F479573

General Info

Members Datasets Scaffolds Average Seq Length
761 351 1522 73

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10012704|Ga0105248_100127042
Length 86
Sequence VETNQPFRKEANEAMNRDENEDATIYKVVLNHEEQYSIWPADRENALGWRDAGKSGPKAECLAYINEVWTDMRPLSLRKKMAEATR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
201 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
206 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
253 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
254 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
255 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
256 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
257 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
258 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
259 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
280 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
281 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
282 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
283 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
284 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
285 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
286 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
287 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
288 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
289 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
290 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
291 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
292 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
293 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
294 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
295 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
296 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
297 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
298 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
299 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
300 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
301 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
302 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
303 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
304 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
305 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
306 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
307 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
308 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
309 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
310 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
316 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
317 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
318 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
319 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
320 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
321 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
322 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
323 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
327 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
328 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
341 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
342 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
343 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
344 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
345 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
346 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
347 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.15
Nodule 0.13
Rhizoplane 1.97
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 8.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10012704 3300009177 Bacteria 9293
2 2214761614 2209111006 Bacteria 834
3 CNBas_1006670 3300000531 Unclassified 670
4 CNAas_1013257 3300000532 Unclassified 570
5 JGI24749J21850_1056116 3300002076 Bacteria 593
6 JGI24751J29686_10000001 3300002459 Bacteria 210953
7 JGI24751J29686_10000422 3300002459 Bacteria 13301
8 Ga0006759J45824_1095372 3300003163 Bacteria 582
9 rootL2_10106450 3300003322 Bacteria 7924
10 rootL2_10342516 3300003322 Bacteria 1125
11 Ga0058862_11894114 3300004803 Bacteria 764
12 Ga0065717_1016680 3300005276 Bacteria 508
13 Ga0065714_10002183 3300005288 Bacteria 378167
14 Ga0065704_10720431 3300005289 Bacteria 543
15 Ga0065712_10000030 3300005290 Bacteria 237869
16 Ga0065712_10124918 3300005290 Bacteria 1618
17 Ga0065715_10093122 3300005293 Bacteria 4802
18 Ga0065715_10124356 3300005293 Bacteria 2156
19 Ga0065715_10169251 3300005293 Bacteria 1560
20 Ga0065715_10198835 3300005293 Bacteria 1373
21 Ga0065715_10514993 3300005293 Bacteria 751
22 Ga0065715_10909840 3300005293 Unclassified 572
23 Ga0065715_11029226 3300005293 Bacteria 528
24 Ga0065707_10117506 3300005295 Bacteria 2209
25 Ga0070658_11124600 3300005327 Bacteria 683
26 Ga0070676_10637773 3300005328 Bacteria 772
27 Ga0070676_10653003 3300005328 Bacteria 764
28 Ga0070683_100004518 3300005329 Bacteria 11484
29 Ga0070690_100946949 3300005330 Bacteria 676
30 Ga0070690_101592457 3300005330 Bacteria 529
31 Ga0070690_101750388 3300005330 Unclassified 506
32 Ga0070670_100000029 3300005331 Bacteria 180239
33 Ga0070670_100003117 3300005331 Bacteria 13718
34 Ga0070670_100035609 3300005331 Bacteria 4285
35 Ga0070670_100075559 3300005331 Bacteria 2895
36 Ga0070670_101270626 3300005331 Bacteria 673
37 Ga0068869_100538529 3300005334 Bacteria 979
38 Ga0068869_101525948 3300005334 Bacteria 594
39 Ga0068869_101607406 3300005334 Bacteria 579
40 Ga0068869_102147124 3300005334 Bacteria 502
41 Ga0070680_100009072 3300005336 Bacteria 7625
42 Ga0070680_101676483 3300005336 Unclassified 551
43 Ga0068868_100027052 3300005338 Bacteria 4374
44 Ga0068868_100380034 3300005338 Bacteria 1215
45 Ga0068868_101250228 3300005338 Bacteria 688
46 Ga0070691_10638343 3300005341 Bacteria 633
47 Ga0070687_100712217 3300005343 Bacteria 702
48 Ga0070692_10029966 3300005345 Bacteria 2717
49 Ga0070692_10111891 3300005345 Unclassified 1511
50 Ga0070669_100085882 3300005353 Bacteria 2350
51 Ga0070669_100726864 3300005353 Bacteria 840
52 Ga0070669_100874283 3300005353 Bacteria 767
53 Ga0070669_101465231 3300005353 Bacteria 593
54 Ga0070675_100250718 3300005354 Bacteria 1549
55 Ga0070671_102030569 3300005355 Bacteria 512
56 Ga0070674_100398493 3300005356 Bacteria 1124
57 Ga0070673_100005192 3300005364 Bacteria 8318
58 Ga0070673_100153836 3300005364 Bacteria 1950
59 Ga0070673_100195166 3300005364 Bacteria 1741
60 Ga0070673_100424051 3300005364 Bacteria 1193
61 Ga0070673_100550567 3300005364 Bacteria 1048
62 Ga0070673_101674513 3300005364 Bacteria 602
63 Ga0070688_100907555 3300005365 Unclassified 695
64 Ga0070659_100748441 3300005366 Bacteria 847
65 Ga0070703_10000220 3300005406 Bacteria 27527
66 Ga0070713_100018701 3300005436 Bacteria 5269
67 Ga0070713_100216711 3300005436 Bacteria 1735
68 Ga0070710_10018180 3300005437 Bacteria 3612
69 Ga0070701_10471026 3300005438 Unclassified 810
70 Ga0070701_10480188 3300005438 Bacteria 803
71 Ga0070705_100059486 3300005440 Bacteria 2263
72 Ga0070705_100623399 3300005440 Bacteria 837
73 Ga0070705_100658381 3300005440 Bacteria 817
74 Ga0070705_100789895 3300005440 Bacteria 754
75 Ga0070705_100867897 3300005440 Bacteria 723
76 Ga0070705_101188844 3300005440 Bacteria 628
77 Ga0070705_101766026 3300005440 Unclassified 524
78 Ga0070700_100014494 3300005441 Bacteria 4452
79 Ga0070700_100031265 3300005441 Unclassified 3188
