F479693

General Info

Members Datasets Scaffolds Average Seq Length
763 376 1526 126

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0172747|Ga0373936_0172747_461_904
Length 147
Sequence MLKRRATPGIGPSSKEGEIAMFFLSEGFTFRNFLTDAFAVFMFVLWFWLLVTVIGDLFRRYDISGWGKAIWVIALIVFPYIAIFAYLIFQSRGMAERNSQQAQQAREELRRVVGFSVADEIEKLDRLKKTGSITDQEFARLRGKLAS

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
224 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
231 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
232 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
233 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
249 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
263 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
264 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
265 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
266 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
269 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
270 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
276 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
293 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
347 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
351 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
352 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
353 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
363 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
368 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
372 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
373 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
374 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
375 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
376 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.13
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0.39
Rhizoplane 10.62
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 28.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0172747 3300035113 Unclassified 945
2 JGI24032J14994_100838 3300001430 Bacteria 1530
3 JGI24741J21665_1006497 3300001915 Unclassified 2344
4 JGI24746J21847_1046851 3300001977 Unclassified 606
5 JGI24740J21852_10160950 3300001979 Unclassified 557
6 JGI24739J22299_10031498 3300001989 Unclassified 1832
7 JGI24739J22299_10147411 3300001989 Unclassified 696
8 JGI24737J22298_10000660 3300001990 Bacteria 12192
9 JGI24737J22298_10065557 3300001990 Unclassified 1088
10 JGI24743J22301_10018082 3300001991 Unclassified 1329
11 JGI24743J22301_10087582 3300001991 Bacteria 661
12 JGI24750J21931_1001126 3300002070 Bacteria 3441
13 JGI24750J21931_1003554 3300002070 Unclassified 1868
14 JGI24748J21848_1010662 3300002074 Unclassified 1081
15 JGI24738J21930_10001941 3300002075 Bacteria 5574
16 JGI24738J21930_10016186 3300002075 Unclassified 1578
17 JGI24738J21930_10137243 3300002075 Unclassified 538
18 JGI24749J21850_1005223 3300002076 Bacteria 1822
19 JGI24744J21845_10007442 3300002077 Bacteria 2263
20 JGI24034J26672_10002472 3300002239 Bacteria 2539
21 JGI24034J26672_10097142 3300002239 Unclassified 552
22 JGI24742J22300_10000371 3300002244 Bacteria 6612
23 JGI24742J22300_10002332 3300002244 Bacteria 3036
24 JGI24742J22300_10003231 3300002244 Bacteria 2638
25 JGI24751J29686_10007860 3300002459 Bacteria 2179
26 JGI24751J29686_10010520 3300002459 Unclassified 1907
27 JGI26145J50221_1001568 3300003371 Bacteria 1803
28 Ga0055529_1019832 3300003763 Bacteria 840
29 JGI25405J52794_10019224 3300003911 Bacteria 1368
30 JGI25405J52794_10133647 3300003911 Bacteria 562
31 Ga0065712_10078528 3300005290 Plasmid 3334
32 Ga0065712_10088691 3300005290 Bacteria 2507
33 Ga0065715_10089541 3300005293 Bacteria 9609
34 Ga0065715_10183146 3300005293 Unclassified 1463
35 Ga0065707_10640969 3300005295 Unclassified 668
36 Ga0070676_10001804 3300005328 Bacteria 10889
37 Ga0070676_10149931 3300005328 Unclassified 1492
38 Ga0070683_100005144 3300005329 Bacteria 10879
39 Ga0070683_100983403 3300005329 Unclassified 810
40 Ga0070690_100001377 3300005330 Bacteria 12657
41 Ga0070690_100017616 3300005330 Bacteria 4299
42 Ga0070690_100052180 3300005330 Plasmid 2613
43 Ga0070670_100016463 3300005331 Bacteria 6349
44 Ga0070670_100865299 3300005331 Unclassified 818
45 Ga0070677_10000803 3300005333 Bacteria 10436
46 Ga0068869_100036470 3300005334 Plasmid 3491
47 Ga0068869_101051372 3300005334 Bacteria 711
48 Ga0070666_10007254 3300005335 Bacteria 6835
49 Ga0070666_10366628 3300005335 Bacteria 1032
50 Ga0070680_100070065 3300005336 Plasmid 2880
51 Ga0070680_101216256 3300005336 Unclassified 652
52 Ga0070682_100002881 3300005337 Bacteria 9542
53 Ga0068868_100012201 3300005338 Bacteria 6278
54 Ga0070660_100003433 3300005339 Bacteria 10902
55 Ga0070660_100192185 3300005339 Bacteria 1654
56 Ga0070689_100011295 3300005340 Bacteria 6393
57 Ga0070689_100021582 3300005340 Plasmid 4797
58 Ga0070689_100243093 3300005340 Bacteria 1483
59 Ga0070691_10001493 3300005341 Bacteria 10041
60 Ga0070691_10083421 3300005341 Unclassified 1568
61 Ga0070687_100048959 3300005343 Unclassified 2175
62 Ga0070687_100402908 3300005343 Unclassified 898
63 Ga0070661_100004234 3300005344 Bacteria 9893
64 Ga0070661_100262705 3300005344 Bacteria 1335
65 Ga0070661_100480497 3300005344 Unclassified 992
66 Ga0070692_10000807 3300005345 Bacteria 10411
67 Ga0070692_11020006 3300005345 Bacteria 580
68 Ga0070668_100039195 3300005347 Plasmid 3624
69 Ga0070668_100104253 3300005347 Bacteria 2250
70 Ga0070668_100310416 3300005347 Bacteria 1325
71 Ga0070669_100207180 3300005353 Bacteria 1545
72 Ga0070675_100152902 3300005354 Unclassified 1979
73 Ga0070675_100253574 3300005354 Unclassified 1541
74 Ga0070671_100014550 3300005355 Bacteria 6362
75 Ga0070671_100128769 3300005355 Unclassified 2131
76 Ga0070674_100205230 3300005356 Bacteria 1524
77 Ga0070673_100000949 3300005364 Bacteria 16423
78 Ga0070688_100002167 3300005365 Bacteria 9902
79 Ga0070688_100020593 3300005365 Bacteria 3837
80 Ga0070659_100003426 3300005366 Bacteria 11303
81 Ga0070659_100331406 3300005366 Bacteria 1274
82 Ga0070659_100378044 3300005366 Unclassified 1193
83 Ga0070659_101599517 3300005366 Unclassified 582
84 Ga0070667_100006348 3300005367 Bacteria 9825
85 Ga0070667_100054104 3300005367 Bacteria 3389
86 Ga0070667_100548186 3300005367 Unclassified 1063
87 Ga0070703_10008236 3300005406 Plasmid 2932
88 Ga0070709_11531356 3300005434 Bacteria 542
89 Ga0070713_100149698 3300005436 Unclassified 2075
90 Ga0070713_100371071 3300005436 Bacteria 1331
91 Ga0070713_101057502 3300005436 Unclassified 784
92 Ga0070713_101543534 3300005436 Unclassified 644
93 Ga0070710_10027755 3300005437 Bacteria 3022
94 Ga0070701_10000352 3300005438 Bacteria 15292
95 Ga0070701_10005150 3300005438 Bacteria 5370
96 Ga0070701_10234496 3300005438 Unclassified 1101
97 Ga0070705_100002284 3300005440 Bacteria 9691
98 Ga0070705_101492432 3300005440 Unclassified 566
99 Ga0070700_100002557 3300005441 Bacteria 9290
100 Ga0070700_100049267 3300005441 Plasmid 2614
101 Ga0070700_100866502 3300005441 Unclassified 733
102 Ga0070694_100007647 3300005444 Bacteria 6595
103 Ga0070694_100238466 3300005444 Unclassified 1371
104 Ga0070694_100969262 3300005444 Unclassified 705
105 Ga0070708_100016558 3300005445 Bacteria 6121
