0496113_0880026 | |||
| 1376 | Ga0496113_1075718 | |||
| 1377 | Ga0496114_0000014 | |||
| 1378 | Ga0496114_0113621 | |||
| 1379 | Ga0496114_0556382 | |||
| 1380 | Ga0496115_0000003 | |||
| 1381 | Ga0496115_0000828 | |||
| 1382 | Ga0496115_0023412 | |||
| 1383 | Ga0496116_0003216 | |||
| 1384 | Ga0496117_0007379 | |||
| 1385 | Ga0496117_0156799 | |||
| 1386 | Ga0496118_0009262 | |||
| 1387 | Ga0496118_0058765 | |||
| 1388 | Ga0496119_0004563 | |||
| 1389 | Ga0496119_0009421 | |||
| 1390 | Ga0496119_0022258 | |||
| 1391 | Ga0496119_0186383 | |||
| 1392 | Ga0496119_0311796 | |||
| 1393 | Ga0496120_0038980 | |||
| 1394 | Ga0496120_0042949 | |||
| 1395 | Ga0496120_0335365 | |||
| 1396 | Ga0496121_0018218 | |||
| 1397 | Ga0496121_0031743 | |||
| 1398 | Ga0496121_0108177 | |||
| 1399 | Ga0496121_0186024 | |||
| 1400 | Ga0496121_0313075 | |||
| 1401 | Ga0496124_0184910 | |||
| 1402 | Ga0496124_0187766 | |||
| 1403 | Ga0496124_0507460 | |||
| 1404 | Ga0496125_0068748 | |||
| 1405 | Ga0496126_0024325 | |||
| 1406 | Ga0496126_0287100 | |||
| 1407 | Ga0501031_0003232 | |||
| 1408 | Ga0501032_0006009 | |||
| 1409 | Ga0501033_0001866 | |||
| 1410 | Ga0501034_0002092 | |||
| 1411 | Ga0501034_0005614 | |||
| 1412 | Ga0501034_0063638 | |||
| 1413 | Ga0501034_0321996 | |||
| 1414 | Ga0501034_0725009 | |||
| 1415 | Ga0501034_1008738 | |||
| 1416 | Ga0501036_0001911 | |||
| 1417 | Ga0501037_0001803 | |||
| 1418 | Ga0501038_0007182 | |||
| 1419 | Ga0501039_0129511 | |||
| 1420 | Ga0501039_0587375 | |||
| 1421 | Ga0501040_0038891 | |||
| 1422 | Ga0501040_0172185 | |||
| 1423 | Ga0501040_0239664 | |||
| 1424 | Ga0501040_0499288 | |||
| 1425 | Ga0501040_0539796 | |||
| 1426 | Ga0501041_0234840 | |||
| 1427 | Ga0501042_0140822 | |||
| 1428 | Ga0501042_0235172 | |||
| 1429 | Ga0501042_0248255 | |||
| 1430 | Ga0501042_0272846 | |||
| 1431 | Ga0501043_0001784 | |||
| 1432 | Ga0501046_0000447 | |||
| 1433 | Ga0501047_0001305 | |||
| 1434 | Ga0501047_0011129 | |||
| 1435 | Ga0501047_0233390 | |||
| 1436 | Ga0501048_0004752 | |||
| 1437 | Ga0501048_0856107 | |||
| 1438 | Ga0501067_0076446 | |||
| 1439 | Ga0501068_0033463 | |||
| 1440 | Ga0501068_0308531 | |||
| 1441 | Ga0501068_0870377 | |||
| 1442 | Ga0501069_0004400 | |||
| 1443 | Ga0501069_0034969 | |||
| 1444 | Ga0501070_0010491 | |||
| 1445 | Ga0501070_0108970 | |||
| 1446 | Ga0501070_0275899 | |||
| 1447 | Ga0501071_0015488 | |||
| 1448 | Ga0501072_0055136 | |||
| 1449 | Ga0501072_0405066 | |||
| 1450 | Ga0501073_0004789 | |||
| 1451 | Ga0501074_0015719 | |||
| 1452 | Ga0501074_0024609 | |||
| 1453 | Ga0501074_0199429 | |||
| 1454 | Ga0501075_0000392 | |||
| 1455 | Ga0501075_0249342 | |||
| 1456 | Ga0501076_0099879 | |||
| 1457 | Ga0501077_0478258 | |||
| 1458 | Ga0501079_0008691 | |||
| 1459 | Ga0501079_0353469 | |||
| 1460 | Ga0501079_0354803 | |||
| 1461 | Ga0501079_0476060 | |||
| 1462 | Ga0501080_0006172 | |||
| 1463 | Ga0501080_0180265 | |||
| 1464 | Ga0501080_0928975 | |||
| 1465 | Ga0501083_0013666 | |||
| 1466 | Ga0501035_0001414 | |||
| 1467 | Ga0501044_0004159 | |||
| 1468 | Ga0501044_0057870 | |||
| 1469 | Ga0501044_0071899 | |||
| 1470 | Ga0501044_0281433 | |||
| 1471 | Ga0501044_0569520 | |||
| 1472 | Ga0501045_0013976 | |||
| 1473 | nmdc:mga03n38_31261_c1 | |||
| 1474 | nmdc:mga00v17_138241_c1 | |||
| 1475 | nmdc:mga00v17_335550_c1 | |||
| 1476 | nmdc:mga0yw44_333751_c1 | |||