80 Ga0070700_100343943 3300005441 Bacteria 1103
81 Ga0070694_100186650 3300005444 Bacteria 1537
82 Ga0070694_100667922 3300005444 Bacteria 842
83 Ga0070694_100714011 3300005444 Bacteria 816
84 Ga0070694_101869502 3300005444 Bacteria 512
85 Ga0070708_100004127 3300005445 Bacteria 11401
86 Ga0070681_10037853 3300005458 Bacteria 4838
87 Ga0070681_10069196 3300005458 Bacteria 3496
88 Ga0068867_100246150 3300005459 Bacteria 1452
89 Ga0068867_100933841 3300005459 Bacteria 783
90 Ga0070685_10091569 3300005466 Unclassified 1841
91 Ga0070685_10662184 3300005466 Bacteria 757
92 Ga0070706_100006396 3300005467 Bacteria 11132
93 Ga0070706_100047275 3300005467 Bacteria 3971
94 Ga0070706_100251583 3300005467 Bacteria 1650
95 Ga0070706_101050089 3300005467 Bacteria 751
96 Ga0070707_100006058 3300005468 Bacteria 11283
97 Ga0070707_100821098 3300005468 Bacteria 894
98 Ga0070698_100005406 3300005471 Bacteria 13956
99 Ga0070698_100182328 3300005471 Bacteria 2038
100 Ga0070698_100555800 3300005471 Bacteria 1087
101 Ga0070698_100759474 3300005471 Bacteria 913
102 Ga0070699_100021238 3300005518 Bacteria 5599
103 Ga0070699_100031595 3300005518 Bacteria 4571
104 Ga0070699_100099820 3300005518 Bacteria 2544
105 Ga0070679_100092578 3300005530 Bacteria 3011
106 Ga0070679_101062793 3300005530 Unclassified 754
107 Ga0070684_100023258 3300005535 Bacteria 5179
108 Ga0070697_100062855 3300005536 Bacteria 3031
109 Ga0070697_100778217 3300005536 Bacteria 846
110 Ga0068853_102229231 3300005539 Unclassified 531
111 Ga0070672_100651582 3300005543 Bacteria 920
112 Ga0070672_101398863 3300005543 Bacteria 626
113 Ga0070686_100062463 3300005544 Bacteria 2410
114 Ga0070695_100384363 3300005545 Bacteria 1060
115 Ga0070695_100500861 3300005545 Bacteria 939
116 Ga0070695_101010896 3300005545 Bacteria 677
117 Ga0070696_100009548 3300005546 Bacteria 6495
118 Ga0070693_100004871 3300005547 Bacteria 6409
119 Ga0070693_100048446 3300005547 Bacteria 2420
120 Ga0070693_100775871 3300005547 Unclassified 708
121 Ga0070693_101536707 3300005547 Bacteria 521
122 Ga0070665_100022826 3300005548 Bacteria 6299
123 Ga0070665_100267516 3300005548 Bacteria 1711
124 Ga0070665_100374836 3300005548 Bacteria 1430
125 Ga0070665_100421458 3300005548 Bacteria 1343
126 Ga0070665_100632199 3300005548 Bacteria 1083
127 Ga0070704_100018252 3300005549 Bacteria 4481
128 Ga0070704_100312465 3300005549 Bacteria 1313
129 Ga0070704_100372176 3300005549 Bacteria 1212
130 Ga0070704_100539727 3300005549 Bacteria 1018
131 Ga0070704_101895921 3300005549 Bacteria 552
132 Ga0068855_100155620 3300005563 Bacteria 2597
133 Ga0068855_100921031 3300005563 Bacteria 922
134 Ga0070664_100324516 3300005564 Bacteria 1396
135 Ga0070664_100628256 3300005564 Bacteria 997
136 Ga0070664_100669274 3300005564 Bacteria 965
137 Ga0070664_100802193 3300005564 Unclassified 880
138 Ga0068857_100145689 3300005577 Unclassified 2143
139 Ga0068857_100332118 3300005577 Bacteria 1405
140 Ga0068857_100359170 3300005577 Bacteria 1350
141 Ga0068857_100386339 3300005577 Bacteria 1301
142 Ga0068857_100404479 3300005577 Bacteria 1271
143 Ga0068857_100705368 3300005577 Unclassified 959
144 Ga0068857_101069754 3300005577 Unclassified 778
145 Ga0068857_101371950 3300005577 Unclassified 687
146 Ga0068857_101751843 3300005577 Unclassified 608
147 Ga0068854_100049693 3300005578 Bacteria 2997
148 Ga0068854_100088210 3300005578 Bacteria 2303
149 Ga0068854_101438159 3300005578 Bacteria 624
150 Ga0068854_101593376 3300005578 Unclassified 595
151 Ga0068856_100004163 3300005614 Bacteria 14449
152 Ga0068856_101092757 3300005614 Unclassified 815
153 Ga0068856_102469266 3300005614 Bacteria 527
154 Ga0070702_100042055 3300005615 Bacteria 2567
155 Ga0070702_100167158 3300005615 Bacteria 1427
156 Ga0070702_100272654 3300005615 Bacteria 1158
157 Ga0068852_100381061 3300005616 Bacteria 1384
158 Ga0068852_100687951 3300005616 Bacteria 1032
159 Ga0068852_100778545 3300005616 Unclassified 970
160 Ga0068852_102335504 3300005616 Bacteria 556
161 Ga0068859_100002124 3300005617 Bacteria 20176
162 Ga0068859_100010458 3300005617 Bacteria 9335
163 Ga0068859_100020283 3300005617 Bacteria 6672
164 Ga0068859_100022160 3300005617 Bacteria 6369
165 Ga0068859_100042712 3300005617 Bacteria 4554
166 Ga0068859_100045031 3300005617 Bacteria 4433
167 Ga0068859_100142321 3300005617 Bacteria 2472
168 Ga0068859_100173641 3300005617 Bacteria 2237
169 Ga0068859_100320598 3300005617 Unclassified 1644
170 Ga0068859_100629668 3300005617 Bacteria 1165
171 Ga0068859_100643336 3300005617 Bacteria 1152
172 Ga0068859_100662149 3300005617 Bacteria 1136
173 Ga0068859_100721786 3300005617 Bacteria 1086
174 Ga0068859_101505572 3300005617 Bacteria 743
175 Ga0068859_101872299 3300005617 Unclassified 662
176 Ga0068859_102537599 3300005617 Bacteria 564
177 Ga0068864_100045212 3300005618 Bacteria 3777
178 Ga0068864_100080767 3300005618 Bacteria 2849
179 Ga0068864_100135436 3300005618 Bacteria 2217
180 Ga0068864_100217080 3300005618 Bacteria 1763
181 Ga0068864_100342185 3300005618 Bacteria 1410
182 Ga0068864_100999065 3300005618 Bacteria 830
183 Ga0068864_101514975 3300005618 Bacteria 674
184 Ga0068861_100208628 3300005719 Bacteria 1644
185 Ga0068861_102123057 3300005719 Bacteria 562
186 Ga0068870_10134043 3300005840 Bacteria 1442
187 Ga0068870_11055857 3300005840 Bacteria 582
188 Ga0068863_100022923 3300005841 Bacteria 5967
189 Ga0068863_100023193 3300005841 Bacteria 5931
190 Ga0068863_100047930 3300005841 Bacteria 4052
191 Ga0068863_100088735 3300005841 Bacteria 2931
192 Ga0068863_100555709 3300005841 Bacteria 1134
193 Ga0068863_100823778 3300005841 Bacteria 926
194 Ga0068863_101218382 3300005841 Bacteria 759
195 Ga0068863_101647552 3300005841 Bacteria 651
196 Ga0068858_100133069 3300005842 Bacteria 2332
197 Ga0068858_100173823 3300005842 Bacteria 2032
198 Ga0068858_100299624 3300005842 Bacteria 1534
199 Ga0068858_100483273 3300005842 Bacteria 1195
200 Ga0068858_100497253 3300005842 Bacteria 1178
201 Ga0068860_100001845 3300005843 Bacteria 22552
202 Ga0068860_100053331 3300005843 Unclassified 3845
203 Ga0068860_100061260 3300005843 Bacteria 3575
204 Ga0068860_100405916 3300005843 Bacteria 1348
205 Ga0068860_100471579 3300005843 Bacteria 1250
206 Ga0068860_101793983 3300005843 Bacteria 635
207 Ga0068862_100427931 3300005844 Bacteria 1244
208 Ga0068862_100432461 3300005844 Bacteria 1237
209 Ga0068862_100565066 3300005844 Bacteria 1088
210 Ga0068862_100781618 3300005844 Bacteria 931
211 Ga0068862_101402448 3300005844 Bacteria 702
212 Ga0068862_102152715 3300005844 Bacteria 569
213 Ga0068862_102221697 3300005844 Bacteria 560
214 Ga0081455_10714285 3300005937 Bacteria 637
215 Ga0070717_10005644 3300006028 Bacteria 9144
216 Ga0070717_10158186 3300006028 Bacteria 1964
217 Ga0070717_10752049 3300006028 Bacteria 886
218 Ga0075368_10120964 3300006042 Bacteria 1084
219 Ga0075363_100288381 3300006048 Bacteria 951
220 Ga0070715_10470858 3300006163 Bacteria 713
221 Ga0075362_10367299 3300006177 Bacteria 722
222 Ga0075367_10003079 3300006178 Bacteria 7827
223 Ga0075367_10004772 3300006178 Bacteria 6664
224 Ga0075366_10039787 3300006195 Bacteria 2779
225 Ga0075366_10326671 3300006195 Bacteria 940
226 Ga0097621_100045373 3300006237 Bacteria 3550
227 Ga0097621_100151745 3300006237 Bacteria 1987
228 Ga0097621_100458555 3300006237 Bacteria 1149
229 Ga0068871_100057391 3300006358 Bacteria 3167
230 Ga0068871_100082722 3300006358 Bacteria 2662
231 Ga0068871_100560232 3300006358 Unclassified 1036
232 Ga0075428_100000624 3300006844 Bacteria 36219