106 Ga0070708_100771481 3300005445 Unclassified 904
107 Ga0070663_100007945 3300005455 Bacteria 6499
108 Ga0070663_100029293 3300005455 Bacteria 3760
109 Ga0070663_100039875 3300005455 Plasmid 3285
110 Ga0070678_100002553 3300005456 Bacteria 9994
111 Ga0070678_100147750 3300005456 Unclassified 1889
112 Ga0070678_100262448 3300005456 Unclassified 1453
113 Ga0070662_100095339 3300005457 Unclassified 2242
114 Ga0070662_100238896 3300005457 Bacteria 1456
115 Ga0070662_100290727 3300005457 Bacteria 1325
116 Ga0070681_10008069 3300005458 Bacteria 10304
117 Ga0068867_100001897 3300005459 Bacteria 14539
118 Ga0068867_100870712 3300005459 Unclassified 808
119 Ga0070685_10004924 3300005466 Bacteria 6756
120 Ga0070685_10056103 3300005466 Bacteria 2289
121 Ga0070685_10340919 3300005466 Bacteria 1022
122 Ga0070706_100436835 3300005467 Bacteria 1218
123 Ga0070706_101694667 3300005467 Bacteria 576
124 Ga0070698_100336751 3300005471 Bacteria 1440
125 Ga0070698_100377904 3300005471 Bacteria 1349
126 Ga0070699_101435147 3300005518 Unclassified 633
127 Ga0070699_101678274 3300005518 Bacteria 582
128 Ga0070679_100123912 3300005530 Plasmid 2567
129 Ga0070684_100174633 3300005535 Unclassified 1952
130 Ga0070684_101132984 3300005535 Unclassified 735
131 Ga0070697_100343050 3300005536 Bacteria 1289
132 Ga0068853_100004946 3300005539 Bacteria 10381
133 Ga0068853_100644946 3300005539 Unclassified 1008
134 Ga0070672_100003467 3300005543 Bacteria 10228
135 Ga0070672_100259686 3300005543 Bacteria 1465
136 Ga0070686_100002124 3300005544 Bacteria 10920
137 Ga0070686_100022657 3300005544 Bacteria 3744
138 Ga0070686_100308585 3300005544 Bacteria 1176
139 Ga0070695_100014925 3300005545 Plasmid 4686
140 Ga0070695_100355405 3300005545 Bacteria 1099
141 Ga0070695_100361723 3300005545 Unclassified 1090
142 Ga0070695_100469715 3300005545 Unclassified 967
143 Ga0070695_101568599 3300005545 Bacteria 549
144 Ga0070696_100093682 3300005546 Unclassified 2142
145 Ga0070696_100268871 3300005546 Bacteria 1296
146 Ga0070696_100307454 3300005546 Unclassified 1216
147 Ga0070693_100019370 3300005547 Plasmid 3565
148 Ga0070693_100159176 3300005547 Unclassified 1437
149 Ga0070693_100239015 3300005547 Bacteria 1199
150 Ga0070665_100150265 3300005548 Bacteria 2332
151 Ga0070704_100019604 3300005549 Bacteria 4348
152 Ga0070704_100654680 3300005549 Unclassified 928
153 Ga0068855_100035768 3300005563 Bacteria 5915
154 Ga0068855_101851351 3300005563 Unclassified 612
155 Ga0070664_100017436 3300005564 Bacteria 5896
156 Ga0070664_100468702 3300005564 Unclassified 1158
157 Ga0068857_100007412 3300005577 Bacteria 9445
158 Ga0068857_102282507 3300005577 Unclassified 531
159 Ga0068854_100034231 3300005578 Bacteria 3547
160 Ga0068854_100845489 3300005578 Unclassified 801
161 Ga0068856_100030043 3300005614 Bacteria 5311
162 Ga0068856_100242747 3300005614 Bacteria 1816
163 Ga0070702_100001391 3300005615 Bacteria 9892
164 Ga0070702_100231429 3300005615 Bacteria 1242
165 Ga0068852_100064559 3300005616 Plasmid 3192
166 Ga0068852_101650072 3300005616 Unclassified 663
167 Ga0068859_100008450 3300005617 Bacteria 10424
168 Ga0068859_100096937 3300005617 Bacteria 3001
169 Ga0068859_101704661 3300005617 Unclassified 696
170 Ga0068864_100007305 3300005618 Bacteria 9088
171 Ga0068864_100149399 3300005618 Bacteria 2115
172 Ga0068866_10024023 3300005718 Bacteria 2843
173 Ga0068866_10107288 3300005718 Unclassified 1551
174 Ga0068861_100004553 3300005719 Bacteria 9308
175 Ga0068861_100020912 3300005719 Bacteria 4696
176 Ga0068851_10173447 3300005834 Bacteria 1191
177 Ga0068870_10014315 3300005840 Bacteria 3746
178 Ga0068863_100015221 3300005841 Bacteria 7392
179 Ga0068863_100068219 3300005841 Plasmid 3364
180 Ga0068858_100057033 3300005842 Bacteria 3609
181 Ga0068858_100135070 3300005842 Bacteria 2314
182 Ga0068858_100952458 3300005842 Unclassified 840
183 Ga0068860_100009067 3300005843 Bacteria 9901
184 Ga0068860_101183938 3300005843 Unclassified 784
185 Ga0068862_100193260 3300005844 Unclassified 1832
186 Ga0081455_10002174 3300005937 Bacteria 23385
187 Ga0081455_10006502 3300005937 Bacteria 12518
188 Ga0081455_10011770 3300005937 Bacteria 8762
189 Ga0081540_1092227 3300005983 Bacteria 1330
190 Ga0070717_10406844 3300006028 Bacteria 1223
191 Ga0070717_10826129 3300006028 Unclassified 843
192 Ga0075365_10538416 3300006038 Unclassified 826
193 Ga0075432_10072954 3300006058 Bacteria 1235
194 Ga0070715_10458425 3300006163 Bacteria 721
195 Ga0070716_100780641 3300006173 Bacteria 738
196 Ga0070716_100926885 3300006173 Unclassified 684
197 Ga0070712_100003979 3300006175 Bacteria 9084
198 Ga0070712_100055181 3300006175 Bacteria 2781
199 Ga0070712_100233565 3300006175 Unclassified 1462
200 Ga0075367_10108485 3300006178 Bacteria 1702
201 Ga0075367_10182622 3300006178 Bacteria 1308
202 Ga0075367_10283317 3300006178 Unclassified 1042
203 Ga0097621_100004187 3300006237 Bacteria 10008
204 Ga0097621_100065584 3300006237 Bacteria 2989
205 Ga0097621_100786893 3300006237 Bacteria 881
206 Ga0075370_10140021 3300006353 Bacteria 1414
207 Ga0068871_100006156 3300006358 Bacteria 8456
208 Ga0068871_100146518 3300006358 Bacteria 2011
209 Ga0075428_100001069 3300006844 Bacteria 29117
210 Ga0075428_100072458 3300006844 Bacteria 3763
211 Ga0075428_100180442 3300006844 Bacteria 2286
212 Ga0075428_100938083 3300006844 Bacteria 917
213 Ga0075430_100182336 3300006846 Unclassified 1746
214 Ga0075430_100360774 3300006846 Unclassified 1200
215 Ga0075431_100002320 3300006847 Bacteria 18275
216 Ga0075431_100141013 3300006847 Bacteria 2484
217 Ga0075433_10003521 3300006852 Bacteria 12092
218 Ga0075433_10684720 3300006852 Unclassified 898
219 Ga0075434_100021792 3300006871 Bacteria 6233
220 Ga0075434_100174935 3300006871 Unclassified 2166
221 Ga0075434_100690168 3300006871 Bacteria 1039
222 Ga0075434_100919528 3300006871 Unclassified 889
223 Ga0075429_100007289 3300006880 Bacteria 9598
224 Ga0075429_100136517 3300006880 Bacteria 2146
225 Ga0068865_100012374 3300006881 Bacteria 5369
226 Ga0068865_100045640 3300006881 Bacteria 3004
227 Ga0075436_100462210 3300006914 Bacteria 925
228 Ga0075436_100927860 3300006914 Unclassified 652
229 Ga0097620_100008451 3300006931 Bacteria 10424
230 Ga0097620_100096940 3300006931 Bacteria 3001
231 Ga0097620_101705066 3300006931 Unclassified 696
232 Ga0075435_100090960 3300007076 Plasmid 2518
233 Ga0075435_100610933 3300007076 Unclassified 946
234 Ga0075435_101393177 3300007076 Bacteria 614
235 Ga0105251_10063903 3300009011 Bacteria 1726
236 Ga0105244_10034106 3300009036 Plasmid 2682
237 Ga0105250_10014102 3300009092 Plasmid 3289
238 Ga0105250_10089242 3300009092 Unclassified 1253
239 Ga0105240_10041852 3300009093 Bacteria 5842
240 Ga0105240_11284243 3300009093 Unclassified 773
241 Ga0111539_10002491 3300009094 Bacteria 24417
242 Ga0111539_10014337 3300009094 Bacteria 9897
243 Ga0111539_10661678 3300009094 Unclassified 1216
244 Ga0111539_11063995 3300009094 Unclassified 940
245 Ga0111539_11207284 3300009094 Unclassified 878
246 Ga0111539_11665766 3300009094 Unclassified 740
247 Ga0105245_10031417 3300009098 Plasmid 4699
248 Ga0105245_10252539 3300009098 Bacteria 1714
249 Ga0105247_10009394 3300009101 Bacteria 5936