| 1477 | nmdc:mga0yw44_345090_c1 | |||
| 1478 | nmdc:mga0yw44_399180_c1 | |||
| 1479 | nmdc:mga0yw44_621268_c1 | |||
| 1480 | nmdc:mga06z11_160116_c1 | |||
| 1481 | nmdc:mga06z11_238976_c1 | |||
| 1482 | nmdc:mga07m45_397734_c1 | |||
| 1483 | nmdc:mga0qj67_18507_c1 | |||
| 1484 | nmdc:mga06r32_139202_c1 | |||
| 1485 | nmdc:mga06r32_452124_c1 | |||
| 1486 | nmdc:mga08y16_859110_c1 | |||
| 1487 | nmdc:mga0n895_689813_c1 | |||
| 1488 | nmdc:mga0rr50_121797_c1 | |||
| 1489 | nmdc:mga0a205_11_c1 | |||
| 1490 | nmdc:mga0a205_1916_c1 | |||
| 1491 | Ga0495601_0000013 | |||
| 1492 | Ga0495601_0000375 | |||
| 1493 | Ga0495601_0005084 | |||
| 1494 | Ga0495601_0031282 | |||
| 1495 | Ga0495601_0045893 | |||
| 1496 | Ga0495601_0300703 | |||
| 1497 | Ga0495612_0000068 | |||
| 1498 | Ga0495612_0004329 | |||
| 1499 | Ga0495612_0014080 | |||
| 1500 | Ga0495612_0181178 | |||
| 1501 | Ga0495655_0000001 | |||
| 1502 | Ga0495655_0000490 | |||
| 1503 | Ga0495595_0000003 | |||
| 1504 | Ga0495595_0000087 | |||
| 1505 | Ga0495595_0298648 | |||
| 1506 | Ga0495595_0312641 | |||
| 1507 | Ga0495595_0543539 | |||
| 1508 | Ga0495619_0000021 | |||
| 1509 | Ga0495619_0000055 | |||
| 1510 | Ga0495619_0000686 | |||
| 1511 | Ga0495619_0000693 | |||
| 1512 | Ga0495619_0001229 | |||
| 1513 | Ga0495619_0001468 | |||
| 1514 | Ga0495619_0004285 | |||
| 1515 | Ga0495619_0006064 | |||
| 1516 | Ga0495619_0075869 | |||
| 1517 | Ga0495619_0501248 | |||
| 1518 | Ga0500566_0065994 | |||
| 1519 | Ga0500641_0033819 | |||
| 1520 | Ga0500595_030412 | |||
| 1521 | Ga0500614_002777 | |||
| 1522 | Ga0500628_000065 | |||
| 1523 | Ga0500658_0280389 | |||
| 1524 | Ga0501082_0006423 | |||
| 1525 | Ga0530510_0184486 | |||
| 1526 | 2688392987 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ljp-assembly2.cif.gz_B | structure of thermotoga maritima smpb | 0.9724 | 15 | 134 |
| 2ob7-assembly1.cif.gz_C | structure of tmrna-(smpb)2 complex as inferred from cryo-em | 0.9327 | 14 | 130 |
| 1wjx-assembly1.cif.gz_A | crystal sturucture of tt0801 from thermus thermophilus | 0.9124 | 17 | 134 |
| 2ob7-assembly1.cif.gz_B | structure of tmrna-(smpb)2 complex as inferred from cryo-em | 0.9092 | 14 | 136 |
| 1p6v-assembly2.cif.gz_C | crystal structure of the trna domain of transfer-messenger rna in complex with smpb | 0.902 | 15 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A832_7_135_2.40.280.10 | Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B | 0.9247 | 11 | 136 | 2.40.280.10 |
| 2czjC00 | Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B | 0.9204 | 18 | 134 | 2.40.280.10 |
| af_P0A832_7_135_2.40.280.10 | Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B | 0.8971 | 11 | 136 | 2.40.280.10 |
| 2czjC00 | Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B | 0.8831 | 18 | 134 | 2.40.280.10 |
| 1j1hA00 | Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B | 0.7497 | 14 | 134 | 2.40.280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2HUU9-F1-model_v4 | SsrA-binding protein SmpB | 0.9905 | 14 | 121 |
GO:0003723
GO:0005829 |
| AF-A0A3D4QUW8-F1-model_v4 | SsrA-binding protein | 0.9892 | 14 | 120 |
GO:0003723
GO:0005829 |
| AF-A7L9H9-F1-model_v4 | SmpB | 0.9815 | 29 | 130 |
GO:0003723
GO:0005829 |
| AF-B6V881-F1-model_v4 | SmpB | 0.9799 | 23 | 126 |
GO:0003723
GO:0005829 |
| AF-D3AUN1-F1-model_v4 | SsrA-binding protein | 0.9785 | 15 | 132 |
GO:0003723
GO:0005829 |