233 Ga0075428_100660157 3300006844 Bacteria 1115
234 Ga0075431_100494243 3300006847 Bacteria 1215
235 Ga0075433_10294666 3300006852 Bacteria 1437
236 Ga0075433_10396810 3300006852 Bacteria 1217
237 Ga0075433_11342025 3300006852 Bacteria 619
238 Ga0075433_11504021 3300006852 Unclassified 581
239 Ga0075434_100264674 3300006871 Bacteria 1738
240 Ga0075434_101207480 3300006871 Bacteria 768
241 Ga0075434_102479707 3300006871 Bacteria 520
242 Ga0068865_100002676 3300006881 Bacteria 10571
243 Ga0075436_100001954 3300006914 Bacteria 14208
244 Ga0097620_100002124 3300006931 Bacteria 20176
245 Ga0097620_100010459 3300006931 Bacteria 9335
246 Ga0097620_100020284 3300006931 Bacteria 6672
247 Ga0097620_100022160 3300006931 Bacteria 6369
248 Ga0097620_100042709 3300006931 Bacteria 4554
249 Ga0097620_100045031 3300006931 Bacteria 4433
250 Ga0097620_100142331 3300006931 Bacteria 2472
251 Ga0097620_100173642 3300006931 Bacteria 2237
252 Ga0097620_100320613 3300006931 Unclassified 1644
253 Ga0097620_100629615 3300006931 Bacteria 1165
254 Ga0097620_100643352 3300006931 Bacteria 1152
255 Ga0097620_100662137 3300006931 Bacteria 1136
256 Ga0097620_100721808 3300006931 Bacteria 1086
257 Ga0097620_101505406 3300006931 Bacteria 743
258 Ga0097620_101872381 3300006931 Unclassified 662
259 Ga0097620_102538215 3300006931 Bacteria 564
260 Ga0099826_10063568 3300006948 Bacteria 2384
261 Ga0075435_100028539 3300007076 Bacteria 4377
262 Ga0105240_10321036 3300009093 Bacteria 1765
263 Ga0105240_12249458 3300009093 Unclassified 565
264 Ga0105245_10018087 3300009098 Bacteria 6159
265 Ga0105245_10174612 3300009098 Bacteria 2048
266 Ga0105245_10980462 3300009098 Bacteria 889
267 Ga0105247_10009330 3300009101 Bacteria 5956
268 Ga0105247_10054350 3300009101 Bacteria 2471
269 Ga0105247_10105907 3300009101 Bacteria 1803
270 Ga0105247_10140137 3300009101 Bacteria 1584
271 Ga0105247_10237928 3300009101 Bacteria 1239
272 Ga0105247_11148564 3300009101 Bacteria 615
273 Ga0114129_10078463 3300009147 Bacteria 4593
274 Ga0114129_13350279 3300009147 Bacteria 517
275 Ga0105243_10385627 3300009148 Bacteria 1297
276 Ga0105243_10398650 3300009148 Bacteria 1278
277 Ga0105243_10432845 3300009148 Bacteria 1230
278 Ga0105243_10547148 3300009148 Bacteria 1105
279 Ga0105243_10641985 3300009148 Bacteria 1028
280 Ga0105243_12715493 3300009148 Bacteria 535
281 Ga0105241_10164032 3300009174 Bacteria 1829
282 Ga0105241_10818936 3300009174 Unclassified 859
283 Ga0105241_10855176 3300009174 Bacteria 842
284 Ga0105241_11769480 3300009174 Bacteria 602
285 Ga0105241_12084819 3300009174 Unclassified 560
286 Ga0105242_10001519 3300009176 Bacteria 18242
287 Ga0105242_10209582 3300009176 Bacteria 1736
288 Ga0105242_10494777 3300009176 Bacteria 1162
289 Ga0105242_10684527 3300009176 Unclassified 1001
290 Ga0105248_10002805 3300009177 Bacteria 19364
291 Ga0105248_10018803 3300009177 Bacteria 7642
292 Ga0105248_10049731 3300009177 Bacteria 4701
293 Ga0105248_10074126 3300009177 Bacteria 3825
294 Ga0105248_10233441 3300009177 Bacteria 2071
295 Ga0105248_10334132 3300009177 Bacteria 1706
296 Ga0105248_10346182 3300009177 Bacteria 1673
297 Ga0105248_10678600 3300009177 Bacteria 1162
298 Ga0105248_10690642 3300009177 Bacteria 1151
299 Ga0105248_11822847 3300009177 Unclassified 690
300 Ga0105237_10154225 3300009545 Bacteria 2293
301 Ga0105237_10354436 3300009545 Bacteria 1472
302 Ga0105238_10221214 3300009551 Bacteria 1869
303 Ga0105238_10469927 3300009551 Bacteria 1256
304 Ga0105238_10953724 3300009551 Bacteria 878
305 Ga0105249_10299175 3300009553 Bacteria 1613
306 Ga0105249_10307748 3300009553 Bacteria 1592
307 Ga0105249_10492994 3300009553 Bacteria 1269
308 Ga0105249_10714312 3300009553 Bacteria 1063
309 Ga0105239_10382335 3300010375 Bacteria 1592
310 Ga0105239_10603312 3300010375 Bacteria 1252
311 Ga0105239_10726078 3300010375 Bacteria 1136
312 Ga0105239_11497551 3300010375 Bacteria 780
313 Ga0105239_11955401 3300010375 Bacteria 680
314 Ga0157371_11226175 3300013102 Bacteria 579
315 Ga0157369_11911226 3300013105 Bacteria 602
316 Ga0157374_10073990 3300013296 Bacteria 3216
317 Ga0157374_10717284 3300013296 Unclassified 1014
318 Ga0157374_10930157 3300013296 Bacteria 887
319 Ga0157374_11099653 3300013296 Bacteria 815
320 Ga0157374_11111437 3300013296 Unclassified 811
321 Ga0157374_11701829 3300013296 Bacteria 655
322 Ga0157374_12843042 3300013296 Bacteria 512
323 Ga0157378_10036366 3300013297 Bacteria 4358
324 Ga0157378_10266418 3300013297 Unclassified 1646
325 Ga0157378_10547209 3300013297 Bacteria 1162
326 Ga0157378_10565390 3300013297 Bacteria 1144
327 Ga0157378_10931873 3300013297 Bacteria 900
328 Ga0157378_12645221 3300013297 Bacteria 554
329 Ga0163162_10000933 3300013306 Bacteria 27147
330 Ga0163162_10018537 3300013306 Bacteria 6820
331 Ga0163162_10304009 3300013306 Bacteria 1727
332 Ga0163162_10552999 3300013306 Bacteria 1279
333 Ga0163162_10986727 3300013306 Bacteria 952
334 Ga0163162_11183495 3300013306 Bacteria 867
335 Ga0163162_11563635 3300013306 Unclassified 752
336 Ga0157372_12037295 3300013307 Bacteria 660
337 Ga0157375_10071194 3300013308 Bacteria 3490
338 Ga0157375_10226216 3300013308 Bacteria 2030
339 Ga0157375_11242507 3300013308 Bacteria 875
340 Ga0157375_12360048 3300013308 Bacteria 634
341 Ga0157375_13325095 3300013308 Bacteria 536
342 Ga0157375_13670390 3300013308 Bacteria 510
343 Ga0163163_10000043 3300014325 Bacteria 137150
344 Ga0163163_10003276 3300014325 Bacteria 13724
345 Ga0163163_10103477 3300014325 Bacteria 2872
346 Ga0163163_10107306 3300014325 Bacteria 2819
347 Ga0163163_10544940 3300014325 Bacteria 1222
348 Ga0163163_10575986 3300014325 Bacteria 1189
349 Ga0163163_10999197 3300014325 Bacteria 900
350 Ga0163163_11004134 3300014325 Unclassified 898
351 Ga0157380_10007160 3300014326 Bacteria 7904
352 Ga0157380_10119271 3300014326 Unclassified 2231
353 Ga0157380_11707464 3300014326 Bacteria 687
354 Ga0157377_10126974 3300014745 Bacteria 1553
355 Ga0157379_10130543 3300014968 Bacteria 2261
356 Ga0157379_10145446 3300014968 Bacteria 2138
357 Ga0157379_11447841 3300014968 Bacteria 667
358 Ga0157376_10147077 3300014969 Bacteria 2121
359 Ga0182007_10096517 3300015262 Unclassified 976
360 Ga0163161_10999809 3300017792 Bacteria 714
361 Ga0206356_10935860 3300020070 Bacteria 783
362 Ga0213874_10359547 3300021377 Bacteria 559
363 Ga0207697_10214069 3300025315 Bacteria 849
364 Ga0207653_10000259 3300025885 Bacteria 33105
365 Ga0207692_10138914 3300025898 Bacteria 1380
366 Ga0207710_10004836 3300025900 Bacteria 5844
367 Ga0207710_10031891 3300025900 Bacteria 2306
368 Ga0207710_10207860 3300025900 Bacteria 968
369 Ga0207680_10286162 3300025903 Bacteria 1146
370 Ga0207647_10618267 3300025904 Bacteria 596
371 Ga0207699_10262153 3300025906 Bacteria 1195
372 Ga0207645_10086488 3300025907 Bacteria 2014
373 Ga0207645_10838077 3300025907 Bacteria 625
374 Ga0207643_10025914 3300025908 Bacteria 3244
375 Ga0207643_10602290 3300025908 Bacteria 707
376 Ga0207684_10004923 3300025910 Bacteria 12459
377 Ga0207684_10214387 3300025910 Bacteria 1661
378 Ga0207654_10450337 3300025911 Unclassified 902
379 Ga0207654_10783585 3300025911 Unclassified 688
380 Ga0207707_10320107 3300025912 Bacteria 1339
381 Ga0207695_10597098 3300025913 Bacteria 985
382 Ga0207660_10084386 3300025917 Bacteria 2341
383 Ga0207660_10764723 3300025917 Bacteria 788
384 Ga0207662_10410723 3300025918 Bacteria 920
385 Ga0207662_10526600 3300025918 Bacteria 816
386 Ga0207662_11059958 3300025918 Bacteria 576
387 Ga0207657_10202951 3300025919 Bacteria 1594