250 Ga0105247_10013481 3300009101 Bacteria 4901
251 Ga0105247_10358947 3300009101 Unclassified 1027
252 Ga0114129_10001552 3300009147 Bacteria 31153
253 Ga0114129_10197146 3300009147 Bacteria 2730
254 Ga0114129_10266303 3300009147 Unclassified 2294
255 Ga0105243_10003783 3300009148 Bacteria 12116
256 Ga0105243_10089952 3300009148 Bacteria 2525
257 Ga0105243_11053411 3300009148 Unclassified 819
258 Ga0105241_10003624 3300009174 Bacteria 11482
259 Ga0105241_10004718 3300009174 Bacteria 10052
260 Ga0105241_10127078 3300009174 Bacteria 2060
261 Ga0105241_11444807 3300009174 Bacteria 660
262 Ga0105242_10026955 3300009176 Plasmid 4558
263 Ga0105242_10306322 3300009176 Bacteria 1452
264 Ga0105242_10829363 3300009176 Unclassified 918
265 Ga0105248_10011181 3300009177 Bacteria 9901
266 Ga0105248_10072144 3300009177 Bacteria 3880
267 Ga0105248_10160476 3300009177 Bacteria 2536
268 Ga0105237_10007939 3300009545 Bacteria 11563
269 Ga0105237_10029496 3300009545 Bacteria 5576
270 Ga0105237_11410032 3300009545 Bacteria 703
271 Ga0105249_10006446 3300009553 Bacteria 10205
272 Ga0105249_10227912 3300009553 Unclassified 1837
273 Ga0105249_10389593 3300009553 Bacteria 1421
274 Ga0099796_10349441 3300010159 Unclassified 637
275 Ga0105239_10374340 3300010375 Bacteria 1610
276 Ga0105239_10384230 3300010375 Unclassified 1587
277 Ga0105239_10488808 3300010375 Bacteria 1399
278 Ga0105246_10145303 3300011119 Unclassified 1789
279 Ga0105246_10321338 3300011119 Unclassified 1258
280 Ga0105246_10983233 3300011119 Unclassified 763
281 Ga0105246_11767584 3300011119 Bacteria 590
282 Ga0105246_12367307 3300011119 Unclassified 520
283 Ga0157324_1052364 3300012506 Bacteria 535
284 Ga0157371_10005749 3300013102 Bacteria 10390
285 Ga0157370_10850992 3300013104 Unclassified 829
286 Ga0157369_10130315 3300013105 Plasmid 2666
287 Ga0157369_10556445 3300013105 Unclassified 1185
288 Ga0157374_10004390 3300013296 Bacteria 11867
289 Ga0157374_10027034 3300013296 Bacteria 5169
290 Ga0157374_10029296 3300013296 Bacteria 4983
291 Ga0157374_10109294 3300013296 Bacteria 2658
292 Ga0157378_10021510 3300013297 Bacteria 5673
293 Ga0157378_10239523 3300013297 Unclassified 1732
294 Ga0157378_11986876 3300013297 Bacteria 631
295 Ga0157378_12498057 3300013297 Unclassified 569
296 Ga0163162_10014581 3300013306 Bacteria 7679
297 Ga0163162_10134665 3300013306 Bacteria 2581
298 Ga0163162_10148220 3300013306 Unclassified 2463
299 Ga0163162_10157306 3300013306 Bacteria 2393
300 Ga0163162_10429279 3300013306 Unclassified 1454
301 Ga0163162_12606479 3300013306 Unclassified 582
302 Ga0157372_10034851 3300013307 Bacteria 5538
303 Ga0157372_10113946 3300013307 Bacteria 3099
304 Ga0157375_10004705 3300013308 Bacteria 11877
305 Ga0157375_10228986 3300013308 Unclassified 2017
306 Ga0157375_12322523 3300013308 Unclassified 640
307 Ga0157375_13044565 3300013308 Unclassified 559
308 Ga0163163_10005346 3300014325 Bacteria 11090
309 Ga0163163_10078625 3300014325 Bacteria 3295
310 Ga0163163_10299525 3300014325 Unclassified 1660
311 Ga0157380_10003292 3300014326 Bacteria 11078
312 Ga0157380_10599572 3300014326 Bacteria 1089
313 Ga0157380_11062459 3300014326 Bacteria 847
314 Ga0182008_10394228 3300014497 Unclassified 742
315 Ga0157377_10000577 3300014745 Bacteria 15330
316 Ga0157377_10548045 3300014745 Unclassified 816
317 Ga0157379_10003458 3300014968 Bacteria 13360
318 Ga0157379_10006778 3300014968 Bacteria 9903
319 Ga0157379_10030911 3300014968 Bacteria 4769
320 Ga0157379_10242111 3300014968 Unclassified 1636
321 Ga0157379_10293556 3300014968 Bacteria 1481
322 Ga0157376_10003423 3300014969 Bacteria 10921
323 Ga0157376_10072284 3300014969 Bacteria 2934
324 Ga0157376_10100193 3300014969 Bacteria 2529
325 Ga0157376_10105600 3300014969 Bacteria 2470
326 Ga0157376_10208190 3300014969 Bacteria 1804
327 Ga0157376_10803155 3300014969 Bacteria 954
328 Ga0163161_10018002 3300017792 Plasmid 4952
329 Ga0163161_10050674 3300017792 Bacteria 3005
330 Ga0163161_10731457 3300017792 Unclassified 826
331 Ga0228598_1065792 3300024227 Bacteria 723
332 Ga0228598_1073854 3300024227 Unclassified 682
333 Ga0209148_1020598 3300025254 Bacteria 1082
334 Ga0209233_1001121 3300025261 Bacteria 10940
335 Ga0207666_1000124 3300025271 Bacteria 11995
336 Ga0209455_1011306 3300025272 Bacteria 2206
337 Ga0207697_10001807 3300025315 Bacteria 11466
338 Ga0207696_1014549 3300025711 Plasmid 2694
339 Ga0207653_10000900 3300025885 Bacteria 9867
340 Ga0207682_10001167 3300025893 Bacteria 12189
341 Ga0207692_10093366 3300025898 Unclassified 1637
342 Ga0207642_10004979 3300025899 Bacteria 4307
343 Ga0207642_10133884 3300025899 Bacteria 1297
344 Ga0207710_10044231 3300025900 Unclassified 1982
345 Ga0207710_10270813 3300025900 Unclassified 853
346 Ga0207710_10448943 3300025900 Unclassified 666
347 Ga0207688_10001600 3300025901 Bacteria 11956
348 Ga0207688_10005618 3300025901 Bacteria 6818
349 Ga0207680_10004764 3300025903 Bacteria 6459
350 Ga0207647_10003822 3300025904 Bacteria 11264
351 Ga0207647_10028979 3300025904 Bacteria 3589
352 Ga0207645_10003428 3300025907 Bacteria 12050
353 Ga0207645_10475989 3300025907 Unclassified 844
354 Ga0207643_10001173 3300025908 Bacteria 15575
355 Ga0207643_10007100 3300025908 Bacteria 6006
356 Ga0207654_10008472 3300025911 Bacteria 5201
357 Ga0207654_10044526 3300025911 Bacteria 2521
358 Ga0207654_10063845 3300025911 Bacteria 2162
359 Ga0207654_11407266 3300025911 Bacteria 508
360 Ga0207707_10019520 3300025912 Bacteria 5917
361 Ga0207707_10208169 3300025912 Unclassified 1704
362 Ga0207695_10181574 3300025913 Unclassified 2025
363 Ga0207671_10010462 3300025914 Bacteria 7652
364 Ga0207671_10224019 3300025914 Bacteria 1474
365 Ga0207693_10004938 3300025915 Bacteria 11208
366 Ga0207693_10228042 3300025915 Unclassified 1463
367 Ga0207693_10412977 3300025915 Bacteria 1055
368 Ga0207693_10634584 3300025915 Bacteria 830
369 Ga0207663_10190251 3300025916 Bacteria 1473
370 Ga0207663_10531117 3300025916 Unclassified 917
371 Ga0207663_11056703 3300025916 Unclassified 652
372 Ga0207660_10074267 3300025917 Unclassified 2481
373 Ga0207660_10309934 3300025917 Bacteria 1258
374 Ga0207662_10001522 3300025918 Bacteria 11296
375 Ga0207662_10026880 3300025918 Bacteria 3321
376 Ga0207657_10007161 3300025919 Bacteria 11457
377 Ga0207657_10015087 3300025919 Bacteria 7505
378 Ga0207649_10014219 3300025920 Plasmid 4453
379 Ga0207652_10004752 3300025921 Bacteria 11009
380 Ga0207694_10073084 3300025924 Plasmid 2682
381 Ga0207694_10155754 3300025924 Bacteria 1843
382 Ga0207650_10063823 3300025925 Plasmid 2755
383 Ga0207650_10734742 3300025925 Unclassified 835
384 Ga0207659_10000171 3300025926 Archaea 38884
385 Ga0207659_11414572 3300025926 Unclassified 596
386 Ga0207659_11657395 3300025926 Unclassified 545
387 Ga0207687_10041743 3300025927 Plasmid 3152
388 Ga0207687_10154236 3300025927 Bacteria 1756
389 Ga0207700_10388251 3300025928 Unclassified 1222
390 Ga0207700_10544929 3300025928 Bacteria 1029
391 Ga0207644_10022859 3300025931 Bacteria 4275
392 Ga0207644_10041637 3300025931 Bacteria 3250
393 Ga0207690_10105213 3300025932 Unclassified 2023
394 Ga0207690_10483717 3300025932 Unclassified 999
395 Ga0207690_11349214 3300025932 Bacteria 596
396 Ga0207706_10007801 3300025933 Bacteria 9879
397 Ga0207706_10022287 3300025933 Bacteria 5683
398 Ga0207706_10458246 3300025933 Bacteria 1102
399 Ga0207686_10003792 3300025934 Bacteria 8111
400 Ga0207686_10076252 3300025934 Bacteria 2173
401 Ga0207686_10235930 3300025934 Bacteria 1329
402 Ga0207709_10035140 3300025935 Plasmid 2961
403 Ga0207709_10054656 3300025935 Unclassified 2463
404 Ga0207709_10291706 3300025935 Bacteria 1209
405 Ga0207709_10358552 3300025935 Bacteria 1103
406 Ga0207670_10009407 3300025936 Bacteria 5577
407 Ga0207670_10067051 3300025936 Bacteria 2468
408 Ga0207670_10175199 3300025936 Bacteria 1611
409 Ga0207670_10210656 3300025936 Unclassified 1482
410 Ga0207669_10094228 3300025937 Bacteria 1958
411 Ga0207669_10117351 3300025937 Bacteria 1798
412 Ga0207704_10051276 3300025938 Unclassified 2494
413 Ga0207704_10073531 3300025938 Unclassified 2177
414 Ga0207665_10162074 3300025939 Bacteria 1609
415 Ga0207691_10006331 3300025940 Bacteria 11431
416 Ga0207691_10019281 3300025940 Bacteria 6456
417 Ga0207711_10073945 3300025941 Bacteria 2963
418 Ga0207711_10219853 3300025941 Unclassified 1737
419 Ga0207711_10253883 3300025941 Bacteria 1615
420 Ga0207689_10009771 3300025942 Bacteria 8266
421 Ga0207689_10025829 3300025942 Bacteria 4920
422 Ga0207661_10062009 3300025944 Plasmid 3023
423 Ga0207679_10148554 3300025945 Bacteria 1904
424 Ga0207679_10418184 3300025945 Unclassified 1182
425 Ga0207651_10012475 3300025960 Bacteria 4812
426 Ga0207712_10348929 3300025961 Bacteria 1230
427 Ga0207712_10386600 3300025961 Bacteria 1173
428 Ga0207668_10057373 3300025972 Plasmid 2715
429 Ga0207668_10199837 3300025972 Bacteria 1591
430 Ga0207640_10034522 3300025981 Bacteria 3157
431 Ga0207640_10225732 3300025981 Bacteria 1437
432 Ga0207658_10036747 3300025986 Bacteria 3514
433 Ga0207658_10084346 3300025986 Unclassified 2444
434 Ga0207658_10127513 3300025986 Bacteria 2039
435 Ga0207677_10010822 3300026023 Bacteria 5174
436 Ga0207677_10823742 3300026023 Unclassified 832
437 Ga0207703_10943395 3300026035 Unclassified 827
438 Ga0207703_11397728 3300026035 Unclassified 673
439 Ga0207639_10088413 3300026041 Unclassified 2472
440 Ga0207639_10745405 3300026041 Bacteria 910
441 Ga0207678_10005381 3300026067 Bacteria 11465
442 Ga0207678_10023692 3300026067 Bacteria 5368
443 Ga0207678_10032866 3300026067 Bacteria 4521
444 Ga0207678_11567343 3300026067 Unclassified 580
445 Ga0207708_10003585 3300026075 Bacteria 11450
446 Ga0207708_10004995 3300026075 Bacteria 9770
447 Ga0207702_10196066 3300026078 Bacteria 1869
448 Ga0207702_10444451 3300026078 Unclassified 1257
449 Ga0207702_10484467 3300026078 Bacteria 1204
450 Ga0207641_10046296 3300026088 Plasmid 3665
451 Ga0207641_10372022 3300026088 Bacteria 1366
452 Ga0207648_10006363 3300026089 Bacteria 11741
453 Ga0207648_10010144 3300026089 Bacteria 8957
454 Ga0207676_10002188 3300026095 Bacteria 14094
455 Ga0207676_10167956 3300026095 Bacteria 1908
456 Ga0207674_10009246 3300026116 Bacteria 11297
457 Ga0207675_100008140 3300026118 Bacteria 9880
458 Ga0207675_100042041 3300026118 Bacteria 4266
459 Ga0207683_10006666 3300026121 Bacteria 9879
460 Ga0207683_10015300 3300026121 Bacteria 6532
461 Ga0207698_10032586 3300026142 Bacteria 3777
462 Ga0207698_10194786 3300026142 Bacteria 1809
463 Ga0209996_1013104 3300027395 Bacteria 1118
464 Ga0209971_1019230 3300027682 Bacteria 1622
465 Ga0209966_1080843 3300027695 Bacteria 720
466 Ga0209998_10006391 3300027717 Unclassified 2447
467 Ga0209998_10062062 3300027717 Bacteria 881
468 Ga0209998_10134594 3300027717 Unclassified 629
469 Ga0209974_10001596 3300027876 Bacteria 8207
470 Ga0209974_10248751 3300027876 Bacteria 668
471 Ga0207428_10005280 3300027907 Bacteria 12063
472 Ga0207428_10010498 3300027907 Bacteria 8266
473 Ga0207428_10565432 3300027907 Unclassified 821
474 Ga0207428_10580280 3300027907 Unclassified 809
475 Ga0268266_10102703 3300028379 Plasmid 2522
476 Ga0268266_10486835 3300028379 Bacteria 1176
477 Ga0268265_10004221 3300028380 Bacteria 10037
478 Ga0268264_10048654 3300028381 Plasmid 3527
479 Ga0265334_10074350 3300028573 Unclassified 1261
480 Ga0265760_10048469 3300031090 Bacteria 1276
481 Ga0265325_10000190 3300031241 Bacteria 43732
482 Ga0265313_10027803 3300031595 Unclassified 2954
483 Ga0307412_10289454 3300031911 Bacteria 1290
484 Ga0307415_100162130 3300032126 Bacteria 1734
485 Ga0373948_0002930 3300034817 Plasmid 2576
486 Ga0373950_0009336 3300034818 Unclassified 1564
487 Ga0373959_0008469 3300034820 Unclassified 1751
488 Ga0373938_0000338 3300034957 Bacteria 7439
489 Ga0373928_0001186 3300035084 Bacteria 5148
490 Ga0373929_0009620 3300035085 Unclassified 1794
491 Ga0373934_0490021 3300035086 Bacteria 516
492 Ga0373940_0013076 3300035088 Unclassified 1999
493 Ga0373940_0033457 3300035088 Bacteria 1383
494 Ga0373949_0044271 3300035090 Bacteria 1104
495 Ga0373951_0005413 3300035091 Plasmid 2966
496 Ga0373951_0046128 3300035091 Unclassified 1062
497 Ga0373923_0142747 3300035111 Bacteria 1083
498 Ga0373932_0015787 3300035112 Unclassified 1919
499 Ga0373932_0208203 3300035112 Unclassified 698
500 Ga0373936_0072469 3300035113 Bacteria 1422
501 Ga0373936_0181163 3300035113 Bacteria 924
502 Ga0373939_0013944 3300035114 Unclassified 2077
503 Ga0373941_0020791 3300035115 Unclassified 1844
504 Ga0373945_0024841 3300035116 Bacteria 2078
505 Ga0373960_0112305 3300035121 Bacteria 895
506 Ga0373960_0146577 3300035121 Bacteria 803
507 Ga0373943_0164971 3300035170 Bacteria 1208
508 Ga0373943_0297782 3300035170 Bacteria 915
509 Ga0373946_0064100 3300035171 Bacteria 1571
510 Ga0373946_0086399 3300035171 Unclassified 1382
511 Ga0373955_0649902 3300035172 Bacteria 647
512 Ga0373942_0000711 3300035207 Bacteria 9217
513 Ga0373962_0375082 3300035242 Unclassified 519
514 Ga0373924_0055741 3300035410 Bacteria 1645
515 Ga0373931_0056058 3300035691 Unclassified 2110
516 Ga0373935_0798842 3300035692 Bacteria 696
517 Ga0373927_0019617 3300035695 Bacteria 4432
518 Ga0373927_0274875 3300035695 Bacteria 1108
519 Ga0373927_0282152 3300035695 Bacteria 1092
520 Ga0373947_0009265 3300035725 Bacteria 5656
521 Ga0373947_0174576 3300035725 Bacteria 1396
522 Ga0373925_0484583 3300037068 Bacteria 1015
523 Ga0373925_0890329 3300037068 Bacteria 734
524 Ga0395899_0212623 3300037312 Bacteria 1343
525 Ga0395900_0322594 3300037418 Bacteria 1524
526 Ga0395898_0056335 3300037466 Bacteria 3831
527 Ga0395898_1380105 3300037466 Unclassified 633
528 Ga0436364_1330700 3300037853 Unclassified 665
529 Ga0395901_0175573 3300038443 Bacteria 2247
530 Ga0436365_0459904 3300039437 Bacteria 2026
531 Ga0436360_0925979 3300039438 Bacteria 2513
532 Ga0436361_0250375 3300039447 Bacteria 722
533 Ga0436363_0791902 3300039450 Bacteria 527
534 Ga0436362_0372448 3300039453 Unclassified 1144
535 Ga0436362_0543685 3300039453 Unclassified 571
536 Ga0451802_1343066 3300041460 Unclassified 612
537 Ga0451853_3621333 3300041512 Unclassified 620
538 Ga0439450_095236 3300042008 Bacteria 751
539 Ga0439464_0012429 3300042439 Bacteria 2268
540 Ga0450916_032199 3300042530 Bacteria 768
541 Ga0451577_1983319 3300042876 Unclassified 509
542 Ga0466964_0099706 3300044706 Bacteria 1279
543 Ga0466964_0145709 3300044706 Unclassified 1093
544 Ga0466970_0575693 3300044765 Unclassified 652
545 Ga0466957_0089000 3300044842 Bacteria 1932