388 Ga0207649_10714526 3300025920 Bacteria 778
389 Ga0207652_10063514 3300025921 Bacteria 3193
390 Ga0207646_10003350 3300025922 Bacteria 18187
391 Ga0207646_11763570 3300025922 Bacteria 530
392 Ga0207681_10672351 3300025923 Bacteria 859
393 Ga0207681_11311753 3300025923 Bacteria 608
394 Ga0207694_10664375 3300025924 Bacteria 878
395 Ga0207650_10000005 3300025925 Bacteria 663190
396 Ga0207650_10027601 3300025925 Bacteria 4065
397 Ga0207650_10126284 3300025925 Bacteria 1997
398 Ga0207650_10143973 3300025925 Bacteria 1876
399 Ga0207650_10304901 3300025925 Bacteria 1301
400 Ga0207650_11801229 3300025925 Bacteria 518
401 Ga0207659_10460307 3300025926 Bacteria 1072
402 Ga0207687_10047568 3300025927 Bacteria 2974
403 Ga0207687_10097910 3300025927 Bacteria 2152
404 Ga0207700_10049335 3300025928 Bacteria 3131
405 Ga0207690_10022895 3300025932 Bacteria 3892
406 Ga0207690_10848132 3300025932 Bacteria 756
407 Ga0207690_11452105 3300025932 Bacteria 573
408 Ga0207686_10001369 3300025934 Bacteria 13846
409 Ga0207686_10122221 3300025934 Bacteria 1774
410 Ga0207686_10447672 3300025934 Bacteria 993
411 Ga0207686_10456456 3300025934 Unclassified 984
412 Ga0207709_10001596 3300025935 Bacteria 15458
413 Ga0207709_10996071 3300025935 Bacteria 685
414 Ga0207669_11604041 3300025937 Bacteria 555
415 Ga0207704_10024281 3300025938 Bacteria 3284
416 Ga0207691_10378783 3300025940 Bacteria 1208
417 Ga0207711_10014094 3300025941 Bacteria 6643
418 Ga0207711_10020406 3300025941 Bacteria 5524
419 Ga0207711_10037767 3300025941 Bacteria 4104
420 Ga0207711_10104756 3300025941 Bacteria 2507
421 Ga0207711_10164381 3300025941 Bacteria 2011
422 Ga0207711_10746023 3300025941 Bacteria 913
423 Ga0207711_10902068 3300025941 Bacteria 822
424 Ga0207711_11767043 3300025941 Bacteria 562
425 Ga0207689_10358686 3300025942 Bacteria 1212
426 Ga0207689_10426849 3300025942 Bacteria 1106
427 Ga0207689_10598437 3300025942 Bacteria 927
428 Ga0207689_10800965 3300025942 Bacteria 795
429 Ga0207689_11099241 3300025942 Bacteria 670
430 Ga0207689_11285903 3300025942 Bacteria 615
431 Ga0207661_10063266 3300025944 Bacteria 2996
432 Ga0207679_10908065 3300025945 Bacteria 806
433 Ga0207679_10953805 3300025945 Bacteria 786
434 Ga0207679_11003522 3300025945 Unclassified 765
435 Ga0207667_10038215 3300025949 Bacteria 5128
436 Ga0207667_10802872 3300025949 Bacteria 938
437 Ga0207651_10006766 3300025960 Bacteria 6042
438 Ga0207651_10057602 3300025960 Bacteria 2681
439 Ga0207651_10387545 3300025960 Bacteria 1186
440 Ga0207651_10591702 3300025960 Bacteria 969
441 Ga0207712_10558045 3300025961 Bacteria 986
442 Ga0207712_10742542 3300025961 Bacteria 859
443 Ga0207712_10863641 3300025961 Bacteria 798
444 Ga0207640_10323040 3300025981 Bacteria 1229
445 Ga0207640_10598826 3300025981 Bacteria 933
446 Ga0207640_11781427 3300025981 Bacteria 556
447 Ga0207677_10018929 3300026023 Bacteria 4146
448 Ga0207677_10561578 3300026023 Bacteria 996
449 Ga0207677_11335215 3300026023 Bacteria 659
450 Ga0207703_10193574 3300026035 Unclassified 1803
451 Ga0207639_11057723 3300026041 Bacteria 761
452 Ga0207708_10247515 3300026075 Bacteria 1435
453 Ga0207708_10769658 3300026075 Bacteria 827
454 Ga0207708_11119941 3300026075 Bacteria 687
455 Ga0207702_10006681 3300026078 Bacteria 9915
456 Ga0207641_10288228 3300026088 Bacteria 1547
457 Ga0207641_10404420 3300026088 Bacteria 1311
458 Ga0207641_10488740 3300026088 Bacteria 1194
459 Ga0207641_10574240 3300026088 Bacteria 1102
460 Ga0207641_10964020 3300026088 Bacteria 849
461 Ga0207641_11327671 3300026088 Bacteria 720
462 Ga0207641_11674858 3300026088 Bacteria 638
463 Ga0207641_11711964 3300026088 Bacteria 631
464 Ga0207641_11749628 3300026088 Bacteria 623
465 Ga0207648_10182795 3300026089 Unclassified 1856
466 Ga0207648_10957153 3300026089 Bacteria 801
467 Ga0207676_10168223 3300026095 Bacteria 1907
468 Ga0207676_10258499 3300026095 Bacteria 1571
469 Ga0207676_10264642 3300026095 Bacteria 1554
470 Ga0207676_11451008 3300026095 Bacteria 683
471 Ga0207676_12153494 3300026095 Bacteria 556
472 Ga0207674_10448539 3300026116 Bacteria 1247
473 Ga0207674_11150992 3300026116 Bacteria 745
474 Ga0207674_11291768 3300026116 Bacteria 699
475 Ga0207674_11339279 3300026116 Bacteria 685
476 Ga0207675_100403323 3300026118 Bacteria 1348
477 Ga0207675_102171048 3300026118 Bacteria 571
478 Ga0207683_11261077 3300026121 Bacteria 685
479 Ga0207698_10160798 3300026142 Unclassified 1964
480 Ga0209813_10411178 3300027866 Bacteria 547
481 Ga0207428_10773166 3300027907 Bacteria 683
482 Ga0207428_11017452 3300027907 Bacteria 582
483 Ga0268266_10009931 3300028379 Bacteria 8359
484 Ga0268266_10117497 3300028379 Bacteria 2363
485 Ga0268266_10247139 3300028379 Bacteria 1649
486 Ga0268266_12116909 3300028379 Bacteria 535
487 Ga0268265_10224930 3300028380 Bacteria 1645
488 Ga0268265_10289308 3300028380 Bacteria 1470
489 Ga0268265_10373342 3300028380 Bacteria 1310
490 Ga0268265_10513982 3300028380 Bacteria 1131
491 Ga0268265_10853305 3300028380 Bacteria 891
492 Ga0268265_11043420 3300028380 Bacteria 809
493 Ga0268265_11685602 3300028380 Bacteria 640
494 Ga0268264_10002804 3300028381 Bacteria 15217
495 Ga0268264_11609012 3300028381 Bacteria 660
496 Ga0268264_12001130 3300028381 Unclassified 589
497 Ga0265334_10100220 3300028573 Unclassified 1049
498 Ga0265338_10078377 3300028800 Bacteria 2787
499 Ga0265338_10078545 3300028800 Bacteria 2783
500 Ga0265332_10319492 3300031238 Bacteria 641
501 Ga0265320_10057014 3300031240 Bacteria 1875
502 Ga0265325_10133896 3300031241 Bacteria 1184
503 Ga0265339_10515213 3300031249 Bacteria 552
504 Ga0307513_10010614 3300031456 Bacteria 11526
505 Ga0307513_10068470 3300031456 Bacteria 3718
506 Ga0307513_10228943 3300031456 Unclassified 1673
507 Ga0307513_10420187 3300031456 Bacteria 1067
508 Ga0307509_10185934 3300031507 Bacteria 1936
509 Ga0307408_100209566 3300031548 Unclassified 1583
510 Ga0307408_100266382 3300031548 Bacteria 1420
511 Ga0307408_101255110 3300031548 Bacteria 693
512 Ga0265314_10247246 3300031711 Bacteria 1026
513 Ga0307516_10473320 3300031730 Bacteria 908
514 Ga0307405_10088610 3300031731 Bacteria 2042
515 Ga0307405_10911781 3300031731 Bacteria 744
516 Ga0307413_10269892 3300031824 Bacteria 1273
517 Ga0307410_10002355 3300031852 Bacteria 9104
518 Ga0307410_10346369 3300031852 Bacteria 1186
519 Ga0307406_10009489 3300031901 Bacteria 5459
520 Ga0307406_10051863 3300031901 Unclassified 2607
521 Ga0307406_10265054 3300031901 Bacteria 1302
522 Ga0307407_10032218 3300031903 Bacteria 2847
523 Ga0307407_10297565 3300031903 Bacteria 1124
524 Ga0307412_10090990 3300031911 Bacteria 2134
525 Ga0307412_11303911 3300031911 Bacteria 654
526 Ga0307409_100156453 3300031995 Bacteria 1987
527 Ga0307416_100019733 3300032002 Bacteria 4788
528 Ga0307416_102561780 3300032002 Bacteria 608
529 Ga0307414_10007965 3300032004 Bacteria 5983
530 Ga0307411_10048817 3300032005 Bacteria 2746
531 Ga0307411_10219869 3300032005 Bacteria 1473
532 Ga0307415_100006049 3300032126 Bacteria 6485
533 Ga0307415_100953851 3300032126 Bacteria 794
534 Ga0307415_101589944 3300032126 Bacteria 628
535 Ga0373930_0047263 3300034816 Bacteria 931
536 Ga0373930_0160895 3300034816 Bacteria 568
537 Ga0373948_0090838 3300034817 Bacteria 708
538 Ga0373958_0034963 3300034819 Bacteria 1004
539 Ga0373959_0011729 3300034820 Bacteria 1553
540 Ga0373959_0080849 3300034820 Unclassified 748
541 Ga0373938_0094902 3300034957 Bacteria 742
542 Ga0373926_0000006 3300035083 Bacteria 38981
543 Ga0373928_0038381 3300035084 Bacteria 1090
544 Ga0373940_0023863 3300035088 Bacteria 1582
545 Ga0373940_0061095 3300035088 Unclassified 1078
546 Ga0373951_0001621 3300035091 Bacteria 5910
547 Ga0373951_0038241 3300035091 Bacteria 1150
548 Ga0373952_0051207 3300035092 Bacteria 985
549 Ga0373923_0029686 3300035111 Bacteria 2194
550 Ga0373932_0039523 3300035112 Bacteria 1353
551 Ga0373932_0350443 3300035112 Bacteria 561
552 Ga0373936_0078458 3300035113 Bacteria 1371
553 Ga0373939_0034554 3300035114 Bacteria 1484
554 Ga0373939_0068567 3300035114 Bacteria 1149
555 Ga0373941_0004139 3300035115 Bacteria 3330
556 Ga0373941_0061086 3300035115 Bacteria 1226
557 Ga0373945_0047753 3300035116 Bacteria 1566
558 Ga0373956_0041987 3300035119 Bacteria 2032
559 Ga0373960_0119736 3300035121 Bacteria 872
560 Ga0373943_0002345 3300035170 Bacteria 8602
561 Ga0373946_0001592 3300035171 Bacteria 7904
562 Ga0373955_0270026 3300035172 Bacteria 1022
563 Ga0373961_0013446 3300035241 Bacteria 2065
564 Ga0373931_0012561 3300035691 Bacteria 4105
565 Ga0373931_0014211 3300035691 Bacteria 3888
566 Ga0373935_0023275 3300035692 Bacteria 3806
567 Ga0373927_0001142 3300035695 Bacteria 20096
568 Ga0373947_0013708 3300035725 Bacteria 4644
569 Ga0373937_0013096 3300036401 Bacteria 7304
570 Ga0373937_0043623 3300036401 Bacteria 4095
571 Ga0373937_1004870 3300036401 Bacteria 783
572 Ga0373925_0000495 3300037068 Bacteria 39676
573 Ga0395898_1751765 3300037466 Bacteria 543
574 Ga0395901_0407024 3300038443 Bacteria 1397
575 Ga0436363_0169416 3300039450 Bacteria 642
576 Ga0436363_1310177 3300039450 Unclassified 566
577 Ga0436362_1188183 3300039453 Unclassified 538
578 Ga0451797_0689075 3300041453 Bacteria 644
579 Ga0451843_1426778 3300041509 Bacteria 588
580 Ga0439446_0345074 3300042156 Bacteria 530
581 Ga0453683_0039500 3300044673 Bacteria 2966
582 Ga0466961_0012540 3300044693 Bacteria 5424
583 Ga0453684_1143982 3300044712 Bacteria 820
584 Ga0453684_1244211 3300044712 Bacteria 779
585 Ga0451576_1740428 3300045051 Bacteria 645
586 Ga0495580_0014581 3300046472 Bacteria 5958
587 Ga0495596_0419259 3300046500 Bacteria 522
588 Ga0495598_0043414 3300046537 Bacteria 1324
589 Ga0495625_0220835 3300046660 Bacteria 1242
590 Ga0495636_0016389 3300047318 Bacteria 2959
591 Ga0495672_0116282 3300047320 Bacteria 1428
592 Ga0495615_0001000 3300048090 Bacteria 4024
593 Ga0495615_0062770 3300048090 Bacteria 984
594 Ga0495615_0186064 3300048090 Bacteria 635
595 Ga0496102_0493572 3300048905 Bacteria 1146
596 Ga0496107_1198736 3300048910 Unclassified 546
597 Ga0496110_0146341 3300048913 Bacteria 2137
598 Ga0496110_0497527 3300048913 Bacteria 1110
599 Ga0496111_0028301 3300048914 Bacteria 3971
600 Ga0496111_0048382 3300048914 Bacteria 3063
601 Ga0496111_1049687 3300048914 Bacteria 582
602 Ga0496111_1057739 3300048914 Bacteria 580
603 Ga0496112_0247125 3300048915 Bacteria 1736
604 Ga0496112_1534378 3300048915 Bacteria 580
605 Ga0496112_1646841 3300048915 Bacteria 555
606 Ga0496113_0464763 3300048916 Bacteria 1017
607 Ga0496113_0691663 3300048916 Bacteria 814
608 Ga0496113_1256565 3300048916 Unclassified 577
609 Ga0501306_084201 3300049127 Bacteria 552
610 Ga0501291_157144 3300049514 Bacteria 517
611 Ga0501294_048415 3300049517 Bacteria 540
612 Ga0501295_127091 3300049518 Bacteria 616
613 Ga0501296_011328 3300049519 Bacteria 1066
614 Ga0501296_049768 3300049519 Bacteria 611
615 Ga0501297_003277 3300049520 Bacteria 1602
616 Ga0501298_000399 3300049521 Bacteria 5886
617 Ga0501298_026517 3300049521 Bacteria 1115
618 Ga0501299_054718 3300049522 Bacteria 832
619 Ga0501325_029743 3300049541 Bacteria 620
620 Ga0501335_021848 3300049551 Bacteria 687
621 Ga0501031_0134536 3300049568 Bacteria 1615
622 Ga0501031_0770257 3300049568 Bacteria 617
623 Ga0501033_0189534 3300049570 Bacteria 1472
624 Ga0501036_0322798 3300049572 Bacteria 1290
625 Ga0501036_0845125 3300049572 Bacteria 753
626 Ga0501037_0482320 3300049573 Bacteria 843
627 Ga0501038_0317152 3300049574 Bacteria 1220
628 Ga0501039_0055983 3300049575 Bacteria 3055
629 Ga0501040_0144609 3300049576 Bacteria 1676
630 Ga0501040_0916243 3300049576 Bacteria 635
631 Ga0501041_0108443 3300049577 Bacteria 1722
632 Ga0501041_0651503 3300049577 Bacteria 673
633 Ga0501042_0705966 3300049578 Bacteria 733
634 Ga0501048_0220941 3300049582 Bacteria 1344
635 Ga0501070_1427245 3300049586 Bacteria 525
636 Ga0501071_0895946 3300049587 Bacteria 684
637 Ga0501072_0253499 3300049588 Bacteria 1401
638 Ga0501073_0708476 3300049589 Bacteria 694
639 Ga0501074_0261236 3300049590 Bacteria 1231
640 Ga0501075_0012624 3300049591 Bacteria 6008
641 Ga0501076_0313111 3300049592 Bacteria 1287
642 Ga0501077_0048727 3300049593 Bacteria 2692
643 Ga0501077_0207597 3300049593 Bacteria 1245
644 Ga0501198_001107 3300049649 Bacteria 3434
645 Ga0501199_012501 3300049650 Bacteria 928
646 Ga0501202_012277 3300049652 Bacteria 1614
647 Ga0501202_132073 3300049652 Bacteria 637
648 Ga0501206_003228 3300049653 Bacteria 2071
649 Ga0501206_008541 3300049653 Bacteria 1355
650 Ga0501208_067645 3300049655 Bacteria 712
651 Ga0501209_038927 3300049656 Bacteria 1248
652 Ga0501209_105151 3300049656 Bacteria 830
653 Ga0501214_001081 3300049659 Bacteria 2053
654 Ga0501214_010188 3300049659 Bacteria 1028
655 Ga0501216_000132 3300049660 Bacteria 7508
656 Ga0501216_079597 3300049660 Bacteria 691
657 Ga0501217_000371 3300049661 Bacteria 7163
658 Ga0501217_265659 3300049661 Bacteria 557
659 Ga0501223_001074 3300049663 Bacteria 6452
660 Ga0501223_007118 3300049663 Bacteria 2297
661 Ga0501223_043658 3300049663 Bacteria 870
662 Ga0501224_000829 3300049664 Bacteria 3934
663 Ga0501224_042554 3300049664 Bacteria 688
664 Ga0501227_000520 3300049665 Bacteria 8292
665 Ga0501227_037687 3300049665 Bacteria 1184
666 Ga0501228_058365 3300049666 Bacteria 541
667 Ga0501230_000097 3300049667 Bacteria 6259
668 Ga0501230_052406 3300049667 Bacteria 812
669 Ga0501233_000563 3300049668 Bacteria 6026
670 Ga0501233_181165 3300049668 Bacteria 604
671 Ga0501235_000939 3300049669 Bacteria 6022
672 Ga0501235_023084 3300049669 Unclassified 1386
673 Ga0501235_072404 3300049669 Bacteria 816
674 Ga0501236_000964 3300049670 Bacteria 3250
675 Ga0501236_049072 3300049670 Bacteria 720
676 Ga0501239_040453 3300049672 Bacteria 643
677 Ga0501243_011098 3300049675 Bacteria 1410
678 Ga0501243_073043 3300049675 Bacteria 655
679 Ga0501247_060263 3300049677 Bacteria 581
680 Ga0501250_030824 3300049680 Bacteria 744
681 Ga0501251_089331 3300049681 Bacteria 551
682 Ga0501253_003103 3300049683 Bacteria 1956
683 Ga0501253_081541 3300049683 Bacteria 731
684 Ga0501255_044384 3300049684 Bacteria 662
685 Ga0501257_002756 3300049686 Bacteria 3718
686 Ga0501257_029656 3300049686 Bacteria 1315
687 Ga0501260_001438 3300049689 Bacteria 1964
688 Ga0501219_004822 3300049703 Bacteria 960
689 Ga0501219_022920 3300049703 Bacteria 553
690 Ga0501221_012721 3300049704 Bacteria 1536
691 Ga0501221_029733 3300049704 Bacteria 1132
692 Ga0501221_038636 3300049704 Bacteria 1032
693 Ga0501225_0000899 3300049705 Bacteria 9246
694 Ga0501225_0078369 3300049705 Bacteria 946
695 Ga0501225_0142993 3300049705 Bacteria 724
696 Ga0501229_002570 3300049706 Bacteria 2142
697 Ga0501229_007425 3300049706 Bacteria 1365
698 Ga0501234_000353 3300049707 Bacteria 6780
699 Ga0501234_010270 3300049707 Bacteria 1458
700 Ga0501245_005108 3300049708 Bacteria 1815
701 Ga0501245_127004 3300049708 Bacteria 543
702 Ga0501079_0060947 3300049741 Bacteria 2911
703 Ga0501080_0796107 3300049742 Bacteria 829
704 Ga0501081_0169836 3300049743 Bacteria 1574
705 Ga0501081_0773344 3300049743 Bacteria 722