546 Ga0466960_0120429 3300044901 Unclassified 1374
547 Ga0495617_085643 3300046452 Bacteria 1031
548 Ga0495592_0142450 3300046454 Bacteria 1666
549 Ga0495592_0364229 3300046454 Bacteria 924
550 Ga0495603_0150350 3300046455 Bacteria 1353
551 Ga0495603_0501051 3300046455 Bacteria 695
552 Ga0495629_0087056 3300046459 Bacteria 2179
553 Ga0495629_0197204 3300046459 Bacteria 1392
554 Ga0495641_0024187 3300046461 Bacteria 3002
555 Ga0495641_0317073 3300046461 Bacteria 703
556 Ga0495641_0496231 3300046461 Bacteria 556
557 Ga0495653_0299335 3300046463 Bacteria 1050
558 Ga0495653_0869083 3300046463 Unclassified 539
559 Ga0495580_0900638 3300046472 Bacteria 569
560 Ga0495582_0013236 3300046473 Plasmid 4540
561 Ga0495582_0178783 3300046473 Unclassified 1208
562 Ga0495639_0045052 3300046475 Bacteria 1995
563 Ga0495639_0152430 3300046475 Bacteria 1115
564 Ga0495662_0085155 3300046476 Bacteria 1539
565 Ga0495664_0077173 3300046477 Unclassified 1994
566 Ga0495664_0204786 3300046477 Bacteria 1195
567 Ga0495584_0399890 3300046491 Bacteria 698
568 Ga0495594_0008179 3300046499 Bacteria 5384
569 Ga0495594_0361964 3300046499 Bacteria 826
570 Ga0495607_0285426 3300046501 Bacteria 782
571 Ga0495618_0156077 3300046514 Bacteria 1456
572 Ga0495618_0445003 3300046514 Bacteria 787
573 Ga0495630_0244017 3300046517 Bacteria 1372
574 Ga0495630_0257041 3300046517 Bacteria 1334
575 Ga0495637_0212524 3300046520 Unclassified 707
576 Ga0495643_0487408 3300046522 Unclassified 532
577 Ga0495666_0030282 3300046526 Bacteria 2657
578 Ga0495652_0011528 3300046529 Bacteria 7992
579 Ga0495652_0101273 3300046529 Bacteria 2335
580 Ga0495652_0276564 3300046529 Bacteria 1231
581 Ga0495652_0307315 3300046529 Bacteria 1150
582 Ga0495665_0108350 3300046531 Bacteria 1457
583 Ga0495640_0165390 3300046533 Bacteria 1415
584 Ga0495640_0392119 3300046533 Bacteria 853
585 Ga0495586_0183476 3300046535 Bacteria 1184
586 Ga0495586_0235765 3300046535 Bacteria 1042
587 Ga0495598_0412410 3300046537 Unclassified 529
588 Ga0495645_0484063 3300046543 Unclassified 776
589 Ga0495667_0148055 3300046559 Bacteria 1512
590 Ga0495667_0400753 3300046559 Bacteria 864
591 Ga0495634_0021551 3300046642 Bacteria 4552
592 Ga0495634_0037313 3300046642 Bacteria 3321
593 Ga0495634_0568639 3300046642 Bacteria 660
594 Ga0495635_0053728 3300046663 Bacteria 2775
595 Ga0495661_0300174 3300046665 Bacteria 804
596 Ga0495588_0102828 3300046674 Bacteria 1502
597 Ga0495588_0370158 3300046674 Bacteria 753
598 Ga0495657_0210601 3300046675 Unclassified 1182
599 Ga0495599_0306963 3300046678 Unclassified 957
600 Ga0495647_0002887 3300046681 Bacteria 5454
601 Ga0495658_1027260 3300046683 Unclassified 526
602 Ga0495613_0336406 3300046689 Bacteria 1039
603 Ga0495624_0024438 3300046690 Plasmid 3975
604 Ga0495671_0478607 3300046692 Unclassified 594
605 Ga0495589_0113372 3300046794 Unclassified 1308
606 Ga0495600_0757974 3300046809 Bacteria 581
607 Ga0495581_0037868 3300047315 Bacteria 2791
608 Ga0495581_0247981 3300047315 Bacteria 1041
609 Ga0495581_0312962 3300047315 Bacteria 917
610 Ga0495674_0014561 3300047319 Bacteria 7359
611 Ga0495674_0058741 3300047319 Bacteria 3361
612 Ga0495674_0280208 3300047319 Bacteria 1366
613 Ga0495674_0394090 3300047319 Bacteria 1119
614 Ga0495674_0584062 3300047319 Bacteria 886
615 Ga0495672_0006409 3300047320 Bacteria 9130
616 Ga0495676_0079062 3300047321 Bacteria 2501
617 Ga0495680_0341852 3300047322 Unclassified 1044
618 Ga0495680_0503862 3300047322 Bacteria 821
619 Ga0495684_0234149 3300047471 Bacteria 1342
620 Ga0495593_0069475 3300047673 Bacteria 1831
621 Ga0495602_0356280 3300048088 Bacteria 1055
622 Ga0495614_0055023 3300048089 Bacteria 1707
623 Ga0496100_0001870 3300048903 Bacteria 10548
624 Ga0496100_0060781 3300048903 Bacteria 2487
625 Ga0496100_0188694 3300048903 Unclassified 1495
626 Ga0496100_0333772 3300048903 Bacteria 1142
627 Ga0496101_0068735 3300048904 Plasmid 2590
628 Ga0496101_0341364 3300048904 Unclassified 1176
629 Ga0496101_0444412 3300048904 Bacteria 1023
630 Ga0496102_0031532 3300048905 Bacteria 4755
631 Ga0496102_0060319 3300048905 Bacteria 3470
632 Ga0496102_0245244 3300048905 Unclassified 1689
633 Ga0496102_0688587 3300048905 Unclassified 945
634 Ga0496103_0019798 3300048906 Bacteria 4040
635 Ga0496103_0113324 3300048906 Unclassified 1723
636 Ga0496103_0874429 3300048906 Unclassified 564
637 Ga0496104_0000044 3300048907 Bacteria 153699
638 Ga0496104_0037727 3300048907 Bacteria 4518
639 Ga0496104_0056917 3300048907 Bacteria 3700
640 Ga0496104_0087893 3300048907 Plasmid 2969
641 Ga0496104_0138069 3300048907 Bacteria 2342
642 Ga0496104_0199208 3300048907 Bacteria 1914
643 Ga0496104_0241975 3300048907 Unclassified 1717
644 Ga0496104_0273703 3300048907 Bacteria 1601
645 Ga0496104_0360951 3300048907 Unclassified 1365
646 Ga0496104_1031954 3300048907 Unclassified 726
647 Ga0496105_0000017 3300048908 Bacteria 210323
648 Ga0496105_0019506 3300048908 Bacteria 5470
649 Ga0496105_0083412 3300048908 Bacteria 2639
650 Ga0496105_0095932 3300048908 Unclassified 2449
651 Ga0496105_0260128 3300048908 Bacteria 1403
652 Ga0496105_0775787 3300048908 Unclassified 730
653 Ga0496105_0934486 3300048908 Bacteria 652
654 Ga0496105_1379835 3300048908 Bacteria 511
655 Ga0496106_0008790 3300048909 Bacteria 7464
656 Ga0496106_0015617 3300048909 Bacteria 5615
657 Ga0496106_0046106 3300048909 Bacteria 3276
658 Ga0496106_0392151 3300048909 Bacteria 1116
659 Ga0496106_0444948 3300048909 Bacteria 1041
660 Ga0496106_1290800 3300048909 Unclassified 567
661 Ga0496107_0012440 3300048910 Bacteria 5942
662 Ga0496107_0031434 3300048910 Plasmid 3788
663 Ga0496107_0149998 3300048910 Bacteria 1724
664 Ga0496107_0547101 3300048910 Bacteria 857
665 Ga0496107_0618442 3300048910 Unclassified 800
666 Ga0496108_0028272 3300048911 Bacteria 4639
667 Ga0496108_0052766 3300048911 Bacteria 3409
668 Ga0496108_0127808 3300048911 Bacteria 2183
669 Ga0496108_0436166 3300048911 Bacteria 1144
670 Ga0496109_0004119 3300048912 Bacteria 12142
671 Ga0496109_0057269 3300048912 Bacteria 3557
672 Ga0496109_0190571 3300048912 Unclassified 1927
673 Ga0496109_0580373 3300048912 Bacteria 1057
674 Ga0496109_0743561 3300048912 Unclassified 918
675 Ga0496110_0044947 3300048913 Bacteria 3858
676 Ga0496110_0077740 3300048913 Bacteria 2953
677 Ga0496110_0253720 3300048913 Unclassified 1601
678 Ga0496110_0874586 3300048913 Bacteria 804
679 Ga0496111_0022328 3300048914 Bacteria 4429
680 Ga0496111_0034976 3300048914 Bacteria 3588
681 Ga0496111_0125748 3300048914 Bacteria 1895
682 Ga0496111_0202340 3300048914 Bacteria 1476
683 Ga0496111_0216614 3300048914 Bacteria 1422
684 Ga0496112_0103395 3300048915 Bacteria 2818
685 Ga0496112_0129835 3300048915 Bacteria 2491
686 Ga0496112_0295650 3300048915 Bacteria 1565
687 Ga0496112_1241486 3300048915 Unclassified 661
688 Ga0496113_0011038 3300048916 Bacteria 6005
689 Ga0496113_0030721 3300048916 Bacteria 3891
690 Ga0496113_0050382 3300048916 Bacteria 3104
691 Ga0496113_0061666 3300048916 Bacteria 2830
692 Ga0496113_0107328 3300048916 Bacteria 2169
693 Ga0496113_0742205 3300048916 Unclassified 782
694 Ga0496114_0002703 3300048917 Bacteria 13546
695 Ga0496115_0032582 3300048918 Bacteria 4111
696 Ga0496115_0130799 3300048918 Bacteria 2069