706 Ga0501083_0446407 3300049744 Bacteria 842
707 Ga0501241_015046 3300049758 Bacteria 1406
708 Ga0501241_146928 3300049758 Bacteria 541
709 Ga0501263_017197 3300049760 Bacteria 948
710 Ga0501263_073017 3300049760 Bacteria 556
711 Ga0501264_015855 3300049761 Bacteria 763
712 Ga0501268_099240 3300049765 Bacteria 622
713 Ga0501272_024563 3300049769 Bacteria 740
714 Ga0501273_007373 3300049770 Bacteria 1293
715 Ga0501273_073020 3300049770 Bacteria 559
716 Ga0501278_039625 3300049774 Bacteria 509
717 Ga0501280_023729 3300049776 Bacteria 927
718 Ga0501283_047127 3300049779 Bacteria 757
719 Ga0501283_136895 3300049779 Bacteria 501
720 Ga0501035_0000012 3300049822 Bacteria 257066
721 Ga0501045_0109125 3300049824 Bacteria 2051
722 Ga0501204_016302 3300049850 Bacteria 930
723 Ga0501204_075422 3300049850 Bacteria 563
724 Ga0501212_002088 3300049851 Bacteria 2369
725 Ga0501212_028149 3300049851 Bacteria 896
726 Ga0501226_000193 3300049853 Bacteria 9706
727 Ga0501226_030973 3300049853 Bacteria 608
728 nmdc:mga03n38_239897_c1 3300050490 Bacteria 953
729 nmdc:mga03n38_397731_c1 3300050490 Bacteria 758
730 nmdc:mga00v17_50470_c1 3300050491 Bacteria 2528
731 nmdc:mga0k408_27703_c1 3300050493 Bacteria 3219
732 nmdc:mga06z11_31373_c1 3300050494 Bacteria 2581
733 nmdc:mga06z11_3165_c1 3300050494 Bacteria 6351
734 nmdc:mga04h51_39579_c1 3300050495 Bacteria 1532
735 nmdc:mga05p37_128142_c1 3300050507 Bacteria 3115
736 nmdc:mga06r32_485037_c1 3300050510 Bacteria 1214
737 nmdc:mga06r32_805330_c1 3300050510 Bacteria 900
738 nmdc:mga0n895_2010829_c1 3300050512 Bacteria 535
739 nmdc:mga0n895_55030_c1 3300050512 Bacteria 3915
740 nmdc:mga0rr50_101771_c1 3300050513 Bacteria 2259
741 nmdc:mga0rr50_10866_c1 3300050513 Bacteria 5803
742 nmdc:mga0rr50_424913_c1 3300050513 Bacteria 1124
743 nmdc:mga08x19_19_c1 3300050514 Bacteria 315774
744 nmdc:mga0a205_255412_c1 3300050515 Bacteria 1631
745 nmdc:mga0a205_91311_c1 3300050515 Bacteria 2943
746 nmdc:mga0a205_95090_c1 3300050515 Bacteria 2878
747 Ga0500651_0459514 3300053093 Unclassified 707
748 Ga0500566_0138029 3300053094 Bacteria 1297
749 Ga0500554_269052 3300053102 Bacteria 558
750 Ga0500597_033438 3300053120 Bacteria 2130
751 Ga0500614_003529 3300053123 Bacteria 3363
752 Ga0500603_013734 3300053150 Bacteria 1882
753 Ga0500622_0300301 3300053156 Bacteria 684
754 Ga0500637_0090709 3300053178 Bacteria 1770
755 Ga0501084_0072278 3300054114 Bacteria 2889
756 Ga0501084_1296804 3300054114 Bacteria 610
757 Ga0500661_016993 3300055283 Bacteria 1300
758 Ga0501082_0128657 3300060353 Bacteria 2197
759 Ga0501082_0193641 3300060353 Bacteria 1768
760 Ga0530510_0196866 3300061734 Bacteria 1496
761 Ga0530510_0270389 3300061734 Bacteria 1268
762 Ga0105248_10012704
763 2214761614
764 CNBas_1006670
765 CNAas_1013257
766 JGI24749J21850_1056116
767 JGI24751J29686_10000001
768 JGI24751J29686_10000422
769 Ga0006759J45824_1095372
770 rootL2_10106450
771 rootL2_10342516
772 Ga0058862_11894114
773 Ga0065717_1016680
774 Ga0065714_10002183
775 Ga0065704_10720431
776 Ga0065712_10000030
777 Ga0065712_10124918
778 Ga0065715_10093122
779 Ga0065715_10124356
780 Ga0065715_10169251
781 Ga0065715_10198835
782 Ga0065715_10514993
783 Ga0065715_10909840
784 Ga0065715_11029226
785 Ga0065707_10117506
786 Ga0070658_11124600
787 Ga0070676_10637773
788 Ga0070676_10653003
789 Ga0070683_100004518
790 Ga0070690_100946949
791 Ga0070690_101592457
792 Ga0070690_101750388
793 Ga0070670_100000029
794 Ga0070670_100003117
795 Ga0070670_100035609
796 Ga0070670_100075559
797 Ga0070670_101270626
798 Ga0068869_100538529
799 Ga0068869_101525948
800 Ga0068869_101607406
801 Ga0068869_102147124
802 Ga0070680_100009072
803 Ga0070680_101676483
804 Ga0068868_100027052
805 Ga0068868_100380034
806 Ga0068868_101250228
807 Ga0070691_10638343
808 Ga0070687_100712217
809 Ga0070692_10029966
810 Ga0070692_10111891
811 Ga0070669_100085882
812 Ga0070669_100726864
813 Ga0070669_100874283
814 Ga0070669_101465231
815 Ga0070675_100250718
816 Ga0070671_102030569
817 Ga0070674_100398493
818 Ga0070673_100005192
819 Ga0070673_100153836
820 Ga0070673_100195166
821 Ga0070673_100424051
822 Ga0070673_100550567
823 Ga0070673_101674513
824 Ga0070688_100907555
825 Ga0070659_100748441
826 Ga0070703_10000220
827 Ga0070713_100018701
828 Ga0070713_100216711
829 Ga0070710_10018180
830 Ga0070701_10471026
831 Ga0070701_10480188
832 Ga0070705_100059486
833 Ga0070705_100623399
834 Ga0070705_100658381
835 Ga0070705_100789895
836 Ga0070705_100867897
837 Ga0070705_101188844
838 Ga0070705_101766026
839 Ga0070700_100014494
840 Ga0070700_100031265
841 Ga0070700_100343943
842 Ga0070694_100186650
843 Ga0070694_100667922
844 Ga0070694_100714011
845 Ga0070694_101869502
846 Ga0070708_100004127
847 Ga0070681_10037853
848 Ga0070681_10069196
849 Ga0068867_100246150
850 Ga0068867_100933841
851 Ga0070685_10091569
852 Ga0070685_10662184
853 Ga0070706_100006396
854 Ga0070706_100047275
855 Ga0070706_100251583
856 Ga0070706_101050089
857 Ga0070707_100006058
858 Ga0070707_100821098
859 Ga0070698_100005406
860 Ga0070698_100182328
861 Ga0070698_100555800
862 Ga0070698_100759474
863 Ga0070699_100021238
864 Ga0070699_100031595
865 Ga0070699_100099820
866 Ga0070679_100092578
867 Ga0070679_101062793
868 Ga0070684_100023258
869 Ga0070697_100062855
870 Ga0070697_100778217
871 Ga0068853_102229231
872 Ga0070672_100651582
873 Ga0070672_101398863
874 Ga0070686_100062463
875 Ga0070695_100384363
876 Ga0070695_100500861
877 Ga0070695_101010896
878 Ga0070696_100009548
879 Ga0070693_100004871
880 Ga0070693_100048446
881 Ga0070693_100775871
882 Ga0070693_101536707
883 Ga0070665_100022826
884 Ga0070665_100267516
885 Ga0070665_100374836
886 Ga0070665_100421458
887 Ga0070665_100632199
888 Ga0070704_100018252
889 Ga0070704_100312465
890 Ga0070704_100372176
891 Ga0070704_100539727
892 Ga0070704_101895921
893 Ga0068855_100155620
894 Ga0068855_100921031
895 Ga0070664_100324516
896 Ga0070664_100628256
897 Ga0070664_100669274
898 Ga0070664_100802193
899 Ga0068857_100145689
900 Ga0068857_100332118
901 Ga0068857_100359170
902 Ga0068857_100386339
903 Ga0068857_100404479
904 Ga0068857_100705368
905 Ga0068857_101069754
906 Ga0068857_101371950
907 Ga0068857_101751843
908 Ga0068854_100049693
909 Ga0068854_100088210
910 Ga0068854_101438159
911 Ga0068854_101593376
912 Ga0068856_100004163
913 Ga0068856_101092757
914 Ga0068856_102469266
915 Ga0070702_100042055
916 Ga0070702_100167158
917 Ga0070702_100272654
918 Ga0068852_100381061
919 Ga0068852_100687951
920 Ga0068852_100778545
921 Ga0068852_102335504
922 Ga0068859_100002124
923 Ga0068859_100010458
924 Ga0068859_100020283
925 Ga0068859_100022160
926 Ga0068859_100042712
927 Ga0068859_100045031
928 Ga0068859_100142321
929 Ga0068859_100173641
930 Ga0068859_100320598
931 Ga0068859_100629668
932 Ga0068859_100643336
933 Ga0068859_100662149
934 Ga0068859_100721786
935 Ga0068859_101505572
936 Ga0068859_101872299
937 Ga0068859_102537599
938 Ga0068864_100045212
939 Ga0068864_100080767
940 Ga0068864_100135436
941 Ga0068864_100217080
942 Ga0068864_100342185
943 Ga0068864_100999065
944 Ga0068864_101514975
945 Ga0068861_100208628
946 Ga0068861_102123057
947 Ga0068870_10134043
948 Ga0068870_11055857
949 Ga0068863_100022923
950 Ga0068863_100023193
951 Ga0068863_100047930
952 Ga0068863_100088735
953 Ga0068863_100555709
954 Ga0068863_100823778
955 Ga0068863_101218382
956 Ga0068863_101647552
957 Ga0068858_100133069
958 Ga0068858_100173823
959 Ga0068858_100299624
960 Ga0068858_100483273
961 Ga0068858_100497253
962 Ga0068860_100001845
963 Ga0068860_100053331
964 Ga0068860_100061260
965 Ga0068860_100405916
966 Ga0068860_100471579
967 Ga0068860_101793983
968 Ga0068862_100427931
969 Ga0068862_100432461
970 Ga0068862_100565066
971 Ga0068862_100781618
972 Ga0068862_101402448
973 Ga0068862_102152715
974 Ga0068862_102221697
975 Ga0081455_10714285
976 Ga0070717_10005644
977 Ga0070717_10158186
978 Ga0070717_10752049
979 Ga0075368_10120964
980 Ga0075363_100288381
981 Ga0070715_10470858
982 Ga0075362_10367299
983 Ga0075367_10003079
984 Ga0075367_10004772
985 Ga0075366_10039787
986 Ga0075366_10326671
987 Ga0097621_100045373
988 Ga0097621_100151745
989 Ga0097621_100458555
990 Ga0068871_100057391
991 Ga0068871_100082722
992 Ga0068871_100560232
993 Ga0075428_100000624
994 Ga0075428_100660157
995 Ga0075431_100494243
996 Ga0075433_10294666
997 Ga0075433_10396810
998 Ga0075433_11342025
999 Ga0075433_11504021
1000 Ga0075434_100264674
1001 Ga0075434_101207480
1002 Ga0075434_102479707
1003 Ga0068865_100002676
1004 Ga0075436_100001954
1005 Ga0097620_100002124
1006 Ga0097620_100010459
1007 Ga0097620_100020284
1008 Ga0097620_100022160
1009 Ga0097620_100042709
1010 Ga0097620_100045031
1011 Ga0097620_100142331
1012 Ga0097620_100173642
1013 Ga0097620_100320613
1014 Ga0097620_100629615
1015 Ga0097620_100643352
1016 Ga0097620_100662137
1017 Ga0097620_100721808
1018 Ga0097620_101505406
1019 Ga0097620_101872381
1020 Ga0097620_102538215
1021 Ga0099826_10063568
1022 Ga0075435_100028539
1023 Ga0105240_10321036
1024 Ga0105240_12249458
1025 Ga0105245_10018087
1026 Ga0105245_10174612
1027 Ga0105245_10980462
1028 Ga0105247_10009330
1029 Ga0105247_10054350
1030 Ga0105247_10105907
1031 Ga0105247_10140137
1032 Ga0105247_10237928
1033 Ga0105247_11148564
1034 Ga0114129_10078463
1035 Ga0114129_13350279
1036 Ga0105243_10385627
1037 Ga0105243_10398650
1038 Ga0105243_10432845
1039 Ga0105243_10547148
1040 Ga0105243_10641985
1041 Ga0105243_12715493
1042 Ga0105241_10164032
1043 Ga0105241_10818936
1044 Ga0105241_10855176
1045 Ga0105241_11769480
1046 Ga0105241_12084819
1047 Ga0105242_10001519
1048 Ga0105242_10209582
1049 Ga0105242_10494777
1050 Ga0105242_10684527
1051 Ga0105248_10002805
1052 Ga0105248_10018803
1053 Ga0105248_10049731
1054 Ga0105248_10074126
1055 Ga0105248_10233441
1056 Ga0105248_10334132
1057 Ga0105248_10346182
1058 Ga0105248_10678600
1059 Ga0105248_10690642
1060 Ga0105248_11822847
1061 Ga0105237_10154225
1062 Ga0105237_10354436
1063 Ga0105238_10221214
1064 Ga0105238_10469927
1065 Ga0105238_10953724
1066 Ga0105249_10299175
1067 Ga0105249_10307748
1068 Ga0105249_10492994
1069 Ga0105249_10714312
1070 Ga0105239_10382335
1071 Ga0105239_10603312
1072 Ga0105239_10726078
1073 Ga0105239_11497551
1074 Ga0105239_11955401
1075 Ga0157371_11226175
1076 Ga0157369_11911226
1077 Ga0157374_10073990
1078 Ga0157374_10717284
1079 Ga0157374_10930157
1080 Ga0157374_11099653
1081 Ga0157374_11111437
1082 Ga0157374_11701829
1083 Ga0157374_12843042
1084 Ga0157378_10036366
1085 Ga0157378_10266418
1086 Ga0157378_10547209
1087 Ga0157378_10565390
1088 Ga0157378_10931873
1089 Ga0157378_12645221
1090 Ga0163162_10000933
1091 Ga0163162_10018537
1092 Ga0163162_10304009
1093 Ga0163162_10552999
1094 Ga0163162_10986727
1095 Ga0163162_11183495
1096 Ga0163162_11563635
1097 Ga0157372_12037295
1098 Ga0157375_10071194
1099 Ga0157375_10226216
1100 Ga0157375_11242507
1101 Ga0157375_12360048
1102 Ga0157375_13325095
1103 Ga0157375_13670390
1104 Ga0163163_10000043
1105 Ga0163163_10003276
1106 Ga0163163_10103477
1107 Ga0163163_10107306
1108 Ga0163163_10544940
1109 Ga0163163_10575986
1110 Ga0163163_10999197
1111 Ga0163163_11004134
1112 Ga0157380_10007160
1113 Ga0157380_10119271
1114 Ga0157380_11707464
1115 Ga0157377_10126974
1116 Ga0157379_10130543
1117 Ga0157379_10145446
1118 Ga0157379_11447841
1119 Ga0157376_10147077
1120 Ga0182007_10096517
1121 Ga0163161_10999809
1122 Ga0206356_10935860
1123 Ga0213874_10359547
1124 Ga0207697_10214069
1125 Ga0207653_10000259
1126 Ga0207692_10138914
1127 Ga0207710_10004836
1128 Ga0207710_10031891
1129 Ga0207710_10207860
1130 Ga0207680_10286162
1131 Ga0207647_10618267
1132 Ga0207699_10262153
1133 Ga0207645_10086488
1134 Ga0207645_10838077
1135 Ga0207643_10025914
1136 Ga0207643_10602290
1137 Ga0207684_10004923
1138 Ga0207684_10214387
1139 Ga0207654_10450337
1140 Ga0207654_10783585
1141 Ga0207707_10320107
1142 Ga0207695_10597098
1143 Ga0207660_10084386
1144 Ga0207660_10764723
1145 Ga0207662_10410723
1146 Ga0207662_10526600
1147 Ga0207662_11059958
1148 Ga0207657_10202951
1149 Ga0207649_10714526
1150 Ga0207652_10063514
1151 Ga0207646_10003350
1152 Ga0207646_11763570
1153 Ga0207681_10672351
1154 Ga0207681_11311753
1155 Ga0207694_10664375
1156 Ga0207650_10000005
1157 Ga0207650_10027601
1158 Ga0207650_10126284
1159 Ga0207650_10143973
1160 Ga0207650_10304901
1161 Ga0207650_11801229
1162 Ga0207659_10460307
1163 Ga0207687_10047568
1164 Ga0207687_10097910
1165 Ga0207700_10049335
1166 Ga0207690_10022895
1167 Ga0207690_10848132
1168 Ga0207690_11452105
1169 Ga0207686_10001369
1170 Ga0207686_10122221
1171 Ga0207686_10447672
1172 Ga0207686_10456456
1173 Ga0207709_10001596
1174 Ga0207709_10996071
1175 Ga0207669_11604041
1176 Ga0207704_10024281
1177 Ga0207691_10378783
1178 Ga0207711_10014094
1179 Ga0207711_10020406
1180 Ga0207711_10037767
1181 Ga0207711_10104756
1182 Ga0207711_10164381
1183 Ga0207711_10746023
1184 Ga0207711_10902068
1185 Ga0207711_11767043
1186 Ga0207689_10358686
1187 Ga0207689_10426849
1188 Ga0207689_10598437
1189 Ga0207689_10800965
1190 Ga0207689_11099241
1191 Ga0207689_11285903
1192 Ga0207661_10063266
1193 Ga0207679_10908065
1194 Ga0207679_10953805
1195 Ga0207679_11003522
1196 Ga0207667_10038215
1197 Ga0207667_10802872
1198 Ga0207651_10006766
1199 Ga0207651_10057602
1200 Ga0207651_10387545
1201 Ga0207651_10591702
1202 Ga0207712_10558045
1203 Ga0207712_10742542
1204 Ga0207712_10863641
1205 Ga0207640_10323040
1206 Ga0207640_10598826
1207 Ga0207640_11781427
1208 Ga0207677_10018929
1209 Ga0207677_10561578
1210 Ga0207677_11335215
1211 Ga0207703_10193574
1212 Ga0207639_11057723
1213 Ga0207708_10247515
1214 Ga0207708_10769658
1215 Ga0207708_11119941
1216 Ga0207702_10006681
1217 Ga0207641_10288228
1218 Ga0207641_10404420
1219 Ga0207641_10488740
1220 Ga0207641_10574240
1221 Ga0207641_10964020
1222 Ga0207641_11327671
1223 Ga0207641_11674858
1224 Ga0207641_11711964
1225 Ga0207641_11749628
1226 Ga0207648_10182795
1227 Ga0207648_10957153
1228 Ga0207676_10168223
1229 Ga0207676_10258499
1230 Ga0207676_10264642
1231 Ga0207676_11451008
1232 Ga0207676_12153494
1233 Ga0207674_10448539
1234 Ga0207674_11150992
1235 Ga0207674_11291768
1236 Ga0207674_11339279
1237 Ga0207675_100403323
1238 Ga0207675_102171048
1239 Ga0207683_11261077
1240 Ga0207698_10160798
1241 Ga0209813_10411178
1242 Ga0207428_10773166
1243 Ga0207428_11017452
1244 Ga0268266_10009931
1245 Ga0268266_10117497
1246 Ga0268266_10247139
1247 Ga0268266_12116909
1248 Ga0268265_10224930
1249 Ga0268265_10289308
1250 Ga0268265_10373342
1251 Ga0268265_10513982
1252 Ga0268265_10853305
1253 Ga0268265_11043420
1254 Ga0268265_11685602
1255 Ga0268264_10002804
1256 Ga0268264_11609012
1257 Ga0268264_12001130
1258 Ga0265334_10100220
1259 Ga0265338_10078377
1260 Ga0265338_10078545
1261 Ga0265332_10319492
1262 Ga0265320_10057014
1263 Ga0265325_10133896
1264 Ga0265339_10515213
1265 Ga0307513_10010614
1266 Ga0307513_10068470
1267 Ga0307513_10228943
1268 Ga0307513_10420187
1269 Ga0307509_10185934
1270 Ga0307408_100209566
1271 Ga0307408_100266382
1272 Ga0307408_101255110
1273 Ga0265314_10247246
1274 Ga0307516_10473320
1275 Ga0307405_10088610