697 Ga0496115_0238393 3300048918 Bacteria 1499
698 Ga0496115_0364714 3300048918 Unclassified 1176
699 Ga0496115_0396802 3300048918 Bacteria 1120
700 Ga0496115_0452231 3300048918 Unclassified 1037
701 Ga0496115_0726275 3300048918 Bacteria 779
702 Ga0496115_0984577 3300048918 Unclassified 645
703 Ga0496119_0002993 3300048922 Bacteria 17920
704 Ga0496119_0220703 3300048922 Unclassified 970
705 Ga0501039_0569195 3300049575 Unclassified 889
706 Ga0501040_0498459 3300049576 Unclassified 878
707 Ga0501048_0426187 3300049582 Unclassified 949
708 Ga0501068_0332051 3300049584 Bacteria 976
709 Ga0501068_0364819 3300049584 Unclassified 929
710 Ga0501072_1219730 3300049588 Bacteria 584
711 Ga0501075_0331573 3300049591 Bacteria 1160
712 Ga0501076_0020445 3300049592 Bacteria 5069
713 Ga0501076_0162999 3300049592 Bacteria 1817
714 Ga0501079_1320246 3300049741 Unclassified 568
715 Ga0501045_0326363 3300049824 Unclassified 1142
716 nmdc:mga03n38_337593_c1 3300050490 Unclassified 817
717 nmdc:mga00v17_120167_c1 3300050491 Unclassified 1672
718 nmdc:mga0yw44_232732_c1 3300050492 Unclassified 1223
719 nmdc:mga06z11_65791_c1 3300050494 Bacteria 1903
720 nmdc:mga06z11_681106_c1 3300050494 Unclassified 626
721 nmdc:mga07m45_102733_c1 3300050496 Bacteria 1642
722 nmdc:mga05p37_143642_c1 3300050507 Bacteria 2923
723 nmdc:mga05p37_2365_c1 3300050507 Bacteria 21950
724 nmdc:mga09592_2980_c1 3300050508 Bacteria 13726
725 nmdc:mga0qj67_23598_c1 3300050509 Plasmid 4733
726 nmdc:mga0qj67_236022_c1 3300050509 Unclassified 1484
727 nmdc:mga06r32_157_c1 3300050510 Bacteria 52160
728 nmdc:mga06r32_283723_c1 3300050510 Bacteria 1643
729 nmdc:mga08y16_107747_c1 3300050511 Plasmid 2901
730 nmdc:mga08y16_1602_c1 3300050511 Bacteria 22869
731 nmdc:mga08y16_235836_c1 3300050511 Unclassified 1892
732 nmdc:mga0n895_126674_c1 3300050512 Plasmid 2578
733 nmdc:mga0n895_139351_c1 3300050512 Bacteria 2453
734 nmdc:mga0n895_665502_c1 3300050512 Bacteria 1039
735 nmdc:mga0rr50_110004_c1 3300050513 Unclassified 2179
736 nmdc:mga0rr50_1192507_c1 3300050513 Bacteria 647
737 nmdc:mga0rr50_516306_c1 3300050513 Bacteria 1016
738 nmdc:mga08x19_496498_c1 3300050514 Bacteria 861
739 nmdc:mga08x19_833280_c1 3300050514 Unclassified 655
740 nmdc:mga0a205_278247_c1 3300050515 Bacteria 1549
741 nmdc:mga0a205_4970_c1 3300050515 Bacteria 11960
742 Ga0495601_0005722 3300053077 Bacteria 7242
743 Ga0495601_0012964 3300053077 Bacteria 5006
744 Ga0495601_0021628 3300053077 Bacteria 3940
745 Ga0495601_0074884 3300053077 Bacteria 2166
746 Ga0495612_0118253 3300053078 Bacteria 1138
747 Ga0495595_0185656 3300053084 Bacteria 1032
748 Ga0495595_0317850 3300053084 Unclassified 784
749 Ga0495595_0581183 3300053084 Unclassified 573
750 Ga0495619_0015864 3300053085 Bacteria 4768
751 Ga0495619_0044453 3300053085 Bacteria 2915
752 Ga0495619_0111358 3300053085 Bacteria 1871
753 Ga0495619_0131082 3300053085 Bacteria 1723
754 Ga0500595_005112 3300053119 Bacteria 5759
755 Ga0501084_1031129 3300054114 Unclassified 691
756 Ga0501082_0168155 3300060353 Bacteria 1906
757 Ga0501082_0525248 3300060353 Unclassified 1035
758 2509146819 2508501128 Bacteria 8613869
759 2643949769 2643221588 Bacteria 3692460
760 2876770175 2876761206 Bacteria 10111113
761 2885418904 2885409591 Bacteria 9235467
762 8006992784 8006984368 Bacteria 9651211
763 8056682484 8056681323 Bacteria 8472857
764 Ga0373936_0172747
765 JGI24032J14994_100838
766 JGI24741J21665_1006497
767 JGI24746J21847_1046851
768 JGI24740J21852_10160950
769 JGI24739J22299_10031498
770 JGI24739J22299_10147411
771 JGI24737J22298_10000660
772 JGI24737J22298_10065557
773 JGI24743J22301_10018082
774 JGI24743J22301_10087582
775 JGI24750J21931_1001126
776 JGI24750J21931_1003554
777 JGI24748J21848_1010662
778 JGI24738J21930_10001941
779 JGI24738J21930_10016186
780 JGI24738J21930_10137243
781 JGI24749J21850_1005223
782 JGI24744J21845_10007442
783 JGI24034J26672_10002472
784 JGI24034J26672_10097142
785 JGI24742J22300_10000371
786 JGI24742J22300_10002332
787 JGI24742J22300_10003231
788 JGI24751J29686_10007860
789 JGI24751J29686_10010520
790 JGI26145J50221_1001568
791 Ga0055529_1019832
792 JGI25405J52794_10019224
793 JGI25405J52794_10133647
794 Ga0065712_10078528
795 Ga0065712_10088691
796 Ga0065715_10089541
797 Ga0065715_10183146
798 Ga0065707_10640969
799 Ga0070676_10001804
800 Ga0070676_10149931
801 Ga0070683_100005144
802 Ga0070683_100983403
803 Ga0070690_100001377
804 Ga0070690_100017616
805 Ga0070690_100052180
806 Ga0070670_100016463
807 Ga0070670_100865299
808 Ga0070677_10000803
809 Ga0068869_100036470
810 Ga0068869_101051372
811 Ga0070666_10007254
812 Ga0070666_10366628
813 Ga0070680_100070065
814 Ga0070680_101216256
815 Ga0070682_100002881
816 Ga0068868_100012201
817 Ga0070660_100003433
818 Ga0070660_100192185
819 Ga0070689_100011295
820 Ga0070689_100021582
821 Ga0070689_100243093
822 Ga0070691_10001493
823 Ga0070691_10083421
824 Ga0070687_100048959
825 Ga0070687_100402908
826 Ga0070661_100004234
827 Ga0070661_100262705
828 Ga0070661_100480497
829 Ga0070692_10000807
830 Ga0070692_11020006
831 Ga0070668_100039195
832 Ga0070668_100104253
833 Ga0070668_100310416
834 Ga0070669_100207180
835 Ga0070675_100152902
836 Ga0070675_100253574
837 Ga0070671_100014550
838 Ga0070671_100128769
839 Ga0070674_100205230
840 Ga0070673_100000949
841 Ga0070688_100002167
842 Ga0070688_100020593
843 Ga0070659_100003426
844 Ga0070659_100331406
845 Ga0070659_100378044
846 Ga0070659_101599517
847 Ga0070667_100006348
848 Ga0070667_100054104
849 Ga0070667_100548186
850 Ga0070703_10008236
851 Ga0070709_11531356
852 Ga0070713_100149698
853 Ga0070713_100371071
854 Ga0070713_101057502
855 Ga0070713_101543534
856 Ga0070710_10027755
857 Ga0070701_10000352
858 Ga0070701_10005150
859 Ga0070701_10234496
860 Ga0070705_100002284
861 Ga0070705_101492432
862 Ga0070700_100002557
863 Ga0070700_100049267
864 Ga0070700_100866502
865 Ga0070694_100007647
866 Ga0070694_100238466
867 Ga0070694_100969262
868 Ga0070708_100016558
869 Ga0070708_100771481
870 Ga0070663_100007945
871 Ga0070663_100029293
872 Ga0070663_100039875
873 Ga0070678_100002553
874 Ga0070678_100147750
875 Ga0070678_100262448
876 Ga0070662_100095339
877 Ga0070662_100238896
878 Ga0070662_100290727
879 Ga0070681_10008069
880 Ga0068867_100001897
881 Ga0068867_100870712
882 Ga0070685_10004924
883 Ga0070685_10056103
884 Ga0070685_10340919
885 Ga0070706_100436835
886 Ga0070706_101694667
887 Ga0070698_100336751
888 Ga0070698_100377904
889 Ga0070699_101435147
890 Ga0070699_101678274
891 Ga0070679_100123912
892 Ga0070684_100174633
893 Ga0070684_101132984
894 Ga0070697_100343050
895 Ga0068853_100004946
896 Ga0068853_100644946
897 Ga0070672_100003467
898 Ga0070672_100259686
899 Ga0070686_100002124
900 Ga0070686_100022657
901 Ga0070686_100308585
902 Ga0070695_100014925
903 Ga0070695_100355405
904 Ga0070695_100361723
905 Ga0070695_100469715
906 Ga0070695_101568599
907 Ga0070696_100093682
908 Ga0070696_100268871
909 Ga0070696_100307454
910 Ga0070693_100019370
911 Ga0070693_100159176
912 Ga0070693_100239015
913 Ga0070665_100150265
914 Ga0070704_100019604
915 Ga0070704_100654680
916 Ga0068855_100035768
917 Ga0068855_101851351
918 Ga0070664_100017436
919 Ga0070664_100468702
920 Ga0068857_100007412