1276 Ga0307405_10911781
1277 Ga0307413_10269892
1278 Ga0307410_10002355
1279 Ga0307410_10346369
1280 Ga0307406_10009489
1281 Ga0307406_10051863
1282 Ga0307406_10265054
1283 Ga0307407_10032218
1284 Ga0307407_10297565
1285 Ga0307412_10090990
1286 Ga0307412_11303911
1287 Ga0307409_100156453
1288 Ga0307416_100019733
1289 Ga0307416_102561780
1290 Ga0307414_10007965
1291 Ga0307411_10048817
1292 Ga0307411_10219869
1293 Ga0307415_100006049
1294 Ga0307415_100953851
1295 Ga0307415_101589944
1296 Ga0373930_0047263
1297 Ga0373930_0160895
1298 Ga0373948_0090838
1299 Ga0373958_0034963
1300 Ga0373959_0011729
1301 Ga0373959_0080849
1302 Ga0373938_0094902
1303 Ga0373926_0000006
1304 Ga0373928_0038381
1305 Ga0373940_0023863
1306 Ga0373940_0061095
1307 Ga0373951_0001621
1308 Ga0373951_0038241
1309 Ga0373952_0051207
1310 Ga0373923_0029686
1311 Ga0373932_0039523
1312 Ga0373932_0350443
1313 Ga0373936_0078458
1314 Ga0373939_0034554
1315 Ga0373939_0068567
1316 Ga0373941_0004139
1317 Ga0373941_0061086
1318 Ga0373945_0047753
1319 Ga0373956_0041987
1320 Ga0373960_0119736
1321 Ga0373943_0002345
1322 Ga0373946_0001592
1323 Ga0373955_0270026
1324 Ga0373961_0013446
1325 Ga0373931_0012561
1326 Ga0373931_0014211
1327 Ga0373935_0023275
1328 Ga0373927_0001142
1329 Ga0373947_0013708
1330 Ga0373937_0013096
1331 Ga0373937_0043623
1332 Ga0373937_1004870
1333 Ga0373925_0000495
1334 Ga0395898_1751765
1335 Ga0395901_0407024
1336 Ga0436363_0169416
1337 Ga0436363_1310177
1338 Ga0436362_1188183
1339 Ga0451797_0689075
1340 Ga0451843_1426778
1341 Ga0439446_0345074
1342 Ga0453683_0039500
1343 Ga0466961_0012540
1344 Ga0453684_1143982
1345 Ga0453684_1244211
1346 Ga0451576_1740428
1347 Ga0495580_0014581
1348 Ga0495596_0419259
1349 Ga0495598_0043414
1350 Ga0495625_0220835
1351 Ga0495636_0016389
1352 Ga0495672_0116282
1353 Ga0495615_0001000
1354 Ga0495615_0062770
1355 Ga0495615_0186064
1356 Ga0496102_0493572
1357 Ga0496107_1198736
1358 Ga0496110_0146341
1359 Ga0496110_0497527
1360 Ga0496111_0028301
1361 Ga0496111_0048382
1362 Ga0496111_1049687
1363 Ga0496111_1057739
1364 Ga0496112_0247125
1365 Ga0496112_1534378
1366 Ga0496112_1646841
1367 Ga0496113_0464763
1368 Ga0496113_0691663
1369 Ga0496113_1256565
1370 Ga0501306_084201
1371 Ga0501291_157144
1372 Ga0501294_048415
1373 Ga0501295_127091
1374 Ga0501296_011328
1375 Ga0501296_049768
1376 Ga0501297_003277
1377 Ga0501298_000399
1378 Ga0501298_026517
1379 Ga0501299_054718
1380 Ga0501325_029743
1381 Ga0501335_021848
1382 Ga0501031_0134536
1383 Ga0501031_0770257
1384 Ga0501033_0189534
1385 Ga0501036_0322798
1386 Ga0501036_0845125
1387 Ga0501037_0482320
1388 Ga0501038_0317152
1389 Ga0501039_0055983
1390 Ga0501040_0144609
1391 Ga0501040_0916243
1392 Ga0501041_0108443
1393 Ga0501041_0651503
1394 Ga0501042_0705966
1395 Ga0501048_0220941
1396 Ga0501070_1427245
1397 Ga0501071_0895946
1398 Ga0501072_0253499
1399 Ga0501073_0708476
1400 Ga0501074_0261236
1401 Ga0501075_0012624
1402 Ga0501076_0313111
1403 Ga0501077_0048727
1404 Ga0501077_0207597
1405 Ga0501198_001107
1406 Ga0501199_012501
1407 Ga0501202_012277
1408 Ga0501202_132073
1409 Ga0501206_003228
1410 Ga0501206_008541
1411 Ga0501208_067645
1412 Ga0501209_038927
1413 Ga0501209_105151
1414 Ga0501214_001081
1415 Ga0501214_010188
1416 Ga0501216_000132
1417 Ga0501216_079597
1418 Ga0501217_000371
1419 Ga0501217_265659
1420 Ga0501223_001074
1421 Ga0501223_007118
1422 Ga0501223_043658
1423 Ga0501224_000829
1424 Ga0501224_042554
1425 Ga0501227_000520
1426 Ga0501227_037687
1427 Ga0501228_058365
1428 Ga0501230_000097
1429 Ga0501230_052406
1430 Ga0501233_000563
1431 Ga0501233_181165
1432 Ga0501235_000939
1433 Ga0501235_023084
1434 Ga0501235_072404
1435 Ga0501236_000964
1436 Ga0501236_049072
1437 Ga0501239_040453
1438 Ga0501243_011098
1439 Ga0501243_073043
1440 Ga0501247_060263
1441 Ga0501250_030824
1442 Ga0501251_089331
1443 Ga0501253_003103
1444 Ga0501253_081541
1445 Ga0501255_044384
1446 Ga0501257_002756
1447 Ga0501257_029656
1448 Ga0501260_001438
1449 Ga0501219_004822
1450 Ga0501219_022920
1451 Ga0501221_012721
1452 Ga0501221_029733
1453 Ga0501221_038636
1454 Ga0501225_0000899
1455 Ga0501225_0078369
1456 Ga0501225_0142993
1457 Ga0501229_002570
1458 Ga0501229_007425
1459 Ga0501234_000353
1460 Ga0501234_010270
1461 Ga0501245_005108
1462 Ga0501245_127004
1463 Ga0501079_0060947
1464 Ga0501080_0796107
1465 Ga0501081_0169836
1466 Ga0501081_0773344
1467 Ga0501083_0446407
1468 Ga0501241_015046
1469 Ga0501241_146928
1470 Ga0501263_017197
1471 Ga0501263_073017
1472 Ga0501264_015855
1473 Ga0501268_099240
1474 Ga0501272_024563
1475 Ga0501273_007373
1476 Ga0501273_073020
1477 Ga0501278_039625
1478 Ga0501280_023729
1479 Ga0501283_047127
1480 Ga0501283_136895
1481 Ga0501035_0000012
1482 Ga0501045_0109125
1483 Ga0501204_016302
1484 Ga0501204_075422
1485 Ga0501212_002088
1486 Ga0501212_028149
1487 Ga0501226_000193
1488 Ga0501226_030973
1489 nmdc:mga03n38_239897_c1
1490 nmdc:mga03n38_397731_c1
1491 nmdc:mga00v17_50470_c1
1492 nmdc:mga0k408_27703_c1
1493 nmdc:mga06z11_31373_c1
1494 nmdc:mga06z11_3165_c1
1495 nmdc:mga04h51_39579_c1
1496 nmdc:mga05p37_128142_c1
1497 nmdc:mga06r32_485037_c1
1498 nmdc:mga06r32_805330_c1
1499 nmdc:mga0n895_2010829_c1
1500 nmdc:mga0n895_55030_c1
1501 nmdc:mga0rr50_101771_c1
1502 nmdc:mga0rr50_10866_c1
1503 nmdc:mga0rr50_424913_c1
1504 nmdc:mga08x19_19_c1
1505 nmdc:mga0a205_255412_c1
1506 nmdc:mga0a205_91311_c1
1507 nmdc:mga0a205_95090_c1
1508 Ga0500651_0459514
1509 Ga0500566_0138029
1510 Ga0500554_269052
1511 Ga0500597_033438
1512 Ga0500614_003529
1513 Ga0500603_013734
1514 Ga0500622_0300301
1515 Ga0500637_0090709
1516 Ga0501084_0072278
1517 Ga0501084_1296804
1518 Ga0500661_016993
1519 Ga0501082_0128657
1520 Ga0501082_0193641
1521 Ga0530510_0196866
1522 Ga0530510_0270389

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03621

MbtH

MbtH-like protein

15

67

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pst-assembly1.cif.gz_X 1.8a crystal structure of the pa2412 protein from pseudomonas aeruginosa 0.9834 6 65
5ja2-assembly1.cif.gz_B entf, a terminal nonribosomal peptide synthetase module bound to the non-native mbth-like protein pa2412 0.9832 6 64
2pst-assembly1.cif.gz_X 1.8a crystal structure of the pa2412 protein from pseudomonas aeruginosa 0.9522 6 65
6ea3-assembly1.cif.gz_A thermobifida fusca fsch adenylation domain complexed with mbth-like protein fsck and ser-amp 0.9308 4 68
8glc-assembly1.cif.gz_D a1 ancala: adenylation domain 1 core construct from ancestral reconstruction of glycopeptide antibiotic biosynthesis, alanine selection pocket 0.9107 3 61
ID Description Score Start End Superfamily
2pstX00 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.9834 6 65 3.90.820.10
2pstX00 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.9522 6 65 3.90.820.10
af_P9WIP5_1_71_3.90.820.10 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.8931 1 67 3.90.820.10
4gr5B01 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.8768 3 58 3.90.820.10
5ja1B00 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.8631 4 53 3.90.820.10
ID Description Score Start End GO Terms
AF-A0A1I6D286-F1-model_v4 MbtH protein 1.005 9 62 GO:0005829
GO:0019290
AF-A0A2N0GRF7-F1-model_v4 deleted 0.9986 9 67
AF-A0A7H0NFG4-F1-model_v4 Amino acid adenylation domain-containing protein 0.9984 9 52 GO:0005737
GO:0031177
GO:0043041
GO:0044550
AF-Q9I169-F1-model_v4 MbtH-like domain-containing protein 0.9977 6 69 GO:0002049
GO:0005829
GO:0019290
AF-A0A553ZRQ2-F1-model_v4 MbtH family protein 0.9974 10 67 GO:0005829
GO:0019290

Map