921 Ga0068857_102282507
922 Ga0068854_100034231
923 Ga0068854_100845489
924 Ga0068856_100030043
925 Ga0068856_100242747
926 Ga0070702_100001391
927 Ga0070702_100231429
928 Ga0068852_100064559
929 Ga0068852_101650072
930 Ga0068859_100008450
931 Ga0068859_100096937
932 Ga0068859_101704661
933 Ga0068864_100007305
934 Ga0068864_100149399
935 Ga0068866_10024023
936 Ga0068866_10107288
937 Ga0068861_100004553
938 Ga0068861_100020912
939 Ga0068851_10173447
940 Ga0068870_10014315
941 Ga0068863_100015221
942 Ga0068863_100068219
943 Ga0068858_100057033
944 Ga0068858_100135070
945 Ga0068858_100952458
946 Ga0068860_100009067
947 Ga0068860_101183938
948 Ga0068862_100193260
949 Ga0081455_10002174
950 Ga0081455_10006502
951 Ga0081455_10011770
952 Ga0081540_1092227
953 Ga0070717_10406844
954 Ga0070717_10826129
955 Ga0075365_10538416
956 Ga0075432_10072954
957 Ga0070715_10458425
958 Ga0070716_100780641
959 Ga0070716_100926885
960 Ga0070712_100003979
961 Ga0070712_100055181
962 Ga0070712_100233565
963 Ga0075367_10108485
964 Ga0075367_10182622
965 Ga0075367_10283317
966 Ga0097621_100004187
967 Ga0097621_100065584
968 Ga0097621_100786893
969 Ga0075370_10140021
970 Ga0068871_100006156
971 Ga0068871_100146518
972 Ga0075428_100001069
973 Ga0075428_100072458
974 Ga0075428_100180442
975 Ga0075428_100938083
976 Ga0075430_100182336
977 Ga0075430_100360774
978 Ga0075431_100002320
979 Ga0075431_100141013
980 Ga0075433_10003521
981 Ga0075433_10684720
982 Ga0075434_100021792
983 Ga0075434_100174935
984 Ga0075434_100690168
985 Ga0075434_100919528
986 Ga0075429_100007289
987 Ga0075429_100136517
988 Ga0068865_100012374
989 Ga0068865_100045640
990 Ga0075436_100462210
991 Ga0075436_100927860
992 Ga0097620_100008451
993 Ga0097620_100096940
994 Ga0097620_101705066
995 Ga0075435_100090960
996 Ga0075435_100610933
997 Ga0075435_101393177
998 Ga0105251_10063903
999 Ga0105244_10034106
1000 Ga0105250_10014102
1001 Ga0105250_10089242
1002 Ga0105240_10041852
1003 Ga0105240_11284243
1004 Ga0111539_10002491
1005 Ga0111539_10014337
1006 Ga0111539_10661678
1007 Ga0111539_11063995
1008 Ga0111539_11207284
1009 Ga0111539_11665766
1010 Ga0105245_10031417
1011 Ga0105245_10252539
1012 Ga0105247_10009394
1013 Ga0105247_10013481
1014 Ga0105247_10358947
1015 Ga0114129_10001552
1016 Ga0114129_10197146
1017 Ga0114129_10266303
1018 Ga0105243_10003783
1019 Ga0105243_10089952
1020 Ga0105243_11053411
1021 Ga0105241_10003624
1022 Ga0105241_10004718
1023 Ga0105241_10127078
1024 Ga0105241_11444807
1025 Ga0105242_10026955
1026 Ga0105242_10306322
1027 Ga0105242_10829363
1028 Ga0105248_10011181
1029 Ga0105248_10072144
1030 Ga0105248_10160476
1031 Ga0105237_10007939
1032 Ga0105237_10029496
1033 Ga0105237_11410032
1034 Ga0105249_10006446
1035 Ga0105249_10227912
1036 Ga0105249_10389593
1037 Ga0099796_10349441
1038 Ga0105239_10374340
1039 Ga0105239_10384230
1040 Ga0105239_10488808
1041 Ga0105246_10145303
1042 Ga0105246_10321338
1043 Ga0105246_10983233
1044 Ga0105246_11767584
1045 Ga0105246_12367307
1046 Ga0157324_1052364
1047 Ga0157371_10005749
1048 Ga0157370_10850992
1049 Ga0157369_10130315
1050 Ga0157369_10556445
1051 Ga0157374_10004390
1052 Ga0157374_10027034
1053 Ga0157374_10029296
1054 Ga0157374_10109294
1055 Ga0157378_10021510
1056 Ga0157378_10239523
1057 Ga0157378_11986876
1058 Ga0157378_12498057
1059 Ga0163162_10014581
1060 Ga0163162_10134665
1061 Ga0163162_10148220
1062 Ga0163162_10157306
1063 Ga0163162_10429279
1064 Ga0163162_12606479
1065 Ga0157372_10034851
1066 Ga0157372_10113946
1067 Ga0157375_10004705
1068 Ga0157375_10228986
1069 Ga0157375_12322523
1070 Ga0157375_13044565
1071 Ga0163163_10005346
1072 Ga0163163_10078625
1073 Ga0163163_10299525
1074 Ga0157380_10003292
1075 Ga0157380_10599572
1076 Ga0157380_11062459
1077 Ga0182008_10394228
1078 Ga0157377_10000577
1079 Ga0157377_10548045
1080 Ga0157379_10003458
1081 Ga0157379_10006778
1082 Ga0157379_10030911
1083 Ga0157379_10242111
1084 Ga0157379_10293556
1085 Ga0157376_10003423
1086 Ga0157376_10072284
1087 Ga0157376_10100193
1088 Ga0157376_10105600
1089 Ga0157376_10208190
1090 Ga0157376_10803155
1091 Ga0163161_10018002
1092 Ga0163161_10050674
1093 Ga0163161_10731457
1094 Ga0228598_1065792
1095 Ga0228598_1073854
1096 Ga0209148_1020598
1097 Ga0209233_1001121
1098 Ga0207666_1000124
1099 Ga0209455_1011306
1100 Ga0207697_10001807
1101 Ga0207696_1014549
1102 Ga0207653_10000900
1103 Ga0207682_10001167
1104 Ga0207692_10093366
1105 Ga0207642_10004979
1106 Ga0207642_10133884
1107 Ga0207710_10044231
1108 Ga0207710_10270813
1109 Ga0207710_10448943
1110 Ga0207688_10001600
1111 Ga0207688_10005618
1112 Ga0207680_10004764
1113 Ga0207647_10003822
1114 Ga0207647_10028979
1115 Ga0207645_10003428
1116 Ga0207645_10475989
1117 Ga0207643_10001173
1118 Ga0207643_10007100
1119 Ga0207654_10008472
1120 Ga0207654_10044526
1121 Ga0207654_10063845
1122 Ga0207654_11407266
1123 Ga0207707_10019520
1124 Ga0207707_10208169
1125 Ga0207695_10181574
1126 Ga0207671_10010462
1127 Ga0207671_10224019
1128 Ga0207693_10004938
1129 Ga0207693_10228042
1130 Ga0207693_10412977
1131 Ga0207693_10634584
1132 Ga0207663_10190251
1133 Ga0207663_10531117
1134 Ga0207663_11056703
1135 Ga0207660_10074267
1136 Ga0207660_10309934
1137 Ga0207662_10001522
1138 Ga0207662_10026880
1139 Ga0207657_10007161
1140 Ga0207657_10015087
1141 Ga0207649_10014219
1142 Ga0207652_10004752
1143 Ga0207694_10073084
1144 Ga0207694_10155754
1145 Ga0207650_10063823
1146 Ga0207650_10734742
1147 Ga0207659_10000171
1148 Ga0207659_11414572
1149 Ga0207659_11657395
1150 Ga0207687_10041743
1151 Ga0207687_10154236
1152 Ga0207700_10388251
1153 Ga0207700_10544929
1154 Ga0207644_10022859
1155 Ga0207644_10041637
1156 Ga0207690_10105213
1157 Ga0207690_10483717
1158 Ga0207690_11349214
1159 Ga0207706_10007801
1160 Ga0207706_10022287
1161 Ga0207706_10458246
1162 Ga0207686_10003792
1163 Ga0207686_10076252
1164 Ga0207686_10235930
1165 Ga0207709_10035140
1166 Ga0207709_10054656
1167 Ga0207709_10291706
1168 Ga0207709_10358552
1169 Ga0207670_10009407
1170 Ga0207670_10067051
1171 Ga0207670_10175199
1172 Ga0207670_10210656
1173 Ga0207669_10094228
1174 Ga0207669_10117351
1175 Ga0207704_10051276
1176 Ga0207704_10073531
1177 Ga0207665_10162074
1178 Ga0207691_10006331
1179 Ga0207691_10019281
1180 Ga0207711_10073945
1181 Ga0207711_10219853
1182 Ga0207711_10253883
1183 Ga0207689_10009771
1184 Ga0207689_10025829
1185 Ga0207661_10062009
1186 Ga0207679_10148554
1187 Ga0207679_10418184
1188 Ga0207651_10012475
1189 Ga0207712_10348929
1190 Ga0207712_10386600
1191 Ga0207668_10057373
1192 Ga0207668_10199837
1193 Ga0207640_10034522
1194 Ga0207640_10225732
1195 Ga0207658_10036747
1196 Ga0207658_10084346
1197 Ga0207658_10127513
1198 Ga0207677_10010822
1199 Ga0207677_10823742
1200 Ga0207703_10943395
1201 Ga0207703_11397728
1202 Ga0207639_10088413
1203 Ga0207639_10745405
1204 Ga0207678_10005381
1205 Ga0207678_10023692
1206 Ga0207678_10032866
1207 Ga0207678_11567343
1208 Ga0207708_10003585
1209 Ga0207708_10004995
1210 Ga0207702_10196066
1211 Ga0207702_10444451
1212 Ga0207702_10484467
1213 Ga0207641_10046296
1214 Ga0207641_10372022
1215 Ga0207648_10006363
1216 Ga0207648_10010144
1217 Ga0207676_10002188
1218 Ga0207676_10167956
1219 Ga0207674_10009246
1220 Ga0207675_100008140
1221 Ga0207675_100042041
1222 Ga0207683_10006666
1223 Ga0207683_10015300
1224 Ga0207698_10032586
1225 Ga0207698_10194786
1226 Ga0209996_1013104
1227 Ga0209971_1019230
1228 Ga0209966_1080843
1229 Ga0209998_10006391
1230 Ga0209998_10062062
1231 Ga0209998_10134594
1232 Ga0209974_10001596
1233 Ga0209974_10248751
1234 Ga0207428_10005280
1235 Ga0207428_10010498
1236 Ga0207428_10565432
1237 Ga0207428_10580280
1238 Ga0268266_10102703
1239 Ga0268266_10486835
1240 Ga0268265_10004221
1241 Ga0268264_10048654
1242 Ga0265334_10074350
1243 Ga0265760_10048469
1244 Ga0265325_10000190
1245 Ga0265313_10027803
1246 Ga0307412_10289454
1247 Ga0307415_100162130
1248 Ga0373948_0002930
1249 Ga0373950_0009336
1250 Ga0373959_0008469
1251 Ga0373938_0000338
1252 Ga0373928_0001186
1253 Ga0373929_0009620
1254 Ga0373934_0490021
1255 Ga0373940_0013076
1256 Ga0373940_0033457
1257 Ga0373949_0044271
1258 Ga0373951_0005413
1259 Ga0373951_0046128
1260 Ga0373923_0142747
1261 Ga0373932_0015787
1262 Ga0373932_0208203
1263 Ga0373936_0072469
1264 Ga0373936_0181163
1265 Ga0373939_0013944
1266 Ga0373941_0020791
1267 Ga0373945_0024841
1268 Ga0373960_0112305
1269 Ga0373960_0146577
1270 Ga0373943_0164971
1271 Ga0373943_0297782
1272 Ga0373946_0064100
1273 Ga0373946_0086399
1274 Ga0373955_0649902
1275 Ga0373942_0000711
1276 Ga0373962_0375082
1277 Ga0373924_0055741
1278 Ga0373931_0056058
1279 Ga0373935_0798842
1280 Ga0373927_0019617
1281 Ga0373927_0274875
1282 Ga0373927_0282152
1283 Ga0373947_0009265
1284 Ga0373947_0174576
1285 Ga0373925_0484583
1286 Ga0373925_0890329
1287 Ga0395899_0212623
1288 Ga0395900_0322594
1289 Ga0395898_0056335
1290 Ga0395898_1380105
1291 Ga0436364_1330700
1292 Ga0395901_0175573
1293 Ga0436365_0459904
1294 Ga0436360_0925979
1295 Ga0436361_0250375
1296 Ga0436363_0791902
1297 Ga0436362_0372448
1298 Ga0436362_0543685
1299 Ga0451802_1343066
1300 Ga0451853_3621333
1301 Ga0439450_095236
1302 Ga0439464_0012429
1303 Ga0450916_032199
1304 Ga0451577_1983319
1305 Ga0466964_0099706
1306 Ga0466964_0145709
1307 Ga0466970_0575693
1308 Ga0466957_0089000
1309 Ga0466960_0120429
1310 Ga0495617_085643
1311 Ga0495592_0142450
1312 Ga0495592_0364229
1313 Ga0495603_0150350
1314 Ga0495603_0501051
1315 Ga0495629_0087056
1316 Ga0495629_0197204
1317 Ga0495641_0024187
1318 Ga0495641_0317073
1319 Ga0495641_0496231
1320 Ga0495653_0299335
1321 Ga0495653_0869083
1322 Ga0495580_0900638
1323 Ga0495582_0013236
1324 Ga0495582_0178783
1325 Ga0495639_0045052
1326 Ga0495639_0152430
1327 Ga0495662_0085155
1328 Ga0495664_0077173
1329 Ga0495664_0204786
1330 Ga0495584_0399890
1331 Ga0495594_0008179
1332 Ga0495594_0361964
1333 Ga0495607_0285426
1334 Ga0495618_0156077
1335 Ga0495618_0445003
1336 Ga0495630_0244017
1337 Ga0495630_0257041
1338 Ga0495637_0212524
1339 Ga0495643_0487408
1340 Ga0495666_0030282
1341 Ga0495652_0011528
1342 Ga0495652_0101273
1343 Ga0495652_0276564
1344 Ga0495652_0307315
1345 Ga0495665_0108350
1346 Ga0495640_0165390
1347 Ga0495640_0392119
1348 Ga0495586_0183476
1349 Ga0495586_0235765
1350 Ga0495598_0412410
1351 Ga0495645_0484063
1352 Ga0495667_0148055
1353 Ga0495667_0400753
1354 Ga0495634_0021551
1355 Ga0495634_0037313
1356 Ga0495634_0568639
1357 Ga0495635_0053728
1358 Ga0495661_0300174
1359 Ga0495588_0102828
1360 Ga0495588_0370158
1361 Ga0495657_0210601
1362 Ga0495599_0306963
1363 Ga0495647_0002887
1364 Ga0495658_1027260
1365 Ga0495613_0336406
1366 Ga0495624_0024438
1367 Ga0495671_0478607
1368 Ga0495589_0113372
1369 Ga0495600_0757974
1370 Ga0495581_0037868
1371 Ga0495581_0247981
1372 Ga0495581_0312962
1373 Ga0495674_0014561
1374 Ga0495674_0058741
1375 Ga0495674_0280208
1376 Ga0495674_0394090
1377 Ga0495674_0584062
1378 Ga0495672_0006409
1379 Ga0495676_0079062
1380 Ga0495680_0341852
1381 Ga0495680_0503862
1382 Ga0495684_0234149
1383 Ga0495593_0069475
1384 Ga0495602_0356280
1385 Ga0495614_0055023
1386 Ga0496100_0001870
1387 Ga0496100_0060781
1388 Ga0496100_0188694
1389 Ga0496100_0333772
1390 Ga0496101_0068735
1391 Ga0496101_0341364
1392 Ga0496101_0444412
1393 Ga0496102_0031532
1394 Ga0496102_0060319
1395 Ga0496102_0245244
1396 Ga0496102_0688587
1397 Ga0496103_0019798
1398 Ga0496103_0113324
1399 Ga0496103_0874429
1400 Ga0496104_0000044
1401 Ga0496104_0037727
1402 Ga0496104_0056917
1403 Ga0496104_0087893
1404 Ga0496104_0138069
1405 Ga0496104_0199208
1406 Ga0496104_0241975
1407 Ga0496104_0273703
1408 Ga0496104_0360951
1409 Ga0496104_1031954
1410 Ga0496105_0000017
1411 Ga0496105_0019506
1412 Ga0496105_0083412
1413 Ga0496105_0095932
1414 Ga0496105_0260128
1415 Ga0496105_0775787
1416 Ga0496105_0934486
1417 Ga0496105_1379835
1418 Ga0496106_0008790
1419 Ga0496106_0015617
1420 Ga0496106_0046106
1421 Ga0496106_0392151
1422 Ga0496106_0444948
1423 Ga0496106_1290800
1424 Ga0496107_0012440
1425 Ga0496107_0031434
1426 Ga0496107_0149998
1427 Ga0496107_0547101
1428 Ga0496107_0618442
1429 Ga0496108_0028272
1430 Ga0496108_0052766
1431 Ga0496108_0127808
1432 Ga0496108_0436166
1433 Ga0496109_0004119
1434 Ga0496109_0057269
1435 Ga0496109_0190571
1436 Ga0496109_0580373
1437 Ga0496109_0743561
1438 Ga0496110_0044947
1439 Ga0496110_0077740
1440 Ga0496110_0253720
1441 Ga0496110_0874586
1442 Ga0496111_0022328
1443 Ga0496111_0034976
1444 Ga0496111_0125748
1445 Ga0496111_0202340
1446 Ga0496111_0216614
1447 Ga0496112_0103395
1448 Ga0496112_0129835
1449 Ga0496112_0295650
1450 Ga0496112_1241486
1451 Ga0496113_0011038
1452 Ga0496113_0030721
1453 Ga0496113_0050382
1454 Ga0496113_0061666
1455 Ga0496113_0107328
1456 Ga0496113_0742205
1457 Ga0496114_0002703
1458 Ga0496115_0032582
1459 Ga0496115_0130799
1460 Ga0496115_0238393
1461 Ga0496115_0364714
1462 Ga0496115_0396802
1463 Ga0496115_0452231
1464 Ga0496115_0726275
1465 Ga0496115_0984577
1466 Ga0496119_0002993
1467 Ga0496119_0220703
1468 Ga0501039_0569195
1469 Ga0501040_0498459
1470 Ga0501048_0426187
1471 Ga0501068_0332051
1472 Ga0501068_0364819
1473 Ga0501072_1219730
1474 Ga0501075_0331573
1475 Ga0501076_0020445
1476 Ga0501076_0162999
1477 Ga0501079_1320246
1478 Ga0501045_0326363
1479 nmdc:mga03n38_337593_c1
1480 nmdc:mga00v17_120167_c1
1481 nmdc:mga0yw44_232732_c1
1482 nmdc:mga06z11_65791_c1
1483 nmdc:mga06z11_681106_c1
1484 nmdc:mga07m45_102733_c1
1485 nmdc:mga05p37_143642_c1
1486 nmdc:mga05p37_2365_c1
1487 nmdc:mga09592_2980_c1
1488 nmdc:mga0qj67_23598_c1
1489 nmdc:mga0qj67_236022_c1
1490 nmdc:mga06r32_157_c1
1491 nmdc:mga06r32_283723_c1
1492 nmdc:mga08y16_107747_c1
1493 nmdc:mga08y16_1602_c1
1494 nmdc:mga08y16_235836_c1
1495 nmdc:mga0n895_126674_c1
1496 nmdc:mga0n895_139351_c1
1497 nmdc:mga0n895_665502_c1
1498 nmdc:mga0rr50_110004_c1
1499 nmdc:mga0rr50_1192507_c1
1500 nmdc:mga0rr50_516306_c1
1501 nmdc:mga08x19_496498_c1
1502 nmdc:mga08x19_833280_c1
1503 nmdc:mga0a205_278247_c1
1504 nmdc:mga0a205_4970_c1
1505 Ga0495601_0005722
1506 Ga0495601_0012964
1507 Ga0495601_0021628
1508 Ga0495601_0074884
1509 Ga0495612_0118253
1510 Ga0495595_0185656
1511 Ga0495595_0317850
1512 Ga0495595_0581183
1513 Ga0495619_0015864
1514 Ga0495619_0044453
1515 Ga0495619_0111358
1516 Ga0495619_0131082
1517 Ga0500595_005112
1518 Ga0501084_1031129
1519 Ga0501082_0168155
1520 Ga0501082_0525248
1521 2509146819
1522 2643949769
1523 2876770175
1524 2885418904
1525 8006992784
1526 8056682484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map